5FVKA

Crystal structure of vps4-vfa1 complex from s.cerevisiae at 1.66 a resolution.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
82
structure length
82
Chain Sequence
MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
publication title Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 38
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 5fvkA00
2K3WA 2V6XA 4NIQA 4A5XA 3ZT6A 3ZT7A 2JQKA 3ZSSA 2MPKA 5CGMA 2CPTA 2JQHA 1YXRA 5LB7B 3EABA 4CN4A 4ZEYA 1WR0A 5FVLA 2LRKA 4U31A 4U7YA 4U2ZA 2WWVA 2W2UA 4P1NA 5FVKA 2V6YA 2JQ9A 3ZSTA 1WFDA 2DL1A 1WCRA 2A9UA 4U2YA 2RPAA 2CRBA 4CN1A 2WY2A 4WZXA 3K1SA 4U7IA 2XZEA 4U3CA 4U33A 4CN6A 3ZT5A 2LRLA 2V6YB 4IT4A 5CJ5A
chains in the Genus database with same CATH superfamily
4EB6E 4WBNE 2VL8A 2IC9A 4O4HE 2IW5B 2BVLA 4DR7T 1WFDA 4GKJT 3ZJ2A 5C2TA 3J7Yq 2UU9T 4Z90A 3OJAA 2QA7A 2XTLA 4AXPA 2B1EA 4JI0T 3WAKA 2UXCT 2IUBA 2X51A 4ZEYA 4YFSA 4ZOLE 4ZI2C 1QSDA 3AEGA 5LOVE 4ZZBA 4WZXA 1N32T 2X68A 1T7SA 4IDOA 5FXXA 2H89A 1HNZT 2WAUA 3OBVE 4UV9B 5HWXA 2W66A 4LMKA 4JI1T 1E1HB 4H63H 2XAQB 1WR6A 5LGNB 5DQWA 2KMFA 2JJ9A 3RHWA 5AQGB 4UR9A 3L3PA 1D1AA 3P50A 4EEBA 1OEDC 2VB6A 4QWNB 5LGUB 1IZNB 3PURA 4IREA 3AE9A 3RH3A 3C4WA 4CN6A 2CBIA 3VR8A 3HL6A 4JUYA 3UFGA 4BA9A 2Y48B 2BG9A 2D0UA 3N2OA 4YY3T 2V7MA 5FNVE 2V8SV 2MYSA 2W2UA 2PJQA 4B3RT 3CQGB 3NKZA 3C4XA 1IJ5A 3KDSE 4UF0A 2NTYA 4A5XA 2VQET 3KV6A 4GKKT 3OTOT 4ZI3D 3QB5A 1WLXA 3ANWA 2YDRA 2VKJA 2CM0A 2H3RA 4B3ST 4N78D 3VKHA 3UQ7A 1KNRA 2Q9QD 2LSJA 2I59A 5L3GB 4KX6A 4X1KE 2NWBA 3MZKB 1W0AA 2YDSA 4CN1A 4TV8E 4UELA 2A2FX 4IE6A 3AAIA 4DR5T 4HFDA 3EDVA 4HFCA 3PTRB 1J5WA 4CN4A 4EGWA 1WRDA 1T72A 2GK9A 4YTMA 2J62A 3I9WA 1UUSA 4WW0A 2QGSA 4QXCB 3N9QA 3FBZA 2K5BB 3E08A 3NZQA 2LLYA 3CX8B 4ZZCA 5L4HA 2ODVA 2WMOA 2ZMAA 1I6ZA 5HXCA 2K48A 4AKLA 3ZN1B 3KV5A 1UX4A 4DVDA 3AVSA 4QKNA 4JYAT 3LK3B 5AQKB 2X66A 5AQTB 1AJ3A 2L8KA 3JADA 2CLYB 4LMLA 1MMGA 4TNWA 5JRCA 3FZFB 3NWIA 4HKAA 4CI1B 3AA7B 3Q2MA 4YTPA 1ZP0A 1GQEA 5F8PA 3CK6A 4KHPT 4H63V 4IGUA 2XAJB 3RPUA 3ZYMA 4KUMB 2W67A 2CMRA 2WDQA 5ABHA 5AQNB 1S94A 1IBKT 4PK4A 3FZLB 2CXFA 2JQQA 3GMIA 2UXBT 3HKCE 5LBQB 2CA5A 2VVSA 2WBLA 1U5PA 4YJ2E 4DBQA 4H9PC 2XPKA 3CPZA 5LBMA 1UX5A 4TNVA 3O1JA 5JTGA 3LJCA 3A8YC 1XMOT 5M4YA 5DJQC 4UIGA 1BR2A 1VCSA 5JDGA 1LVFA 3KV9A 4TUYE 2ZM0A 4MALA 2JQHA 3GWHA 1T8BA 3HA4A 1D1BA 1B7TA 3EUHA 5CB4E 3SFEA 3VRAA 1X79A 5BMVE 1CUNA 3EAMA 4JBWF 1MIWA 5FXZA 2EHOC 5ABGA 2K9AA 3VRBA 3T1HT 5FY7A 2E5LT 2H7OA 4JI8T 3KV4A 3M3ZB 2F4VT 3UU6A 1HNWT 2V7LA 3AE2A 4U33A 1IJ6A 1HFAA 2E9XA 2V6XA 3UT5E 3CIRA 4G63A 4O4IE 1ZV4X 2ZM2A 1OEDB 4GYRA 5FXWA 4B6XA 4QX8B 2N9DA 2WY2A 5JDFA 5HCJA 2SPCA 3MK7C 2Y8DA 5LP6E 4ASKA 4KMCA 3DP7A 2BBHA 4JI5T 1LRZA 4ILCA 4C91A 1UK5A 3IA3A 1HX1B 5JDQA 2W4XA 3JAFA 4JV5T 3ZMTB 3PU8A 2LEHA 5AQJB 3UUXB 3C98B 2WB5A 3AXJA 4GIWA 3ONXA 4LF8T 3AEFA 1YKHB 2XJ7A 