4U7YA

Structure of the complex of vps4b mit and ist1 mim
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
83
structure length
83
Chain Sequence
MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein 4B
total genus 34
structure length 83
sequence length 83
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7yA00
2XZEA 2V6YB 4U7YA 1WCRA 4U2ZA 5CJ5A 1WFDA 2CRBA 2DL1A 2WY2A 5LB7B 4NIQA 4WZXA 3ZSTA 4U2YA 2MPKA 2WWVA 4A5XA 4P1NA 4U31A 3ZT6A 2CPTA 2K3WA 2JQ9A 5FVKA 4CN4A 2JQKA 3ZT5A 4CN1A 1WR0A 1YXRA 2V6YA 4CN6A 3ZT7A 5CGMA 4ZEYA 2LRKA 3K1SA 2V6XA 5FVLA 2RPAA 2JQHA 2LRLA 2A9UA 4U7IA 4U3CA 4U33A 2W2UA 3ZSSA 4IT4A 3EABA
chains in the Genus database with same CATH superfamily
2XQ7A 3F57A 3NRYA 3X1DA 4YLHA 5CJ5A 3JADA 3LFMA 2CWYA 2PJQA 2X68A 4YTNA 1HFAA 2UUAT 4DV6T 4F8HA 2X0LB 4ILBA 2V7KA 2I59A 5FY1A 1D0XA 3RKGA 3SWHA 5LYJE 1MIYA 1VRBA 5LA6E 2Q9QD 5JDMA 1ZV4X 4A5XA 4DBQA 1YD8G 1MMAA 4P1NA 1H7CA 3ZMZB 3KBUA 3CPZA 5C8YE 2WDRA 4TWFA 4N78D 3LBXB 3MZKB 4CN1A 2OA5A 2N2NA 2PFVA 2WDQA 3AVSA 5A1LA 3MJXA 5JR9C 4DV4T 4B3MT 5F8PA 2MYSA 4ZS2A 5ABHA 2MOZA 2NWBA 2E5LT 3BQKA 1QSDA 2QVAA 4ZI3D 4DR5T 4O2BE 3U3IA 3KINB 4IDPA 2PBIA 3J9X1 2EHOB 1UUSA 4NUVA 2RA1A 5HCJA 4TUYE 4KI0F 4XBFB 5JDNA 2Q9QC 5AQIB 2W63A 2BVLA 5LHGB 2V7LA 4KUMB 2WZHA 2CCQA 4IIJE 2J47A 3SRZA 2ODVA 5EZYE 1ZKEA 3RC8A 3OYXA 3PU8A 3AXJB 3QB5K 4QXBB 4IE6A 2ZM0A 3PTRB 4WNKA 2WWUA 1N34T 3EUHA 5EK3A 2B1EA 5DABA 4CI2B 2UUBT 4AKGA 3ZSTA 2X51A 3C50A 3ETVA 3JAFA 4GK5E 4HFBA 4ILUA 2DHRA 3KDSE 4G63A 4QH5A 4X1KE 3TLSA 3OBVE 2EHOD 2LEHA 2JQ9A 1ZHCA 2BDEA 2BBHA 2HH7A 3AE8A 3CQGB 3JC6C 4MALA 3R6NA 3V5SA 4CN4A 4MHCA 4AKIA 4LF9T 4DVDA 5C2TA 3FHNA 1HG5A 5JH7E 5LP6E 5HXRA 4AKRB 1SE7A 3NBXX 2DLRA 5HYAA 4CXYA 1BR4A 5AQVB 3ZC0A 4DR6T 3BQLA 3AE5A 4LFCT 3HKCE 3L39A 4IHJE 4LF8T 3QUJA 5BR8T 4YXDA 4JI7T 3CWZB 4O4IE 3P4RA 2XSBA 3DJBA 1LVFA 3AAAB 3QB5A 4IGUA 4OYKA 4U2ZA 4X1IE 4H9PC 2HHHT 3TKLB 2JJ9A 3O4XE 3OPCA 3K3QC 2OLTA 5LCYA 5HAXA 2H89A 3Q5EA 1IBLT 4H9NC 2XQ6A 3KBTA 2C0SA 4HE8A 4OFZA 3UQ7A 1IJ5A 4K0KT 2W4XA 5L47A 4H9RC 4E7SA 4YTPA 3AA0B 4DR1T 1Z0PA 2JPFA 3I9WA 3OVUA 3WAJA 1AJ3A 5AQMB 3PUSA 4H63H 2XQ4A 2SPCA 2KT9A 3C51A 5FY7A 2WU5A 