2VKJA

Structure of the soluble domain of the membrane protein tm1634 from thermotoga maritima
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
GSHMNLAVKLTRMEKTLKAYELYIFSDYENFENYVKKEGLKIEGMELLKEKKARSLIAEGKDLFETANYGEALVFFEKALNLSDNEEIKKIASFYLEECRKKLAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TM1634
publication title Structure and Ligand Binding of the Soluble Domain of a Thermotoga Maritima Membrane Protein of Unknown Function Tm1634.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Membrane protein
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2vkjA00
2VKJA 2VKOA
chains in the Genus database with same CATH superfamily
2LHNA 1UUSA 3AE9A 4UF0B 5DJQC 5IUXA 3LG7A 3UTKA 4O4LE 4CN6A 3LDQB 2WDQA 4LMKA 3RRWA 4IDOA 4UVCB 4TV9E 4JI6T 2DI4A 1AJ3A 1UX5A 3AEGA 2MPKA 2CWYA 4AQFA 3MJXA 5ABHA 2I6HA 2YKSA 2WBLA 5HEGA 1KF6A 1SUMB 2N2NA 3HKDE 4EOZB 1XMQT 2CLYB 2IDOB 5BR8T 1FMVA 4TZ4C 1KK7A 4TV8E 2LOSA 3WAJA 3FBZA 3C4ZA 3RYFE 3PUWF 2LHRA 4PJNA 2DHRA 1IJ5A 3ZCJA 5CA1E 3H3AA 3QB5K 3PDYA 5LG3A 1MIVA 4ISSA 1QSDA 3O1JA 1LVFA 2X9HA 3AAEB 4HWFA 2V1DB 3HKEE 1WYBA 2HN1A 4X1IE 5JDHA 2DCFA 4BJMA 4XBFB 3AXJB 3LBXB 4PK5A 5L4HA 2D5UA 4HN9A 3P4PA 5HXRA 4HFCA 4ZS2A 3CK6A 3GN5A 3C50A 2BS3A 2V7MA 3ZT6A 5JDGA 4YT0A 1U4QA 2V6XA 1I6ZA 2LSIA 3BK9A 2JMKA 3P4SA 2L3LA 4KX6A 4YHJA 3PUVF 3V5UA 2NW8A 4TNVA 3KDSE 5LB7B 2V6YA 2CCQA 3QB5A 2CBJA 2WAUA 2E5LT 2V7KA 5HXCA 4P0BA 3QC9A 4Z90A 3DTOA 3R6NA 3SWHA 4EYUA 2XQ5A 2CXLA 2UXNB 5AQQB 3PU8A 3HA4A 4LFAT 5FYMA 2WU5A 5LXTE 2XUEA 1T98A 1BR4A 3AA7B 2WB5A 3BQIA 5LGTB 1MMNA 4FI5A 2ODVA 3AB3B 2G0UA 1YXRA 4H9SE 4UIGA 2CRBA 1CUNA 2HPLA 2X9YA 4YSZA 3EHZA 2CM0A 5AQGB 3ONXA 2NTYA 4IL9A 4LF6T 1E1HB 1HG2A 3U78A 1T7SA 4JI1T 2CWOA 4WBOA 3RIUC 3A8YC 3CIRA 3WI3A 2LM9A 2WS3A 2PJQA 4LF7T 3MXZA 5JQGE 4U2ZA 4M1PA 1OEDB 4ILCA 2BBHA 2BS4A 4HFVA 3UUNA 5TAOA 5H6QB 5F8PA 2VQFT 2BG9B 4DNDA 3AE4A 3BQKA 3N2GE 4U7IA 4X5TA 3SFDA 2ES0A 5FKYA 4PNIA 4JBWF 4X62T 1KFYA 4GKKT 3E08A 3P8CD 3L39A 5LHIB 1W09A 4JEHB 2H88A 5AQLB 1W9RA 4L9IA 3UU3A 5ABFB 3AEBA 3J9X1 4QXBB 3UQ4A 2MYSA 1S35A 2Y6XA 1IBMT 5HXHA 4JI2T 2K3WA 3UU6A 2BVLA 4U31A 1S94A 1NWMX 2XQAA 4QWNB 2BDEA 4AKHA 1HX1B 4GK0E 2VKJA 5AQNB 3FXDB 3RYHE 4B3MT 2A2FX 2E9XC 5CFBA 3ANWB 5LGUB 2XAQB 3NZPA 3FB2A 2J62A 3ZEFB 4IE6A 2DLRA 3AVSA 1BR1A 2IHR1 4P0AA 2PFVA 3N9NA 4HE8A 4QH4A 4AKIA 3MZKB 1N34T 2IC9A 2W67A 5JR9C 4O8SA 4TWFA 3IHRA 4EGWA 5LCYA 2XQ6A 2CHNA 4TN7B 2IIUA 3AVRA 4F8HA 3KV5A 3N9PA 3G06A 4EZHA 1OEDE 3UQ7A 2H7OA 2MOZA 4B3ST 2E9XD 2WZIA 2WP9A 3P4WA 4DV5T 1CHUA 5AQJB 4XZCA 2QRXA 4KMCA 2X67A 4WW0A 5FL0A 3T1YT 4H9QC 2DL1A 2XQ8A 3RRCA 4ILBA 4L5GA 4IE4A 5L3EB 3RYCE 3VR8A 3SFEA 2XPKA 3ZSTA 2W4XA 3RKOA 4DVDA 3E0ZA 5AQMB 2LKHA 3CKDA 2VVSA 3Q5WA 2PG8A 5LMUT 3FZLB 4E7SA 4JV5T 1J1JA 1D0XA 3LK2B 3PE0A 3ZMZB 1D0YA 2ZM0A 3F2EA 3GN5B 4CZZB 3WAKA 2X51A 4PJJA 5HYAA 5LHHB 4A98A 1MNDA 3S4UA 3AA0B 4QH5A 1HTJF 5JDQA 4JUYA 1HS7A 4NUUA 3LK42 3N9MA 4UELA 3GMIA 2ODUA 2V6YB 1D1BA 3N9OA 1HNXT 5AQHB 2ZM6T 4HWDA 5JDFA 2ACZA 4DBQA 5FY0A 5AQUB 4UV9B 1OEDA 3B57A 2XQ3A 3ETVA 3ONLC 3H37A 4ILAA 3PUZF 3PTRB 4WZXA 2NR4A 1US7B 5GONE 2CXFA 5LYJE 4B3RT 2WWVA 3K3QC 4JYAT 4ASKA 3K1SA 3L8RA 2BKNA 2CE7A 5JTGA 3QK6A 4ADZA 2ZM2A 1JNZA 3VRBA 4DMVA 1XWMA 2W00A 3P4QA 3ZJ2A 3RQWA 3O9XA 5AQSB 5HAXA 4DV2T 5KMGP 3N9QA 3ZT5A 2W2UA 3VHLA 4A97A 3I1AA 1Y64B 4AIUA 5AQTB 2UUBT 3EDVA 4AKRB 3L09A 2FJAA 2M67A 4OYJA 3HKBE 2YU2A 3ZYKA 3TLVA 2IC6A 3OYXA 1JNRA 2VKOA 4E7ZA 3KBUA 3OJAA 2C5KT 4I43B 3JAEA 3PJAA 5EK3A 1J5ET 5EK2A 3AEDA 5LHGB 2NW7A 2XM2A 4MBQA 4OYKA 4AQGA 3RIFA 4OFZA 4Q25A 4YJ2E 2SPCA 3ZMTB 2JIWA 1KNRA 2XQYA 4LF4T 2WDVA 3OPCA 3FXEB 2MBGA 2LSKA 4AKGA 3Q5EA 5J1GA 3ZPOA 5HCMA 1U5PA 4IL4A 4NXMT 2H7VC 3PJAJ 4A56A 4O2AE 2VKHA 5F3JA 4IDZA 3NRXA 3VKGA 3KVBA 4UR9A 2N9DA 4KBMB 3T1HT 1W0BA 2NOXA 2F4VT 2VKDA 5AQOB 4DUZT 2YEVC 3ESLA 2K24A 3AE2A 2XM1A 2XQ4A 4J2CA 1B7TA 1NEKA 5C3JA 1ZV4X 4LFCT 5IYZE 1SHZC 4COFA 5CJ5A 3TLUA 1FEWA 5LNKA 4U33A 4I55E 2BG9C 4X1KE 4OK0A 2LLYA 3ZT7A 2M6IA 3CMLA 2E5VA 4UEMA 4HTEA 3AE7A 1HFAA 5FY7A 3C98B 2B76A 2X9WA 4G63A 5CGMA 3AEFA 1LVKA 3RC3A 3UFEA 4UVAB 2YK0A 1VRBA 3LJCA 5C8YE 2BBJA 3ZC0A 1XMOT 5L3BB 4ZZBA 4TWDA 2RA1A 2IW5B 5FVKA 1M7KA 4LMLA 2XAHB 5FY1A 4KI0F 3GA8A 2VURA 1WFDA 1OWAA 