5FVKA

Crystal structure of vps4-vfa1 complex from s.cerevisiae at 1.66 a resolution.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
82
structure length
82
Chain Sequence
MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
publication title Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 38
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 5fvkA00
2W2UA 4P1NA 2WY2A 2V6YA 2LRKA 2JQHA 2V6XA 1WR0A 3ZT7A 4NIQA 4U7IA 4A5XA 3ZSSA 2LRLA 4U2ZA 3EABA 2WWVA 1WCRA 4CN4A 5FVKA 1YXRA 2RPAA 2K3WA 5CGMA 2CPTA 3ZSTA 4U7YA 4U33A 4U31A 5FVLA 4IT4A 4U2YA 4U3CA 2MPKA 5LB7B 5CJ5A 2A9UA 1WFDA 2V6YB 2DL1A 4CN6A 4WZXA 2JQKA 2CRBA 4ZEYA 3K1SA 2XZEA 3ZT6A 3ZT5A 4CN1A 2JQ9A
chains in the Genus database with same CATH superfamily
1OEDA 2M6IA 4LMLA 5ABGA 3ONXA 3UQ7A 1XMQT 3MACA 5L3BB 1NWMX 1HFAA 3H3MA 3N9PA 4ZI3D 5FXXA 2HN1A 2CHNA 2KXPB 5LP6E 3TLUA 2K24A 4UR9A 4TWHA 2OLTA 4N78D 2L3LA 4EV6A 4XBFB 3RPUA 3QB5A 4JYAT 3AXJB 3OJAA 2BS2A 2LJLA 4ANJA 3P4WA 4ADZA 2BDEA 3J9X1 5HCMA 2QA7A 2BBJA 5LMNT 2E5LT 5HXEA 3AA6B 4ZHQE 4IHJE 4ZI2D 3T1HT 3KDSE 2PBIA 3ZMVB 1WYBA 4DV6T 1D1CA 4Q25A 4X66T 4JLEA 3AA1B 1D1AA 2YDSA 1KNZA 1QLBA 1FMWA 3KVAA 3TLWA 2HPJA 2A2FX 4LF6T 1FEWA 5BMVE 2DNXA 4H9NC 2Y48B 2ZLYA 5LBMA 4QHOA 4AQYT 3I9YA 3OVUA 3T1YT 4X65T 2NTXA 3LK42 3ZC1A 4DR6T 1M7KA 2NW8A 3B5MA 3U3IA 3NBXX 3FHNA 4O2BE 5LYJE 4LF7T 5FMNA 1EZ3A 4ZZCA 5DJQC 4O4JE 3AE5A 1YQ4A 2K3WA 3VHLA 2WZIA 5HEJA 4IIJE 5HEHA 2XTLA 3IA3A 3HR0A 4JUYA 2D9DA 2JMKA 4IDOA 2B76A 4IDPA 3ZJ2A 3I0QA 3A7MA 3ZN0B 4DIDB 3HKCE 2IUBA 1XMOT 3NRYA 4E7SA 2OV9A 5LJNA 3JC6D 4ZS2A 1SE7A 3A5XA 1ZEEA 3BK9A 4PJMA 3DP7A 2UXDT 2W2UA 3C98B 2XQ8A 2XQYA 2VKJA 3RRCA 4BJMA 5HXHA 5JR9B 2FBWA 1H7CA 2H7VC 2E9XD 2V8SV 3OTOT 1IAPA 2WDRA 1MMAA 1KF6A 4IDQA 1WCRA 5AQQB 4DO0A 4UF0A 2KINB 5FP3A 5HAXA 2E2AA 2XQ6A 4FJOA 3HKBE 3WI3A 1D0XA 5A1LA 3ANWB 3S4UA 4CN6A 4PJLA 2CXDA 3MK7C 1IJ6A 4JI3T 3MKDA 4YJ2E 3C4XA 5JDFA 2SPCA 3KFWX 1Y64B 1I94T 1XZYA 4EIWA 2XY8B 2V6YB 3CIRA 2WMNA 5L3EB 2CWOA 2HH7A 5HWYA 2H89A 3PUQA 3VR8A 3E08A 2Q9QB 3AE4A 2EHOC 4HFEA 3EDUA 2UXBT 4YTMA 4B3RT 2PG8A 5AQFB 4ZOLE 4KHPT 2BKOA 4X64T 4AKGA 5LHGB 4LF5T 1KEYA 4ILAA 2XQ5A 3PU3A 3EABA 3UU5A 5CA0E 1MMGA 3AXJA 1Z0PA 3E0ZA 1R8IA 3GN5B 4YSZA 1HR0T 3ZPOA 1G73A 4YSYA 2VVSA 2WDVA 3VR9A 1QSDA 3FZMB 4A97A 3PJAJ 2LSJA 1OEDC 3TLSA 2HHHT 4JI7T 4DV3T 3I9WA 3LK2B 3CQGB 4LF9T 4H9SE 3RF1A 2JQQA 2W67A 2DWKA 5EK2A 4DR2T 1O3XA 2F4VT 2A9UA 1CHUA 2BKNA 4QXCB 3N9NA 4J2CA 5LOVE 4PFOA 1KK7A 5FL1A 2UXNB 2KSRA 3UQ4A 2QVAA 4GK0E 2MOZA 2WWUA 4DR4T 2WP9A 4NXNT 1T98A 1M62A 5E0OA 2JPFA 5TAOA 5IHYA 3J7Yq 3VKHA 3HKEE 5LGTB 5L3GB 4YFSA 4HWFA 5AQLB 4DUZT 1HX1B 4KX6A 5LHHB 4DR1T 4O8SA 4KP3C 5AFUL 2CRBA 1OWAA 2LM2A 4P09A 2C5KT 3ETUA 5ABHA 4OX9T 4HWIB 2WCAA 4UV8B 4UVAB 4DBRA 5HYAA 4PK5A 3P4SA 1BR1A 4EOZB 1YKEB 5AQNB 3RQUA 3AE6A 4AQFA 2CBJA 1MNEA 5C3JA 