2VKJA

Structure of the soluble domain of the membrane protein tm1634 from thermotoga maritima
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
GSHMNLAVKLTRMEKTLKAYELYIFSDYENFENYVKKEGLKIEGMELLKEKKARSLIAEGKDLFETANYGEALVFFEKALNLSDNEEIKKIASFYLEECRKKLAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords TM1634
publication title Structure and Ligand Binding of the Soluble Domain of a Thermotoga Maritima Membrane Protein of Unknown Function Tm1634.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 46
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2vkjA00
2VKJA 2VKOA
chains in the Genus database with same CATH superfamily
2ZMAA 3VKHA 4GKJT 5DABA 2WBLA 2C5KT 2UUAT 2ACXA 3P4RA 4DVDA 3O1JA 3BQKA 3PU3A 5AQVB 1W0BA 3PUGA 2JQKA 2L9QA 1FIOA 3PJAA 2BS3A 3JC6D 5LNKA 3P4QA 2PJQA 3OVUA 4WW0A 5HEJA 3ZT6A 2LJLA 3PUZF 4DBQA 4QXCB 5KMGP 4PJJA 4LFAT 2KT9A 3JAEA 5KXJA 2UUBT 1MMDA 4LF9T 4ZOLE 5IYZE 4LMJA 4I55E 1Y64B 2AE9A 2IUBA 3NVOA 3FBLA 4I4TE 3AAAB 4J2CA 2CM0A 5LHIB 3CWZB 5J2UE 3CX8B 4NXNT 1KNRA 3M3ZB 4JV5T 3RC3A 1IBLT 3PURA 1CUNA 3OYZA 4H9NC 4O4JE 1X79A 3F31A 3VRAA 2BS4A 3H3MA 1Z0PA 5AFUL 4WBOA 1SE7A 4DV2T 3PUWF 3P8CD 2YDQA 4TV8E 1FMWA 1HR0T 3FHNA 2NW7A 2Z6EA 3OYXA 5LG4A 5EK2A 2YDRA 4F8HA 4CI3B 1KK7A 5F8PA 5FXVA 2WQYA 2BKOA 4X64T 4UELA 3N2KE 3HI2A 2VL0A 4NUUA 3NZPA 4DR2T 2NP9A 3ZSSA 2LOPA 4H63V 3TLWA 2D9DA 4KP3C 2DI4A 2KMFA 2M67A 4AI6A 1T8BA 2DWKA 3QB5K 3U3IA 3AEDA 4U7IA 4GYRA 1Y01A 1MIVA 4LMKA 4DR3T 3I9YA 2QA7A 3UT5E 2MBGA 3C50A 4PNIA 2WAUA 5HXCA 2CPTA 3T8OA 3CMLA 2V7IA 5E0OA 4KUMB 3K3OA 3ZN1B 2EHOD 3ZT7A 3CQGB 4IT4A 2CA5A 4HFBA 3RF1A 2QYWA 1UX5A 3AVRA 2V5CA 3HKBE 4YSYA 4HWDA 4LF4T 2I0MA 3I0QA 4QH4A 2V6XA 3VR8A 1W9RA 3M65A 4P09A 5JRCB 3UU6A 3B57A 4YJ3E 3RIUA 2V1DB 5AQFB 2E2AA 2MYSA 2YU1A 1D1CA 2WMOA 5LB7B 2D2SA 4HFIA 1E1HB 2XAHB 2WZHA 1XNRT 3LSVA 5HEOA 1YQ4A 1MNEA 4O8SA 5ABEA 2E5VA 2VVSA 4PK5A 3RQWA 1X9BA 3ZJ2A 3C51A 4BAYB 3ZYLA 2OV9A 4DV7T 4EEBA 4PK4A 3GN5B 2DHRA 5JRCA 4ISTA 2IHR1 4CXYA 2VQFT 4TX5A 3UQ4A 2N2NA 4G63A 2CLYC 2WY2A 4UXNB 4N78D 3VHLA 3CIRA 3OBVE 5HWXA 5LBQB 3QK6A 1WYCA 3ZMSB 2ZM8A 2UXNB 1MMGA 2ZM2A 3FB2A 4ZZCA 2FUPA 2AXDS 2WWUA 3K3QC 1WCRA 1ZOYA 2MOZA 2NR4A 2XAQB 3ZYMA 2R6GF 2DLRA 4GKKT 5AQHB 3GN5A 4YLHA 2H3RA 2IAKA 2ACZA 3T1YT 2FBWA 3PUYF 5LBMA 1WYBA 2V5DA 3AEEA 3WAJA 3AE5A 3AEBA 2EHOB 2LT3A 3PV0F 3MKDA 2BVMA 4G2AA 5JDHA 2LSGA 4DMWA 2XQ7A 1OEDC 3PUXF 1G8XA 2VL8A 3TLUA 4B6XA 4E7ZA 1BR0A 2VKJA 4OYKA 3L8RA 2VKOA 4O4IE 3K3NA 5FY0A 2BVLA 4DV1T 3ZCJA 2W4XA 1ZEEA 4H63H 2CXDA 5AQOB 2X9XA 2E9XB 5AQJB 2LHRA 3B13A 4ILAA 4H9PC 2KZ7B 4X20E 3SOLA 4UVCB 5LGNB 4DV3T 2L8KA 5H6QB 3UUNA 3C4WA 5LGUB 5FXXA 5HEHA 4MHCA 3VR9A 4B3TT 1YQ3A 3AECA 3HA4A 2DL1A 2I6HA 2DWGA 3FXDB 5JR9C 4AKIA 4WBNE 1R8IA 1KNPA 2W61A 1D1AA 3DTOA 3ZSTA 2UXXB 1IBMT 3AB3B 4DR7T 5CA1E 1CHUA 3J7Yq 3HKCE 3PUSA 3AVSA 1IJ6A 5KX5E 1SA0E 4PAGA 1OXZA 5EK4A 2ZM0A 2E9XA 5JDMA 4FI5A 4OYJA 4DR1T 1J5WA 4EB6E 5J0ZA 5AQQB 1XNQT 4IE4A 2GK9A 1QLBA 1T72A 3LK42 3PDYA 4Z8XA 4ILCA 3KVAA 4PJMA 4F6RC 2E5LT 3BK9A 4QXHB 3TKLB 3RH3A 4QWNB 2DNXA 3RQUA 2LSJA 3O4XE 4IE7A 1W0AA 2WSSV 5AQLB 3ZMTB 2XSBA 1UX4A 5IUXA 3UU8A 2C5IT 4O2AE 5EZYE 5L2LA 2BG9C 1ZV4X 5DQWA 5BMVE 3ONJA 4UVAB 3CK6A 3HR0A 2KLQA 3K1SA 4AKRB 4O4LE 4U31A 2V7MA 5L3CB 2XJ7A 2UXBT 2X66A 3UQ7A 2VQET 1N34T 4TWFA 5FVLA 2W63A 1U5PA 5FKYA 3IF8B 2N1GA 4ZHQE 3RYHE 3TLSA 2DCFA 2MTQA 3PUVF 4I0UA 4DNDA 3ZC1A 5JDNA 3DJBA 1I94T 4EZ4A 2BG9E 3NKZA 3MJXA 4X1YE 4GK5E 3UU4A 2KWHA 3Q5EA 4QX8B 3RYIE 5J2TE 3RPUA 2YDSA 3JAFA 4AISA 4XAXB 2UUCT 2JRKA 5HYAA 2BBHA 3N9LA 3VRBA 4C90A 4JI8T 2A2FX 1U4QA 2XQYA 1Z8UA 2KWIB 3OKQA 2UXDT 4CZZB 4Q25A 1HTJF 2J47A 1S94A 1WFDA 2LLYA 2HN1A 4HE8A 2JJ9A 4UF0B 3ESLA 2LRLA 1UURA 5AQSB 2W2UA 3N9MA 3LBXB 4ANJA 4PFOA 1IAPA 2W66A 2HPJA 1ZP0A 3Q5WA 2G0UA 4PJNA 1QUUA 2KSRA 4I43B 4IGUA 2C5JA 2CHOA 1FEWA 5JVDE 2CE7A 4Z90A 1UCUA 4TN7B 5CJ5A 4TUYE 4OK0A 3R6NA 3N9QA 2F4VT 4IHJE 3NRYA 4UF0A 3U78A 1T7SA 3J9X1 1G73A 2VB6A 5JQGE 3AA1B 3UUBA 4YJ2E 1YKHB 4TZ4C 1DU2A 3GA8A 2B1EA 2B76A 3CVRA 3BQLA 2D0UA 3UU3A 2Y8DA 2BDEA 3I0OA 5LHGB 5CFBA 1UUSA 4IDOA 5HEUA 5L4EA 3RRWA 2FJDA 3N2GE 5FVKA 5ABFB 4LF5T 4KI0F 3ONLC 2YU2A 2YEVC 2YK0A 3FZMB 2Q9QC 3Q9DA 5HAXA 2NW9A 3AEAA 1WR0A 4BJNA 3SFEA 3CX6B 4CN4A 