4B3TT 3B13A 1UK5A 3RQUA 3FZMB 2V8SV 3D0TA 3IBPA 3RH3A 2DWGA 3KVAA 1H7CA 3TLWA 4HFHA 3F31A 2HN2A 3RLFF 3RYIE 3PURA 2CHOA 4JI7T 3HL6A 4HFEA 4Z8XA 1N36T 4F6RC 4BAYB 3KV6A 4OX9T 3AE6A 2KZ7B 3PU3A 5AQPB 4I0UA 3KBTA 4V1Av 5JH7E 5JREA 4AQFC 2Z6EA 2Q9QA 2ZMAA 5JVDE 3TLSA 1YQ3A 3JC6C 3SOLA 2J47A 3ZLIA 2KMFA 2XAGB 3TKLB 4PJLA 5HEOA 4NUVA 4HFBA 4JI5T 5M4YA 1N32T 4ANJA 5F5WA 4ERRA 2RP4A 3N2OA 2LEHA 2YINA 3SS1A 3FBLA 3RIAA 1Z0PA 3FZKB 2V26A 1IBLT 3VRAA 2XSAA 3CPZA 4KHZF 3LSVA 3JCFA 5LOVE 3TLTA 4DR1T 3ZYLA 3JAFA 3JC6D 4CXYA 5LGNB 2XTLA 3QNUA 3ONJA 2JPFA 2EHOA 3N5LA 2D0UA 3MACA 2UU9T 3H3MA 3C51A 2JQKA 3UUBA 4C91A 4ZOLE 2W63A 3QUJA 4NIQA 3Q9DA 4ILUA 4DV7T 3RI5A 2ZLYA 3VR9A 4YY3T 2VWAA 4CI1B 1HCIA 3ZMUB 2V7JA 4GOUA 1ZEEA 5KX5E 1YD8G 2VQET 4U7YA 5LP6E 2JMHA 2XASB 1XDPA 4PW8A 3FZFB 4DV3T 2N1GA 2D0TA 3OVUA 1QUUA 1HX8A 4PFOA 4YFSA 1MIYA 2IUBA 3ZMSB 4YSYA 2XQ9A 4ZZCA 2W62A 2QGSA 5ABEA 2VL8A 2V5CA 4YSXA 1YQ4A 4DV0T 4WBNE 1LRZA 4LF9T 2RPAA 2OV9A 2CMRA 2QYWA 1IJ6A 3RPUA 1WR0A 1LKXA 1ZOYA 4ZI3C 4ZHQE 5ETWA 4IDQA 3W15B 2WSSV 3T8OA 4DIDB 1M62A 5DABA 3OTOT 5L2LA 1FIOA 3I9WA 4X64T 5ADXL 2XSBA 2CA5A 2CEAA 4KHPT 2BKPA 3X1DA 4O4HE 5LJNA 5HWXA 3AAIA 5DQVA 4ZEYA 4TWHA 3C64A 4PAGA 3KV4A 2VB6A 1WCRA 4QX7B 5HXSA 5AQFB 4K0KT 2JJ9A 2LJLA 3OYZA 5IWAT 2BVMA 4CN4A 4ZI3D 2HPJA 1MMAA 3AA6B 4QHOA 2YDRA 2GK9A 4DR7T 3RHWA 2YDSA 4NPPA 1KNZA 4H63V 4EAHA 2XHEB 3L3PA 4JI3T 4Z91A 4LF5T 2FBWA 2KT9A 2QVAA 2YOEA 3ZC1A 1YKEB 3A5XA 4IDNA 1J5WA 2KWIB 5AQVB 4IT4A 3K8PC 4DR3T 4TUYE 5LG4A 2MTQA 5DQWA 2WY2A 3EABA 3OBVE 4PK4A 1XNQT 2L9QA 1WR6A 2E9XB 2M6BA 1DU2A 5JDLA 2CLYC 3CX7B 5E0OA 4YTNA 4DO0A 5FXVA 5L47A 4JI4T 3NBXX 4IREA 1HNWT 1Y01A 2UUCT 3P50A 2LE8A 4HFIA 3VKHA 3CQGB 3MKDA 4MHCA 1HR0T 3PUGA 4GIWA 3BQLA 5FXZA 3GWHA 3HI2A 2IMLA 4P1NA 5L3DB 5L3CB 4U3CA 1D1CA 3J7Yq 3Q5DA 3IEEA 2LM2A 5CA0E 2H89A 4ISTA 5EZYE 1O3XA 2Q9QB 4PJMA 5ABGA 5FVLA 4YLHA 4QXHB 4ZS3A 4EB6E 2C5JA 5LMNT 3UULA 4O4JE 4IIJE 2NWBA 1IAPA 2LSYA 1VOMA 1YKHB 4HFDA 2P9BA 3EI0A 5J2UE 1G8XA 3EDUA 3DJBA 4C90A 3EVYA 2YDQA 2K5BB 3CWZB 4N78D 4U2YA 1L0VA 3CQCB 3M3ZB 4QX8B 2R6GF 2J4GA 2JQHA 3IF8B 1UGOA 5A1LA 3QOFA 5FP3A 4O2BE 5JRCA 3O4XE 4EIWA 4YHHT 3K3NA 4EV6A 2QA7A 1ZHCA 2EHOB 2A3DA 4DUYT 2MAWA 3HKCE 2UXCT 5HEHA 4AI6A 5J2TE 2KWHA 2XZEA 2X0HA 2J1DG 1XDOA 4YTPA 5FL1A 1WRDA 1UX4A 4X66T 2UUAT 4IGUA 4AXPA 4JI8T 2LT3A 4EEBA 5L3FB 3RIUA 2FJEA 4UVBB 3ZCIA 1BR2A 4G2AA 3ZSSA 3O1IA 1BR0A 3V5SA 4HGAA 4EXTA 1XZYA 2IAKA 3I0OA 3A7MA 3ZYMA 1OEDC 3F57A 2NTXA 3CX8B 4ZI2C 4L0RA 4EYYR 2VL0A 2WMNA 1V9DA 1FJGT 2V7IA 4YTMA 4X65T 4GKJT 2KINB 4HWIB 4AKLA 4CI2B 3NZQA 3AE8A 4EZ4A 4UXNB 1X9BA 3AE5A 3CX6B 2VK9A 3N9LA 5AQKB 3KINB 3AEAA 3LFMA 2Y48B 4KP3C 1MNEA 2E9XA 3LK3B 4YJ3E 3RX6A 3RC8A 4LFBT 3I0QA 1G73A 2BS2A 2OLTA 4ZI2D 2XJ7A 4QH1A 5FMNA 4QXCB 3PUSA 1ZP0A 5JR9A 5H6RB 5HEUA 3AEEA 4FJOA 4B6XA 4HKAA 2XY8B 4PK6A 3RGLA 4IE0A 3FHNA 3AA1B 1X79A 3K3OA 5EK4A 3CQXC 1R8IA 3UU4A 3UUMA 4IDPA 4ZI7E 4BA9A 3ZN1B 2NP9A 2K9AA 1I94T 3MA9A 2BKOA 1OXZA 2VVNA 4DR4T 4MLKA 4MALA 2C5IT 2ACXA 2KNDA 4DV6T 5HXEA 2AE9A 2WM9A 2JQ9A 2JRKA 5IHYA 2DNXA 2ZM8A 2X0LB 1NENA 3C4XA 2CBIA 5HCJA 3P4RA 3U3IA 5HWYA 1MMGA 2YN6A 3UUXB 2LKGA 1E7PA 4OHFA 4JI0T 4UF0A 1VCSA 4IE7A 1D0ZA 3Q5XA 5LBQB 5FXXA 4H9OC 3AE1A 1Z8UA 4AISA 4H63H 2I0MA 4WNKA 3M65A 1SE7A 1ZKEA 2HHHT 3KV9A 4H9NC 4HWCA 5C2TA 4WYVA 2X9XA 2WMOA 5FNVE 1WYCA 2LOPA 2WQYA 1MIWA 2E8IA 4YXDA 4AQYT 4DV4T 1IZNB 4K0UA 2DWKA 3UT5E 5AQIB 2X68A 4A5XA 2X66A 1HF8A 5HEJA 4NXNT 3RF1A 4HWHA 2A9UA 3EUHA 2W66A 1W0AA 4EEDA 3ETUA 4GYSA 4IHJE 3VU7H 1NAFA 2WWUA 2UXXB 4CI3B 2X0YA 4HEAA 5JRCB 3NKZA 3HR0A 1HG5A 2D9DA 4QKNA 4ZXLA 2V7LA 3NVOA 4TX5A 1QLBA 1UURA 5FXWA 4O4IE 2VASA 5L3GB 3AXJA 3LBXA 4P09A 2FJDA 5KDMC 2PBIA 2WCAA 4GK5E 2D2SA 1N33T 2WU2A 2UXDT 4U74A 5LA6E 3N2KE 2L8KA 3CVRA 3OKQA 2BG9E 1HNZT 4UV8B 1YW0A 2I59A 3ZN0B 2CXDA 4DMWA 2Y8DA 2Q9QC 2XAJB 2A72A 3UU5A 2E2AA 3SRZA 3KFWX 4I4TE 2YU1A 5KXJA 3NWIA 3DP7A 2FUPA 1XNRT 1VCTA 4XAXB 3FZHB 2W61A 1UCUA 3I9YA 4JEUB 2XQ7A 2WDRA 3ZKRA 2LRLA 3AAAB 3NRYA 2H3RA 4CXWA 4GYRA 4IE5A 4DBRA 2C0SA 4PFPA 2CPTA 2K48A 3EAMA 3PUYF 2HH7A 3UU8A 3B5MA 3PV0F 5L4EA 4CQIA 4CXXA 2Q9QD 5BMVE 5JDMA 4X1YE 3R84B 3PUAA 3PUQA 4DV1T 1EZ3A 4H9PC 4BJNA 4U72A 4LF8T 2PTFA 2KLQA 2EHOC 1GQEA 1KNPA 1FMWA 3E22E 2OA5A 3JADA 2V5DA 2BZBA 2JQQA 3AECA 3RKGA 4DR5T 3IA3A 3MK7C 3PUXF 3Q2MA 5JR9B 2UXBT 2KSRA 1MMDA 2B1EA 2WZHA 2LSJA 5LJMA 4DR6T 4I50E 2BG9A 4DR2T 2EHOD 2XAFB 2NW9A 1IBKT 3ABVA 5LBMA 2LRKA 1WLXA 3P7IA 4MFRA 1SA0E 5CB4E 4KUMB 1KEYA 4CN1A 5ABFA 4LMJA 2W0GA 5J0ZA 4H9RC 2AXDS 3AE3A 1T8BA 2KXPB 2LSGA 5AFUL 3C4WA 3ZJ1A 4TNWA 5JDNA 3UFGA 1D1AA 3O1HA 5AQRB 4X20E 2FJBA 3ANWA 4JLEA 1T72A 1E2AA 3ZMVB