3NKZA 4AXPA 4EEBA 3K3NA 1OEDA 1XWMA 4IE0A 3I1AA 2V6YA 1J1JA 2AXDS 2ES0A 3N2OA 2V26A 4JEHB 1KEYA 4ISSA 1J5WA 5L4HA 4BA9A 2D0TA 2OV9A 3P4QA 5KX5E 1BR1A 4XAXB 3CX7B 2CBIA 2XHEB 3D0TA 3QC9A 4QWNB 5CA1E 5AQLB 1OEDE 2VL0A 2E9XC 3AEBA 4M1PA 1UX4A 4WBOA 2IIUA 3F31A 4CXWA 2BKPA 3P50A 3IBPA 4P09A 3DP7A 4KHPT 2XQ3A 4EZ4A 2J1DG 4I50E 5HEJA 5M4YA 3PUGA 5IWAT 1G73A 1WYBA 5LB7B 3FZMB 4LF7T 3N2GE 4HFDA 4MBQA 4PFPA 2BBJA 3PUZF 4UF0B 5LMUT 1IBKT 1YQ3A 1HNXT 3AA1B 3ONJA 1N32T 5JDGA 3G06A 4ZXLA 3FXEB 3RYCE 1N33T 1LKXA 4L0RA 3TLVA 4EYUA 4DR2T 2LSJA 5H6RB 2BKNA 4TNWA 4O4JE 5LJMA 2W62A 2XJ7A 3RHWA 2I6HA 2BS3A 3LDQB 4X20E 1B7TA 2XAGB 4O4HE 3KV9A 4DV7T 5L3FB 3T1YT 4NXMT 4P0AA 4UEMA 5FXZA 1BR2A 4EZHA 1UX5A 3RKOA 3RX6A 5FY0A 4WBNE 1WYCA 4L9IA 2Z6EA 4AQGA 1EZ3A 3MA9A 4QX7B 4TX5A 4EAHA 5LMNT 4JI1T 1T98A 5HXEA 2CLYB 2UU9T 2VKHA 4Q25A 1MNDA 3KV6A 4PJMA 5FL0A 2KINB 3RF1A 2W67A 1QUUA 2VQFT 2B76A 3AEEA 4UVCB 3UTKA 4A98A 2K24A 3L8RA 4H63V 5CB4E 2E2AA 3HKDE 3P4WA 2H88A 2E9XD 3Q5DA 5DQWA 3UUMA 2WCAA 3AXJA 2BG9C 2CPTA 1HR0T 4LFAT 2QA7A 3U78A 1MMNA 3SFDA 4AQFA 4ANJA 4JYAT 3VKGA 2I0MA 3FB2A 5CA0E 3PUYF 4H9OC 3ZT7A 4DMWA 3K1SA 3N9PA 2YDSA 4GYRA 4QXCB 4PK5A 3FZFB 1NWMX 3RH3A 2LOPA 2WMNA 2VL8A 4U7IA 3FZLB 3LK3B 4HWCA 4TWHA 4BJNA 4YHHT 2VKDA 4PK6A 4JI8T 1OWAA 3HI2A 2W61A 4PW8A 4WW0A 2Q9QA 2XM2A 1HX1B 3ZJ2A 1FJGT 2WY2A 5IYZE 2QYWA 3AECA 2LJLA 4HN9A 4MLKA 5HWXA 3UQ4A 4P0BA 4PFOA 4YJ3E 1T72A 4LMLA 3AEDA 3B5MA 4TZ4C 4I0UA 5JRCA 4LMJA 3P8CD 2H3RA 4HFEA 1HNWT 3NZPA 3C4XA 4GKJT 3ZT6A 3PDYA 2JQKA 2X67A 2XAHB 3ANWB 4GYSA 4CN6A 3ESLA 2D5UA 1KFYA 2UUCT 3E08A 4KMCA 3M65A 4YT0A 5C3JA 1L0VA 1D0ZA 2K48A 2L9QA 2XQAA 3WI3A 2CBJA 3EDUA 4ZZCA 5L3EB 2XSAA 3KFWX 2J4GA 2A2FX 2EHOC 1HTJF 1NAFA 2P9BA 2YOEA 4KHZF 4QH1A 4I43B 5FYMA 2DI4A 3ZMUB 5LBQB 4ADZA 3JC6D 2G0UA 3N9NA 4GKKT 5FL1A 4UIGA 3RIUC 4ZI7E 4Z90A 3RC3A 5JR9B 2WU2A 2DL1A 2NTXA 4Z91A 2V1DB 5ABGA 3HKEE 4YSXA 3RYFE 5JREA 3SOLA 5EK2A 2NW7A 2LHRA 4UVBB 4HFVA 3UU3A 2WWVA 4QXHB 2X0HA 4IDOA 4JI3T 4HKAA 2E5VA 5FKYA 3IF8B 4KP3C 1YXRA 1ZP0A 2YDQA 3MXZA 3CX6B 2LRKA 2WM9A 5FXWA 2WSSV 5F5WA 1HCIA 2V6XA 3VU7H 3C98B 3ZN1B 2MBGA 4JUYA 4XZCA 5AFUL 2UXBT 2D9DA 4HWIB 1VCTA 2LSIA 4KX6A 