3HKBE 4PW8A 4DUZT 4OX9T 3AEAA 3C4ZA 1KK7A 1MMDA 3AA6B 2XM1A 3U3IA 5F3JA 2JIWA 1BR4A 5JDLA 3O9XA 2LSGA 3OVUA 5LG4A 4LMJA 1JNRA 3GN5A 3RX6A 4HFBA 1Z0PA 5JR9C 2AXDS 2XSAA 3MKDA 2V6YA 3ZPOA 4HWDA 3SWHA 3ZCJA 2BS2A 3Q9DA 4DV1T 2NW9A 4UVAB 5BR8T 2JRKA 1XNQT 1NWMX 1M62A 3RRWA 4OHFA 4PFOA 3LSVA 2H7VC 1U4QA 1FMVA 1Y01A 3UU5A 4YSYA 4ISSA 1KFYA 4XAXB 3JCFA 3AE8A 1XZYA 2YKSA 3LDQB 3A5XA 3VR9A 1M7KA 3QNUA 3S4UA 3MJXA 1YKEB 3QUJA 2MAWA 4BJMA 2WU5A 2D2SA 3PJAJ 4CI2B 2LE8A 4IT4A 5FKYA 5FYMA 3TLSA 2RP4A 3N9NA 4HGAA 1SUMB 2KXPB 3LBXA 3Q5WA 2KWHA 2E8IA 4PNIA 2VASA 4OK0A 4DR2T 4WBOA 5FY0A 3UULA 4X66T 3ZSSA 2XASB 4J2CA 2XQ5A 4ZHQE 2Q9QC 2I6HA 5JQGE 4C90A 2LM2A 2Z6EA 1KEYA 3T1YT 4WNKA 3SFDA 1DU2A 4TWDA 5LA6E 1KNPA 3RYCE 4TWFA 2E9XC 2LOPA 4UVCB 4YHHT 2WQYA 3RF1A 3PUSA 4BAYB 2K24A 2XQYA 3KINB 5JVDE 4BJNA 5L47A 5HCMA 3O1IA 2VK9A 3CKDA 4PK6A 3PJAA 5JH7E 2W00A 2A9UA 4DV4T 2CEAA 5J2UE 3ZJ1A 4DIDB 2V26A 5EK2A 5LYJE 4HEAA 4YT0A 2ZM8A 3WAJA 4L9IA 5KXJA 2FUPA 2LM9A 3N9PA 1MMAA 2BG9B 3KBTA 3PE0A 1NAFA 5EK3A 1W09A 2KINB 4QHOA 4NXNT 5LHIB 1FMWA 3PUVF 4HFHA 4UF0B 1YW0A 2LOSA 2WWVA 4V1Av 3FBLA 3I0QA 4KP3C 3UU8A 4IL9A 3K8PC 2YU1A 3ZYKA 4EOZB 2CRBA 2FJAA 3RQWA 3I0OA 2PFVA 5GONE 3IBPA 3ANWB 3E0ZA 3QOFA 1HNXT 4LFCT 3AE5A 1XDOA 5FP3A 2PBIA 1WR0A 2HPLA 2JQ9A 2HH7A 2XQ8A 2PG8A 5LMUT 4LF6T 2IHR1 3NVOA 2V1DB 2XQ9A 2HN2A 4KBMB 5AQHB 2YDQA 2BG9E 2XM2A 4H9NC 2EHOA 2KZ7B 2XUEA 3ZMVB 5ABFA 5FVKA 3ZMUB 5AQLB 1HTJF 2V7IA 1LKXA 2WSSV 3AAEB 3K3QC 2L3LA 4H9QC 3ZCIA 3V5UA 4IDPA 1BR1A 4O2AE 3PUYF 1ZKEA 5JDNA 5J0ZA 3PUAA 3PUWF 2HHHT 2A72A 2E2AA 4JI7T 3WI3A 3I9YA 2BS4A 1W9RA 3RGLA 1Y64B 3OKQA 4LF5T 4AKIA 2JQKA 4DBRA 4Q25A 3ZLIA 3L39A 4DR6T 1XNRT 3P4QA 5IWAT 2OV9A 4LF9T 5JRCB 4U7IA 1SA0E 3LK2B 1IBLT 3RLFF 2BKPA 1SHZC 3CQCB 5LB7B 1MNEA 4B3MT 3AAAB 3P4PA 3RIFA 3AVRA 2VWAA 2J47A 4YJ3E 1Z8UA 2YOEA 2AE9A 4QXHB 3TLVA 2UXNB 3C51A 5HEGA 4AQGA 4EZ4A 3W15B 5FVLA 2BZBA 2KWIB 3AECA 2HN1A 3F2EA 5LHGB 1IBMT 2XSBA 5JR9A 3VHLA 4EYUA 5F5WA 4HWHA 2BKOA 4IDNA 4ILUA 2WMNA 2UUCT 4ZI7E 3ESLA 2QVAA 3AE4A 2RA1A 5L2LA 4PAGA 5IYZE 5LG3A 2W63A 2CHNA 3LG7A 3A7MA 3X1DA 2DWGA 3RYFE 2FJEA 2WDRA 4L5GA 5LNKA 3N5LA 5AQRB 3JC6C 2C5JA 3K3NA 5ADXL 1HG5A 3UU4A 1OWAA 3BQIA 3P4SA 4QH1A 3B5MA 4TZ4C 4X1YE 2M6BA 3AE7A 2VURA 2KT9A 4HWFA 4X64T 3CWZB 2DCFA 1NEKA 4CXXA 4ADZA 2BBJA 4DR1T 3OYXA 3ZT7A 3U78A 5CGMA 2VVNA 3RQUA 5EK4A 3PUXF 3KFWX 3KBUA 2E9XB 3MXZA 1I94T 2UUBT 4I55E 4LF7T 3C50A 5H6RB 2RPAA 2QYWA 4Z8XA 2N1GA 1US7B 2XHEB 3B13A 1HS7A 3RKOA 3ETUA 3C64A 5AQSB 2NW8A 2C5KT 3R84B 4IE5A 5FL1A 5AQQB 5CFBA 2Q9QA 1IAPA 1KNZA 4DNDA 5CA1E 2X0LB 2XQ4A 4ZS2A 2N2NA 3ZN0B 3N2KE 3PUZF 3UUMA 4LF4T 2WM9A 2VQFT 1X9BA 4HN9A 5AQFB 3AXJB 3ABVA 4E7SA 5L4EA 4COFA 2IDOB 3V5SA 4GOUA 4I4TE 4YXDA 5AQVB 4AKGA 4X62T 3PUGA 1N33T 4IDQA 2YEVC 5C8YE 4GK0E 5LXTE 1LVKA 1YQ4A 4QH5A 3AEEA 4A97A 4TV9E 2B76A 2ES0A 3GN5B 