chains in the Genus database with same CATH topology
3Q5WA 3LK3B 2LHNA 2PG8A 3N5LA 4YJ3E 3RX6A 2D0UA 3RC8A 4UF0B 3I0QA 5DJQC 1G73A 4E7SA 3MACA 3LG7A 1D0XA 3LK2B 3PE0A 3UTKA 3C51A 4O4LE 4ZI2D 3ZMZB 1D0YA 2ZM0A 5FMNA 3F2EA 4C91A 4ZOLE 2W63A 3QUJA 3GN5B 4QXCB 3PUSA 3Q9DA 3RRWA 4ILUA 4CZZB 3WAKA 5JR9A 5H6RB 2ZLYA 4FJOA 4UVCB 4B6XA 2VWAA 4CI1B 1HCIA 3ZMUB 4TV9E 2X51A 4PJJA 5HYAA 4HKAA 2DI4A 5LHHB 1MNDA 4PK6A 2V7JA 4IE0A 1UX5A 3AA0B 3FHNA 1HTJF 3S4UA 4GOUA 1ZEEA 3AA1B 4JUYA 5JDQA 5KX5E 1HS7A 4NUUA 1X79A 1YD8G 3K3OA 5LP6E 2JMHA 2CWYA 5EK4A 2XASB 3CQXC 3LK42 4PW8A 4AQFA 3MJXA 3N9MA 2N1GA 4UELA 3GMIA 2ODUA 2D0TA 2WBLA 1D1BA 1QUUA 1HX8A 3UUMA 4PFOA 4YFSA 4ZI7E 3N9OA 1MIYA 2N2NA 4BA9A 3HKDE 5JDFA 3ZMSB 4EOZB 3ZN1B 2NP9A 2CLYB 4DBQA 2K9AA 5FY0A 1FMVA 3MA9A 4TZ4C 4UV9B 1KK7A 1OXZA 2LOSA 4TV8E 3WAJA 2W62A 4MLKA 2QGSA 3B57A 3ETVA 4MALA 2VL8A 3C4ZA 3FBZA 3RYFE 2C5IT 2ACXA 2LHRA 3H37A 2KNDA 4PJNA 4WBNE 1LRZA 2DHRA 1IJ5A 3PTRB 3ZCJA 5CA1E 2CMRA 1IJ6A 3H3AA 3RPUA 1US7B 5HXEA 5GONE 2CXFA 1LKXA 5LYJE 3PDYA 2WM9A 4ZI3C 4ZHQE 2JRKA 5IHYA 2DNXA 5ETWA 1MIVA 2ZM8A 3W15B 3K3QC 4ISSA 1QSDA 2X0LB 3C4XA 2WSSV 3T8OA 3O1JA 1LVFA 2X9HA 3AAEB 5DABA 4ASKA 5L2LA 1FIOA 2V1DB 3HKEE 3I9WA 5ADXL 2CE7A 3U3IA 2CA5A 5HWYA 1MMGA 1WYBA 3QK6A 4ADZA 2CEAA 2ZM2A 3UUXB 4DMVA 4X1IE 2W00A 4O4HE 3ZJ2A 5HWXA 5JDHA 5LJNA 3AAIA 2DCFA 5DQVA 3O9XA 4BJMA 4OHFA 4UF0A 3C64A 4PAGA 4XBFB 3LBXB 5HAXA 4IE7A 4PK5A 3KV4A 5KMGP 1D0ZA 2D5UA 2VB6A 4HN9A 3Q5XA 3N9QA 4QX7B 5LBQB 5FXXA 4H9OC 5HXRA 5HXSA 4ZS2A 3GN5A 3C50A 2V7MA 5JDGA 3VHLA 1U4QA 4H63H 2JJ9A 2LJLA 4WNKA 3I1AA 1Y64B 3OYZA 3M65A 1ZKEA 3EDVA 3KV9A 4AKRB 2BVMA 4ZI3D 4H9NC 2LSIA 2HPJA 1MMAA 3BK9A 3L09A 2JMKA 3AA6B 2M67A 4OYJA 2L3LA 4QHOA 4YHJA 2GK9A 3HKBE 2YU2A 3V5UA 3ZYKA 2X9XA 2NW8A 2WMOA 5FNVE 1WYCA 3KDSE 2LOPA 1MIWA 2IC6A 2CCQA 2E8IA 1KNZA 3OYXA 4H63V 4EAHA 2XHEB 2WAUA 3L3PA 1IZNB 2V7KA 5HXCA 2VKOA 4E7ZA 3KBUA 4P0BA 2KT9A 4K0UA 2DWKA 3ZC1A 3QC9A 1YKEB 3OJAA 3UT5E 2X68A 3A5XA 2X66A 2C5KT 4I43B 2KWIB 1HF8A 3DTOA 3R6NA 3K8PC 3SWHA 5EK3A 4EYUA 4TUYE 5LG4A 2MTQA 5EK2A 5DQWA 3OBVE 4PK4A 3EUHA 2CXLA 2L9QA 2UXNB 5LHGB 2NW7A 4MBQA 1WR6A 3PU8A 2E9XB 3HA4A 3ETUA 4OYKA 4AQGA 5JDLA 2CLYC 3CX7B 5FYMA 4GYSA 4OFZA 5LXTE 4IHJE 2XUEA 3VU7H 5E0OA 1T98A 4YJ2E 1NAFA 2SPCA 1BR4A 2WWUA 3ZMTB 4DO0A 3AA7B 2XQYA 5FXVA 2UXXB 4CI3B 3BQIA 5LGTB 3FXEB 2MBGA 4HEAA 1MMNA 5JRCB 2LSKA 4FI5A 3HR0A 2ODVA 3AB3B 2G0UA 1HG5A 4H9SE 3NBXX 4UIGA 4AKGA 1CUNA 2HPLA 5J1GA 3ZPOA 2X9YA 2LE8A 4QKNA 2V7LA 1U5PA 3VKHA 2H7VC 3CQGB 2CM0A 3MKDA 4MHCA 3ONXA 4A56A 2NTYA 4O2AE 2VKHA 3PUGA 4TX5A 5FXWA 4O4IE 5F3JA 2VASA 5L3GB 3LBXA 4IDZA 1E1HB 1HG2A 3NRXA 4GIWA 4P09A 3U78A 3VKGA 5KDMC 2PBIA 3KVBA 4GK5E 3BQLA 2D2SA 2N9DA 4KBMB 2NOXA 5FXZA 3GWHA 3HI2A 2VKDA 2YEVC 4U74A 5LA6E 2CWOA 3ESLA 4WBOA 2K24A 3N2KE 2L8KA 5L3DB 3CVRA 5L3CB 3OKQA 4UV8B 3WI3A 1YW0A 2LM9A 1D1CA 4J2CA 1B7TA 2PJQA 2I59A 3ZN0B 3J7Yq 2CXDA 4DMWA 3MXZA 1ZV4X 5JQGE 5IYZE 3IEEA 1SHZC 2Y8DA 4M1PA 2Q9QC 1FEWA 5CA0E 2XAJB 1AJ3A 4ISTA 5EZYE 5LNKA 1O3XA 4HFVA 2Q9QB 3UUNA 2A72A 4PJMA 5TAOA 4I55E 5H6QB 5F8PA 4X1KE 3SRZA 4OK0A 4YLHA 3CMLA 4QXHB 4ZS3A 4EB6E 3KFWX 4DNDA 2C5JA 3BQKA 4I4TE 3N2GE 4UEMA 3UULA 4O4JE 4IIJE 2NWBA 2YU1A 4HTEA 1IAPA 2ES0A 1HFAA 3DP7A 2LSYA 1VOMA 1YKHB 4PNIA 3ZMVB 5FY7A 3C98B 3E08A 2X9WA 3P8CD 2P9BA 5J2UE 5LHIB 1G8XA 3EDUA 4G63A 4XAXB 1LVKA 3DJBA 4C90A 4JEHB 2W61A 3EVYA 1UCUA 3RC3A 3I9YA 4JEUB 3UFEA 4UVAB 3AAAB 4L9IA 2YK0A 3NRYA 1VRBA 2H3RA 2K5BB 3CWZB 3LJCA 4N78D 5C8YE 4CXWA 3CQCB 4GYRA 4IE5A 3ZC0A 4DBRA 2C0SA 4PFPA 5L3BB 2K48A 3J9X1 4QX8B 2HH7A 4QXBB 2RA1A 2MYSA 1S35A 2IW5B 2XAHB 5FY1A 4CQIA 2Y6XA 4CXXA 2Q9QD 3GA8A 3IF8B 5BMVE 5JDMA 5HXHA 4X1YE 2BVLA 1S94A 1NWMX 5A1LA 5FP3A 4O2BE 3R84B 5JRCA 1OWAA 4QWNB 3O4XE 3B13A 2BDEA 3PUAA 4AKHA 4GK0E 2VKJA 3PUQA 3FXDB 3RYHE 1EZ3A 4H9PC 4BJNA 