2LSYA 1W0AA 2ZM2A 3R84B 5EK4A 2WWVA 4GOUA 2V7IA 5H6QB 4YJ3E 3ZJ1A 4C90A 2X0HA 3AVSA 1XNRT 3HI2A 5JR9A 3ZMZB 1UUSA 2W4XA 2JMHA 1WRDA 4I43B 2YU1A 5JQGE 1E2AA 4EXTA 3EHZA 3AE2A 5JTGA 3UFEA 1T7SA 2XAJB 4KUMB 5F5WA 3CX6B 4AQGA 4HWDA 3PUGA 4OK0A 2FJEA 3G06A 5LG3A 3ANWA 3RYIE 3ZYMA 2VKOA 4U72A 2W61A 5L2LA 5AQUB 3RIAA 2CPTA 3FZKB 3UUMA 2VK9A 4NPPA 5LCYA 4Z90A 4OYKA 1MMNA 4TNWA 4E7ZA 1HX8A 2V6YA 5L3FB 2WU2A 3P8CD 2X51A 1N34T 2MAWA 2Z6EA 4KMCA 3L8RA 3OYZA 1VCTA 4HWCA 4UEMA 4PK4A 2XZEA 4QXBB 4LF8T 3FB2A 5HCJA 3LBXB 3UU8A 5JRCB 3C4ZA 2E9XA 5JDGA 5L3CB 4JI2T 1LKXA 2LKHA 2IC6A 3ZN1B 2Y8DA 4TWFA 1UX5A 2ACXA 2PTFA 1UGOA 3O4XE 3N9MA 3GN5A 2CM0A 4ZZBA 3PUXF 2J1DG 2YN6A 5AQRB 3F57A 3LG7A 1LRZA 4PJNA 2XAFB 3QOFA 4AXPA 3NZPA 5LB7B 2ODUA 4AI6A 1HS7A 3HA4A 4WNKA 4WW0A 4TUYE 5J0ZA 3NZQA 3TLTA 4X1IE 2LHNA 4HFCA 2ZM0A 2IAKA 3H37A 2VASA 3C4WA 3CX7B 2KZ7B 5LBQB 4HFIA 3CMLA 3D0TA 3A8YC 4BJNA 2K48A 2FUPA 1WR0A 3B13A 4H9OC 2IDOB 3BQIA 4AKLA 5AQMB 3SRZA 2X9HA 5LG4A 4IDNA 3AAAB 4YLHA 4X62T 2BG9E 1NAFA 3I1AA 1BR0A 3AA7B 4ILBA 4KI0F 4HTEA 3K8PC 1HF8A 1LVFA 3HL6A 4H9RC 2LLYA 1IZNB 5AQGB 3AA0B 2D0UA 3PUZF 2KWIB 1YQ3A 2L9QA 5KDMC 3K3OA 5J2UE 3ZT5A 4ERRA 5ABEA 1IBLT 3KV5A 4TNVA 4WBNE 2C5IT 2J62A 4B3TT 4ZI3C 3P4PA 3O1IA 5EZYE 2WS3A 2UUCT 3MA9A 4H63V 2IHR1 1I6ZA 2LEHA 4BA9A 2VKDA 3C51A 1UURA 5KMGP 2IMLA 1VRBA 3ZT7A 3LK3B 3PUAA 2LHRA 2X9XA 3QK6A 4AIUA 1OEDE 3Q5DA 1N36T 3RKOA 4ILCA 4U3CA 2KNDA 2KLQA 2VKHA 3N9OA 4ZI2C 1VOMA 2XQAA 2Q9QD 2X9YA 3AVRA 2J47A 5L4EA 2I59A 2N2NA 4CXYA 2XPKA 1MNDA 3CQXC 3ABVA 4LMJA 3RRWA 5HXCA 3PUVF 4K0UA 2XHEB 1S94A 2V7LA 4KHZF 4DR3T 4YXDA 1ZV4X 2XSBA 2XUEA 3OPCA 3UUBA 3AE9A 2WBLA 2W63A 4G2AA 2QRXA 2NR4A 3Q5WA 4QH1A 1HTJF 3M3ZB 4TV9E 4CN4A 4X1KE 3AEDA 2DLRA 2LSGA 2M6BA 3RH3A 2EHOB 4OHFA 2IW5B 3EDVA 5AQPB 4LFBT 2NW7A 1L0VA 3AE7A 4EYYR 1WR6A 1XDPA 2LOSA 3AEAA 2BG9C 4U7IA 2PJQA 4QXHB 3L09A 1KFYA 2VVNA 2ES0A 5FVLA 5JRCA 4TN7B 2A3DA 3L3PA 1E7PA 2V7MA 3SFEA 1LVKA 1WLXA 3KBTA 3UULA 2ACZA 5C2TA 2KT9A 2WQYA 5ABFB 1W9RA 3JC6C 4UVBB 4WBOA 2N9DA 2W0GA 5HEGA 4LMKA 2NTYA 3WAJA 3FZLB 3JAFA 2WMOA 2FJAA 4I55E 4JI5T 4EYUA 3TLVA 4OYJA 3JADA 3MZKB 3P4QA 2E9XC 2UUBT 4EZ4A 1HG5A 1YW0A 2JQHA 5FL0A 4X20E 1YKHB 3QB5K 4AKRB 4GYSA 1WYCA 1X9BA 2AXDS 4IT4A 2MTQA 3AE8A 2YDRA 2VB6A 2XM2A 4M1PA 1KNPA 2N1GA 3RIUA 2V5DA 1HNWT 5HWXA 1YXRA 5AQTB 3AEGA 5BR8T 4U31A 1E1HB 2WSSV 3RYHE 5J2TE 5IYZE 3V5UA 5F3JA 3AECA 1NEKA 4P0AA 4JI1T 1D0ZA 3PDYA 3PJAA 2CA5A 5AQHB 2XSAA 4EB6E 2YU2A 4NUUA 2K5BB 2NWBA 3FBZA 1OXZA 4O4IE 3O1HA 2VQFT 4JI8T 3LSVA 4HFHA 2WDQA 1HG2A 2CE7A 2X66A 1MMDA 3CWZB 3OBVE 2BZBA 1XNQT 2DCFA 4ISSA 1NENA 5LMUT 4YT0A 4NUVA 3PURA 2XJ7A 2D5UA 2YOEA 4WYVA 3NRXA 1W0BA 4B3ST 4MFRA 5LHIB 2V5CA 2VL0A 4JI6T 5CGMA 4IE0A 4ISTA 3MJXA 4LFCT 5EK3A 2UU9T 3AAEB 2XAHB 2BVLA 3GWHA 2JQ9A 3F2EA 2D0TA 3NKZA 3PUSA 1YD8G 3JAEA 3TKLB 3FBLA 4U33A 1MIWA 