4QHOA 4HEAA 3FZKB 3GMIA 4EIWA 1J5ET 2FBWA 4FJOA 1G8XA 3UU8A 1JNRA 5L3GB 3SS1A 3LK42 4NUUA 3AEGA 2M6BA 2E8IA 2X9WA 3HL6A 4HTEA 4PAGA 4DR4T 2BS4A 2FJDA 2UXDT 1W0AA 4HFCA 2X0YA 3O1IA 4X1YE 3ZLIA 4B6XA 1BR0A 2NOXA 1I94T 3K8PC 5JDFA 2ACZA 5AQRB 2F4VT 5GONE 4YY3T 2VB6A 1D1CA 2YEVC 2K5BB 3CQCB 3N5LA 2CXDA 3AE7A 2IMLA 3OYZA 4U31A 2M6IA 3TLTA 1NEKA 3FBZA 3ZCIA 5F3JA 3E0ZA 2DWKA 1FMVA 3FZHB 5LXTE 2BG9A 2IC6A 3PUXF 2MTQA 3LK2B 4JI0T 3UUNA 1NENA 2WMOA 2WS3A 2XQ5A 4HWFA 4DV0T 4JV5T 2IHR1 3PE0A 5FVLA 3S4UA 3PU3A 4TWDA 3UT5E 5HEUA 3B57A 4JI2T 3KVBA 2ZM2A 2VKOA 3H3MA 5HEGA 4DO0A 5L3CB 4UELA 5KDMC 2YINA 2FJAA 3F2EA 2HN2A 2YN6A 3QNUA 2DCFA 2DNXA 3PUQA 4JEUB 4UVAB 2VURA 5ABFB 3L3PA 1W09A 4IDZA 3PV0F 4GIWA 1O3XA 5LG3A 4C90A 5LNKA 2CWOA 2M67A 4KBMB 5AQSB 4AKHA 3N9QA 2XY8B 3NZQA 4DV2T 2ACXA 4LF5T 1V9DA 5AQHB 4CQIA 5FP3A 3OJAA 3ANWA 2ZM6T 3E22E 2H7VC 3LG7A 4DR7T 2MAWA 5HWYA 3AEAA 5FXVA 1FEWA 3A8YC 3ZYLA 3P4SA 4U3CA 3RI5A 3BK9A 3N9OA 1E7PA 3EABA 2CXFA 3O1JA 4YTMA 5LGUB 2Q9QB 4TV8E 4NPPA 1Y64B 4U7YA 4AIUA 4B3TT 4EOZB 4HFIA 2XUEA 3AA7B 4X64T 2K9AA 3AB3B 3MKDA 5JVDE 4ZI3C 2VWAA 1KK7A 3DTOA 1Z8UA 2XTLA 2WP9A 2XM1A 3KV4A 1WRDA 2YU2A 3EDVA 4HFHA 4QH4A 4ZS3A 3RRCA 5IUXA 3Q9DA 5LHHB 4LF4T 2LHNA 2MPKA 3CVRA 5FMNA 3C64A 1XNQT 2BG9B 2V7MA 4V1Av 4CZZB 4TNVA 4B3RT 2JMHA 3CIRA 1OEDC 1IJ6A 1UURA 5TAOA 3ZC1A 5IHYA 1XDPA 1WR0A 2KMFA 4E7ZA 4DV3T 4DIDB 2CHNA 2NTYA 4LFBT 3B13A 1S35A 3N9MA 2DWGA 2NP9A 5HCMA 5HXCA 4CXXA 4A97A 3Q5XA 2CE7A 2CLYC 5ETWA 2CXLA 1E2AA 3EI0A 2R6GF 3FBLA 4BAYB 2KWIB 2LRLA 5KMGP 4IREA 3QOFA 3RPUA 4EEDA 4IDNA 1QLBA 5HXHA 2NW8A 3JCFA 5AQOB 2WQYA 1WCRA 3AAIA 1XNRT 4ASKA 2CRBA 5LOVE 3O9XA 3RIFA 2YKSA 2BG9E 3V5UA 1M7KA 2IAKA 2X9HA 3HA4A 4EB6E 3EAMA 4X66T 3UFGA 1HX8A 1UGOA 4CI1B 3ONXA 3AE3A 4UV9B 2W66A 3ZEFB 4ZHQE 5J2UE 2Y8DA 5FVKA 2IW5B 5DQVA 2VKJA 5DJQC 2JQQA 2LSKA 2KWHA 2X9XA 4JI6T 4PJJA 2XQ8A 4HWDA 4Z8XA 2RPAA 1YW0A 3PJAA 1JNZA 4ISTA 4DV1T 2VVSA 4O4LE 2V8SV 4U33A 4OYJA 5KXJA 2UXCT 2XQYA 2XZEA 3AE4A 3UU6A 1MIWA 1W0BA 3BQIA 2X9YA 1WFDA 3RYHE 1GQEA 2XASB 3TLUA 1W9RA 3P4PA 5JTGA 2CMRA 2ZMAA 3ZMVB 3NVOA 1LRZA 4J2CA 4C91A 1YQ4A 2EHOA 2LLYA 4YSZA 3C4ZA 2NW9A 4UV8B 5JDQA 4PK4A 4NIQA 