4EIWA 3D0TA 3IBPA 4U72A 3K3NA 3RH3A 2DWGA 2A2FX 2E9XC 2KLQA 3ANWB 2EHOC 2QA7A 3KVAA 1ZHCA 5LGUB 1H7CA 2XAQB 3NZPA 2EHOB 2A3DA 3FB2A 3F31A 3HKCE 3ZEFB 1FMWA 3E22E 4AI6A 5J2TE 2KWHA 4IE6A 2DLRA 3RYIE 3PURA 2J1DG 1BR1A 3AVSA 2OA5A 4P0AA 2BZBA 2JQQA 2PFVA 3HL6A 4Z8XA 3N9NA 4HE8A 4F6RC 4AKIA 3MZKB 1WRDA 4BAYB 2IC9A 1UX4A 5JR9C 3MK7C 3Q2MA 4IGUA 4O8SA 3KV6A 4AXPA 5JR9B 3IHRA 2LT3A 1MMDA 2B1EA 2KZ7B 3PU3A 5LCYA 5L3FB 3KBTA 2LSJA 4UVBB 4V1Av 5JH7E 3ZCIA 5LJMA 4TN7B 5JREA 4AQFC 3AVRA 2Z6EA 1BR2A 3KV5A 3N9PA 2Q9QA 2ZMAA 4G2AA 5JVDE 4EZHA 2H7OA 2MOZA 3JC6C 4I50E 3SOLA 3O1IA 2E9XD 1BR0A 3V5SA 2EHOD 4HGAA 3ZLIA 2XAFB 4EXTA 2KMFA 2XAGB 2NW9A 3TKLB 2IAKA 5LBMA 4PJLA 3I0OA 3ZYMA 4NUVA 4XZCA 3F57A 4KMCA 1WLXA 2NTXA 2X67A 3CX8B 3P7IA 5M4YA 4MFRA 4ZI2C 4ANJA 4WW0A 1SA0E 5CB4E 4ERRA 4KUMB 2RP4A 3N2OA 4L0RA 2LEHA 4EYYR 2WMNA 2YINA 1V9DA 2W0GA 4H9QC 4H9RC 3SS1A 3FBLA 2V7IA 1Z0PA 2V26A 2KXPB 2LSGA 3RRCA 3CPZA 2KINB 5AFUL 3C4WA 3ZJ1A 4AKLA 4CI2B 4L5GA 4IE4A 5L3EB 3NZQA 5JDNA 3RYCE 5LOVE 4EZ4A 1D1AA 3O1HA 4UXNB 3ZYLA 4X20E 3JC6D 4CXYA 5LGNB 3RKOA 4DVDA 3E0ZA 3CX6B 2VK9A 3CKDA 3N9LA 2XTLA 3ANWA 3KINB 4JLEA 3LFMA 2Y48B 4KP3C 2JPFA 1MNEA 2E9XA 2EHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKJ A;  2VKO A; 
#chains in the Genus database with same CATH topology
 2LHN A;  1UUS A;  3AE9 A;  4UF0 B;  5DJQ C;  5IUX A;  3LG7 A;  3UTK A;  4O4L E;  4CN6 A;  3LDQ B;  2WDQ A;  4LMK A;  3RRW A;  4IDO A;  4UVC B;  4TV9 E;  4JI6 T;  2DI4 A;  1AJ3 A;  1UX5 A;  3AEG A;  2MPK A;  2CWY A;  4AQF A;  3MJX A;  5ABH A;  2I6H A;  2YKS A;  2WBL A;  5HEG A;  1KF6 A;  1SUM B;  2N2N A;  3HKD E;  4EOZ B;  1XMQ T;  2CLY B;  2IDO B;  5BR8 T;  1FMV A;  4TZ4 C;  1KK7 A;  4TV8 E;  2LOS A;  3WAJ A;  3FBZ A;  3C4Z A;  3RYF E;  3PUW F;  2LHR A;  4PJN A;  2DHR A;  1IJ5 A;  3ZCJ A;  5CA1 E;  3H3A A;  3QB5 K;  3PDY A;  5LG3 A;  1MIV A;  4ISS A;  1QSD A;  3O1J A;  1LVF A;  2X9H A;  3AAE B;  4HWF A;  2V1D B;  3HKE E;  1WYB A;  2HN1 A;  4X1I E;  5JDH A;  2DCF A;  4BJM A;  4XBF B;  3AXJ B;  3LBX B;  4PK5 A;  5L4H A;  2D5U A;  4HN9 A;  3P4P A;  5HXR A;  4HFC A;  4ZS2 A;  3CK6 A;  3GN5 A;  3C50 A;  2BS3 A;  2V7M A;  3ZT6 A;  5JDG A;  4YT0 A;  1U4Q A;  2V6X A;  1I6Z A;  2LSI A;  3BK9 A;  2JMK A;  3P4S A;  2L3L A;  4KX6 A;  4YHJ A;  3PUV F;  3V5U A;  2NW8 A;  4TNV A;  3KDS E;  5LB7 B;  2V6Y A;  2CCQ A;  3QB5 A;  2CBJ A;  2WAU A;  2E5L T;  2V7K A;  5HXC A;  4P0B A;  3QC9 A;  4Z90 A;  3DTO A;  3R6N A;  3SWH A;  4EYU A;  2XQ5 A;  2CXL A;  2UXN B;  5AQQ B;  3PU8 A;  3HA4 A;  4LFA T;  5FYM A;  2WU5 A;  5LXT E;  2XUE A;  1T98 A;  1BR4 A;  3AA7 B;  2WB5 A;  3BQI A;  5LGT B;  1MMN A;  4FI5 A;  2ODV A;  3AB3 B;  2G0U A;  1YXR A;  4H9S E;  4UIG A;  2CRB A;  1CUN A;  2HPL A;  2X9Y A;  4YSZ A;  3EHZ A;  2CM0 A;  5AQG B;  3ONX A;  2NTY A;  4IL9 A;  4LF6 T;  1E1H B;  1HG2 A;  3U78 A;  1T7S A;  4JI1 T;  2CWO A;  4WBO A;  3RIU C;  3A8Y C;  3CIR A;  3WI3 A;  2LM9 A;  2WS3 A;  2PJQ A;  4LF7 T;  3MXZ A;  5JQG E;  4U2Z A;  4M1P A;  1OED B;  4ILC A;  2BBH A;  2BS4 A;  4HFV A;  3UUN A;  5TAO A;  5H6Q B;  5F8P A;  2VQF T;  2BG9 B;  4DND A;  3AE4 A;  3BQK A;  3N2G E;  4U7I A;  4X5T A;  3SFD A;  2ES0 A;  5FKY A;  4PNI A;  4JBW F;  4X62 T;  1KFY A;  4GKK T;  3E08 A;  3P8C D;  3L39 A;  5LHI B;  1W09 A;  4JEH B;  2H88 A;  5AQL B;  1W9R A;  4L9I A;  3UU3 A;  5ABF B;  3AEB A;  3J9X 1;  4QXB B;  3UQ4 A;  2MYS A;  1S35 A;  2Y6X A;  1IBM T;  5HXH A;  4JI2 T;  2K3W A;  3UU6 A;  2BVL A;  4U31 A;  1S94 A;  1NWM X;  2XQA A;  4QWN B;  2BDE A;  4AKH A;  1HX1 B;  4GK0 E;  2VKJ A;  5AQN B;  3FXD B;  3RYH E;  4B3M T;  2A2F X;  2E9X C;  5CFB A;  3ANW B;  5LGU B;  2XAQ B;  3NZP A;  3FB2 A;  2J62 A;  3ZEF B;  4IE6 A;  2DLR A;  3AVS A;  1BR1 A;  2IHR 1;  4P0A A;  2PFV A;  3N9N A;  4HE8 A;  4QH4 A;  4AKI A;  3MZK B;  1N34 T;  2IC9 A;  2W67 A;  5JR9 C;  4O8S A;  4TWF A;  3IHR A;  4EGW A;  5LCY A;  2XQ6 A;  2CHN A;  4TN7 B;  2IIU A;  3AVR A;  4F8H A;  3KV5 A;  3N9P A;  3G06 A;  4EZH A;  1OED E;  3UQ7 A;  2H7O A;  2MOZ A;  4B3S T;  2E9X D;  2WZI A;  2WP9 A;  3P4W A;  4DV5 T;  1CHU A;  5AQJ B;  4XZC A;  2QRX A;  4KMC A;  2X67 A;  4WW0 A;  5FL0 A;  3T1Y T;  4H9Q C;  2DL1 A;  2XQ8 A;  3RRC A;  