2H7VC 4NUVA 1UK5A 2C0SA 1HG5A 4TNWA 4JI6T 1M7KA 4YT0A 2W00A 4YTNA 5AQKB 4DV4T 5M4YA 4H9QC 5FY1A 4BJMA 4A56A 4HWFA 5LXTE 1SUMB 2RPAA 2D0TA 2XAFB 5KDMC 3EHZA 2XY8B 2IMLA 4QHOA 2CLYB 2WB5A 4U33A 3CQXC 4JBWF 5ABFA 2X51A 2V6YB 3RX6A 1QSDA 3CQCB 2LRKA 2XQ3A 4HTEA 3UUXB 5ADXL 3E08A 3RRCA 2ODVA 2J4GA 1XDPA 4H9RC 5BR8T 3F57A 5JDLA 4JI1T 2CCQA 3QC9A 3D0TA 3R84B 5FXZA 1B7TA 3FZLB 1J5ET 2LEHA 5HXRA 2BKNA 3RIFA 2WZIA 1JNRA 5L3DB 3ETVA 5CB4E 4WYVA 2H88A 3P4WA 4U2YA 5GONE 4KHPT 4AIUA 1US7B 2LKGA 4FJOA 2BKPA 1NEKA 4ZI3C 2CEAA 2NTXA 4AKGA 3I9WA 4YHHT 2V6YA 4EOZB 2XQAA 3ZKRA 2BS2A 2VASA 2PFVA 1YW0A 2XUEA 1OEDB 4ILUA 5LG3A 5ETWA 3AAIA 4JI5T 5LP6E 2ZLYA 1HF8A 4JUYA 3S4UA 2QGSA 1GQEA 4WNKA 3BQIA 2V8SV 4NIQA 1KEYA 4IIJE 2XQ6A 4YSXA 5ABHA 3AXJB 4DIDB 5JREA 1KFYA 4JEUB 4B3RT 4YY3T 4Z91A 2HPLA 4HKAA 4AQFA 5FNVE 1YXRA 2NTYA 3I1AA 3OJAA 5JR9B 3N9PA 1OEDA 2WU5A 5HEGA 2W67A 5EK3A 4JI0T 4O2BE 2XQ4A 2BZBA 4AQYT 2M6IA 2CBJA 3W15B 3AE3A 1IZNB 2ES0A 2UXCT 4CI1B 4QKNA 1BR2A 2A72A 3Q5DA 1LVFA 4QXBB 3AE4A 2CWOA 5LJNA 2WM9A 3N2OA 3ONXA 3A8YC 2YN6A 2LOSA 1WR6A 5LHHB 4OHFA 4EIWA 2EHOA 4YFSA 4IE5A 3P4SA 4YXDA 4ZI2C 2I59A 5JR9A 3OPCA 3RI5A 3PU8A 2XQ8A 3OTOT 1W09A 3KV5A 5FMNA 1M62A 3AE1A 2ZM6T 1D0XA 2XM1A 2RP4A 2BG9B 1D0YA 4HWHA 4IDNA 3WAKA 2LSIA 3LK3B 2XTLA 3A7MA 4X1KE 3FZKB 4GK0E 1XZYA 2KINB 1HNXT 4JEHB 4L5GA 3DP7A 3H3AA 4AQGA 2X9YA 2CXLA 3K8PC 2IIUA 4NPPA 4U74A 3TLVA 4LMLA 4I50E 3AA0B 3AE9A 3C4XA 3PTRB 2PG8A 2ODUA 4LFBT 1MMAA 4U3CA 3EDUA 3HL6A 5HWYA 1VCTA 5DQVA 4PJLA 3RIAA 4KMCA 4ZS3A 4ZZBA 3Q2MA 3AAEB 2YOEA 3E0ZA 2P9BA 1O3XA 2Q9QD 3L3PA 1MNDA 5AQUB 2VVNA 3RYFE 2XPKA 4TNVA 4H9SE 4EYUA 1VRBA 1N32T 2MAWA 4V1Av 1N36T 3QB5A 5JDQA 5JDFA 3AA7B 4BA9A 1IJ5A 1ZHCA 5FY7A 5L3FB 5FYMA 4UR9A 2WWVA 4PW8A 3UFGA 4JI4T 3P7IA 3ANWB 5HXHA 4IDZA 2XZEA 1UGOA 4JI7T 3L39A 2V7LA 4CN1A 2NWBA 3HKDE 4P0AA 4XZCA 3EABA 2XAJB 3MXZA 1XMOT 4IE6A 1D1BA 3RYCE 2JMKA 1E2AA 4CI2B 3C64A 1FMVA 1WLXA 3AE2A 3AEGA 4PK6A 4QH1A 2LHNA 2FJEA 2H7OA 5AQNB 4ASKA 2W62A 3ANWA 3E22E 1HNWT 4ZI3D 3AEFA 3UTKA 2KNDA 2LM2A 5LGTB 2VWAA 4ZS2A 2XASB 5LCYA 4HFHA 4IL9A 5AQTB 2E8IA 4ERRA 3RKOA 1V9DA 2FJAA 4HN9A 3AE7A 4A98A 1HX8A 3C98B 3LFMA 1AJ3A 3KINB 3KV9A 4CN6A 1I6ZA 5IWAT 4X5TA 3ZYKA 1HG2A 2CXFA 2XQ9A 3CX7B 2JQQA 4YTPA 3RHWA 2HN2A 4MBQA 3LK2B 2KXPB 3LJCA 3NZQA 5AQPB 2CMRA 3CKDA 4UV9B 4IDPA 4NXMT 2VKDA 2D5UA 2X0HA 3FZHB 5LJMA 1LKXA 5L47A 2J62A 3O1HA 3P4PA 4DV0T 4U7YA 3C4ZA 2YKSA 2JMHA 2Y48B 2Q9QB 4QH5A 2N9DA 4UEMA 4X1IE 5FL1A 4JI2T 4M1PA 1N33T 3ZC0A 3EDVA 3L09A 3ZMUB 3SRZA 1HNZT 2J1DG 4UIGA 3MZKB 3AA6B 4WZXA 2PTFA 5FL0A 4UVBB 2V7KA 2IC6A 4X65T 3CPZA 3QNUA 3LBXA 3FXEB 2WMNA 3KVBA 2WP9A 4L9IA 5C2TA 1MIWA 4AXPA 4LFCT 5IHYA 4DMVA 3ABVA 4YHJA 1FJGT 4HEAA 1BR4A 3GMIA 2WDRA 3N9OA 2HH7A 5L4HA 2HHHT 1KF6A 3ZEFB 5CGMA 2NOXA 4IDQA 2Q9QA 3GWHA 5L3EB 3V5UA 4YTMA 4GOUA 4CQIA 4ZI2D 3N5LA 5AQIB 5L3BB 1HX1B 1MMNA 3AE8A 3UULA 3FBZA 1VCSA 4EGWA 3KBTA 4U2ZA 3EAMA 4O4HE 4P1NA 5J1GA 3AE6A 3N9NA 4X66T 2BBJA 4E7SA 3PUAA 4B3MT 3VKGA 1JNZA 1XWMA 3WI3A 2VK9A 2V7JA 4CXXA 4DV5T 2JPFA 4H9OC 2JIWA 3HKEE 5JDGA 1L0VA 2IC9A 5LOVE 1ZKEA 2JQHA 4CXWA 4JLEA 5HCMA 2VKHA 5JTGA 2QVAA 2E9XD 1VOMA 3RIUC 3PUQA 2K9AA 2CBIA 5F3JA 3MACA 1MIYA 2K5BB 3KV6A 3JC6C 5H6RB 4DR4T 3ZMVB 3KV4A 2OLTA 3NRXA 3PJAJ 3MA9A 3ZLIA 3ETUA 3UFEA 4DR5T 4HFVA 3KBUA 5C3JA 1WRDA 5DJQC 2IW5B 3RLFF 4OX9T 4L0RA 1XDOA 4ZEYA 1NAFA 1H7CA 4X62T 5C8YE 2X0LB 3PE0A 4EXTA 4QX7B 2XQ5A 2H89A 2X68A 3LG7A 2WS3A 3KFWX 3JCFA 1S35A 3MK7C 5LMNT 5AQMB 4LF6T 3P50A 4DUZT 1T98A 3QOFA 2IDOB 5HXEA 4DBRA 2XAGB 4AKHA 2XSAA 5AQGB 2Y6XA 3ZT5A 4JI3T 4HGAA 2XM2A 4UV8B 2JQ9A 4OFZA 1D0ZA 3G06A 4EAHA 2WDQA 3ZN0B 4GYSA 2M6BA 4ISSA 2LSKA 4ILBA 2WCAA 3ZPOA 3Q5XA 4PFPA 2NW8A 3F2EA 2V26A 4ZXLA 1OWAA 4DUYT 2WU2A 2LE8A 5LYJE 3QUJA 4COFA 1YKEB 5JH7E 4EZHA 3TLTA 4AQFC 4ADZA 2X9HA 4IREA 3RKGA 3AXJA 4DO0A 4EYYR 4IE0A 2VURA 3UU5A 3VU7H 4K0UA 1HFAA 4P0BA 4HFDA 1J1JA 2RA1A 1SHZC 2OA5A 2LKHA 3EUHA 3T1HT 4TWDA 4A97A 3IHRA 3LDQB 2K3WA 5HCJA 1NWMX 2A9UA 2W0GA 5FP3A 1EZ3A 4YSZA 1XMQT 1HCIA 4TV9E 3KDSE 4IL4A 4LF7T 5CA0E 4HFCA 2CWYA 3IBPA 4ZI7E 3NBXX 2EHOC 3O1IA 5TAOA 5L3GB 3NWIA 2CHNA 2CRBA 2SPCA 3IEEA 4HFEA 3ZCIA 3SWHA 1OEDE 4MLKA 4DV6T 2K24A 5AQRB 2X9WA 1HS7A 2FJBA 4KBMB 4MALA 5F5WA 4HWCA 4GIWA 4EEDA 4EV6A 2E9XC 1IBKT 2MPKA 3V5SA 3EVYA 3IA3A 5LA6E 4K0KT 4XBFB 5FXWA 3ZJ1A 2BG9A 3SS1A 5A1LA 5ABGA 1E7PA 3H37A 1NENA 2K48A 5HXSA 4U72A 3FZFB 4KHZF 4AKLA 3RGLA 2LM9A 2XHEB 1LRZA 3ZMZB 3O9XA 2YINA 2A3DA 1BR1A 4TWHA 2X0YA 3X1DA 4KX6A 2LSYA 3A5XA 4MFRA 1KNZA 2UU9T 2X67A 3RC8A 4HWIB 4DR6T 3JADA 4A5XA 2QRXA 1LVKA 5LMUT 4B3ST 2L3LA 2WDVA 3B5MA 3SFDA 4C91A 3EI0A 4LF8T 3UUMA 1YD8G 4JYAT 2PBIA