4CI1B 4I0UA 3PUWF 4JEUB 2ZM6T 1JNRA 2YK0A 5LGUB 4ZEYA 1XWMA 4LFAT 3ZCJA 2NP9A 4CI3B 3ESLA 1US7B 4GKJT 2ODVA 3IEEA 3CVRA 4YY3T 4GK5E 3BQKA 4MLKA 2XQ9A 2ZM8A 4DUYT 3ZKRA 2CLYC 2CEAA 2EHOA 4NXMT 4UF0B 3Q9DA 2LRKA 3H3AA 3NVOA 3MXZA 1HNXT 3ZSSA 2V7JA 4H9PC 2YINA 5FVKA 5HEOA 5M4YA 4PJJA 3LDQB 2CHOA 3QNUA 2Q9QA 3AE3A 3L39A 5FXVA 2FJBA 2NOXA 4QX8B 3ZMTB 3ZEFB 5FNVE 1SA0E 2C0SA 5JVDE 2Y6XA 1IJ5A 4JV5T 3PE0A 3SS1A 3UUNA 4CQIA 1MIVA 5LA6E 3UU4A 3QC9A 4H9QC 4DV4T 1SUMB 4DMVA 3CPZA 4DMWA 4DNDA 5ABFA 2VWAA 4DV0T 2JJ9A 3OKQA 3B57A 1N33T 4PW8A 2DWGA 4L0RA 2LE8A 3P7IA 5DABA 3W15B 4YTPA 3EI0A 2E8IA 3EAMA 3UUXB 1X79A 5KXJA 1JNZA 1WFDA 4EGWA 2K9AA 2WM9A 3IBPA 4XAXB 4O2AE 3ZC0A 3VRAA 5CA1E 2W66A 3DTOA 3N2GE 3V5SA 3F31A 2JRKA 5KX5E 2WAUA 4HFVA 1XDOA 1N32T 4HKAA 4U2YA 4O4HE 1Y01A 3PV0F 3ZT6A 5HXRA 4X1YE 2MBGA 3FZHB 3ZCIA 2R6GF 3Q2MA 5FXWA 3Q5EA 2XAGB 1G8XA 5FXZA 1ZHCA 2MPKA 3LJCA 5IUXA 2DL1A 5LJMA 2YDQA 5CB4E 2LKGA 4JI4T 4G63A 4AISA 4TX5A 3EVYA 3EUHA 1GQEA 4IREA 5FKYA 2XM1A 4B6XA 4QWNB 4C91A 1CUNA 4DV7T 2X0LB 2CCQA 3RQWA 1HCIA 2QGSA 5DQVA 3C50A 4COFA 1U5PA 3RIUC 5ETWA 3SFDA 4DV2T 2LM9A 3O1JA 4YTNA 3K1SA 2LT3A 2GK9A 3PUYF 3P50A 5FY1A 1ZP0A 5AQVB 3RIFA 4MHCA 1IBKT 1VCSA 3UFGA 4Z91A 3N2OA 2EHOD 2BKPA 4JBWF 2BS4A 5AQJB 3HKDE 4FI5A 5CJ5A 3AEFA 2DHRA 4UELA 2PFVA 4AKHA 2I0MA 4UXNB 4CXWA 1ZKEA 4I4TE 3LFMA 4PFPA 1FIOA 1UCUA 1ZOYA 4PNIA 4HFDA 4BAYB 2CXLA 3AB3B 1D1BA 3RLFF 5H6RB 5AQIB 1MIYA 4WZXA 2JQKA 4TV8E 2CBIA 3ETVA 2V7KA 3N9QA 3RGLA 2JIWA 1J5WA 2XQ3A 4EZHA 2X9WA 3KV9A 2L8KA 3ZYLA 1V9DA 1BR4A 5L47A 4AQFC 4YSXA 4EEBA 4K0KT 3OYXA 4AKIA 3GMIA 3GA8A 4HGAA 2BVMA 3RC3A 2B1EA 2X67A 4HFBA 3RYFE 5LXTE 3RX6A 5AQOB 4ZXLA 3SOLA 3ZYKA 2BG9B 2WZHA 4LF4T 2RA1A 3ZMUB 5JR9C 2LSKA 5J1GA 1D0YA 3AEBA 3N2KE 3UU3A 5JDHA 4PAGA 3R6NA 3O9XA 3N9LA 3ONLC 5JDMA 2XAQB 5L4HA 4DV1T 3LBXA 3PU8A 3ZLIA 3VKGA 2UXCT 3FXDB 2VQET 3VRBA 1J5ET 2V26A 4V1Av 4A5XA 2WU5A 4F6RC 2P9BA 3KINB 4IE7A 4DVDA 4QX7B 4YHJA 1OEDB 3UU6A 4ZS3A 2X68A 4EEDA 2E9XB 3KV6A 3I0OA 3KV4A 4DR7T 2Q9QC 4QKNA 4P0BA 2RPAA 4GKKT 4Z8XA 4ASKA 3Q5XA 5GONE 4MALA 2MYSA 4L5GA 1Z8UA 4PK6A 1IBMT 3CKDA 4IGUA 3C64A 4QH4A 2WY2A 3T8OA 4HWHA 5HEUA 3BQLA 2I6HA 4GYRA 4HE8A 2V1DB 5JDQA 3U78A 4X5TA 3ONJA 5LGNB 2HN2A 4H63H 2W00A 4CZZB 1S35A 2LOPA 2G0UA 2C5JA 3K3QC 3WAKA 3FZFB 3FXEB 2CXFA 1W09A 4HEAA 2X0YA 3P4RA 2XQ7A 3QUJA 2M67A 5FY0A 1SHZC 4O4LE 2YKSA 2WB5A 3ZSTA 3K3NA 3AE1A 4YHHT 3NWIA 4I50E 1UX4A 2DI4A 2J4GA 3CX8B 4IE5A 4IL9A 2NW9A 4A56A 3KBUA 4U2ZA 4L9IA 5DQWA 5HXSA 4QH5A 1T72A 2VL8A 4IE6A 3RHWA 4A98A 4EAHA 2H7OA 4JEHB 3VU7H 4JI0T 1B7TA 4F8HA 2RP4A 4UV9B 2XQ4A 4IL4A 3AEEA 4P1NA 1UK5A 4ZI7E 2KMFA 4B3MT 2VURA 5JREA 2FJDA 4U74A 1U4QA 3SWHA 4GIWA 2H3RA 3UT5E 4TZ4C 2H88A 2QYWA 1HNZT 1QUUA 2IIUA 3E22E 1J1JA 3RC8A 4NIQA 3X1DA 2LRLA 1AJ3A 3M65A 4CXXA 4XZCA 5ADXL 4DV5T 4HN9A 4MBQA 3RI5A 2LSIA 3N5LA 5L3DB 2W62A 5CFBA 2D2SA 3JCFA 4IE4A 2CLYB 1DU2A 4TWDA 2YEVC 1T8BA 4ILUA 4IDZA 3DJBA 5IWAT 2CMRA 2UUAT 2BG9A 2ZMAA 3AAIA 1FMVA 5AQSB 1BR2A 2A72A 4CN1A 2IC9A 5LNKA 2E5VA 5FY7A 5AQKB 2CWYA 3RKGA 5JH7E 2UXXB 5JDNA 2OA5A 1KNRA 5C8YE 3PTRB 3UTKA 3RYCE 4CI2B 2HPLA 3IF8B 5JDLA 4OFZA 3IHRA 4DBQA 3CK6A 4KBMB 5FYMA 4UVCB 3ZMSB 4DR5T 2KWHA 2V6XA 3CQCB 5F8PA 4U7YA 2AE9A 2XASB 1FJGT 2BBHA 3KVBA 4UIGA 2BS3A