4ILB A;  4L5G A;  4IE4 A;  5L3E B;  3RYC E;  3VR8 A;  3SFE A;  2XPK A;  3ZST A;  2W4X A;  3RKO A;  4DVD A;  3E0Z A;  5AQM B;  2LKH A;  3CKD A;  2VVS A;  3Q5W A;  2PG8 A;  5LMU T;  3FZL B;  4E7S A;  4JV5 T;  1J1J A;  1D0X A;  3LK2 B;  3PE0 A;  3ZMZ B;  1D0Y A;  2ZM0 A;  3F2E A;  3GN5 B;  4CZZ B;  3WAK A;  2X51 A;  4PJJ A;  5HYA A;  5LHH B;  4A98 A;  1MND A;  3S4U A;  3AA0 B;  4QH5 A;  1HTJ F;  5JDQ A;  4JUY A;  1HS7 A;  4NUU A;  3LK4 2;  3N9M A;  4UEL A;  3GMI A;  2ODU A;  2V6Y B;  1D1B A;  3N9O A;  1HNX T;  5AQH B;  2ZM6 T;  4HWD A;  5JDF A;  2ACZ A;  4DBQ A;  5FY0 A;  5AQU B;  4UV9 B;  1OED A;  3B57 A;  2XQ3 A;  3ETV A;  3ONL C;  3H37 A;  4ILA A;  3PUZ F;  3PTR B;  4WZX A;  2NR4 A;  1US7 B;  5GON E;  2CXF A;  5LYJ E;  4B3R T;  2WWV A;  3K3Q C;  4JYA T;  4ASK A;  3K1S A;  3L8R A;  2BKN A;  2CE7 A;  5JTG A;  3QK6 A;  4ADZ A;  2ZM2 A;  1JNZ A;  3VRB A;  4DMV A;  1XWM A;  2W00 A;  3P4Q A;  3ZJ2 A;  3RQW A;  3O9X A;  5AQS B;  5HAX A;  4DV2 T;  5KMG P;  3N9Q A;  3ZT5 A;  2W2U A;  3VHL A;  4A97 A;  3I1A A;  1Y64 B;  4AIU A;  5AQT B;  2UUB T;  3EDV A;  4AKR B;  3L09 A;  2FJA A;  2M67 A;  4OYJ A;  3HKB E;  2YU2 A;  3ZYK A;  3TLV A;  2IC6 A;  3OYX A;  1JNR A;  2VKO A;  4E7Z A;  3KBU A;  3OJA A;  2C5K T;  4I43 B;  3JAE A;  3PJA A;  5EK3 A;  1J5E T;  5EK2 A;  3AED A;  5LHG B;  2NW7 A;  2XM2 A;  4MBQ A;  4OYK A;  4AQG A;  3RIF A;  4OFZ A;  4Q25 A;  4YJ2 E;  2SPC A;  3ZMT B;  2JIW A;  1KNR A;  2XQY A;  4LF4 T;  2WDV A;  3OPC A;  3FXE B;  2MBG A;  2LSK A;  4AKG A;  3Q5E A;  5J1G A;  3ZPO A;  5HCM A;  1U5P A;  4IL4 A;  4NXM T;  2H7V C;  3PJA J;  4A56 A;  4O2A E;  2VKH A;  5F3J A;  4IDZ A;  3NRX A;  3VKG A;  3KVB A;  4UR9 A;  2N9D A;  4KBM B;  3T1H T;  1W0B A;  2NOX A;  2F4V T;  2VKD A;  5AQO B;  4DUZ T;  2YEV C;  3ESL A;  2K24 A;  3AE2 A;  2XM1 A;  2XQ4 A;  4J2C A;  1B7T A;  1NEK A;  5C3J A;  1ZV4 X;  4LFC T;  5IYZ E;  1SHZ C;  4COF A;  5CJ5 A;  3TLU A;  1FEW A;  5LNK A;  4U33 A;  4I55 E;  2BG9 C;  4X1K E;  4OK0 A;  2LLY A;  3ZT7 A;  2M6I A;  3CML A;  2E5V A;  4UEM A;  4HTE A;  3AE7 A;  1HFA A;  5FY7 A;  3C98 B;  2B76 A;  2X9W A;  4G63 A;  5CGM A;  3AEF A;  1LVK A;  3RC3 A;  3UFE A;  4UVA B;  2YK0 A;  1VRB A;  3LJC A;  5C8Y E;  2BBJ A;  3ZC0 A;  1XMO T;  5L3B B;  4ZZB A;  4TWD A;  2RA1 A;  2IW5 B;  5FVK A;  1M7K A;  4LML A;  2XAH B;  5FY1 A;  4KI0 F;  3GA8 A;  2VUR A;  1WFD A;  1OWA A;  4B3T T;  3B13 A;  1UK5 A;  3RQU A;  3FZM B;  2V8S V;  3D0T A;  3IBP A;  3RH3 A;  2DWG A;  3KVA A;  1H7C A;  3TLW A;  4HFH A;  3F31 A;  2HN2 A;  3RLF F;  3RYI E;  3PUR A;  2CHO A;  4JI7 T;  3HL6 A;  4HFE A;  4Z8X A;  1N36 T;  4F6R C;  4BAY B;  3KV6 A;  4OX9 T;  3AE6 A;  2KZ7 B;  3PU3 A;  5AQP B;  4I0U A;  3KBT A;  4V1A v;  5JH7 E;  5JRE A;  4AQF C;  2Z6E A;  2Q9Q A;  2ZMA A;  5JVD E;  3TLS A;  1YQ3 A;  3JC6 C;  3SOL A;  2J47 A;  3ZLI A;  2KMF A;  2XAG B;  3TKL B;  4PJL A;  5HEO A;  4NUV A;  4HFB A;  4JI5 T;  5M4Y A;  1N32 T;  4ANJ A;  5F5W A;  4ERR A;  2RP4 A;  3N2O A;  2LEH A;  2YIN A;  3SS1 A;  3FBL A;  3RIA A;  1Z0P A;  3FZK B;  2V26 A;  1IBL T;  3VRA A;  2XSA A;  3CPZ A;  4KHZ F;  3LSV A;  3JCF A;  5LOV E;  3TLT A;  4DR1 T;  3ZYL A;  3JAF A;  3JC6 D;  4CXY A;  5LGN B;  2XTL A;  3QNU A;  3ONJ A;  2JPF A;  2EHO A;  3N5L A;  2D0U A;  3MAC A;  2UU9 T;  3H3M A;  3C51 A;  2JQK A;  3UUB A;  4C91 A;  4ZOL E;  2W63 A;  3QUJ A;  4NIQ A;  3Q9D A;  4ILU A;  4DV7 T;  3RI5 A;  2ZLY A;  3VR9 A;  4YY3 T;  2VWA A;  4CI1 B;  1HCI A;  3ZMU B;  2V7J A;  4GOU A;  1ZEE A;  5KX5 E;  1YD8 G;  2VQE T;  4U7Y A;  5LP6 E;  2JMH A;  2XAS B;  1XDP A;  4PW8 A;  3FZF B;  4DV3 T;  2N1G A;  2D0T A;  3OVU A;  1QUU A;  1HX8 A;  4PFO A;  4YFS A;  1MIY A;  2IUB A;  3ZMS B;  4YSY A;  2XQ9 A;  4ZZC A;  2W62 A;  2QGS A;  5ABE A;  2VL8 A;  2V5C A;  4YSX A;  1YQ4 A;  4DV0 T;  4WBN E;  1LRZ A;  4LF9 T;  2RPA A;  2OV9 A;  2CMR A;  2QYW A;  1IJ6 A;  3RPU A;  1WR0 A;  1LKX A;  1ZOY A;  4ZI3 C;  4ZHQ E;  5ETW A;  4IDQ A;  3W15 B;  2WSS V;  3T8O A;  4DID B;  1M62 A;  5DAB A;  3OTO T;  5L2L A;  1FIO A;  3I9W A;  4X64 T;  5ADX L;  2XSB A;  2CA5 A;  2CEA A;  4KHP T;  2BKP A;  3X1D A;  4O4H E;  5LJN A;  5HWX A;  3AAI A;  5DQV A;  4ZEY A;  4TWH A;  3C64 A;  