chains in the Genus database with same CATH topology
3HA4A 3CPZA 2ZMAA 3VKHA 5DABA 3LBXA 2WBLA 2C5KT 3FXEB 2WMNA 3KVBA 5GONE 2ACXA 1US7B 4L9IA 4FJOA 4DVDA 1MIWA 4AXPA 2DWGA 2CEAA 3FXDB 4ZI3C 2NTXA 3O1JA 5JR9C 3BQKA 4AKIA 4WBNE 2W61A 3PU3A 1D1AA 4AKGA 3DTOA 3I9WA 5IHYA 4EOZB 3PUGA 2UXXB 2VASA 2PFVA 1YW0A 2XUEA 4DMVA 2L9QA 3AB3B 5CA1E 1FIOA 4YHJA 4HEAA 1BR4A 3JC6D 5LNKA 3GMIA 3J7Yq 3HKCE 2PJQA 3N9OA 4ILUA 2HH7A 5ETWA 3AAIA 3PUSA 3AVSA 3ZEFB 4WW0A 1IJ6A 2NOXA 5KX5E 1SA0E 2Q9QA 3GWHA 4PAGA 5L3EB 5LP6E 3V5UA 2LJLA 2ZLYA 1HF8A 4DBQA 1OXZA 4QXCB 4JUYA 5KMGP 4GOUA 2ZM0A 5EK4A 2E9XA 3S4UA 4CQIA 4ZI2D 3N5LA 4PJJA 5JDMA 2KT9A 5L3BB 4FI5A 2QGSA 4OYJA 4WNKA 3BQIA 1MMNA 4EB6E 1MMDA 4IIJE 4ZOLE 3UULA 3FBZA 4IE4A 2GK9A 3LK42 5IYZE 3PDYA 4Z8XA 3KVAA 4PJMA 3KBTA 4I55E 4F6RC 5JREA 1Y64B 4JEUB 4O4HE 3BK9A 4QXHB 5J1GA 3TKLB 3FBLA 3RH3A 4I4TE 3AAAB 4J2CA 3N9NA 4QWNB 2DNXA 2CM0A 5LHIB 2LSJA 3CWZB 3O4XE 4IE7A 4E7SA 3PUAA 3VKGA 5J2UE 2HPLA 2WSSV 3CX8B 4HKAA 3ZMTB 4AQFA 3WI3A 2VK9A 5FNVE 2NTYA 3I1AA 2V7JA 3OJAA 3RC3A 4CXXA 5JR9B 1UX4A 3N9PA 3PURA 2JPFA 4H9OC 5EK3A 1CUNA 3OYZA 4H9NC 4O4JE 2C5IT 1X79A 4O2BE 4O2AE 5EZYE 5L2LA 3HKEE 5JDGA 3F31A 2BZBA 2IC9A 1ZV4X 5LOVE 3W15B 1ZKEA 5DQWA 5BMVE 1IZNB 2ES0A 4CI1B 4CXWA 4JLEA 4QKNA 1BR2A 1Z0PA 5AFUL 4UVAB 4WBOA 2VKHA 3HR0A 2E9XD 2KLQA 1VOMA 2A72A 1LVFA 4QXBB 4O4LE 4AKRB 3P8CD 2V7MA 5L3CB 2CWOA 3PUQA 5LJNA 2K9AA 4TV8E 2WM9A 3N2OA 3ONXA 5F3JA 2X66A 3MACA 1FMWA 1MIYA 2W63A 2K5BB 2LOSA 3FHNA 2NW7A 1WR6A 2Z6EA 3KV6A 3OYXA 3JC6C 5H6RB 5LHHB 4OHFA 4EIWA 5LG4A 1U5PA 3IF8B 5EK2A 3ZMVB 3KV4A 2N1GA 2EHOA 3NRXA 4YFSA 4IE5A 4ZHQE 3RYHE 4CI3B 3MA9A 3ZLIA 1KK7A 5F8PA 2DCFA 5FXVA 4ZI2C 2I59A 2MTQA 3ETUA 3UFEA 5JR9A 4HFVA 4UELA 3N2KE 3KBUA 3PU8A 3HI2A 1WRDA 5DJQC 4NUUA 3NZPA 2IW5B 4DNDA 2NP9A 3KV5A 3ZC1A 4L0RA 2LOPA 5JDNA 5FMNA 3DJBA 4H63V 1D0XA 1NAFA 1H7CA 4KP3C 2DI4A 2KMFA 2M67A 4EZ4A 2X0LB 5C8YE 3PE0A 2RP4A 3MJXA 4EXTA 4AI6A 2DWKA 3U3IA 4X1YE 4QX7B 1D0YA 4GK5E 4GYRA 2X68A 1MIVA 2KWHA 3LG7A 3I9YA 2LSIA 3WAKA 2QA7A 3KFWX 3LK3B 3UT5E 4QX8B 1S35A 3MK7C 3RYIE 5J2TE 2XTLA 2MBGA 3RPUA 3C50A 4PNIA 2WAUA 5HXCA 4X1KE 1T98A 4GK0E 2KINB 3T8OA 3CMLA 2V7IA 4JEHB 4L5GA 4XAXB 3DP7A 3H3AA 4AQGA 2JRKA 5HYAA 5HXEA 5E0OA 2X9YA 4KUMB 4DBRA 2XAGB 2CXLA 3K8PC 4AKHA 3N9LA 2Y6XA 3K3OA 4C90A 3ZN1B 2EHOD 4U74A 4HGAA 2A2FX 4UV8B 3CQGB 1U4QA 2XQYA 4I50E 4OFZA 1D0ZA 2KWIB 3OKQA 3AA0B 4CZZB 2CA5A 4EAHA 3C4XA 3PTRB 3ZN0B 1UX5A 2PG8A 1HTJF 2ODUA 4GYSA 1S94A 4ISSA 3AVRA 2LSKA 3HKBE 1MMAA 3ZPOA 3Q5XA 4PFPA 3EDUA 4HE8A 3HL6A 2NW8A 5HWYA 2JJ9A 4UF0B 3ESLA 3I0QA 3F2EA 2V26A 5DQVA 4PJLA 1OWAA 3M65A 4KMCA 2LE8A 5LYJE 4P09A 4ZS3A 3QUJA 5JRCB 1YKEB 3Q2MA 3AAEB 3E0ZA 3N9MA 2P9BA 1O3XA 2Q9QD 3LBXB 4ANJA 4EZHA 5JH7E 3B57A 4YJ3E 2V1DB 4PFOA 2MYSA 1IAPA 4AQFC 2HPJA 2YU1A 1D1CA 3L3PA 1MNDA 2WMOA 3Q5WA 4ADZA 2X9HA 2D2SA 3RYFE 1E1HB 4H9SE 4DO0A 2XAHB 4EYYR 4EYUA 1VRBA 2G0UA 4IE0A 4V1Av 4PJNA 3VU7H 1QUUA 5JDQA 4K0UA 4I43B 1HFAA 4P0BA 4IGUA 1MNEA 2C5JA 4O8SA 5JDFA 1FEWA 3AA7B 4BA9A 2RA1A 1SHZC 2OA5A 3EUHA 1IJ5A 1ZHCA 5JVDE 2CE7A 1UCUA 5FY7A 5L3FB 4TN7B 5FYMA 3IHRA 4TUYE 4PK5A 4OK0A 4PW8A 3R6NA 3N9QA 1NWMX 3P7IA 3ANWB 3ZJ2A 2W0GA 5FP3A 5HXHA 3C51A 4IHJE 1EZ3A 3NRYA 4UF0A 3U78A 4BAYB 4IDZA 3ZYLA 2V7LA 1HCIA 4PK4A 3GN5B 4TV9E 3J9X1 3KDSE 2DHRA 5CA0E 5JRCA 4ISTA 2NWBA 1G73A 2CWYA 2VB6A 3HKDE 3IBPA 4ZI7E 4CXYA 5JQGE 3NBXX 4P0AA 3AA1B 4YJ2E 2EHOC 1YKHB 3O1IA 4TZ4C 5TAOA 5L3GB 3GA8A 2B1EA 4XZCA 4TX5A 2XAJB 3MXZA 2N2NA 4G63A 3CVRA 2CLYC 3BQLA 4UXNB 4N78D 4IE6A 1D1BA 3VHLA 3OBVE 1YD8G 2D0UA 2SPCA 5HWXA 5LBQB 3RYCE 2JMKA 3QK6A 1WYCA 4CI2B 3ZMSB 3C64A 2ZM8A 1FMVA 2Y8DA 3IEEA 2UXNB 1WLXA 2BDEA 3ZCIA 2ZM2A 1MMGA 3SWHA 3I0OA 3FB2A 5LHGB 4MLKA 4PK6A 3RRWA 2WWUA 2K24A 3K3QC 3N2GE 2MOZA 2LHNA 2XAQB 2X9WA 3ZYMA 2H7OA 1HS7A 2DLRA 4KBMB 2YU2A 2YEVC 2YK0A 4MALA 2Q9QC 