chains in the Genus database with same CATH topology
2W2UA 4P1NA 2WY2A 2V6YA 2LRKA 2JQHA 2V6XA 1WR0A 3ZT7A 4NIQA 4U7IA 4A5XA 3ZSSA 2LRLA 4U2ZA 3EABA 2WWVA 1WCRA 4CN4A 5FVKA 1YXRA 2RPAA 2K3WA 5CGMA 2CPTA 3ZSTA 4U7YA 4U33A 4U31A 5FVLA 4IT4A 4U2YA 4U3CA 2MPKA 5LB7B 5CJ5A 2A9UA 1WFDA 2V6YB 2DL1A 4CN6A 4WZXA 2JQKA 2CRBA 4ZEYA 3K1SA 2XZEA 3ZT6A 3ZT5A 4CN1A 2JQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2U A;  4P1N A;  2WY2 A;  2V6Y A;  2LRK A;  2JQH A;  2V6X A;  1WR0 A;  3ZT7 A;  4NIQ A;  4U7I A;  4A5X A;  3ZSS A;  2LRL A;  4U2Z A;  3EAB A;  2WWV A;  1WCR A;  4CN4 A;  5FVK A;  1YXR A;  2RPA A;  2K3W A;  5CGM A;  2CPT A;  3ZST A;  4U7Y A;  4U33 A;  4U31 A;  5FVL A;  4IT4 A;  4U2Y A;  4U3C A;  2MPK A;  5LB7 B;  5CJ5 A;  2A9U A;  1WFD A;  2V6Y B;  2DL1 A;  4CN6 A;  4WZX A;  2JQK A;  2CRB A;  4ZEY A;  3K1S A;  2XZE A;  3ZT6 A;  3ZT5 A;  4CN1 A;  2JQ9 A; 
#chains in the Genus database with same CATH topology
 1OED A;  2M6I A;  4LML A;  5ABG A;  3ONX A;  3UQ7 A;  1XMQ T;  3MAC A;  5L3B B;  1NWM X;  1HFA A;  3H3M A;  3N9P A;  4ZI3 D;  5FXX A;  2HN1 A;  2CHN A;  2KXP B;  5LP6 E;  3TLU A;  2K24 A;  4UR9 A;  4TWH A;  2OLT A;  4N78 D;  2L3L A;  4EV6 A;  4XBF B;  3RPU A;  3QB5 A;  4JYA T;  3AXJ B;  3OJA A;  2BS2 A;  2LJL A;  4ANJ A;  3P4W A;  4ADZ A;  2BDE A;  3J9X 1;  5HCM A;  2QA7 A;  2BBJ A;  5LMN T;  2E5L T;  5HXE A;  3AA6 B;  4ZHQ E;  4IHJ E;  4ZI2 D;  3T1H T;  3KDS E;  2PBI A;  3ZMV B;  1WYB A;  4DV6 T;  1D1C A;  4Q25 A;  4X66 T;  4JLE A;  3AA1 B;  1D1A A;  2YDS A;  1KNZ A;  1QLB A;  1FMW A;  3KVA A;  3TLW A;  2HPJ A;  2A2F X;  4LF6 T;  1FEW A;  5BMV E;  2DNX A;  4H9N C;  2Y48 B;  2ZLY A;  5LBM A;  4QHO A;  4AQY T;  3I9Y A;  3OVU A;  3T1Y T;  4X65 T;  2NTX A;  3LK4 2;  3ZC1 A;  4DR6 T;  1M7K A;  2NW8 A;  3B5M A;  3U3I A;  3NBX X;  3FHN A;  4O2B E;  5LYJ E;  4LF7 T;  5FMN A;  1EZ3 A;  4ZZC A;  5DJQ C;  4O4J E;  3AE5 A;  1YQ4 A;  2K3W A;  3VHL A;  2WZI A;  5HEJ A;  4IIJ E;  5HEH A;  2XTL A;  3IA3 A;  3HR0 A;  4JUY A;  2D9D A;  2JMK A;  4IDO A;  2B76 A;  4IDP A;  3ZJ2 A;  3I0Q A;  3A7M A;  3ZN0 B;  4DID B;  3HKC E;  2IUB A;  1XMO T;  3NRY A;  4E7S A;  2OV9 A;  5LJN A;  3JC6 D;  4ZS2 A;  1SE7 A;  3A5X A;  1ZEE A;  3BK9 A;  4PJM A;  3DP7 A;  2UXD T;  2W2U A;  3C98 B;  2XQ8 A;  2XQY A;  2VKJ A;  3RRC A;  4BJM A;  5HXH A;  5JR9 B;  2FBW A;  1H7C A;  2H7V C;  2E9X D;  2V8S V;  3OTO T;  1IAP A;  2WDR A;  1MMA