5FL0A 3FHNA 2YINA 3RYHE 3FXDB 1VOMA 3NBXX 2QRXA 4IL4A 3ZYLA 5AQIB 2V6YB 3MACA 4LFBT 2BKNA 2WU2A 5KDMC 4CXWA 5LJMA 5L3EB 2LRKA 5JDMA 3Q5DA 4DV7T 1N34T 4PJMA 5TAOA 1HR0T 4PK5A 4YLHA 2WZIA 2YU2A 1OEDE 3CX6B 4X65T 4I50E 4AKHA 5FY1A 4EV6A 2DWKA 2BDEA 5HEHA 1HF8A 4MFRA 4JI2T 2XAGB 4JI3T 3KVAA 4AQYT 2M67A 3CMLA 1WYBA 4DV6T 4H9OC 4GYSA 3Q5XA 2X9HA 3RKGA 4YSZA 1KF6A 2WP9A 4UVBB 3J9X1 4JI4T 2VKDA 3SOLA 3F57A 3L8RA 1BR0A 3LBXB 2LRLA 5LGTB 2V5CA 4ZS3A 2C5IT 2CPTA 2ZM6T 1J5ET 3I1AA 4IIJE 4CI3B 2XQ7A 1MMNA 4I43B 2J1DG 2W0GA 4PFPA 4EYYR 4O2BE 4TN7B 1ZOYA 4DO0A 3H3AA 4MLKA 2YN6A 3ZT6A 4IE0A 4PJJA 2CE7A 5FXVA 4U31A 4U74A 2JPFA 4HWCA 4E7ZA 1VCTA 3TKLB 4A98A 2G0UA 4ZI3C 1UCUA 3AEBA 2MTQA 2JMHA 3H37A 3H3MA 4ANJA 2Y6XA 2LKHA 4LFAT 3MA9A 3RRCA 1HX8A 2UXXB 5L3BB 1NENA 4DV3T 5KMGP 4P1NA 2R6GF 3TLTA 2X9XA 1L0VA 5C3JA 3SS1A 5HEJA 3ZT5A 4OFZA 2XQ3A 5AQOB 3AE6A 4AQFC 5AQUB 4EXTA 3ZKRA 3P7IA 1D0XA 2KLQA 2UUAT 2IMLA 2A3DA 2LKGA 4HWIB 3B57A 2D0TA 5LCYA 4K0UA 5HYAA 3SRZA 2L9QA 4ILBA 1R8IA 3VU7H 3O4XE 4O8SA 4PJLA 3D0TA 4ISTA 1QUUA 5HXHA 4HFIA 4AIUA 2XAHB 4EZHA 3AB3B 5HEOA 2K3WA 4NIQA 2PTFA 5HXSA 3JAEA 3OPCA 1ZHCA 1YQ3A 2W62A 4PJNA 2CWOA 1UURA 2ACZA 4KHZF 1W0BA 2EHOB 1FIOA 3P8CD 3ZC0A 4U3CA 5ABFB 4P09A 2LSIA 2CBJA 2NW7A 3UUNA 2X0YA 4NUUA 2NOXA 1O3XA 1J1JA 3ZC1A 3ZSTA 2V7JA 4FJOA 1N36T 2LHNA 3TLWA 3UU3A 3EVYA 1QLBA 2P9BA 1JNZA 4U7YA 2H88A 2E5VA 2HPJA 2JMKA 3RC8A 4IHJE 2KNDA 3QK6A 5LMNT 3BQLA 3QC9A 3FZHB 2M6IA 4NUVA 2CCQA 2DL1A 2XQAA 2WS3A 4DV5T 3HR0A 5HEUA 4DV2T 4EIWA 4ZI2D 3T8OA 1XDPA 2MBGA 4DMVA 3ZMSB 4JI6T 2VL0A 2X67A 5ETWA 1XMQT 3NRXA 2E9XD 1UGOA 2BVMA 4DR4T 4H9SE 1T98A 2V5DA 5JR9B 1FEWA 5AFUL 1H7CA 2FBWA 3IEEA 2MOZA 3PU3A 1D0YA 2XY8B 3AEDA 5JDHA 4HE8A 5DQVA 2LSYA 4A56A 4AISA 2VKHA 4JEUB 2WCAA 2NTXA 3FXEB 4IE7A 5LHHB 5AQPB 4DMWA 2LSKA 2D9DA 2X9YA 2BS3A 2ODUA 4MBQA 2DI4A 3DJBA 3VKGA 3E22E 4MHCA 1G73A 3KVBA 3Q5EA 5L3DB 2J4GA 3O1HA 3TLUA 3UUBA 4U2ZA 5CA0E 2D5UA 4QX7B 5HXEA 5J1GA 3RIUA 3EDUA 1WYCA 5CJ5A 2NP9A 3M65A 5H6QB 3GA8A 4CXYA 2WDVA 3P4WA 3NZPA 2OLTA 4HFVA 3N9LA 3R6NA 4X5TA 2C0SA 1HCIA 2X0HA 3P4RA 1XWMA 1MIYA 4NPPA 5HAXA 2Q9QB 4ZXLA 2WWUA 3EHZA 3ZMZB 4ILAA 5IHYA 1E2AA 3LK42 4P0BA 3IF8B 5JREA 4YTNA 1WCRA 3UQ4A 3PUQA 3IHRA 4AKRB 4K0KT 2BG9C 3UFEA 4CQIA 5DABA 3PV0F 2I0MA 1HG2A 3CVRA 1D0ZA 4IE4A 1MNDA 2XQ6A 2CXLA 3FB2A 3K1SA 3NRYA 1MIVA 4Z91A 5FMNA 2DHRA 1S35A 4M1PA 4U72A 4X20E 3AA1B 1EZ3A 4AQFA 4I0UA 3BQKA 3CX7B 2CHOA 3N9MA 3ONLC 2OA5A 2XAFB 1ZEEA 3F31A 1G8XA 2IAKA 4H9RC 4O4LE 2LT3A 4X1IE 5AQMB 1CHUA 3CQXC 4QH4A 4DR3T 3DTOA 4UXNB 2DNXA 4YSXA 4HTEA 1E7PA 4JEHB 3AE1A 2UXDT 2IC6A 5J2TE 4XZCA 3PDYA 2XZEA 2IIUA 4O4JE 1V9DA 1OEDA 3ETVA 2V7KA 4GK5E 1YD8G 4ERRA 2X9WA 4OYKA 4G2AA 4B3TT 3RC3A 4QXBB 3RI5A 1OXZA 2CXDA 2LJLA 3JC6D 4P0AA 1FJGT 4DV0T 3G06A 3HKDE 4UV8B 3HKEE 3QB5K 4L0RA 3FZKB 4XBFB 5LJNA 4NXMT 1YXRA 3EABA 4KI0F 4FI5A 5EZYE 2ACXA 3RIUC 3ONJA 3N2GE 4EAHA 3ZEFB 4TWHA 4IDZA 2LHRA 3L09A 3HI2A 4F6RC 2FJDA 4OYJA 3BK9A 4AI6A 2KSRA 5HXRA 3OYZA 3UTKA 3RYIE 2W61A 5L3CB 3K3OA 4YHJA 5E0OA 4F8HA 2EHOD 1VRBA 4TX5A 2CLYC 3AE3A 4UEMA 1D1CA 3FZMB 2WZHA 5ABEA 1SE7A 4HFEA 2ZLYA 5IUXA 2MPKA 4CZZB 2CWYA 3AA0B 2FJBA 3LFMA 3RIAA 5L3FB 4WYVA 5KX5E 4DUYT 2DLRA 3N9OA 4EEDA 2NR4A 3EI0A 4U2YA 2VKOA 5A1LA 2YK0A 4JLEA 5HWYA