4PAG A;  3KV4 A;  2VB6 A;  1WCR A;  4QX7 B;  5HXS A;  5AQF B;  4K0K T;  2JJ9 A;  2LJL A;  3OYZ A;  5IWA T;  2BVM A;  4CN4 A;  4ZI3 D;  2HPJ A;  1MMA A;  3AA6 B;  4QHO A;  2YDR A;  2GK9 A;  4DR7 T;  3RHW A;  2YDS A;  4NPP A;  1KNZ A;  4H63 V;  4EAH A;  2XHE B;  3L3P A;  4JI3 T;  4Z91 A;  4LF5 T;  2FBW A;  2KT9 A;  2QVA A;  2YOE A;  3ZC1 A;  1YKE B;  3A5X A;  4IDN A;  1J5W A;  2KWI B;  5AQV B;  4IT4 A;  3K8P C;  4DR3 T;  4TUY E;  5LG4 A;  2MTQ A;  5DQW A;  2WY2 A;  3EAB A;  3OBV E;  4PK4 A;  1XNQ T;  2L9Q A;  1WR6 A;  2E9X B;  2M6B A;  1DU2 A;  5JDL A;  2CLY C;  3CX7 B;  5E0O A;  4YTN A;  4DO0 A;  5FXV A;  5L47 A;  4JI4 T;  3NBX X;  4IRE A;  1HNW T;  1Y01 A;  2UUC T;  3P50 A;  2LE8 A;  4HFI A;  3VKH A;  3CQG B;  3MKD A;  4MHC A;  1HR0 T;  3PUG A;  4GIW A;  3BQL A;  5FXZ A;  3GWH A;  3HI2 A;  2IML A;  4P1N A;  5L3D B;  5L3C B;  4U3C A;  1D1C A;  3J7Y q;  3Q5D A;  3IEE A;  2LM2 A;  5CA0 E;  2H89 A;  4IST A;  5EZY E;  1O3X A;  2Q9Q B;  4PJM A;  5ABG A;  5FVL A;  4YLH A;  4QXH B;  4ZS3 A;  4EB6 E;  2C5J A;  5LMN T;  3UUL A;  4O4J E;  4IIJ E;  2NWB A;  1IAP A;  2LSY A;  1VOM A;  1YKH B;  4HFD A;  2P9B A;  3EI0 A;  5J2U E;  1G8X A;  3EDU A;  3DJB A;  4C90 A;  3EVY A;  2YDQ A;  2K5B B;  3CWZ B;  4N78 D;  4U2Y A;  1L0V A;  3CQC B;  3M3Z B;  4QX8 B;  2R6G F;  2J4G A;  2JQH A;  3IF8 B;  1UGO A;  5A1L A;  3QOF A;  5FP3 A;  4O2B E;  5JRC A;  3O4X E;  4EIW A;  4YHH T;  3K3N A;  4EV6 A;  2QA7 A;  1ZHC A;  2EHO B;  2A3D A;  4DUY T;  2MAW A;  3HKC E;  2UXC T;  5HEH A;  4AI6 A;  5J2T E;  2KWH A;  2XZE A;  2X0H A;  2J1D G;  1XDO A;  4YTP A;  5FL1 A;  1WRD A;  1UX4 A;  4X66 T;  2UUA T;  4IGU A;  4AXP A;  4JI8 T;  2LT3 A;  4EEB A;  5L3F B;  3RIU A;  2FJE A;  4UVB B;  3ZCI A;  1BR2 A;  4G2A A;  3ZSS A;  3O1I A;  1BR0 A;  3V5S A;  4HGA A;  4EXT A;  1XZY A;  2IAK A;  3I0O A;  3A7M A;  3ZYM A;  1OED C;  3F57 A;  2NTX A;  3CX8 B;  4ZI2 C;  4L0R A;  4EYY R;  2VL0 A;  2WMN A;  1V9D A;  1FJG T;  2V7I A;  4YTM A;  4X65 T;  4GKJ T;  2KIN B;  4HWI B;  4AKL A;  4CI2 B;  3NZQ A;  3AE8 A;  4EZ4 A;  4UXN B;  1X9B A;  3AE5 A;  3CX6 B;  2VK9 A;  3N9L A;  5AQK B;  3KIN B;  3AEA A;  3LFM A;  2Y48 B;  4KP3 C;  1MNE A;  2E9X A;  3LK3 B;  4YJ3 E;  3RX6 A;  3RC8 A;  4LFB T;  3I0Q A;  1G73 A;  2BS2 A;  2OLT A;  4ZI2 D;  2XJ7 A;  4QH1 A;  5FMN A;  4QXC B;  3PUS A;  1ZP0 A;  5JR9 A;  5H6R B;  5HEU A;  3AEE A;  4FJO A;  4B6X A;  4HKA A;  2XY8 B;  4PK6 A;  3RGL A;  4IE0 A;  3FHN A;  3AA1 B;  1X79 A;  3K3O A;  5EK4 A;  3CQX C;  1R8I A;  3UU4 A;  3UUM A;  4IDP A;  4ZI7 E;  4BA9 A;  3ZN1 B;  2NP9 A;  2K9A A;  1I94 T;  3MA9 A;  2BKO A;  1OXZ A;  2VVN A;  4DR4 T;  4MLK A;  4MAL A;  2C5I T;  2ACX A;  2KND A;  4DV6 T;  5HXE A;  2AE9 A;  2WM9 A;  2JQ9 A;  2JRK A;  5IHY A;  2DNX A;  2ZM8 A;  2X0L B;  1NEN A;  3C4X A;  2CBI A;  5HCJ A;  3P4R A;  3U3I A;  5HWY A;  1MMG A;  2YN6 A;  3UUX B;  2LKG A;  1E7P A;  4OHF A;  4JI0 T;  4UF0 A;  1VCS A;  4IE7 A;  1D0Z A;  3Q5X A;  5LBQ B;  5FXX A;  4H9O C;  3AE1 A;  1Z8U A;  4AIS A;  4H63 H;  2I0M A;  4WNK A;  3M65 A;  1SE7 A;  1ZKE A;  2HHH T;  3KV9 A;  4H9N C;  4HWC A;  5C2T A;  4WYV A;  2X9X A;  2WMO A;  5FNV E;  1WYC A;  2LOP A;  2WQY A;  1MIW A;  2E8I A;  4YXD A;  4AQY T;  4DV4 T;  1IZN B;  4K0U A;  2DWK A;  3UT5 E;  5AQI B;  2X68 A;  4A5X A;  2X66 A;  1HF8 A;  5HEJ A;  4NXN T;  3RF1 A;  4HWH A;  2A9U A;  3EUH A;  2W66 A;  1W0A A;  4EED A;  3ETU A;  4GYS A;  4IHJ E;  3VU7 H;  1NAF A;  2WWU A;  2UXX B;  4CI3 B;  2X0Y A;  4HEA A;  5JRC B;  3NKZ A;  3HR0 A;  1HG5 A;  2D9D A;  4QKN A;  4ZXL A;  2V7L A;  3NVO A;  4TX5 A;  1QLB A;  1UUR A;  5FXW A;  4O4I E;  2VAS A;  5L3G B;  3AXJ A;  3LBX A;  4P09 A;  2FJD A;  5KDM C;  2PBI A;  2WCA A;  4GK5 E;  2D2S A;  1N33 T;  2WU2 A;  2UXD T;  4U74 A;  5LA6 E;  3N2K E;  2L8K A;  3CVR A;  3OKQ A;  2BG9 E;  1HNZ T;  4UV8 B;  1YW0 A;  2I59 A;  3ZN0 B;  2CXD A;  4DMW A;  2Y8D A;  2Q9Q C;  2XAJ B;  2A72 A;  3UU5 A;  2E2A A;  3SRZ A;  3KFW X;  4I4T E;  2YU1 A;  5KXJ A;  3NWI A;  3DP7 A;  2FUP A;  1XNR T;  1VCT A;  4XAX B;  3FZH B;  2W61 A;  1UCU A;  3I9Y A;  4JEU B;  2XQ7 A;  2WDR A;  3ZKR A;  2LRL A;  3AAA B;  3NRY A;  2H3R A;  4CXW A;  4GYR A;  4IE5 A;  4DBR A;  