2XAJB 4WZXA 4LF6T 4U2YA 1MIVA 3NWIA 2HPLA 1KNRA 3PJAJ 2A3DA 3UU5A 3OTOT 2NR4A 4K0UA 2LSGA 4PNIA 3R84B 4I55E 4X65T 2JRKA 2ZLYA 3ZCJA 5CFBA 5LGTB 1I6ZA 1E1HB 4YHJA 2JIWA 1YKHB 4CI3B 5L2LA 5AQNB 3AVRA 4HWHA 1OXZA 5LJNA 2Y48B 4GK0E 2UXXB 2LKGA 4GOUA 3UFEA 2VVNA 1XDOA 4YJ2E 1MMGA 2Y6XA 5J1GA 4EXTA 4B3ST 3VKHA 3CK6A 1WR6A 5AQGB 4DMVA 2W0GA 4UXNB 4AKLA 3PUWF 3IEEA 2W2UA 5AQQB 5J0ZA 4X62T 5HEOA 3VR8A 4IE7A 2WDVA 3VHLA 2BZBA 1S94A 3LSVA 3VRAA 3AAEB 3RIAA 2N9DA 1WLXA 4UR9A 5LHIB 2VQET 1R8IA 3AEFA 5AQFB 2KNDA 4H9QC 2ODUA 3ZPOA 4OX9T 3PURA 1IAPA 3OKQA 2VK9A 3ZKRA 3A7MA 3ONLC 3GWHA 3ZMTB 4EGWA 1D0YA 3IA3A 1VCSA 5E0OA 1T8BA 3MK7C 2LSYA 2XQ9A 3RQUA 1FMWA 3LBXA 2BS2A 1XMQT 3M3ZB 1UCUA 2YK0A 4ILCA 1Y01A 2LM2A 4IL9A 2CEAA 2N1GA 2FJEA 2LM9A 4YFSA 1CUNA 4JBWF 2CHOA 1KNPA 3ZN0B 4AQFC 3T8OA 2L3LA 4U72A 1DU2A 3CKDA 4JI4T 3AE6A 2CM0A 2IC9A 2CA5A 3CQXC 4L5GA 3EVYA 1VOMA 5BMVE 2LE8A 3W15B 1ZOYA 2WAUA 2WBLA 1MMDA 3RIUA 2XAQB 1KNZA 3Q2MA 1M62A 5EK4A 2HN1A 3UUXB 4ILAA 1OEDB 2KSRA 2E9XA 3L09A 5L3DB 1SUMB 3HR0A 4OHFA 4HGAA 2V5DA 4AISA 1SA0E 5JQGE 2FUPA 2L8KA 4F6RC 2X66A 3ZYKA 3CMLA 3T1HT 4YSYA 2C5JA 1U4QA 2V7IA 4WYVA 5L4EA 1ZEEA 3ABVA 3FXDB 3HKBE 2RP4A 3C4WA 3VR9A 4DNDA 2A72A 2V7JA 4JLEA 2XAFB 3O1HA 4IDQA 5AQPB 2W00A 2D0UA 1MNEA 5CGMA 2XPKA 4UF0A 2ZM8A 4AQYT 5JDHA 4AI6A 5LBMA 1T7SA 2WB5A 3I9YA 3SFEA 3UUBA 5HXSA 3ZJ1A 2BKOA 3ZSSA 4G2AA 4LMKA 1US7B 5ADXL 1SHZC 3N2KE 1HS7A 1YKEB 3AE9A 4IT4A 2V6YB 4FI5A 5AQUB 1D1AA 1X79A 5FXXA 4MFRA 4DR3T 3KV5A 3N9LA 2GK9A 3EHZA 5HEHA 2WZIA 3H37A 4IL4A 5JDLA 4U74A 2LT3A 4ZI2D 5JRCB 2C5KT 4TN7B 1KF6A 5J2TE 4DUZT 2BVMA 4QX8B 1N36T 1CHUA 3ZYMA 3JAEA 5JR9A 3NRXA 2K3WA 3IHRA 2PG8A 3KVAA 3GN5B 3PUAA 3RGLA 3WAKA 1X9BA 3I0OA 5AQJB 2IDOB 3ZT5A 3J7Yq 1FIOA 3LJCA 2LOSA 5AQTB 1IBMT 2QGSA 2QRXA 2KLQA 2JQHA 2J62A 3ETUA 4H9SE 3MACA 3A5XA 4IE5A 4O8SA 2VASA 4EYYR 1HF8A 4ERRA 3UULA 5ABEA 3TLWA 1LVKA 1U5PA 2PTFA 4IE4A 4EV6A 3PUVF 1IZNB 3AE2A 3AE1A 3VRBA 5LG4A 4OK0A 5LGNB 3GA8A 4ZZBA 1HNZT 3H3AA 4TV9E 3P7IA 4DBRA 4I4TE 4PJNA 4PJLA 3RYIE 1HG2A 4NXNT 4A56A 1UK5A 3CX8B 5AQKB 2C5IT 4DV5T 4X5TA 5L3BB 1D1BA 3QK6A 3RLFF 2V5CA 2H7OA 3K3OA 3Q5WA 4JI5T 5H6QB 2HPJA 2KZ7B 3UU4A 1XZYA 2D2SA 4ZEYA 3GN5A 3I0QA 3AA6B 4BJMA 4COFA 4ZI2C 1XMOT 3RQWA 2UXNB 2JMKA 2YDRA 2IUBA 2E9XB 4ZOLE 3RRWA 2FJBA 2A9UA 2YU1A 5ABFA 2LKHA 4DUYT 2KXPB 4O2AE 5FNVE 4QKNA 3ZMSB 2AE9A