4ASKA 3Q9DA 2W62A 3ANWA 5HAXA 2NW9A 4GIWA 2E9XC 3E22E 4ZI3D 4BJNA 3UTKA 2KNDA 3CX6B 2H7VC 5LGTB 4NUVA 2VWAA 3GN5A 4YLHA 4ZS2A 3V5SA 2H3RA 2XASB 3EVYA 2C0SA 5LCYA 2IAKA 4ERRA 2E8IA 1HG5A 3RKOA 5LA6E 1V9DA 4XBFB 4HN9A 2W00A 5FXWA 3ZJ1A 5LBMA 1HX8A 1WYBA 3C98B 3LFMA 3WAJA 3SS1A 5A1LA 1AJ3A 5M4YA 3KINB 3H37A 4H9QC 5FY1A 4BJMA 3KV9A 2K48A 5HXSA 4U72A 4A56A 2EHOB 5LXTE 2LT3A 2D0TA 2XAFB 5KDMC 4AKLA 3ZYKA 3MKDA 1HG2A 2LM9A 2XHEB 1LRZA 2CXFA 3ZMZB 3O9XA 3CX7B 2CLYB 4QHOA 2BVMA 2JQQA 2YINA 4G2AA 2A3DA 5JDHA 2LSGA 3LK2B 4MBQA 4DMWA 2KXPB 1BR1A 3LJCA 3CQXC 3NZQA 1G8XA 2VL8A 2CMRA 2X51A 3CKDA 4UV9B 2VKDA 4B6XA 2D5UA 3RX6A 4E7ZA 1QSDA 3CQCB 2LSYA 1BR0A 3A5XA 4HTEA 3UUXB 2VKJA 3E08A 5ADXL 1LKXA 5LJMA 4OYKA 3RRCA 4MFRA 2VKOA 3O1HA 4O4IE 1KNZA 2ODVA 3K3NA 3C4ZA 5FY0A 2X67A 3RC8A 2JMHA 2BVLA 2Y48B 2Q9QB 4H9RC 3ZCJA 3F57A 2N9DA 1ZEEA 4UEMA 4H63H 4X1IE 2CXDA 5JDLA 2X9XA 4M1PA 2CCQA 2E9XB 3QC9A 3ZC0A 3D0TA 3EDVA 1LVKA 2LHRA 3B13A 3L09A 5FXZA 1B7TA 3R84B 3ZMUB 2LEHA 4H9PC 2KZ7B 2L3LA 5HXRA 4X20E 3SOLA 4UVCB 5LGNB 2L8KA 5H6QB 2J1DG 3SRZA 4UIGA 3UUNA 4C91A 3MZKB 3AA6B 5L3DB 3C4WA 3ETVA 5LGUB 5FXXA 5CB4E 4MHCA 4UVBB 3UUMA 2V7KA 2IC6A 2PBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKJ A;  2VKO A; 
#chains in the Genus database with same CATH topology
 2ZMA A;  3VKH A;  4GKJ T;  5DAB A;  2WBL A;  2C5K T;  2UUA T;  2ACX A;  3P4R A;  4DVD A;  3O1J A;  3BQK A;  3PU3 A;  5AQV B;  1W0B A;  3PUG A;  2JQK A;  2L9Q A;  1FIO A;  3PJA A;  2BS3 A;  3JC6 D;  5LNK A;  3P4Q A;  2PJQ A;  3OVU A;  4WW0 A;  5HEJ A;  3ZT6 A;  2LJL A;  3PUZ F;  4DBQ A;  4QXC B;  5KMG P;  4PJJ A;  4LFA T;  2KT9 A;  3JAE A;  5KXJ A;  2UUB T;  1MMD A;  4LF9 T;  4ZOL E;  5IYZ E;  4LMJ A;  4I55 E;  1Y64 B;  2AE9 A;  2IUB A;  3NVO A;  3FBL A;  4I4T E;  3AAA B;  4J2C A;  2CM0 A;  5LHI B;  3CWZ B;  5J2U E;  3CX8 B;  4NXN T;  1KNR A;  3M3Z B;  4JV5 T;  3RC3 A;  1IBL T;  3PUR A;  1CUN A;  3OYZ A;  4H9N C;  4O4J E;  1X79 A;  3F31 A;  3VRA A;  2BS4 A;  3H3M A;  1Z0P A;  5AFU L;  4WBO A;  1SE7 A;  4DV2 T;  3PUW F;  3P8C D;  2YDQ A;  4TV8 E;  1FMW A;  1HR0 T;  3FHN A;  2NW7 A;  2Z6E A;  3OYX A;  5LG4 A;  5EK2 A;  2YDR A;  4F8H A;  4CI3 B;  1KK7 A;  5F8P A;  5FXV A;  2WQY A;  2BKO A;  4X64 T;  4UEL A;  3N2K E;  3HI2 A;  2VL0 A;  4NUU A;  3NZP A;  4DR2 T;  2NP9 A;  3ZSS A;  2LOP A;  4H63 V;  3TLW A;  2D9D A;  4KP3 C;  2DI4 A;  2KMF A;  2M67 A;  4AI6 A;  1T8B A;  2DWK A;  3QB5 K;  3U3I A;  3AED A;  4U7I A;  4GYR A;  1Y01 A;  1MIV A;  4LMK A;  4DR3 T;  3I9Y A;  2QA7 A;  3UT5 E;  2MBG A;  3C50 A;  4PNI A;  2WAU A;  5HXC A;  2CPT A;  3T8O A;  3CML A;  2V7I A;  5E0O A;  4KUM B;  3K3O A;  3ZN1 B;  2EHO D;  3ZT7 A;  3CQG B;  4IT4 A;  2CA5 A;  4HFB A;  3RF1 A;  2QYW A;  1UX5 A;  3AVR A;  2V5C A;  3HKB E;  4YSY A;  4HWD A;  4LF4 T;  2I0M A;  3I0Q A;  4QH4 A;  2V6X A;  3VR8 A;  1W9R A;  3M65 A;  4P09 A;  5JRC B;  3UU6 A;  3B57 A;  4YJ3 E;  3RIU A;  2V1D B;  5AQF B;  2E2A A;  2MYS A;  2YU1 A;  1D1C A;  2WMO A;  5LB7 B;  2D2S A;  4HFI A;  1E1H B;  2XAH B;  2WZH A;  1XNR T;  3LSV A;  5HEO A;  1YQ4 A;  1MNE A;  4O8S A;  5ABE A;  2E5V A;  2VVS A;  4PK5 A;  3RQW A;  1X9B A;  3ZJ2 A;  3C51 A;  4BAY B;  3ZYL A;  2OV9 A;  4DV7 T;  4EEB A;  4PK4 A;  3GN5 B;  2DHR A;  5JRC A;  4IST A;  2IHR 1;  4CXY A;  2VQF T;  4TX5 A;  3UQ4 A;  2N2N A;  4G63 A;  2CLY C;  2WY2 A;  4UXN B;  4N78 D;  3VHL A;  3CIR A;  3OBV E;  5HWX A;  5LBQ B;  3QK6 A;  1WYC A;  3ZMS B;  2ZM8 A;  2UXN B;  1MMG A;  2ZM2 A;  3FB2 A;  4ZZC A;  2FUP A;  2AXD S;  2WWU A;  3K3Q C;  1WCR A;  1ZOY A;  2MOZ A;  2NR4 A;  2XAQ B;  3ZYM A;  2R6G F;  2DLR A;  4GKK T;  5AQH B;  3GN5 A;  4YLH A;  2H3R A;  2IAK A;  2ACZ A;  3T1Y T;  2FBW A;  3PUY F;  5LBM A;  1WYB A;  2V5D A;  3AEE A;  3WAJ A;  3AE5 A;  3AEB A;  2EHO B;  2LT3 A;  3PV0 F;  3MKD A;  2BVM A;  4G2A A;  5JDH A;  2LSG A;  4DMW A;  2XQ7 A;  1OED C;  3PUX F;  1G8X A;  2VL8 A;  3TLU A;  4B6X A;  4E7Z A;  1BR0 A;  2VKJ A;  4OYK A;  3L8R A;  2VKO A;  4O4I E;  3K3N A;  5FY0 A;  2BVL A;  4DV1 T;  3ZCJ A;  2W4X A;  1ZEE A;  4H63 H;  2CXD A;  5AQO B;  2X9X A;  2E9X B;  5AQJ B;  2LHR A;  3B13 A;  4ILA A;  4H9P C;  2KZ7 B;  4X20 E;  3SOL A;  4UVC B;  5LGN B;  4DV3 