chains in the Genus database with same CATH topology
2K3WA 2V6XA 4NIQA 4A5XA 3ZT6A 3ZT7A 2JQKA 3ZSSA 2MPKA 5CGMA 2CPTA 2JQHA 1YXRA 5LB7B 3EABA 4CN4A 4ZEYA 1WR0A 5FVLA 2LRKA 4U31A 4U7YA 4U2ZA 2WWVA 2W2UA 4P1NA 5FVKA 2V6YA 2JQ9A 3ZSTA 1WFDA 2DL1A 1WCRA 2A9UA 4U2YA 2RPAA 2CRBA 4CN1A 2WY2A 4WZXA 3K1SA 4U7IA 2XZEA 4U3CA 4U33A 4CN6A 3ZT5A 2LRLA 2V6YB 4IT4A 5CJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3W A;  2V6X A;  4NIQ A;  4A5X A;  3ZT6 A;  3ZT7 A;  2JQK A;  3ZSS A;  2MPK A;  5CGM A;  2CPT A;  2JQH A;  1YXR A;  5LB7 B;  3EAB A;  4CN4 A;  4ZEY A;  1WR0 A;  5FVL A;  2LRK A;  4U31 A;  4U7Y A;  4U2Z A;  2WWV A;  2W2U A;  4P1N A;  5FVK A;  2V6Y A;  2JQ9 A;  3ZST A;  1WFD A;  2DL1 A;  1WCR A;  2A9U A;  4U2Y A;  2RPA A;  2CRB A;  4CN1 A;  2WY2 A;  4WZX A;  3K1S A;  4U7I A;  2XZE A;  4U3C A;  4U33 A;  4CN6 A;  3ZT5 A;  2LRL A;  2V6Y B;  4IT4 A;  5CJ5 A; 
#chains in the Genus database with same CATH topology
 4EB6 E;  4WBN E;  2VL8 A;  2IC9 A;  4O4H E;  2IW5 B;  2BVL A;  4DR7 T;  1WFD A;  4GKJ T;  3ZJ2 A;  5C2T A;  3J7Y q;  2UU9 T;  4Z90 A;  3OJA A;  2QA7 A;  2XTL A;  4AXP A;  2B1E A;  4JI0 T;  3WAK A;  2UXC T;  2IUB A;  2X51 A;  4ZEY A;  4YFS A;  4ZOL E;  4ZI2 C;  1QSD A;  3AEG A;  5LOV E;  4ZZB A;  4WZX A;  1N32 T;  2X68 A;  1T7S A;  4IDO A;  5FXX A;  2H89 A;  1HNZ T;  2WAU A;  3OBV E;  4UV9 B;  5HWX A;  2W66 A;  4LMK A;  4JI1 T;  1E1H B;  4H63 H;  2XAQ B;  1WR6 A;  5LGN B;  5DQW A;  2KMF A;  2JJ9 A;  3RHW A;  5AQG B;  4UR9 A;  3L3P A;  1D1A A;  3P50 A;  4EEB A;  1OED C;  2VB6 A;  4QWN B;  5LGU B;  1IZN B;  3PUR A;  4IRE A;  3AE9 A;  3RH3 A;  3C4W A;  4CN6 A;  2CBI A;  3VR8 A;  3HL6 A;  4JUY A;  3UFG A;  4BA9 A;  2Y48 B;  2BG9 A;  2D0U A;  3N2O A;  4YY3 T;  2V7M A;  5FNV E;  2V8S V;  2MYS A;  2W2U A;  2PJQ A;  4B3R T;  3CQG B;  3NKZ A;  3C4X A;  1IJ5 A;  3KDS E;  4UF0 A;  2NTY A;  4A5X A;  2VQE T;  3KV6 A;  4GKK T;  3OTO T;  4ZI3 D;  3QB5 A;  1WLX A;  3ANW A;  2YDR A;  2VKJ A;  2CM0 A;  2H3R A;  4B3S T;  4N78 D;  3VKH A;  3UQ7 A;  1KNR A;  2Q9Q D;  2LSJ A;  2I59 A;  5L3G B;  4KX6 A;  4X1K E;  2NWB A;  3MZK B;  1W0A A;  2YDS A;  4CN1 A;  4TV8 E;  4UEL A;  2A2F X;  4IE6 A;  3AAI A;  4DR5 T;  4HFD A;  3EDV A;  4HFC A;  3PTR B;  1J5W A;  4CN4 A;  4EGW A;  1WRD A;  1T72 A;  2GK9 A;  4YTM A;  2J62 A;  3I9W A;  1UUS A;  4WW0 A;  2QGS A;  4QXC B;  3N9Q A;  3FBZ A;  2K5B B;  3E08 A;  3NZQ A;  2LLY A;  3CX8 