chains in the Genus database with same CATH topology
2XZEA 2V6YB 4U7YA 1WCRA 4U2ZA 5CJ5A 1WFDA 2CRBA 2DL1A 2WY2A 5LB7B 4NIQA 4WZXA 3ZSTA 4U2YA 2MPKA 2WWVA 4A5XA 4P1NA 4U31A 3ZT6A 2CPTA 2K3WA 2JQ9A 5FVKA 4CN4A 2JQKA 3ZT5A 4CN1A 1WR0A 1YXRA 2V6YA 4CN6A 3ZT7A 5CGMA 4ZEYA 2LRKA 3K1SA 2V6XA 5FVLA 2RPAA 2JQHA 2LRLA 2A9UA 4U7IA 4U3CA 4U33A 2W2UA 3ZSSA 4IT4A 3EABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZE A;  2V6Y B;  4U7Y A;  1WCR A;  4U2Z A;  5CJ5 A;  1WFD A;  2CRB A;  2DL1 A;  2WY2 A;  5LB7 B;  4NIQ A;  4WZX A;  3ZST A;  4U2Y A;  2MPK A;  2WWV A;  4A5X A;  4P1N A;  4U31 A;  3ZT6 A;  2CPT A;  2K3W A;  2JQ9 A;  5FVK A;  4CN4 A;  2JQK A;  3ZT5 A;  4CN1 A;  1WR0 A;  1YXR A;  2V6Y A;  4CN6 A;  3ZT7 A;  5CGM A;  4ZEY A;  2LRK A;  3K1S A;  2V6X A;  5FVL A;  2RPA A;  2JQH A;  2LRL A;  2A9U A;  4U7I A;  4U3C A;  4U33 A;  2W2U A;  3ZSS A;  4IT4 A;  3EAB A; 
#chains in the Genus database with same CATH topology
 2XQ7 A;  3F57 A;  3NRY A;  3X1D A;  4YLH A;  5CJ5 A;  3JAD A;  3LFM A;  2CWY A;  2PJQ A;  2X68 A;  4YTN A;  1HFA A;  2UUA T;  4DV6 T;  4F8H A;  2X0L B;  4ILB A;  2V7K A;  2I59 A;  5FY1 A;  1D0X A;  3RKG A;  3SWH A;  5LYJ E;  1MIY A;  1VRB A;  5LA6 E;  2Q9Q D;  5JDM A;  1ZV4 X;  4A5X A;  4DBQ A;  1YD8 G;  1MMA A;  4P1N A;  1H7C A;  3ZMZ B;  3KBU A;  3CPZ A;  5C8Y E;  2WDR A;  4TWF A;  4N78 D;  3LBX B;  3MZK B;  4CN1 A;  2OA5 A;  2N2N A;  2PFV A;  2WDQ A;  3AVS A;  5A1L A;  3MJX A;  5JR9 C;  4DV4 T;  4B3M T;  5F8P A;  2MYS A;  4ZS2 A;  5ABH A;  2MOZ A;  2NWB A;  2E5L T;  3BQK A;  1QSD A;  2QVA A;  4ZI3 D;  4DR5 T;  4O2B E;  3U3I A;  3KIN B;  4IDP A;  2PBI A;  3J9X 1;  2EHO B;  1UUS A;  4NUV A;  2RA1 A;  5HCJ A;  4TUY E;  4KI0 F;  4XBF B;  5JDN A;  2Q9Q C;  5AQI B;  2W63 A;  2BVL A;  5LHG B;  2V7L A;  4KUM B;  2WZH A;  2CCQ A;  4IIJ E;  2J47 A;  3SRZ A;  2ODV A;  5EZY E;  1ZKE A;  3RC8 A;  3OYX A;  3PU8 A;  3AXJ B;  3QB5 K;  4QXB B;  4IE6 A;  2ZM0 A;  3PTR B;  4WNK A;  2WWU A;  1N34 T;  