2C0S A;  4PFP A;  2CPT A;  2K48 A;  3EAM A;  3PUY F;  2HH7 A;  3UU8 A;  3B5M A;  3PV0 F;  5L4E A;  4CQI A;  4CXX A;  2Q9Q D;  5BMV E;  5JDM A;  4X1Y E;  3R84 B;  3PUA A;  3PUQ A;  4DV1 T;  1EZ3 A;  4H9P C;  4BJN A;  4U72 A;  4LF8 T;  2PTF A;  2KLQ A;  2EHO C;  1GQE A;  1KNP A;  1FMW A;  3E22 E;  2OA5 A;  3JAD A;  2V5D A;  2BZB A;  2JQQ A;  3AEC A;  3RKG A;  4DR5 T;  3IA3 A;  3MK7 C;  3PUX F;  3Q2M A;  5JR9 B;  2UXB T;  2KSR A;  1MMD A;  2B1E A;  2WZH A;  2LSJ A;  5LJM A;  4DR6 T;  4I50 E;  2BG9 A;  4DR2 T;  2EHO D;  2XAF B;  2NW9 A;  1IBK T;  3ABV A;  5LBM A;  2LRK A;  1WLX A;  3P7I A;  4MFR A;  1SA0 E;  5CB4 E;  4KUM B;  1KEY A;  4CN1 A;  5ABF A;  4LMJ A;  2W0G A;  5J0Z A;  4H9R C;  2AXD S;  3AE3 A;  1T8B A;  2KXP B;  2LSG A;  5AFU L;  3C4W A;  3ZJ1 A;  4TNW A;  5JDN A;  3UFG A;  1D1A A;  3O1H A;  5AQR B;  4X20 E;  2FJB A;  3ANW A;  4JLE A;  1T72 A;  1E2A A;  3ZMV B; 
#chains in the Genus database with same CATH homology
 3Q5W A;  3LK3 B;  2LHN A;  2PG8 A;  3N5L A;  4YJ3 E;  3RX6 A;  2D0U A;  3RC8 A;  4UF0 B;  3I0Q A;  5DJQ C;  1G73 A;  4E7S A;  3MAC A;  3LG7 A;  1D0X A;  3LK2 B;  3PE0 A;  3UTK A;  3C51 A;  4O4L E;  4ZI2 D;  3ZMZ B;  1D0Y A;  2ZM0 A;  5FMN A;  3F2E A;  4C91 A;  4ZOL E;  2W63 A;  3QUJ A;  3GN5 B;  4QXC B;  3PUS A;  3Q9D A;  3RRW A;  4ILU A;  4CZZ B;  3WAK A;  5JR9 A;  5H6R B;  2ZLY A;  4FJO A;  4UVC B;  4B6X A;  2VWA A;  4CI1 B;  1HCI A;  3ZMU B;  4TV9 E;  2X51 A;  4PJJ A;  5HYA A;  4HKA A;  2DI4 A;  5LHH B;  1MND A;  4PK6 A;  2V7J A;  4IE0 A;  1UX5 A;  3AA0 B;  3FHN A;  1HTJ F;  3S4U A;  4GOU A;  1ZEE A;  3AA1 B;  4JUY A;  5JDQ A;  5KX5 E;  1HS7 A;  4NUU A;  1X79 A;  1YD8 G;  3K3O A;  5LP6 E;  2JMH A;  2CWY A;  5EK4 A;  2XAS B;  3CQX C;  3LK4 2;  4PW8 A;  4AQF A;  3MJX A;  3N9M A;  2N1G A;  4UEL A;  3GMI A;  2ODU A;  2D0T A;  2WBL A;  1D1B A;  1QUU A;  1HX8 A;  3UUM A;  4PFO A;  4YFS A;  4ZI7 E;  3N9O A;  1MIY A;  2N2N A;  4BA9 A;  3HKD E;  5JDF A;  3ZMS B;  4EOZ B;  3ZN1 B;  2NP9 A;  2CLY B;  4DBQ A;  2K9A A;  5FY0 A;  1FMV A;  3MA9 A;  4TZ4 C;  4UV9 B;  1KK7 A;  1OXZ A;  2LOS A;  4TV8 E;  3WAJ A;  2W62 A;  4MLK A;  2QGS A;  3B57 A;  3ETV A;  4MAL A;  2VL8 A;  3C4Z A;  3FBZ A;  3RYF E;  2C5I T;  2ACX A;  2LHR A;  3H37 A;  2KND A;  4PJN A;  4WBN E;  1LRZ A;  2DHR A;  1IJ5 A;  3PTR B;  3ZCJ A;  5CA1 E;  2CMR A;  1IJ6 A;  3H3A A;  3RPU A;  1US7 B;  5HXE A;  5GON E;  2CXF A;  1LKX A;  5LYJ E;  3PDY A;  2WM9 A;  4ZI3 C;  4ZHQ E;  2JRK A;  5IHY A;  2DNX A;  5ETW A;  1MIV A;  2ZM8 A;  3W15 B;  3K3Q C;  4ISS A;  1QSD A;  2X0L B;  3C4X A;  2WSS V;  3T8O A;  3O1J A;  1LVF A;  2X9H A;  3AAE B;  5DAB A;  4ASK A;  5L2L A;  1FIO A;  2V1D B;  3HKE E;  3I9W A;  5ADX L;  2CE7 A;  3U3I A;  2CA5 A;  5HWY A;  1MMG A;  1WYB A;  3QK6 A;  4ADZ A;  2CEA A;  2ZM2 A;  3UUX B;  4DMV A;  4X1I E;  2W00 A;  4O4H E;  3ZJ2 A;  5HWX A;  5JDH A;  5LJN A;  3AAI A;  2DCF A;  5DQV A;  3O9X A;  4BJM A;  4OHF A;  4UF0 A;  3C64 A;  4PAG A;  4XBF B;  3LBX B;  5HAX A;  4IE7 A;  4PK5 A;  3KV4 A;  5KMG P;  1D0Z A;  2D5U A;  2VB6 A;  4HN9 A;  3Q5X A;  3N9Q A;  4QX7 B;  5LBQ B;  5FXX A;  4H9O C;  5HXR A;  5HXS A;  4ZS2 A;  3GN5 A;  3C50 A;  2V7M A;  5JDG A;  3VHL A;  1U4Q A;  4H63 H;  2JJ9 A;  2LJL A;  4WNK A;  3I1A A;  1Y64 B;  3OYZ A;  3M65 A;  1ZKE A;  3EDV A;  3KV9 A;  4AKR B;  2BVM A;  4ZI3 D;  4H9N C;  2LSI A;  2HPJ A;  1MMA A;  3BK9 A;  3L09 A;  2JMK A;  3AA6 B;  2M67 A;  4OYJ A;  2L3L A;  4QHO A;  4YHJ A;  2GK9 A;  3HKB E;  2YU2 A;  3V5U A;  3ZYK A;  2X9X A;  2NW8 A;  2WMO A;  5FNV E;  1WYC A;  3KDS E;  2LOP A;  1MIW A;  2IC6 A;  2CCQ A;  2E8I A;  1KNZ A;  3OYX A;  4H63 V;  4EAH A;  2XHE B;  2WAU A;  3L3P A;  1IZN B;  2V7K A;  5HXC A;  2VKO A;  4E7Z A;  3KBU A;  4P0B A;  2KT9 A;  4K0U A;  2DWK A;  3ZC1 A;  3QC9 A;  1YKE B;  3OJA A;  3UT5 E;  2X68 A;  3A5X A;  2X66 A;  2C5K T;  4I43 B;  2KWI B;  1HF8 A;  3DTO A;  3R6N A;  3K8P C;  3SWH A;  5EK3 A;  4EYU A;  4TUY E;  5LG4 A;  2MTQ A;  5EK2 A;  5DQW A;  3OBV E;  4PK4 A;  3EUH A;  2CXL A;  2L9Q A;  2UXN B;  5LHG B;  2NW7 A;  4MBQ A;  1WR6 A;  3PU8 A;  2E9X B;  3HA4 A;  3ETU A;  4OYK A;  4AQG A;  5JDL A;  2CLY C;  3CX7 B;  5FYM A;  4GYS A;  4OFZ A;  5LXT