T;  2L8K A;  5H6Q B;  3UUN A;  3C4W A;  5LGU B;  5FXX A;  5HEH A;  4MHC A;  3VR9 A;  4B3T T;  1YQ3 A;  3AEC A;  3HA4 A;  2DL1 A;  2I6H A;  2DWG A;  3FXD B;  5JR9 C;  4AKI A;  4WBN E;  1R8I A;  1KNP A;  2W61 A;  1D1A A;  3DTO A;  3ZST A;  2UXX B;  1IBM T;  3AB3 B;  4DR7 T;  5CA1 E;  1CHU A;  3J7Y q;  3HKC E;  3PUS A;  3AVS A;  1IJ6 A;  5KX5 E;  1SA0 E;  4PAG A;  1OXZ A;  5EK4 A;  2ZM0 A;  2E9X A;  5JDM A;  4FI5 A;  4OYJ A;  4DR1 T;  1J5W A;  4EB6 E;  5J0Z A;  5AQQ B;  1XNQ T;  4IE4 A;  2GK9 A;  1QLB A;  1T72 A;  3LK4 2;  3PDY A;  4Z8X A;  4ILC A;  3KVA A;  4PJM A;  4F6R C;  2E5L T;  3BK9 A;  4QXH B;  3TKL B;  3RH3 A;  4QWN B;  2DNX A;  3RQU A;  2LSJ A;  3O4X E;  4IE7 A;  1W0A A;  2WSS V;  5AQL B;  3ZMT B;  2XSB A;  1UX4 A;  5IUX A;  3UU8 A;  2C5I T;  4O2A E;  5EZY E;  5L2L A;  2BG9 C;  1ZV4 X;  5DQW A;  5BMV E;  3ONJ A;  4UVA B;  3CK6 A;  3HR0 A;  2KLQ A;  3K1S A;  4AKR B;  4O4L E;  4U31 A;  2V7M A;  5L3C B;  2XJ7 A;  2UXB T;  2X66 A;  3UQ7 A;  2VQE T;  1N34 T;  4TWF A;  5FVL A;  2W63 A;  1U5P A;  5FKY A;  3IF8 B;  2N1G A;  4ZHQ E;  3RYH E;  3TLS A;  2DCF A;  2MTQ A;  3PUV F;  4I0U A;  4DND A;  3ZC1 A;  5JDN A;  3DJB A;  1I94 T;  4EZ4 A;  2BG9 E;  3NKZ A;  3MJX A;  4X1Y E;  4GK5 E;  3UU4 A;  2KWH A;  3Q5E A;  4QX8 B;  3RYI E;  5J2T E;  3RPU A;  2YDS A;  3JAF A;  4AIS A;  4XAX B;  2UUC T;  2JRK A;  5HYA A;  2BBH A;  3N9L A;  3VRB A;  4C90 A;  4JI8 T;  2A2F X;  1U4Q A;  2XQY A;  1Z8U A;  2KWI B;  3OKQ A;  2UXD T;  4CZZ B;  4Q25 A;  1HTJ F;  2J47 A;  1S94 A;  1WFD A;  2LLY A;  2HN1 A;  4HE8 A;  2JJ9 A;  4UF0 B;  3ESL A;  2LRL A;  1UUR A;  5AQS B;  2W2U A;  3N9M A;  3LBX B;  4ANJ A;  4PFO A;  1IAP A;  2W66 A;  2HPJ A;  1ZP0 A;  3Q5W A;  2G0U A;  4PJN A;  1QUU A;  2KSR A;  4I43 B;  4IGU A;  2C5J A;  2CHO A;  1FEW A;  5JVD E;  2CE7 A;  4Z90 A;  1UCU A;  4TN7 B;  5CJ5 A;  4TUY E;  4OK0 A;  3R6N A;  3N9Q A;  2F4V T;  4IHJ E;  3NRY A;  4UF0 A;  3U78 A;  1T7S A;  3J9X 1;  1G73 A;  2VB6 A;  5JQG E;  3AA1 B;  3UUB A;  4YJ2 E;  1YKH B;  4TZ4 C;  1DU2 A;  3GA8 A;  2B1E A;  2B76 A;  3CVR A;  3BQL A;  2D0U A;  3UU3 A;  2Y8D A;  2BDE A;  3I0O A;  5LHG B;  5CFB A;  1UUS A;  4IDO A;  5HEU A;  5L4E A;  3RRW A;  2FJD A;  3N2G E;  5FVK A;  5ABF B;  4LF5 T;  4KI0 F;  3ONL C;  2YU2 A;  2YEV C;  2YK0 A;  3FZM B;  2Q9Q C;  3Q9D A;  5HAX A;  2NW9 A;  3AEA A;  1WR0 A;  4BJN A;  3SFE A;  3CX6 B;  4CN4 A;  2H7V C;  4NUV A;  1UK5 A;  2C0S A;  1HG5 A;  4TNW A;  4JI6 T;  1M7K A;  4YT0 A;  2W00 A;  4YTN A;  5AQK B;  4DV4 T;  5M4Y A;  4H9Q C;  5FY1 A;  4BJM A;  4A56 A;  4HWF A;  5LXT E;  1SUM B;  2RPA A;  2D0T A;  2XAF B;  5KDM C;  3EHZ A;  2XY8 B;  2IML A;  4QHO A;  2CLY B;  2WB5 A;  4U33 A;  3CQX C;  4JBW F;  5ABF A;  2X51 A;  2V6Y B;  3RX6 A;  1QSD A;  3CQC B;  2LRK A;  2XQ3 A;  4HTE A;  3UUX B;  5ADX L;  3E08 A;  3RRC A;  2ODV A;  2J4G A;  1XDP A;  4H9R C;  5BR8 T;  3F57 A;  5JDL A;  4JI1 T;  2CCQ A;  3QC9 A;  3D0T A;  3R84 B;  5FXZ A;  1B7T A;  3FZL B;  1J5E T;  2LEH A;  5HXR A;  2BKN A;  3RIF A;  2WZI A;  1JNR A;  5L3D B;  3ETV A;  5CB4 E;  4WYV A;  2H88 A;  3P4W A;  4U2Y A;  5GON E;  4KHP T;  4AIU A;  1US7 B;  2LKG A;  4FJO A;  2BKP A;  1NEK A;  4ZI3 C;  2CEA A;  2NTX A;  4AKG A;  3I9W A;  4YHH T;  2V6Y A;  4EOZ B;  2XQA A;  3ZKR A;  2BS2 A;  2VAS A;  2PFV A;  1YW0 A;  2XUE A;  1OED B;  4ILU A;  5LG3 A;  5ETW A;  3AAI A;  4JI5 T;  5LP6 E;  2ZLY A;  1HF8 A;  4JUY A;  3S4U A;  2QGS A;  1GQE A;  4WNK A;  3BQI A;  2V8S V;  4NIQ A;  1KEY A;  4IIJ E;  2XQ6 A;  4YSX A;  5ABH A;  3AXJ B;  4DID B;  5JRE A;  1KFY A;  4JEU B;  4B3R T;  4YY3 T;  4Z91 A;  2HPL A;  4HKA A;  4AQF A;  5FNV E;  1YXR A;  2NTY A;  3I1A A;  3OJA A;  5JR9 B;  3N9P A;  1OED A;  2WU5 A;  5HEG A;  2W67 A;  5EK3 A;  4JI0 T;  4O2B E;  2XQ4 A;  2BZB A;  4AQY T;  2M6I A;  2CBJ A;  3W15 B;  3AE3 A;  1IZN B;  2ES0 A;  2UXC T;  4CI1 B;  4QKN A;  1BR2 A;  2A72 A;  3Q5D A;  1LVF A;  4QXB B;  3AE4 A;  2CWO A;  5LJN A;  2WM9 A;  3N2O A;  3ONX A;  3A8Y C;  2YN6 A;  2LOS A;  1WR6 A;  5LHH B;  4OHF A;  4EIW A;  2EHO A;  4YFS A;  4IE5 A;  3P4S A;  4YXD A;  4ZI2 C;  2I59 A;  5JR9 A;  3OPC A;  3RI5 A;  3PU8 A;  2XQ8 A;  3OTO T;  1W09 A;  3KV5 A;  5FMN A;  1M62 