B;  4ZZC A;  5L4H A;  2ODV A;  2WMO A;  2ZMA A;  1I6Z A;  5HXC A;  2K48 A;  4AKL A;  3ZN1 B;  3KV5 A;  1UX4 A;  4DVD A;  3AVS A;  4QKN A;  4JYA T;  3LK3 B;  5AQK B;  2X66 A;  5AQT B;  1AJ3 A;  2L8K A;  3JAD A;  2CLY B;  4LML A;  1MMG A;  4TNW A;  5JRC A;  3FZF B;  3NWI A;  4HKA A;  4CI1 B;  3AA7 B;  3Q2M A;  4YTP A;  1ZP0 A;  1GQE A;  5F8P A;  3CK6 A;  4KHP T;  4H63 V;  4IGU A;  2XAJ B;  3RPU A;  3ZYM A;  4KUM B;  2W67 A;  2CMR A;  2WDQ A;  5ABH A;  5AQN B;  1S94 A;  1IBK T;  4PK4 A;  3FZL B;  2CXF A;  2JQQ A;  3GMI A;  2UXB T;  3HKC E;  5LBQ B;  2CA5 A;  2VVS A;  2WBL A;  1U5P A;  4YJ2 E;  4DBQ A;  4H9P C;  2XPK A;  3CPZ A;  5LBM A;  1UX5 A;  4TNV A;  3O1J A;  5JTG A;  3LJC A;  3A8Y C;  1XMO T;  5M4Y A;  5DJQ C;  4UIG A;  1BR2 A;  1VCS A;  5JDG A;  1LVF A;  3KV9 A;  4TUY E;  2ZM0 A;  4MAL A;  2JQH A;  3GWH A;  1T8B A;  3HA4 A;  1D1B A;  1B7T A;  3EUH A;  5CB4 E;  3SFE A;  3VRA A;  1X79 A;  5BMV E;  1CUN A;  3EAM A;  4JBW F;  1MIW A;  5FXZ A;  2EHO C;  5ABG A;  2K9A A;  3VRB A;  3T1H T;  5FY7 A;  2E5L T;  2H7O A;  4JI8 T;  3KV4 A;  3M3Z B;  2F4V T;  3UU6 A;  1HNW T;  2V7L A;  3AE2 A;  4U33 A;  1IJ6 A;  1HFA A;  2E9X A;  2V6X A;  3UT5 E;  3CIR A;  4G63 A;  4O4I E;  1ZV4 X;  2ZM2 A;  1OED B;  4GYR A;  5FXW A;  4B6X A;  4QX8 B;  2N9D A;  2WY2 A;  5JDF A;  5HCJ A;  2SPC A;  3MK7 C;  2Y8D A;  5LP6 E;  4ASK A;  4KMC A;  3DP7 A;  2BBH A;  4JI5 T;  1LRZ A;  4ILC A;  4C91 A;  1UK5 A;  3IA3 A;  1HX1 B;  5JDQ A;  2W4X A;  3JAF A;  4JV5 T;  3ZMT B;  3PU8 A;  2LEH A;  5AQJ B;  3UUX B;  3C98 B;  2WB5 A;  3AXJ A;  4GIW A;  3ONX A;  4LF8 T;  3AEF A;  1YKH B;  2XJ7 A;  3HKB E;  4PW8 A;  4DUZ T;  4OX9 T;  3AEA A;  3C4Z A;  1KK7 A;  1MMD A;  3AA6 B;  2XM1 A;  3U3I A;  5F3J A;  2JIW A;  1BR4 A;  5JDL A;  3O9X A;  2LSG A;  3OVU A;  5LG4 A;  4LMJ A;  1JNR A;  3GN5 A;  3RX6 A;  4HFB A;  1Z0P A;  5JR9 C;  2AXD S;  2XSA A;  3MKD A;  2V6Y A;  3ZPO A;  4HWD A;  3SWH A;  3ZCJ A;  2BS2 A;  3Q9D A;  4DV1 T;  2NW9 A;  4UVA B;  5BR8 T;  2JRK A;  1XNQ T;  1NWM X;  1M62 A;  3RRW A;  4OHF A;  4PFO A;  3LSV A;  2H7V C;  1U4Q A;  1FMV A;  1Y01 A;  3UU5 A;  4YSY A;  4ISS A;  1KFY A;  4XAX B;  3JCF A;  3AE8 A;  1XZY A;  2YKS A;  3LDQ B;  3A5X A;  3VR9 A;  1M7K A;  3QNU A;  3S4U A;  3MJX A;  1YKE B;  3QUJ A;  2MAW A;  4BJM A;  2WU5 A;  2D2S A;  3PJA J;  4CI2 B;  2LE8 A;  4IT4 A;  5FKY A;  5FYM A;  3TLS A;  2RP4 A;  3N9N A;  4HGA A;  1SUM B;  2KXP B;  3LBX A;  3Q5W A;  2KWH A;  2E8I A;  4PNI A;  2VAS A;  4OK0 A;  4DR2 T;  4WBO A;  5FY0 A;  3UUL A;  4X66 T;  3ZSS A;  2XAS B;  4J2C A;  2XQ5 A;  4ZHQ E;  2Q9Q C;  2I6H A;  5JQG E;  4C90 A;  2LM2 A;  2Z6E A;  1KEY A;  3T1Y T;  4WNK A;  3SFD A;  1DU2 A;  4TWD A;  5LA6 E;  1KNP A;  3RYC E;  4TWF A;  2E9X C;  2LOP A;  4UVC B;  4YHH T;  2WQY A;  3RF1 A;  3PUS A;  4BAY B;  2K24 A;  