E;  4IHJ E;  2XUE A;  3VU7 H;  5E0O A;  1T98 A;  4YJ2 E;  1NAF A;  2SPC A;  1BR4 A;  2WWU A;  3ZMT B;  4DO0 A;  3AA7 B;  2XQY A;  5FXV A;  2UXX B;  4CI3 B;  3BQI A;  5LGT B;  3FXE B;  2MBG A;  4HEA A;  1MMN A;  5JRC B;  2LSK A;  4FI5 A;  3HR0 A;  2ODV A;  3AB3 B;  2G0U A;  1HG5 A;  4H9S E;  3NBX X;  4UIG A;  4AKG A;  1CUN A;  2HPL A;  5J1G A;  3ZPO A;  2X9Y A;  2LE8 A;  4QKN A;  2V7L A;  1U5P A;  3VKH A;  2H7V C;  3CQG B;  2CM0 A;  3MKD A;  4MHC A;  3ONX A;  4A56 A;  2NTY A;  4O2A E;  2VKH A;  3PUG A;  4TX5 A;  5FXW A;  4O4I E;  5F3J A;  2VAS A;  5L3G B;  3LBX A;  4IDZ A;  1E1H B;  1HG2 A;  3NRX A;  4GIW A;  4P09 A;  3U78 A;  3VKG A;  5KDM C;  2PBI A;  3KVB A;  4GK5 E;  3BQL A;  2D2S A;  2N9D A;  4KBM B;  2NOX A;  5FXZ A;  3GWH A;  3HI2 A;  2VKD A;  2YEV C;  4U74 A;  5LA6 E;  2CWO A;  3ESL A;  4WBO A;  2K24 A;  3N2K E;  2L8K A;  5L3D B;  3CVR A;  5L3C B;  3OKQ A;  4UV8 B;  3WI3 A;  1YW0 A;  2LM9 A;  1D1C A;  4J2C A;  1B7T A;  2PJQ A;  2I59 A;  3ZN0 B;  3J7Y q;  2CXD A;  4DMW A;  3MXZ A;  1ZV4 X;  5JQG E;  5IYZ E;  3IEE A;  1SHZ C;  2Y8D A;  4M1P A;  2Q9Q C;  1FEW A;  5CA0 E;  2XAJ B;  1AJ3 A;  4IST A;  5EZY E;  5LNK A;  1O3X A;  4HFV A;  2Q9Q B;  3UUN A;  2A72 A;  4PJM A;  5TAO A;  4I55 E;  5H6Q B;  5F8P A;  4X1K E;  3SRZ A;  4OK0 A;  4YLH A;  3CML A;  4QXH B;  4ZS3 A;  4EB6 E;  3KFW X;  4DND A;  2C5J A;  3BQK A;  4I4T E;  3N2G E;  4UEM A;  3UUL A;  4O4J E;  4IIJ E;  2NWB A;  2YU1 A;  4HTE A;  1IAP A;  2ES0 A;  1HFA A;  3DP7 A;  2LSY A;  1VOM A;  1YKH B;  4PNI A;  3ZMV B;  5FY7 A;  3C98 B;  3E08 A;  2X9W A;  3P8C D;  2P9B A;  5J2U E;  5LHI B;  1G8X A;  3EDU A;  4G63 A;  4XAX B;  1LVK A;  3DJB A;  4C90 A;  4JEH B;  2W61 A;  3EVY A;  1UCU A;  3RC3 A;  3I9Y A;  4JEU B;  3UFE A;  4UVA B;  3AAA B;  4L9I A;  2YK0 A;  3NRY A;  1VRB A;  2H3R A;  2K5B B;  3CWZ B;  3LJC A;  4N78 D;  5C8Y E;  4CXW A;  3CQC B;  4GYR A;  4IE5 A;  3ZC0 A;  4DBR A;  2C0S A;  4PFP A;  5L3B B;  2K48 A;  3J9X 1;  4QX8 B;  2HH7 A;  4QXB B;  2RA1 A;  2MYS A;  1S35 A;  2IW5 B;  2XAH B;  5FY1 A;  4CQI A;  2Y6X A;  4CXX A;  2Q9Q D;  3GA8 A;  3IF8 B;  5BMV E;  5JDM A;  5HXH A;  4X1Y E;  2BVL A;  1S94 A;  1NWM X;  5A1L A;  5FP3 A;  4O2B E;  3R84 B;  5JRC A;  1OWA A;  4QWN B;  3O4X E;  3B13 A;  2BDE A;  3PUA A;  4AKH A;  4GK0 E;  2VKJ A;  3PUQ A;  3FXD B;  3RYH E;  1EZ3 A;  4H9P C;  4BJN A;  4EIW A;  3D0T A;  3IBP A;  4U72 A;  3K3N A;  3RH3 A;  2DWG A;  2A2F X;  2E9X C;  2KLQ A;  3ANW B;  2EHO C;  2QA7 A;  3KVA A;  1ZHC A;  5LGU B;  1H7C A;  2XAQ B;  3NZP A;  2EHO B;  2A3D A;  3FB2 A;  3F31 A;  3HKC E;  3ZEF B;  1FMW A;  3E22 E;  4AI6 A;  5J2T E;  2KWH A;  4IE6 A;  2DLR A;  3RYI E;  3PUR A;  2J1D G;  1BR1 A;  3AVS A;  2OA5 A;  4P0A A;  2BZB A;  2JQQ A;  2PFV A;  3HL6 A;  4Z8X A;  3N9N A;  4HE8 A;  4F6R C;  4AKI A;  3MZK B;  1WRD A;  4BAY B;  2IC9 A;  1UX4 A;  5JR9 C;  3MK7 C;  3Q2M A;  4IGU A;  4O8S A;  3KV6 A;  4AXP A;  5JR9 B;  3IHR A;  2LT3 A;  1MMD A;  2B1E A;  2KZ7 B;  3PU3 A;  5LCY A;  5L3F B;  3KBT A;  2LSJ A;  4UVB B;  4V1A v;  5JH7 E;  3ZCI A;  5LJM A;  4TN7 B;  5JRE A;  4AQF C;  3AVR A;  2Z6E A;  1BR2 A;  3KV5 A;  3N9P A;  2Q9Q A;  2ZMA A;  4G2A A;  5JVD E;  4EZH A;  2H7O A;  2MOZ A;  3JC6 C;  4I50 E;  3SOL A;  3O1I A;  2E9X D;  1BR0 A;  3V5S A;  2EHO D;  4HGA A;  3ZLI A;  2XAF B;  4EXT A;  2KMF A;  2XAG B;  2NW9 A;  3TKL B;  2IAK A;  5LBM A;  4PJL A;  3I0O A;  3ZYM A;  4NUV A;  4XZC A;  3F57 A;  4KMC A;  1WLX A;  2NTX A;  2X67 A;  3CX8 B;  3P7I A;  5M4Y A;  4MFR A;  4ZI2 C;  4ANJ A;  4WW0 A;  1SA0 E;  5CB4 E;  4ERR A;  4KUM B;  2RP4 A;  3N2O A;  4L0R A;  2LEH A;  4EYY R;  2WMN A;  2YIN A;  1V9D A;  2W0G A;  4H9Q C;  4H9R C;  3SS1 A;  3FBL A;  2V7I A;  1Z0P A;  2V26 A;  2KXP B;  2LSG A;  3RRC A;  3CPZ A;  2KIN B;  5AFU L;  3C4W A;  3ZJ1 A;  4AKL A;  4CI2 B;  4L5G A;  4IE4 A;  5L3E B;  3NZQ A;  5JDN A;  3RYC E;  5LOV E;  4EZ4 A;  1D1A A;  3O1H A;  4UXN B;  3ZYL A;  4X20 E;  3JC6 D;  4CXY A;  5LGN B;  3RKO A;  4DVD A;  3E0Z A;  3CX6 B;  2VK9 A;  3CKD A;  3N9L A;  2XTL A;  3ANW A;  3KIN B;  4JLE A;  3LFM A;  2Y48 B;  4KP3 C;  2JPF A;  1MNE A;  2E9X A;  2EHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...