A;  3AE1 A;  2ZM6 T;  1D0X A;  2XM1 A;  2RP4 A;  2BG9 B;  1D0Y A;  4HWH A;  4IDN A;  3WAK A;  2LSI A;  3LK3 B;  2XTL A;  3A7M A;  4X1K E;  3FZK B;  4GK0 E;  1XZY A;  2KIN B;  1HNX T;  4JEH B;  4L5G A;  3DP7 A;  3H3A A;  4AQG A;  2X9Y A;  2CXL A;  3K8P C;  2IIU A;  4NPP A;  4U74 A;  3TLV A;  4LML A;  4I50 E;  3AA0 B;  3AE9 A;  3C4X A;  3PTR B;  2PG8 A;  2ODU A;  4LFB T;  1MMA A;  4U3C A;  3EDU A;  3HL6 A;  5HWY A;  1VCT A;  5DQV A;  4PJL A;  3RIA A;  4KMC A;  4ZS3 A;  4ZZB A;  3Q2M A;  3AAE B;  2YOE A;  3E0Z A;  2P9B A;  1O3X A;  2Q9Q D;  3L3P A;  1MND A;  5AQU B;  2VVN A;  3RYF E;  2XPK A;  4TNV A;  4H9S E;  4EYU A;  1VRB A;  1N32 T;  2MAW A;  4V1A v;  1N36 T;  3QB5 A;  5JDQ A;  5JDF A;  3AA7 B;  4BA9 A;  1IJ5 A;  1ZHC A;  5FY7 A;  5L3F B;  5FYM A;  4UR9 A;  2WWV A;  4PW8 A;  3UFG A;  4JI4 T;  3P7I A;  3ANW B;  5HXH A;  4IDZ A;  2XZE A;  1UGO A;  4JI7 T;  3L39 A;  2V7L A;  4CN1 A;  2NWB A;  3HKD E;  4P0A A;  4XZC A;  3EAB A;  2XAJ B;  3MXZ A;  1XMO T;  4IE6 A;  1D1B A;  3RYC E;  2JMK A;  1E2A A;  4CI2 B;  3C64 A;  1FMV A;  1WLX A;  3AE2 A;  3AEG A;  4PK6 A;  4QH1 A;  2LHN A;  2FJE A;  2H7O A;  5AQN B;  4ASK A;  2W62 A;  3ANW A;  3E22 E;  1HNW T;  4ZI3 D;  3AEF A;  3UTK A;  2KND A;  2LM2 A;  5LGT B;  2VWA A;  4ZS2 A;  2XAS B;  5LCY A;  4HFH A;  4IL9 A;  5AQT B;  2E8I A;  4ERR A;  3RKO A;  1V9D A;  2FJA A;  4HN9 A;  3AE7 A;  4A98 A;  1HX8 A;  3C98 B;  3LFM A;  1AJ3 A;  3KIN B;  3KV9 A;  4CN6 A;  1I6Z A;  5IWA T;  4X5T A;  3ZYK A;  1HG2 A;  2CXF A;  2XQ9 A;  3CX7 B;  2JQQ A;  4YTP A;  3RHW A;  2HN2 A;  4MBQ A;  3LK2 B;  2KXP B;  3LJC A;  3NZQ A;  5AQP B;  2CMR A;  3CKD A;  4UV9 B;  4IDP A;  4NXM T;  2VKD A;  2D5U A;  2X0H A;  3FZH B;  5LJM A;  1LKX A;  5L47 A;  2J62 A;  3O1H A;  3P4P A;  4DV0 T;  4U7Y A;  3C4Z A;  2YKS A;  2JMH A;  2Y48 B;  2Q9Q B;  4QH5 A;  2N9D A;  4UEM A;  4X1I E;  5FL1 A;  4JI2 T;  4M1P A;  1N33 T;  3ZC0 A;  3EDV A;  3L09 A;  3ZMU B;  3SRZ A;  1HNZ T;  2J1D G;  4UIG A;  3MZK B;  3AA6 B;  4WZX A;  2PTF A;  5FL0 A;  4UVB B;  2V7K A;  2IC6 A;  4X65 T;  3CPZ A;  3QNU A;  3LBX A;  3FXE B;  2WMN A;  3KVB A;  2WP9 A;  4L9I A;  5C2T A;  1MIW A;  4AXP A;  4LFC T;  5IHY A;  4DMV A;  3ABV A;  4YHJ A;  1FJG T;  4HEA A;  1BR4 A;  3GMI A;  2WDR A;  3N9O A;  2HH7 A;  5L4H A;  2HHH T;  1KF6 A;  3ZEF B;  5CGM A;  2NOX A;  4IDQ A;  2Q9Q A;  3GWH A;  5L3E B;  3V5U A;  4YTM A;  4GOU A;  4CQI A;  4ZI2 D;  3N5L A;  5AQI B;  5L3B B;  1HX1 B;  1MMN A;  3AE8 A;  3UUL A;  3FBZ A;  1VCS A;  4EGW A;  3KBT A;  4U2Z A;  3EAM A;  4O4H E;  4P1N A;  5J1G A;  3AE6 A;  3N9N A;  4X66 T;  2BBJ A;  4E7S A;  3PUA A;  4B3M T;  3VKG A;  1JNZ A;  1XWM A;  3WI3 A;  2VK9 A;  2V7J A;  4CXX A;  4DV5 T;  2JPF A;  4H9O C;  2JIW A;  3HKE E;  5JDG A;  1L0V A;  2IC9 A;  5LOV E;  1ZKE A;  2JQH A;  4CXW A;  4JLE A;  5HCM A;  2VKH A;  5JTG A;  2QVA A;  2E9X D;  1VOM A;  3RIU C;  3PUQ A;  2K9A A;  2CBI A;  5F3J A;  3MAC A;  1MIY A;  2K5B B;  3KV6 A;  3JC6 C;  5H6R B;  4DR4 T;  3ZMV B;  3KV4 A;  2OLT A;  3NRX A;  3PJA J;  3MA9 A;  3ZLI A;  3ETU A;  3UFE A;  4DR5 T;  4HFV A;  3KBU A;  5C3J A;  1WRD A;  5DJQ C;  2IW5 B;  3RLF F;  4OX9 T;  4L0R A;  1XDO A;  4ZEY A;  1NAF A;  1H7C A;  4X62 T;  5C8Y E;  2X0L B;  3PE0 A;  4EXT A;  4QX7 B;  2XQ5 A;  2H89 A;  2X68 A;  3LG7 A;  2WS3 A;  3KFW X;  3JCF A;  1S35 A;  3MK7 C;  5LMN T;  5AQM B;  4LF6 T;  3P50 A;  4DUZ T;  1T98 A;  3QOF A;  2IDO B;  5HXE A;  4DBR A;  2XAG B;  4AKH A;  2XSA A;  5AQG B;  2Y6X A;  3ZT5 A;  4JI3 T;  4HGA A;  2XM2 A;  4UV8 B;  2JQ9 A;  4OFZ A;  1D0Z A;  3G06 A;  4EAH A;  2WDQ A;  3ZN0 B;  4GYS A;  2M6B A;  4ISS A;  2LSK A;  4ILB A;  2WCA A;  3ZPO A;  3Q5X A;  4PFP A;  2NW8 A;  3F2E A;  2V26 A;  4ZXL A;  1OWA A;  4DUY T;  2WU2 A;  2LE8 A;  5LYJ E;  3QUJ A;  4COF A;  1YKE B;  5JH7 E;  4EZH A;  3TLT A;  4AQF C;  4ADZ A;  2X9H A;  4IRE A;  3RKG A;  3AXJ A;  4DO0 A;  4EYY R;  4IE0 A;  2VUR A;  3UU5 A;  3VU7 H;  4K0U A;  1HFA A;  4P0B A;  4HFD A;  1J1J A;  2RA1 A;  1SHZ C;  2OA5 A;  2LKH A;  3EUH A;  3T1H T;  4TWD A;  4A97 A;  3IHR A;  3LDQ B;  2K3W A;  5HCJ A;  1NWM X;  2A9U A;  2W0G A;  5FP3 A;  1EZ3 A;  4YSZ A;  1XMQ T;  1HCI A;  4TV9 E;  3KDS E;  4IL4 