A;  1KF6 A;  4IDQ A;  1WCR A;  5AQQ B;  4DO0 A;  4UF0 A;  2KIN B;  5FP3 A;  5HAX A;  2E2A A;  2XQ6 A;  4FJO A;  3HKB E;  3WI3 A;  1D0X A;  5A1L A;  3ANW B;  3S4U A;  4CN6 A;  4PJL A;  2CXD A;  3MK7 C;  1IJ6 A;  4JI3 T;  3MKD A;  4YJ2 E;  3C4X A;  5JDF A;  2SPC A;  3KFW X;  1Y64 B;  1I94 T;  1XZY A;  4EIW A;  2XY8 B;  2V6Y B;  3CIR A;  2WMN A;  5L3E B;  2CWO A;  2HH7 A;  5HWY A;  2H89 A;  3PUQ A;  3VR8 A;  3E08 A;  2Q9Q B;  3AE4 A;  2EHO C;  4HFE A;  3EDU A;  2UXB T;  4YTM A;  4B3R T;  2PG8 A;  5AQF B;  4ZOL E;  4KHP T;  2BKO A;  4X64 T;  4AKG A;  5LHG B;  4LF5 T;  1KEY A;  4ILA A;  2XQ5 A;  3PU3 A;  3EAB A;  3UU5 A;  5CA0 E;  1MMG A;  3AXJ A;  1Z0P A;  3E0Z A;  1R8I A;  3GN5 B;  4YSZ A;  1HR0 T;  3ZPO A;  1G73 A;  4YSY A;  2VVS A;  2WDV A;  3VR9 A;  1QSD A;  3FZM B;  4A97 A;  3PJA J;  2LSJ A;  1OED C;  3TLS A;  2HHH T;  4JI7 T;  4DV3 T;  3I9W A;  3LK2 B;  3CQG B;  4LF9 T;  4H9S E;  3RF1 A;  2JQQ A;  2W67 A;  2DWK A;  5EK2 A;  4DR2 T;  1O3X A;  2F4V T;  2A9U A;  1CHU A;  2BKN A;  4QXC B;  3N9N A;  4J2C A;  5LOV E;  4PFO A;  1KK7 A;  5FL1 A;  2UXN B;  2KSR A;  3UQ4 A;  2QVA A;  4GK0 E;  2MOZ A;  2WWU A;  4DR4 T;  2WP9 A;  4NXN T;  1T98 A;  1M62 A;  5E0O A;  2JPF A;  5TAO A;  5IHY A;  3J7Y q;  3VKH A;  3HKE E;  5LGT B;  5L3G B;  4YFS A;  4HWF A;  5AQL B;  4DUZ T;  1HX1 B;  4KX6 A;  5LHH B;  4DR1 T;  4O8S A;  4KP3 C;  5AFU L;  2CRB A;  1OWA A;  2LM2 A;  4P09 A;  2C5K T;  3ETU A;  5ABH A;  4OX9 T;  4HWI B;  2WCA A;  4UV8 B;  4UVA B;  4DBR A;  5HYA A;  4PK5 A;  3P4S A;  1BR1 A;  4EOZ B;  1YKE B;  5AQN B;  3RQU A;  3AE6 A;  4AQF A;  2CBJ A;  1MNE A;  5C3J A;  2LSY A;  1W0A A;  2ZM2 A;  3R84 B;  5EK4 A;  2WWV A;  4GOU A;  2V7I A;  5H6Q B;  4YJ3 E;  3ZJ1 A;  4C90 A;  2X0H A;  3AVS A;  1XNR T;  3HI2 A;  5JR9 A;  3ZMZ B;  1UUS A;  2W4X A;  2JMH A;  1WRD A;  4I43 B;  2YU1 A;  5JQG E;  1E2A A;  4EXT A;  3EHZ A;  3AE2 A;  5JTG A;  3UFE A;  1T7S A;  2XAJ B;  4KUM B;  5F5W A;  3CX6 B;  4AQG A;  4HWD A;  3PUG A;  4OK0 A;  2FJE A;  3G06 A;  5LG3 A;  3ANW A;  3RYI E;  3ZYM A;  2VKO A;  4U72 A;  2W61 A;  5L2L A;  5AQU B;  3RIA A;  2CPT A;  3FZK B;  3UUM A;  2VK9 A;  4NPP A;  5LCY A;  4Z90 A;  4OYK A;  1MMN A;  4TNW A;  4E7Z A;  1HX8 A;  2V6Y A;  5L3F B;  2WU2 A;  3P8C D;  2X51 A;  1N34 T;  2MAW A;  2Z6E A;  4KMC A;  3L8R A;  3OYZ A;  1VCT A;  4HWC A;  4UEM A;  4PK4 A;  2XZE A;  4QXB B;  4LF8 T;  3FB2 A;  5HCJ A;  3LBX B;  3UU8 A;  5JRC B;  3C4Z A;  2E9X A;  5JDG A;  5L3C B;  4JI2 T;  1LKX A;  2LKH A;  2IC6 A;  3ZN1 B;  2Y8D A;  4TWF A;  1UX5 A;  2ACX A;  2PTF A;  1UGO A;  3O4X E;  3N9M A;  3GN5 A;  2CM0 A;  4ZZB A;  3PUX F;  2J1D G;  2YN6 A;  5AQR B;  3F57 A;  3LG7 A;  1LRZ A;  4PJN A;  2XAF B;  3QOF A;  4AXP A;  3NZP A;  5LB7 B;  2ODU A;  4AI6 A;  1HS7 A;  3HA4 A;  4WNK A;  4WW0 A;  4TUY E;  5J0Z A;  