2XQY A;  3KIN B;  5JVD E;  4BJN A;  5L47 A;  5HCM A;  3O1I A;  2VK9 A;  3CKD A;  4PK6 A;  3PJA A;  5JH7 E;  2W00 A;  2A9U A;  4DV4 T;  2CEA A;  5J2U E;  3ZJ1 A;  4DID B;  2V26 A;  5EK2 A;  5LYJ E;  4HEA A;  4YT0 A;  2ZM8 A;  3WAJ A;  4L9I A;  5KXJ A;  2FUP A;  2LM9 A;  3N9P A;  1MMA A;  2BG9 B;  3KBT A;  3PE0 A;  1NAF A;  5EK3 A;  1W09 A;  2KIN B;  4QHO A;  4NXN T;  5LHI B;  1FMW A;  3PUV F;  4HFH A;  4UF0 B;  1YW0 A;  2LOS A;  2WWV A;  4V1A v;  3FBL A;  3I0Q A;  4KP3 C;  3UU8 A;  4IL9 A;  3K8P C;  2YU1 A;  3ZYK A;  4EOZ B;  2CRB A;  2FJA A;  3RQW A;  3I0O A;  2PFV A;  5GON E;  3IBP A;  3ANW B;  3E0Z A;  3QOF A;  1HNX T;  4LFC T;  3AE5 A;  1XDO A;  5FP3 A;  2PBI A;  1WR0 A;  2HPL A;  2JQ9 A;  2HH7 A;  2XQ8 A;  2PG8 A;  5LMU T;  4LF6 T;  2IHR 1;  3NVO A;  2V1D B;  2XQ9 A;  2HN2 A;  4KBM B;  5AQH B;  2YDQ A;  2BG9 E;  2XM2 A;  4H9N C;  2EHO A;  2KZ7 B;  2XUE A;  3ZMV B;  5ABF A;  5FVK A;  3ZMU B;  5AQL B;  1HTJ F;  2V7I A;  1LKX A;  2WSS V;  3AAE B;  3K3Q C;  2L3L A;  4H9Q C;  3ZCI A;  3V5U A;  4IDP A;  1BR1 A;  4O2A E;  3PUY F;  1ZKE A;  5JDN A;  5J0Z A;  3PUA A;  3PUW F;  2HHH T;  2A72 A;  2E2A A;  4JI7 T;  3WI3 A;  3I9Y A;  2BS4 A;  1W9R A;  3RGL A;  1Y64 B;  3OKQ A;  4LF5 T;  4AKI A;  2JQK A;  4DBR A;  4Q25 A;  3ZLI A;  3L39 A;  4DR6 T;  1XNR T;  3P4Q A;  5IWA T;  2OV9 A;  4LF9 T;  5JRC B;  4U7I A;  1SA0 E;  3LK2 B;  1IBL T;  3RLF F;  2BKP A;  1SHZ C;  3CQC B;  5LB7 B;  1MNE A;  4B3M T;  3AAA B;  3P4P A;  3RIF A;  3AVR A;  2VWA A;  2J47 A;  4YJ3 E;  1Z8U A;  2YOE A;  2AE9 A;  4QXH B;  3TLV A;  2UXN B;  3C51 A;  5HEG A;  4AQG A;  4EZ4 A;  3W15 B;  5FVL A;  2BZB A;  2KWI B;  3AEC A;  2HN1 A;  3F2E A;  5LHG B;  1IBM T;  2XSB A;  5JR9 A;  3VHL A;  4EYU A;  5F5W A;  4HWH A;  2BKO A;  4IDN A;  4ILU A;  2WMN A;  2UUC T;  4ZI7 E;  3ESL A;  2QVA A;  3AE4 A;  2RA1 A;  5L2L A;  4PAG A;  5IYZ E;  5LG3 A;  2W63 A;  2CHN A;  3LG7 A;  3A7M A;  3X1D A;  2DWG A;  3RYF E;  2FJE A;  2WDR A;  4L5G A;  5LNK A;  3N5L A;  5AQR B;  3JC6 C;  2C5J A;  3K3N A;  5ADX L;  1HG5 A;  3UU4 A;  1OWA A;  3BQI A;  3P4S A;  4QH1 A;  3B5M A;  4TZ4 C;  4X1Y E;  2M6B A;  3AE7 A;  2VUR A;  2KT9 A;  4HWF A;  4X64 T;  3CWZ B;  2DCF A;  1NEK A;  4CXX A;  4ADZ A;  2BBJ A;  4DR1 T;  3OYX A;  3ZT7 A;  3U78 A;  5CGM A;  2VVN A;  3RQU A;  5EK4 A;  3PUX F;  3KFW X;  3KBU A;  2E9X B;  3MXZ A;  1I94 T;  2UUB T;  4I55 E;  4LF7 T;  3C50 A;  5H6R B;  2RPA A;  2QYW A;  4Z8X A;  2N1G A;  1US7 B;  2XHE B;  3B13 A;  1HS7 A;  3RKO A;  3ETU A;  3C64 A;  5AQS B;  2NW8 A;  2C5K T;  3R84 B;  4IE5 A;  5FL1 A;  5AQQ B;  5CFB A;  2Q9Q A;  1IAP A;  1KNZ A;  4DND A;  5CA1 E;  2X0L B;  2XQ4 A;  4ZS2 A;  2N2N A;  3ZN0 B;  3N2K E;  3PUZ F;  3UUM A;  4LF4 T;  2WM9 A;  2VQF T;  1X9B A;  4HN9 A;  5AQF B;  3AXJ B;  3ABV A;  4E7S A;  5L4E A;  4COF A;  