A;  4LF7 T;  5CA0 E;  4HFC A;  2CWY A;  3IBP A;  4ZI7 E;  3NBX X;  2EHO C;  3O1I A;  5TAO A;  5L3G B;  3NWI A;  2CHN A;  2CRB A;  2SPC A;  3IEE A;  4HFE A;  3ZCI A;  3SWH A;  1OED E;  4MLK A;  4DV6 T;  2K24 A;  5AQR B;  2X9W A;  1HS7 A;  2FJB A;  4KBM B;  4MAL A;  5F5W A;  4HWC A;  4GIW A;  4EED A;  4EV6 A;  2E9X C;  1IBK T;  2MPK A;  3V5S A;  3EVY A;  3IA3 A;  5LA6 E;  4K0K T;  4XBF B;  5FXW A;  3ZJ1 A;  2BG9 A;  3SS1 A;  5A1L A;  5ABG A;  1E7P A;  3H37 A;  1NEN A;  2K48 A;  5HXS A;  4U72 A;  3FZF B;  4KHZ F;  4AKL A;  3RGL A;  2LM9 A;  2XHE B;  1LRZ A;  3ZMZ B;  3O9X A;  2YIN A;  2A3D A;  1BR1 A;  4TWH A;  2X0Y A;  3X1D A;  4KX6 A;  2LSY A;  3A5X A;  4MFR A;  1KNZ A;  2UU9 T;  2X67 A;  3RC8 A;  4HWI B;  4DR6 T;  3JAD A;  4A5X A;  2QRX A;  1LVK A;  5LMU T;  4B3S T;  2L3L A;  2WDV A;  3B5M A;  3SFD A;  4C91 A;  3EI0 A;  4LF8 T;  3UUM A;  1YD8 G;  4JYA T;  2PBI A; 
#chains in the Genus database with same CATH homology
 3HA4 A;  3CPZ A;  2ZMA A;  3VKH A;  5DAB A;  3LBX A;  2WBL A;  2C5K T;  3FXE B;  2WMN A;  3KVB A;  5GON E;  2ACX A;  1US7 B;  4L9I A;  4FJO A;  4DVD A;  1MIW A;  4AXP A;  2DWG A;  2CEA A;  3FXD B;  4ZI3 C;  2NTX A;  3O1J A;  5JR9 C;  3BQK A;  4AKI A;  4WBN E;  2W61 A;  3PU3 A;  1D1A A;  4AKG A;  3DTO A;  3I9W A;  5IHY A;  4EOZ B;  3PUG A;  2UXX B;  2VAS A;  2PFV A;  1YW0 A;  2XUE A;  4DMV A;  2L9Q A;  3AB3 B;  5CA1 E;  1FIO A;  4YHJ A;  4HEA A;  1BR4 A;  3JC6 D;  5LNK A;  3GMI A;  3J7Y q;  3HKC E;  2PJQ A;  3N9O A;  4ILU A;  2HH7 A;  5ETW A;  3AAI A;  3PUS A;  3AVS A;  3ZEF B;  4WW0 A;  1IJ6 A;  2NOX A;  5KX5 E;  1SA0 E;  2Q9Q A;  3GWH A;  4PAG A;  5L3E B;  5LP6 E;  3V5U A;  2LJL A;  2ZLY A;  1HF8 A;  4DBQ A;  1OXZ A;  4QXC B;  4JUY A;  5KMG P;  4GOU A;  2ZM0 A;  5EK4 A;  2E9X A;  3S4U A;  4CQI A;  4ZI2 D;  3N5L A;  4PJJ A;  5JDM A;  2KT9 A;  5L3B B;  4FI5 A;  2QGS A;  4OYJ A;  4WNK A;  3BQI A;  1MMN A;  4EB6 E;  1MMD A;  4IIJ E;  4ZOL E;  3UUL A;  3FBZ A;  4IE4 A;  2GK9 A;  3LK4 2;  5IYZ E;  3PDY A;  4Z8X A;  3KVA A;  4PJM A;  3KBT A;  4I55 E;  4F6R C;  5JRE A;  1Y64 B;  4JEU B;  4O4H E;  3BK9 A;  4QXH B;  5J1G A;  3TKL B;  3FBL A;  3RH3 A;  4I4T E;  3AAA B;  4J2C A;  3N9N A;  4QWN B;  2DNX A;  2CM0 A;  5LHI B;  2LSJ A;  3CWZ B;  3O4X E;  4IE7 A;  4E7S A;  3PUA A;  3VKG A;  5J2U E;  2HPL A;  2WSS V;  3CX8 B;  4HKA A;  3ZMT B;  4AQF A;  3WI3 A;  2VK9 A;  5FNV E;  2NTY A;  3I1A A;  2V7J A;  3OJA A;  3RC3 A;  4CXX A;  5JR9 B;  1UX4 A;  3N9P A;  3PUR A;  2JPF A;  4H9O C;  5EK3 A;  1CUN A;  3OYZ A;  4H9N C;  4O4J E;  2C5I T;  1X79 A;  4O2B E;  4O2A E;  5EZY E;  5L2L A;  3HKE E;  5JDG A;  3F31 A;  2BZB A;  2IC9 A;  1ZV4 X;  5LOV E;  3W15 B;  1ZKE A;  5DQW A;  5BMV E;  1IZN B;  2ES0 A;  4CI1 B;  4CXW A;  4JLE A;  4QKN A;  1BR2 A;  1Z0P A;  5AFU L;  4UVA B;  4WBO A;  2VKH A;  3HR0 A;  2E9X D;  2KLQ A;  1VOM A;  2A72 A;  1LVF A;  4QXB B;  4O4L E;  4AKR B;  3P8C D;  2V7M A;  5L3C B;  2CWO A;  3PUQ A;  5LJN A;  2K9A A;  4TV8 E;  2WM9 A;  3N2O A;  3ONX A;  5F3J A;  2X66 A;  3MAC A;  1FMW A;  1MIY A;  2W63 A;  2K5B B;  2LOS A;  3FHN A;  2NW7 A;  1WR6 A;  2Z6E A;  3KV6 A;  3OYX A;  3JC6 C;  5H6R B;  5LHH B;  4OHF A;  4EIW A;  5LG4 A;  1U5P A;  3IF8 B;  5EK2 A;  3ZMV B;  3KV4 A;  2N1G A;  2EHO A;  3NRX A;  4YFS A;  4IE5 A;  4ZHQ E;  3RYH E;  4CI3 B;  3MA9 A;  3ZLI A;  1KK7 A;  5F8P A;  2DCF A;  5FXV A;  4ZI2 C;  2I59 A;  2MTQ A;  3ETU A;  3UFE A;  5JR9 A;  4HFV A;  4UEL A;  3N2K E;  3KBU A;  3PU8 A;  3HI2 A;  1WRD A;  5DJQ C;  4NUU A;  3NZP A;  2IW5 B;  4DND A;  2NP9 A;  3KV5 A;  3ZC1 A;  4L0R A;  2LOP A;  5JDN A;  5FMN A;  3DJB A;  4H63 V;  1D0X A;  1NAF A;  1H7C A;  4KP3 C;  2DI4 A;  2KMF A;  2M67 A;  4EZ4 A;  2X0L B;  5C8Y E;  3PE0 A;  2RP4 A;  3MJX A;  4EXT A;  4AI6 A;  2DWK A;  3U3I A;  4X1Y E;  4QX7 B;  1D0Y A;  4GK5 E;  4GYR A;  2X68 A;  1MIV A;  2KWH A;  3LG7 A;  3I9Y A;  2LSI A;  3WAK A;  2QA7 A;  3KFW X;  3LK3 B;  3UT5 E;  4QX8 B;  1S35 A;  3MK7 C;  3RYI E;  5J2T E;  2XTL A;  2MBG A;  3RPU A;  3C50 A;  4PNI A;  2WAU A;  5HXC A;  4X1K E;  1T98 A;  4GK0 E;  2KIN B;  3T8O A;  3CML A;  2V7I A;  4JEH B;  4L5G A;  4XAX B;  3DP7 A;  3H3A A;  4AQG A;  2JRK A;  5HYA A;  5HXE