3NZQ A;  3TLT A;  4X1I E;  2LHN A;  4HFC A;  2ZM0 A;  2IAK A;  3H37 A;  2VAS A;  3C4W A;  3CX7 B;  2KZ7 B;  5LBQ B;  4HFI A;  3CML A;  3D0T A;  3A8Y C;  4BJN A;  2K48 A;  2FUP A;  1WR0 A;  3B13 A;  4H9O C;  2IDO B;  3BQI A;  4AKL A;  5AQM B;  3SRZ A;  2X9H A;  5LG4 A;  4IDN A;  3AAA B;  4YLH A;  4X62 T;  2BG9 E;  1NAF A;  3I1A A;  1BR0 A;  3AA7 B;  4ILB A;  4KI0 F;  4HTE A;  3K8P C;  1HF8 A;  1LVF A;  3HL6 A;  4H9R C;  2LLY A;  1IZN B;  5AQG B;  3AA0 B;  2D0U A;  3PUZ F;  2KWI B;  1YQ3 A;  2L9Q A;  5KDM C;  3K3O A;  5J2U E;  3ZT5 A;  4ERR A;  5ABE A;  1IBL T;  3KV5 A;  4TNV A;  4WBN E;  2C5I T;  2J62 A;  4B3T T;  4ZI3 C;  3P4P A;  3O1I A;  5EZY E;  2WS3 A;  2UUC T;  3MA9 A;  4H63 V;  2IHR 1;  1I6Z A;  2LEH A;  4BA9 A;  2VKD A;  3C51 A;  1UUR A;  5KMG P;  2IML A;  1VRB A;  3ZT7 A;  3LK3 B;  3PUA A;  2LHR A;  2X9X A;  3QK6 A;  4AIU A;  1OED E;  3Q5D A;  1N36 T;  3RKO A;  4ILC A;  4U3C A;  2KND A;  2KLQ A;  2VKH A;  3N9O A;  4ZI2 C;  1VOM A;  2XQA A;  2Q9Q D;  2X9Y A;  3AVR A;  2J47 A;  5L4E A;  2I59 A;  2N2N A;  4CXY A;  2XPK A;  1MND A;  3CQX C;  3ABV A;  4LMJ A;  3RRW A;  5HXC A;  3PUV F;  4K0U A;  2XHE B;  1S94 A;  2V7L A;  4KHZ F;  4DR3 T;  4YXD A;  1ZV4 X;  2XSB A;  2XUE A;  3OPC A;  3UUB A;  3AE9 A;  2WBL A;  2W63 A;  4G2A A;  2QRX A;  2NR4 A;  3Q5W A;  4QH1 A;  1HTJ F;  3M3Z B;  4TV9 E;  4CN4 A;  4X1K E;  3AED A;  2DLR A;  2LSG A;  2M6B A;  3RH3 A;  2EHO B;  4OHF A;  2IW5 B;  3EDV A;  5AQP B;  4LFB T;  2NW7 A;  1L0V A;  3AE7 A;  4EYY R;  1WR6 A;  1XDP A;  2LOS A;  3AEA A;  2BG9 C;  4U7I A;  2PJQ A;  4QXH B;  3L09 A;  1KFY A;  2VVN A;  2ES0 A;  5FVL A;  5JRC A;  4TN7 B;  2A3D A;  3L3P A;  1E7P A;  2V7M A;  3SFE A;  1LVK A;  1WLX A;  3KBT A;  3UUL A;  2ACZ A;  5C2T A;  2KT9 A;  2WQY A;  5ABF B;  1W9R A;  3JC6 C;  4UVB B;  4WBO A;  2N9D A;  2W0G A;  5HEG A;  4LMK A;  2NTY A;  3WAJ A;  3FZL B;  3JAF A;  2WMO A;  2FJA A;  4I55 E;  4JI5 T;  4EYU A;  3TLV A;  4OYJ A;  3JAD A;  3MZK B;  3P4Q A;  2E9X C;  2UUB T;  4EZ4 A;  1HG5 A;  1YW0 A;  2JQH A;  5FL0 A;  4X20 E;  1YKH B;  3QB5 K;  4AKR B;  4GYS A;  1WYC A;  1X9B A;  2AXD S;  4IT4 A;  2MTQ A;  3AE8 A;  2YDR A;  2VB6 A;  2XM2 A;  4M1P A;  1KNP A;  2N1G A;  3RIU A;  2V5D A;  1HNW T;  5HWX A;  1YXR A;  5AQT B;  3AEG A;  5BR8 T;  4U31 A;  1E1H B;  2WSS V;  3RYH E;  5J2T E;  5IYZ E;  3V5U A;  5F3J A;  3AEC A;  1NEK A;  4P0A A;  4JI1 T;  1D0Z A;  3PDY A;  3PJA A;  2CA5 A;  5AQH B;  2XSA A;  4EB6 E;  2YU2 A;  4NUU A;  2K5B B;  2NWB A;  3FBZ A;  1OXZ A;  4O4I E;  3O1H A;  2VQF T;  4JI8 T;  3LSV A;  4HFH A;  2WDQ A;  1HG2 A;  2CE7 A;  2X66 A;  1MMD A;  3CWZ B;  3OBV E;  2BZB A;  1XNQ T;  2DCF A;  4ISS A;  1NEN A;  5LMU T;  4YT0 A;  4NUV A;  3PUR A;  2XJ7 A;  2D5U A;  2YOE A;  4WYV A;  3NRX A;  1W0B A;  4B3S T;  4MFR A;  5LHI B;  2V5C A;  