2IDO B;  3V5S A;  4GOU A;  4I4T E;  4YXD A;  5AQV B;  4AKG A;  4X62 T;  3PUG A;  1N33 T;  4IDQ A;  2YEV C;  5C8Y E;  4GK0 E;  5LXT E;  1LVK A;  1YQ4 A;  4QH5 A;  3AEE A;  4A97 A;  4TV9 E;  2B76 A;  2ES0 A;  3GN5 B;  5FL0 A;  3FHN A;  2YIN A;  3RYH E;  3FXD B;  1VOM A;  3NBX X;  2QRX A;  4IL4 A;  3ZYL A;  5AQI B;  2V6Y B;  3MAC A;  4LFB T;  2BKN A;  2WU2 A;  5KDM C;  4CXW A;  5LJM A;  5L3E B;  2LRK A;  5JDM A;  3Q5D A;  4DV7 T;  1N34 T;  4PJM A;  5TAO A;  1HR0 T;  4PK5 A;  4YLH A;  2WZI A;  2YU2 A;  1OED E;  3CX6 B;  4X65 T;  4I50 E;  4AKH A;  5FY1 A;  4EV6 A;  2DWK A;  2BDE A;  5HEH A;  1HF8 A;  4MFR A;  4JI2 T;  2XAG B;  4JI3 T;  3KVA A;  4AQY T;  2M67 A;  3CML A;  1WYB A;  4DV6 T;  4H9O C;  4GYS A;  3Q5X A;  2X9H A;  3RKG A;  4YSZ A;  1KF6 A;  2WP9 A;  4UVB B;  3J9X 1;  4JI4 T;  2VKD A;  3SOL A;  3F57 A;  3L8R A;  1BR0 A;  3LBX B;  2LRL A;  5LGT B;  2V5C A;  4ZS3 A;  2C5I T;  2CPT A;  2ZM6 T;  1J5E T;  3I1A A;  4IIJ E;  4CI3 B;  2XQ7 A;  1MMN A;  4I43 B;  2J1D G;  2W0G A;  4PFP A;  4EYY R;  4O2B E;  4TN7 B;  1ZOY A;  4DO0 A;  3H3A A;  4MLK A;  2YN6 A;  3ZT6 A;  4IE0 A;  4PJJ A;  2CE7 A;  5FXV A;  4U31 A;  4U74 A;  2JPF A;  4HWC A;  4E7Z A;  1VCT A;  3TKL B;  4A98 A;  2G0U A;  4ZI3 C;  1UCU A;  3AEB A;  2MTQ A;  2JMH A;  3H37 A;  3H3M A;  4ANJ A;  2Y6X A;  2LKH A;  4LFA T;  3MA9 A;  3RRC A;  1HX8 A;  2UXX B;  5L3B B;  1NEN A;  4DV3 T;  5KMG P;  4P1N A;  2R6G F;  3TLT A;  2X9X A;  1L0V A;  5C3J A;  3SS1 A;  5HEJ A;  3ZT5 A;  4OFZ A;  2XQ3 A;  5AQO B;  3AE6 A;  4AQF C;  5AQU B;  4EXT A;  3ZKR A;  3P7I A;  1D0X A;  2KLQ A;  2UUA T;  2IML A;  2A3D A;  2LKG A;  4HWI B;  3B57 A;  2D0T A;  5LCY A;  4K0U A;  5HYA A;  3SRZ A;  2L9Q A;  4ILB A;  1R8I A;  3VU7 H;  3O4X E;  4O8S A;  4PJL A;  3D0T A;  4IST A;  1QUU A;  5HXH A;  4HFI A;  4AIU A;  2XAH B;  4EZH A;  3AB3 B;  5HEO A;  2K3W A;  4NIQ A;  2PTF A;  5HXS A;  3JAE A;  3OPC A;  1ZHC A;  1YQ3 A;  2W62 A;  4PJN A;  2CWO A;  1UUR A;  2ACZ A;  4KHZ F;  1W0B A;  2EHO B;  1FIO A;  3P8C D;  3ZC0 A;  4U3C A;  5ABF B;  4P09 A;  2LSI A;  2CBJ A;  2NW7 A;  3UUN A;  2X0Y A;  4NUU A;  2NOX A;  1O3X A;  1J1J A;  3ZC1 A;  3ZST A;  2V7J A;  4FJO A;  1N36 T;  2LHN A;  3TLW A;  3UU3 A;  3EVY A;  1QLB A;  2P9B A;  1JNZ A;  4U7Y A;  2H88 A;  2E5V A;  2HPJ A;  2JMK A;  3RC8 A;  4IHJ E;  2KND A;  3QK6 A;  5LMN T;  3BQL A;  3QC9 A;  3FZH B;  2M6I A;  4NUV A;  2CCQ A;  2DL1 A;  2XQA A;  2WS3 A;  4DV5 T;  3HR0 A;  5HEU A;  4DV2 T;  4EIW A;  4ZI2 D;  3T8O A;  1XDP A;  2MBG A;  4DMV A;  3ZMS B;  4JI6 T;  2VL0 A;  2X67 A;  5ETW A;  1XMQ T;  3NRX A;  2E9X D;  1UGO A;  2BVM A;  4DR4 T;  4H9S E;  1T98 A;  2V5D A;  5JR9 B;  1FEW A;  5AFU L;  1H7C A;  2FBW A;  3IEE A;  2MOZ A;  3PU3 A;  1D0Y A;  2XY8 B;  3AED A;  5JDH A;  4HE8 A;  5DQV A;  2LSY A;  4A56 A;  4AIS A;  2VKH