A;  5E0O A;  2X9Y A;  4KUM B;  4DBR A;  2XAG B;  2CXL A;  3K8P C;  4AKH A;  3N9L A;  2Y6X A;  3K3O A;  4C90 A;  3ZN1 B;  2EHO D;  4U74 A;  4HGA A;  2A2F X;  4UV8 B;  3CQG B;  1U4Q A;  2XQY A;  4I50 E;  4OFZ A;  1D0Z A;  2KWI B;  3OKQ A;  3AA0 B;  4CZZ B;  2CA5 A;  4EAH A;  3C4X A;  3PTR B;  3ZN0 B;  1UX5 A;  2PG8 A;  1HTJ F;  2ODU A;  4GYS A;  1S94 A;  4ISS A;  3AVR A;  2LSK A;  3HKB E;  1MMA A;  3ZPO A;  3Q5X A;  4PFP A;  3EDU A;  4HE8 A;  3HL6 A;  2NW8 A;  5HWY A;  2JJ9 A;  4UF0 B;  3ESL A;  3I0Q A;  3F2E A;  2V26 A;  5DQV A;  4PJL A;  1OWA A;  3M65 A;  4KMC A;  2LE8 A;  5LYJ E;  4P09 A;  4ZS3 A;  3QUJ A;  5JRC B;  1YKE B;  3Q2M A;  3AAE B;  3E0Z A;  3N9M A;  2P9B A;  1O3X A;  2Q9Q D;  3LBX B;  4ANJ A;  4EZH A;  5JH7 E;  3B57 A;  4YJ3 E;  2V1D B;  4PFO A;  2MYS A;  1IAP A;  4AQF C;  2HPJ A;  2YU1 A;  1D1C A;  3L3P A;  1MND A;  2WMO A;  3Q5W A;  4ADZ A;  2X9H A;  2D2S A;  3RYF E;  1E1H B;  4H9S E;  4DO0 A;  2XAH B;  4EYY R;  4EYU A;  1VRB A;  2G0U A;  4IE0 A;  4V1A v;  4PJN A;  3VU7 H;  1QUU A;  5JDQ A;  4K0U A;  4I43 B;  1HFA A;  4P0B A;  4IGU A;  1MNE A;  2C5J A;  4O8S A;  5JDF A;  1FEW A;  3AA7 B;  4BA9 A;  2RA1 A;  1SHZ C;  2OA5 A;  3EUH A;  1IJ5 A;  1ZHC A;  5JVD E;  2CE7 A;  1UCU A;  5FY7 A;  5L3F B;  4TN7 B;  5FYM A;  3IHR A;  4TUY E;  4PK5 A;  4OK0 A;  4PW8 A;  3R6N A;  3N9Q A;  1NWM X;  3P7I A;  3ANW B;  3ZJ2 A;  2W0G A;  5FP3 A;  5HXH A;  3C51 A;  4IHJ E;  1EZ3 A;  3NRY A;  4UF0 A;  3U78 A;  4BAY B;  4IDZ A;  3ZYL A;  2V7L A;  1HCI A;  4PK4 A;  3GN5 B;  4TV9 E;  3J9X 1;  3KDS E;  2DHR A;  5CA0 E;  5JRC A;  4IST A;  2NWB A;  1G73 A;  2CWY A;  2VB6 A;  3HKD E;  3IBP A;  4ZI7 E;  4CXY A;  5JQG E;  3NBX X;  4P0A A;  3AA1 B;  4YJ2 E;  2EHO C;  1YKH B;  3O1I A;  4TZ4 C;  5TAO A;  5L3G B;  3GA8 A;  2B1E A;  4XZC A;  4TX5 A;  2XAJ B;  3MXZ A;  2N2N A;  4G63 A;  3CVR A;  2CLY C;  3BQL A;  4UXN B;  4N78 D;  4IE6 A;  1D1B A;  3VHL A;  3OBV E;  1YD8 G;  2D0U A;  2SPC A;  5HWX A;  5LBQ B;  3RYC E;  2JMK A;  3QK6 A;  1WYC A;  4CI2 B;  3ZMS B;  3C64 A;  2ZM8 A;  1FMV A;  2Y8D A;  3IEE A;  2UXN B;  1WLX A;  2BDE A;  3ZCI A;  2ZM2 A;  1MMG A;  3SWH A;  3I0O A;  3FB2 A;  5LHG B;  4MLK A;  4PK6 A;  3RRW A;  2WWU A;  2K24 A;  3K3Q C;  3N2G E;  2MOZ A;  2LHN A;  2XAQ B;  2X9W A;  3ZYM A;  2H7O A;  1HS7 A;  2DLR A;  4KBM B;  2YU2 A;  2YEV C;  2YK0 A;  4MAL A;  2Q9Q C;  4ASK A;  3Q9D A;  2W62 A;  3ANW A;  5HAX A;  2NW9 A;  4GIW A;  2E9X C;  3E22 E;  4ZI3 D;  4BJN A;  3UTK A;  2KND A;  3CX6 B;  2H7V C;  5LGT B;  4NUV A;  2VWA A;  3GN5 A;  4YLH A;  4ZS2 A;  3V5S A;  2H3R A;  2XAS B;  3EVY A;  2C0S A;  5LCY A;  2IAK A;  4ERR A;  2E8I A;  1HG5 A;  3RKO A;  5LA6 E;  1V9D A;  4XBF B;  4HN9 A;  2W00 A;  5FXW A;  3ZJ1 A;  5LBM A;  1HX8 A;  1WYB A;  3C98 B;  3LFM A;  3WAJ A;  3SS1 A;  5A1L A;  1AJ3 A;  5M4Y A;  3KIN B;  3H37 A;  4H9Q C;  5FY1 A;  4BJM A;  3KV9 A;  2K48 A;  5HXS A;  4U72 A;  4A56 A;  2EHO B;  5LXT E;  2LT3 A;  2D0T A;  2XAF B;  5KDM C;  4AKL A;  3ZYK A;  3MKD A;  1HG2 A;  2LM9 A;  2XHE B;  1LRZ A;  2CXF A;  3ZMZ B;  3O9X A;  3CX7 B;  2CLY B;  4QHO A;  2BVM A;  2JQQ A;  2YIN A;  4G2A A;  2A3D A;  5JDH A;  2LSG A;  3LK2 B;  4MBQ A;  4DMW A;  2KXP B;  1BR1 A;  3LJC A;  3CQX C;  3NZQ A;  1G8X A;  2VL8 A;  2CMR A;  2X51 A;  3CKD A;  4UV9 B;  2VKD A;  4B6X A;  2D5U A;  3RX6 A;  4E7Z A;  1QSD A;  3CQC B;  2LSY A;  1BR0 A;  3A5X A;  4HTE A;  3UUX B;  2VKJ A;  3E08 A;  5ADX L;  1LKX A;  5LJM A;  4OYK A;  3RRC A;  4MFR A;  2VKO A;  3O1H A;  4O4I E;  1KNZ A;  2ODV A;  3K3N A;  3C4Z A;  5FY0 A;  2X67 A;  3RC8 A;  2JMH A;  2BVL A;  2Y48 B;  2Q9Q B;  4H9R C;  3ZCJ A;  3F57 A;  2N9D A;  1ZEE A;  4UEM A;  4H63 H;  4X1I E;  2CXD A;  5JDL A;  2X9X A;  4M1P A;  2CCQ A;  2E9X B;  3QC9 A;  3ZC0 A;  3D0T A;  3EDV A;  1LVK A;  2LHR A;  3B13 A;  3L09 A;  5FXZ A;  1B7T A;  3R84 B;  3ZMU B;  2LEH A;  4H9P C;  2KZ7 B;  2L3L A;  5HXR A;  4X20 E;  3SOL A;  4UVC B;  5LGN B;  2L8K A;  5H6Q B;  2J1D G;  3SRZ A;  4UIG A;  3UUN A;  4C91 A;  3MZK B;  3AA6 B;  5L3D B;  3C4W A;  3ETV A;  5LGU B;  5FXX A;  5CB4 E;  4MHC A;  4UVB B;  3UUM A;  2V7K A;  2IC6 A;  2PBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...