3EUH A;  5EK3 A;  2B1E A;  5DAB A;  4CI2 B;  2UUB T;  4AKG A;  3ZST A;  2X51 A;  3C50 A;  3ETV A;  3JAF A;  4GK5 E;  4HFB A;  4ILU A;  2DHR A;  3KDS E;  4G63 A;  4QH5 A;  4X1K E;  3TLS A;  3OBV E;  2EHO D;  2LEH A;  2JQ9 A;  1ZHC A;  2BDE A;  2BBH A;  2HH7 A;  3AE8 A;  3CQG B;  3JC6 C;  4MAL A;  3R6N A;  3V5S A;  4CN4 A;  4MHC A;  4AKI A;  4LF9 T;  4DVD A;  5C2T A;  3FHN A;  1HG5 A;  5JH7 E;  5LP6 E;  5HXR A;  4AKR B;  1SE7 A;  3NBX X;  2DLR A;  5HYA A;  4CXY A;  1BR4 A;  5AQV B;  3ZC0 A;  4DR6 T;  3BQL A;  3AE5 A;  4LFC T;  3HKC E;  3L39 A;  4IHJ E;  4LF8 T;  3QUJ A;  5BR8 T;  4YXD A;  4JI7 T;  3CWZ B;  4O4I E;  3P4R A;  2XSB A;  3DJB A;  1LVF A;  3AAA B;  3QB5 A;  4IGU A;  4OYK A;  4U2Z A;  4X1I E;  4H9P C;  2HHH T;  3TKL B;  2JJ9 A;  3O4X E;  3OPC A;  3K3Q C;  2OLT A;  5LCY A;  5HAX A;  2H89 A;  3Q5E A;  1IBL T;  4H9N C;  2XQ6 A;  3KBT A;  2C0S A;  4HE8 A;  4OFZ A;  3UQ7 A;  1IJ5 A;  4K0K T;  2W4X A;  5L47 A;  4H9R C;  4E7S A;  4YTP A;  3AA0 B;  4DR1 T;  1Z0P A;  2JPF A;  3I9W A;  3OVU A;  3WAJ A;  1AJ3 A;  5AQM B;  3PUS A;  4H63 H;  2XQ4 A;  2SPC A;  2KT9 A;  3C51 A;  5FY7 A;  2WU5 A;  3NKZ A;  4AXP A;  4EEB A;  3K3N A;  1OED A;  1XWM A;  4IE0 A;  3I1A A;  2V6Y A;  1J1J A;  2AXD S;  2ES0 A;  3N2O A;  2V26 A;  4JEH B;  1KEY A;  4ISS A;  1J5W A;  5L4H A;  4BA9 A;  2D0T A;  2OV9 A;  3P4Q A;  5KX5 E;  1BR1 A;  4XAX B;  3CX7 B;  2CBI A;  2XHE B;  3D0T A;  3QC9 A;  4QWN B;  5CA1 E;  5AQL B;  1OED E;  2VL0 A;  2E9X C;  3AEB A;  4M1P A;  1UX4 A;  4WBO A;  2IIU A;  3F31 A;  4CXW A;  2BKP A;  3P50 A;  3IBP A;  4P09 A;  3DP7 A;  4KHP T;  2XQ3 A;  4EZ4 A;  2J1D G;  4I50 E;  5HEJ A;  5M4Y A;  3PUG A;  5IWA T;  1G73 A;  1WYB A;  5LB7 B;  3FZM B;  4LF7 T;  3N2G E;  4HFD A;  4MBQ A;  4PFP A;  2BBJ A;  3PUZ F;  4UF0 B;  5LMU T;  1IBK T;  1YQ3 A;  1HNX T;  3AA1 B;  3ONJ A;  1N32 T;  5JDG A;  3G06 A;  4ZXL A;  3FXE B;  3RYC E;  1N33 T;  1LKX A;  4L0R A;  3TLV A;  4EYU A;  4DR2 T;  2LSJ A;  5H6R B;  2BKN A;  4TNW A;  4O4J E;  5LJM A;  2W62 A;  2XJ7 A;  3RHW A;  2I6H A;  2BS3 A;  3LDQ B;  4X20 E;  1B7T A;  2XAG B;  4O4H E;  3KV9 A;  4DV7 T;  5L3F B;  3T1Y T;  4NXM T;  