A;  4JEU B;  2WCA A;  2NTX A;  3FXE B;  4IE7 A;  5LHH B;  5AQP B;  4DMW A;  2LSK A;  2D9D A;  2X9Y A;  2BS3 A;  2ODU A;  4MBQ A;  2DI4 A;  3DJB A;  3VKG A;  3E22 E;  4MHC A;  1G73 A;  3KVB A;  3Q5E A;  5L3D B;  2J4G A;  3O1H A;  3TLU A;  3UUB A;  4U2Z A;  5CA0 E;  2D5U A;  4QX7 B;  5HXE A;  5J1G A;  3RIU A;  3EDU A;  1WYC A;  5CJ5 A;  2NP9 A;  3M65 A;  5H6Q B;  3GA8 A;  4CXY A;  2WDV A;  3P4W A;  3NZP A;  2OLT A;  4HFV A;  3N9L A;  3R6N A;  4X5T A;  2C0S A;  1HCI A;  2X0H A;  3P4R A;  1XWM A;  1MIY A;  4NPP A;  5HAX A;  2Q9Q B;  4ZXL A;  2WWU A;  3EHZ A;  3ZMZ B;  4ILA A;  5IHY A;  1E2A A;  3LK4 2;  4P0B A;  3IF8 B;  5JRE A;  4YTN A;  1WCR A;  3UQ4 A;  3PUQ A;  3IHR A;  4AKR B;  4K0K T;  2BG9 C;  3UFE A;  4CQI A;  5DAB A;  3PV0 F;  2I0M A;  1HG2 A;  3CVR A;  1D0Z A;  4IE4 A;  1MND A;  2XQ6 A;  2CXL A;  3FB2 A;  3K1S A;  3NRY A;  1MIV A;  4Z91 A;  5FMN A;  2DHR A;  1S35 A;  4M1P A;  4U72 A;  4X20 E;  3AA1 B;  1EZ3 A;  4AQF A;  4I0U A;  3BQK A;  3CX7 B;  2CHO A;  3N9M A;  3ONL C;  2OA5 A;  2XAF B;  1ZEE A;  3F31 A;  1G8X A;  2IAK A;  4H9R C;  4O4L E;  2LT3 A;  4X1I E;  5AQM B;  1CHU A;  3CQX C;  4QH4 A;  4DR3 T;  3DTO A;  4UXN B;  2DNX A;  4YSX A;  4HTE A;  1E7P A;  4JEH B;  3AE1 A;  2UXD T;  2IC6 A;  5J2T E;  4XZC A;  3PDY A;  2XZE A;  2IIU A;  4O4J E;  1V9D A;  1OED A;  3ETV A;  2V7K A;  4GK5 E;  1YD8 G;  4ERR A;  2X9W A;  4OYK A;  4G2A A;  4B3T T;  3RC3 A;  4QXB B;  3RI5 A;  1OXZ A;  2CXD A;  2LJL A;  3JC6 D;  4P0A A;  1FJG T;  4DV0 T;  3G06 A;  3HKD E;  4UV8 B;  3HKE E;  3QB5 K;  4L0R A;  3FZK B;  4XBF B;  5LJN A;  4NXM T;  1YXR A;  3EAB A;  4KI0 F;  4FI5 A;  5EZY E;  2ACX A;  3RIU C;  3ONJ A;  3N2G E;  4EAH A;  3ZEF B;  4TWH A;  4IDZ A;  2LHR A;  3L09 A;  3HI2 A;  4F6R C;  2FJD A;  4OYJ A;  3BK9 A;  4AI6 A;  2KSR A;  5HXR A;  3OYZ A;  3UTK A;  3RYI E;  2W61 A;  5L3C B;  3K3O A;  4YHJ A;  5E0O A;  4F8H A;  2EHO D;  1VRB A;  4TX5 A;  2CLY C;  3AE3 A;  4UEM A;  1D1C A;  3FZM B;  2WZH A;  5ABE A;  1SE7 A;  4HFE A;  2ZLY A;  5IUX A;  2MPK A;  4CZZ B;  2CWY A;  3AA0 B;  2FJB A;  3LFM A;  3RIA A;  5L3F B;  4WYV A;  5KX5 E;  4DUY T;  2DLR A;  3N9O A;  4EED A;  2NR4 A;  3EI0 A;  4U2Y A;  2VKO A;  5A1L A;  2YK0 A;  4JLE A;  5HWY A; 
#chains in the Genus database with same CATH homology
 2K3W A;  2V6X A;  4NIQ A;  4A5X A;  3ZT6 A;  3ZT7 A;  2JQK A;  3ZSS A;  2MPK A;  5CGM A;  2CPT A;  2JQH A;  1YXR A;  5LB7 B;  3EAB A;  4CN4 A;  4ZEY A;  1WR0 A;  5FVL A;  2LRK A;  4U31 A;  4U7Y A;  4U2Z A;  2WWV A;  2W2U A;  4P1N A;  5FVK A;  2V6Y A;  2JQ9 A;  3ZST A;  1WFD A;  2DL1 A;  1WCR A;  2A9U A;  4U2Y A;  2RPA A;  2CRB A;  4CN1 A;  2WY2 A;  4WZX A;  3K1S A;  4U7I A;  2XZE A;  4U3C A;  4U33 A;  4CN6 A;  3ZT5 A;  2LRL A;  2V6Y B;  4IT4 A;  5CJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...