2VL0 A;  4JI6 T;  5CGM A;  4IE0 A;  4IST A;  3MJX A;  4LFC T;  5EK3 A;  2UU9 T;  3AAE B;  2XAH B;  2BVL A;  3GWH A;  2JQ9 A;  3F2E A;  2D0T A;  3NKZ A;  3PUS A;  1YD8 G;  3JAE A;  3TKL B;  3FBL A;  4U33 A;  1MIW A;  4CI1 B;  4I0U A;  3PUW F;  4JEU B;  2ZM6 T;  1JNR A;  2YK0 A;  5LGU B;  4ZEY A;  1XWM A;  4LFA T;  3ZCJ A;  2NP9 A;  4CI3 B;  3ESL A;  1US7 B;  4GKJ T;  2ODV A;  3IEE A;  3CVR A;  4YY3 T;  4GK5 E;  3BQK A;  4MLK A;  2XQ9 A;  2ZM8 A;  4DUY T;  3ZKR A;  2CLY C;  2CEA A;  2EHO A;  4NXM T;  4UF0 B;  3Q9D A;  2LRK A;  3H3A A;  3NVO A;  3MXZ A;  1HNX T;  3ZSS A;  2V7J A;  4H9P C;  2YIN A;  5FVK A;  5HEO A;  5M4Y A;  4PJJ A;  3LDQ B;  2CHO A;  3QNU A;  2Q9Q A;  3AE3 A;  3L39 A;  5FXV A;  2FJB A;  2NOX A;  4QX8 B;  3ZMT B;  3ZEF B;  5FNV E;  1SA0 E;  2C0S A;  5JVD E;  2Y6X A;  1IJ5 A;  4JV5 T;  3PE0 A;  3SS1 A;  3UUN A;  4CQI A;  1MIV A;  5LA6 E;  3UU4 A;  3QC9 A;  4H9Q C;  4DV4 T;  1SUM B;  4DMV A;  3CPZ A;  4DMW A;  4DND A;  5ABF A;  2VWA A;  4DV0 T;  2JJ9 A;  3OKQ A;  3B57 A;  1N33 T;  4PW8 A;  2DWG A;  4L0R A;  2LE8 A;  3P7I A;  5DAB A;  3W15 B;  4YTP A;  3EI0 A;  2E8I A;  3EAM A;  3UUX B;  1X79 A;  5KXJ A;  1JNZ A;  1WFD A;  4EGW A;  2K9A A;  2WM9 A;  3IBP A;  4XAX B;  4O2A E;  3ZC0 A;  3VRA A;  5CA1 E;  2W66 A;  3DTO A;  3N2G E;  3V5S A;  3F31 A;  2JRK A;  5KX5 E;  2WAU A;  4HFV A;  1XDO A;  1N32 T;  4HKA A;  4U2Y A;  4O4H E;  1Y01 A;  3PV0 F;  3ZT6 A;  5HXR A;  4X1Y E;  2MBG A;  3FZH B;  3ZCI A;  2R6G F;  3Q2M A;  5FXW A;  3Q5E A;  2XAG B;  1G8X A;  5FXZ A;  1ZHC A;  2MPK A;  3LJC A;  5IUX A;  2DL1 A;  5LJM A;  2YDQ A;  5CB4 E;  2LKG A;  4JI4 T;  4G63 A;  4AIS A;  4TX5 A;  3EVY A;  3EUH A;  1GQE A;  4IRE A;  5FKY A;  2XM1 A;  4B6X A;  4QWN B;  4C91 A;  1CUN A;  4DV7 T;  2X0L B;  2CCQ A;  3RQW A;  1HCI A;  2QGS A;  5DQV A;  3C50 A;  4COF A;  1U5P A;  3RIU C;  5ETW A;  3SFD A;  4DV2 T;  2LM9 A;  3O1J A;  4YTN A;  3K1S A;  2LT3 A;  2GK9 A;  3PUY F;  3P50 A;  5FY1 A;  1ZP0 A;  5AQV B;  3RIF A;  4MHC A;  1IBK T;  1VCS A;  3UFG A;  4Z91 A;  3N2O A;  2EHO D;  2BKP A;  4JBW F;  2BS4 A;  5AQJ B;  3HKD E;  4FI5 A;  5CJ5 A;  3AEF A;  2DHR A;  4UEL A;  2PFV A;  4AKH A;  2I0M A;  4UXN B;  4CXW A;  1ZKE A;  4I4T E;  3LFM A;  4PFP A;  1FIO A;  1UCU A;  1ZOY A;  4PNI A;  4HFD A;  4BAY B;  2CXL A;  3AB3 B;  1D1B A;  3RLF F;  5H6R B;  5AQI B;  1MIY A;  4WZX A;  2JQK A;  4TV8 E;  2CBI A;  3ETV A;  2V7K A;  3N9Q A;  3RGL A;  2JIW A;  1J5W A;  2XQ3 A;  4EZH A;  2X9W A;  3KV9 A;  2L8K A;  3ZYL A;  1V9D A;  1BR4 A;  5L47 A;  4AQF C;  4YSX A;  4EEB A;  4K0K T;  3OYX A;  4AKI A;  3GMI A;  3GA8 A;  4HGA A;  2BVM A;  3RC3 A;  2B1E A;  2X67 A;  4HFB A;  3RYF E;  5LXT E;  3RX6 A;  5AQO B;  4ZXL A;  3SOL A;  3ZYK A;  2BG9 B;  2WZH A;  4LF4 T;  2RA1 A;  3ZMU B;  5JR9 C;  2LSK A;  5J1G A;  1D0Y A;  3AEB