4P0A A;  4UEM A;  5FXZ A;  1BR2 A;  4EZH A;  1UX5 A;  3RKO A;  3RX6 A;  5FY0 A;  4WBN E;  1WYC A;  4L9I A;  2Z6E A;  4AQG A;  1EZ3 A;  3MA9 A;  4QX7 B;  4TX5 A;  4EAH A;  5LMN T;  4JI1 T;  1T98 A;  5HXE A;  2CLY B;  2UU9 T;  2VKH A;  4Q25 A;  1MND A;  3KV6 A;  4PJM A;  5FL0 A;  2KIN B;  3RF1 A;  2W67 A;  1QUU A;  2VQF T;  2B76 A;  3AEE A;  4UVC B;  3UTK A;  4A98 A;  2K24 A;  3L8R A;  4H63 V;  5CB4 E;  2E2A A;  3HKD E;  3P4W A;  2H88 A;  2E9X D;  3Q5D A;  5DQW A;  3UUM A;  2WCA A;  3AXJ A;  2BG9 C;  2CPT A;  1HR0 T;  4LFA T;  2QA7 A;  3U78 A;  1MMN A;  3SFD A;  4AQF A;  4ANJ A;  4JYA T;  3VKG A;  2I0M A;  3FB2 A;  5CA0 E;  3PUY F;  4H9O C;  3ZT7 A;  4DMW A;  3K1S A;  3N9P A;  2YDS A;  4GYR A;  4QXC B;  4PK5 A;  3FZF B;  1NWM X;  3RH3 A;  2LOP A;  2WMN A;  2VL8 A;  4U7I A;  3FZL B;  3LK3 B;  4HWC A;  4TWH A;  4BJN A;  4YHH T;  2VKD A;  4PK6 A;  4JI8 T;  1OWA A;  3HI2 A;  2W61 A;  4PW8 A;  4WW0 A;  2Q9Q A;  2XM2 A;  1HX1 B;  3ZJ2 A;  1FJG T;  2WY2 A;  5IYZ E;  2QYW A;  3AEC A;  2LJL A;  4HN9 A;  4MLK A;  5HWX A;  3UQ4 A;  4P0B A;  4PFO A;  4YJ3 E;  1T72 A;  4LML A;  3AED A;  3B5M A;  4TZ4 C;  4I0U A;  5JRC A;  4LMJ A;  3P8C D;  2H3R A;  4HFE A;  1HNW T;  3NZP A;  3C4X A;  4GKJ T;  3ZT6 A;  3PDY A;  2JQK A;  2X67 A;  2XAH B;  3ANW B;  4GYS A;  4CN6 A;  3ESL A;  2D5U A;  1KFY A;  2UUC T;  3E08 A;  4KMC A;  3M65 A;  4YT0 A;  5C3J A;  1L0V A;  1D0Z A;  2K48 A;  2L9Q A;  2XQA A;  3WI3 A;  2CBJ A;  3EDU A;  4ZZC A;  5L3E B;  2XSA A;  3KFW X;  2J4G A;  2A2F X;  2EHO C;  1HTJ F;  1NAF A;  2P9B A;  2YOE A;  4KHZ F;  4QH1 A;  4I43 B;  5FYM A;  2DI4 A;  3ZMU B;  5LBQ B;  4ADZ A;  3JC6 D;  2G0U A;  3N9N A;  4GKK T;  5FL1 A;  4UIG A;  3RIU C;  4ZI7 E;  4Z90 A;  3RC3 A;  5JR9 B;  2WU2 A;  2DL1 A;  2NTX A;  4Z91 A;  2V1D B;  5ABG A;  3HKE E;  4YSX A;  3RYF E;  5JRE A;  3SOL A;  5EK2 A;  2NW7 A;  2LHR A;  4UVB B;  4HFV A;  3UU3 A;  2WWV A;  4QXH B;  2X0H A;  4IDO A;  4JI3 T;  4HKA A;  2E5V A;  5FKY A;  3IF8 B;  4KP3 C;  1YXR A;  1ZP0 A;  2YDQ A;  3MXZ A;  3CX6 B;  2LRK A;  2WM9 A;  5FXW A;  2WSS V;  5F5W A;  1HCI A;  2V6X A;  3VU7 H;  3C98 B;  3ZN1 B;  2MBG A;  4JUY A;  4XZC