A;  3N2K E;  3UU3 A;  5JDH A;  4PAG A;  3R6N A;  3O9X A;  3N9L A;  3ONL C;  5JDM A;  2XAQ B;  5L4H A;  4DV1 T;  3LBX A;  3PU8 A;  3ZLI A;  3VKG A;  2UXC T;  3FXD B;  2VQE T;  3VRB A;  1J5E T;  2V26 A;  4V1A v;  4A5X A;  2WU5 A;  4F6R C;  2P9B A;  3KIN B;  4IE7 A;  4DVD A;  4QX7 B;  4YHJ A;  1OED B;  3UU6 A;  4ZS3 A;  2X68 A;  4EED A;  2E9X B;  3KV6 A;  3I0O A;  3KV4 A;  4DR7 T;  2Q9Q C;  4QKN A;  4P0B A;  2RPA A;  4GKK T;  4Z8X A;  4ASK A;  3Q5X A;  5GON E;  4MAL A;  2MYS A;  4L5G A;  1Z8U A;  4PK6 A;  1IBM T;  3CKD A;  4IGU A;  3C64 A;  4QH4 A;  2WY2 A;  3T8O A;  4HWH A;  5HEU A;  3BQL A;  2I6H A;  4GYR A;  4HE8 A;  2V1D B;  5JDQ A;  3U78 A;  4X5T A;  3ONJ A;  5LGN B;  2HN2 A;  4H63 H;  2W00 A;  4CZZ B;  1S35 A;  2LOP A;  2G0U A;  2C5J A;  3K3Q C;  3WAK A;  3FZF B;  3FXE B;  2CXF A;  1W09 A;  4HEA A;  2X0Y A;  3P4R A;  2XQ7 A;  3QUJ A;  2M67 A;  5FY0 A;  1SHZ C;  4O4L E;  2YKS A;  2WB5 A;  3ZST A;  3K3N A;  3AE1 A;  4YHH T;  3NWI A;  4I50 E;  1UX4 A;  2DI4 A;  2J4G A;  3CX8 B;  4IE5 A;  4IL9 A;  2NW9 A;  4A56 A;  3KBU A;  4U2Z A;  4L9I A;  5DQW A;  5HXS A;  4QH5 A;  1T72 A;  2VL8 A;  4IE6 A;  3RHW A;  4A98 A;  4EAH A;  2H7O A;  4JEH B;  3VU7 H;  4JI0 T;  1B7T A;  4F8H A;  2RP4 A;  4UV9 B;  2XQ4 A;  4IL4 A;  3AEE A;  4P1N A;  1UK5 A;  4ZI7 E;  2KMF A;  4B3M T;  2VUR A;  5JRE A;  2FJD A;  4U74 A;  1U4Q A;  3SWH A;  4GIW A;  2H3R A;  3UT5 E;  4TZ4 C;  2H88 A;  2QYW A;  1HNZ T;  1QUU A;  2IIU A;  3E22 E;  1J1J A;  3RC8 A;  4NIQ A;  3X1D A;  2LRL A;  1AJ3 A;  3M65 A;  4CXX A;  4XZC A;  5ADX L;  4DV5 T;  4HN9 A;  4MBQ A;  3RI5 A;  2LSI A;  3N5L A;  5L3D B;  2W62 A;  5CFB A;  2D2S A;  3JCF A;  4IE4 A;  2CLY B;  1DU2 A;  4TWD A;  2YEV C;  1T8B A;  4ILU A;  4IDZ A;  3DJB A;  5IWA T;  2CMR A;  2UUA T;  2BG9 A;  2ZMA A;  3AAI A;  1FMV A;  5AQS B;  1BR2 A;  2A72 A;  4CN1 A;  2IC9 A;  5LNK A;  2E5V A;  5FY7 A;  5AQK B;  2CWY A;  3RKG A;  5JH7 E;  2UXX B;  5JDN A;  2OA5 A;  1KNR A;  5C8Y E;  3PTR B;  3UTK A;  3RYC E;  4CI2 B;  2HPL A;  3IF8 B;  5JDL A;  4OFZ A;  3IHR A;  4DBQ A;  3CK6 A;  4KBM B;  5FYM A;  4UVC B;  3ZMS B;  4DR5 T;  2KWH A;  2V6X A;  3CQC B;  5F8P A;  4U7Y A;  2AE9 A;  2XAS B;  1FJG T;  2BBH A;  3KVB A;  4UIG A;  2BS3 A; 
#chains in the Genus database with same CATH homology
 2W2U A;  4P1N A;  2WY2 A;  2V6Y A;  2LRK A;  2JQH A;  2V6X A;  1WR0 A;  3ZT7 A;  4NIQ A;  4U7I A;  4A5X A;  3ZSS A;  2LRL A;  4U2Z A;  3EAB A;  2WWV A;  1WCR A;  4CN4 A;  5FVK A;  1YXR A;  2RPA A;  2K3W A;  5CGM A;  2CPT A;  3ZST A;  4U7Y A;  4U33 A;  4U31 A;  5FVL A;  4IT4 A;  4U2Y A;  4U3C A;  2MPK A;  5LB7 B;  5CJ5 A;  2A9U A;  1WFD A;  2V6Y B;  2DL1 A;  4CN6 A;  4WZX A;  2JQK A;  2CRB A;  4ZEY A;  3K1S A;  2XZE A;  3ZT6 A;  3ZT5 A;  4CN1 A;  2JQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...