A;  5AFU L;  2UXB T;  2D9D A;  4HWI B;  1VCT A;  2LSI A;  4KX6 A;  4QHO A;  4HEA A;  3FZK B;  3GMI A;  4EIW A;  1J5E T;  2FBW A;  4FJO A;  1G8X A;  3UU8 A;  1JNR A;  5L3G B;  3SS1 A;  3LK4 2;  4NUU A;  3AEG A;  2M6B A;  2E8I A;  2X9W A;  3HL6 A;  4HTE A;  4PAG A;  4DR4 T;  2BS4 A;  2FJD A;  2UXD T;  1W0A A;  4HFC A;  2X0Y A;  3O1I A;  4X1Y E;  3ZLI A;  4B6X A;  1BR0 A;  2NOX A;  1I94 T;  3K8P C;  5JDF A;  2ACZ A;  5AQR B;  2F4V T;  5GON E;  4YY3 T;  2VB6 A;  1D1C A;  2YEV C;  2K5B B;  3CQC B;  3N5L A;  2CXD A;  3AE7 A;  2IML A;  3OYZ A;  4U31 A;  2M6I A;  3TLT A;  1NEK A;  3FBZ A;  3ZCI A;  5F3J A;  3E0Z A;  2DWK A;  1FMV A;  3FZH B;  5LXT E;  2BG9 A;  2IC6 A;  3PUX F;  2MTQ A;  3LK2 B;  4JI0 T;  3UUN A;  1NEN A;  2WMO A;  2WS3 A;  2XQ5 A;  4HWF A;  4DV0 T;  4JV5 T;  2IHR 1;  3PE0 A;  5FVL A;  3S4U A;  3PU3 A;  4TWD A;  3UT5 E;  5HEU A;  3B57 A;  4JI2 T;  3KVB A;  2ZM2 A;  2VKO A;  3H3M A;  5HEG A;  4DO0 A;  5L3C B;  4UEL A;  5KDM C;  2YIN A;  2FJA A;  3F2E A;  2HN2 A;  2YN6 A;  3QNU A;  2DCF A;  2DNX A;  3PUQ A;  4JEU B;  4UVA B;  2VUR A;  5ABF B;  3L3P A;  1W09 A;  4IDZ A;  3PV0 F;  4GIW A;  1O3X A;  5LG3 A;  4C90 A;  5LNK A;  2CWO A;  2M67 A;  4KBM B;  5AQS B;  4AKH A;  3N9Q A;  2XY8 B;  3NZQ A;  4DV2 T;  2ACX A;  4LF5 T;  1V9D A;  5AQH B;  4CQI A;  5FP3 A;  3OJA A;  3ANW A;  2ZM6 T;  3E22 E;  2H7V C;  3LG7 A;  4DR7 T;  2MAW A;  5HWY A;  3AEA A;  5FXV A;  1FEW A;  3A8Y C;  3ZYL A;  3P4S A;  4U3C A;  3RI5 A;  3BK9 A;  3N9O A;  1E7P A;  3EAB A;  2CXF A;  3O1J A;  4YTM A;  5LGU B;  2Q9Q B;  4TV8 E;  4NPP A;  1Y64 B;  4U7Y A;  4AIU A;  4B3T T;  4EOZ B;  4HFI A;  2XUE A;  3AA7 B;  4X64 T;  2K9A A;  3AB3 B;  3MKD A;  5JVD E;  4ZI3 C;  2VWA A;  1KK7 A;  3DTO A;  1Z8U A;  2XTL A;  2WP9 A;  2XM1 A;  3KV4 A;  1WRD A;  2YU2 A;  3EDV A;  4HFH A;  4QH4 A;  4ZS3 A;  3RRC A;  5IUX A;  3Q9D A;  5LHH B;  4LF4 T;  2LHN A;  2MPK A;  3CVR A;  5FMN A;  3C64 A;  1XNQ T;  2BG9 B;  2V7M A;  4V1A v;  4CZZ B;  4TNV A;  4B3R T;  2JMH A;  3CIR A;  1OED C;  1IJ6 A;  1UUR A;  5TAO A;  3ZC1 A;  5IHY A;  1XDP A;  1WR0 A;  2KMF A;  4E7Z A;  4DV3 T;  4DID B;  2CHN A;  2NTY A;  4LFB T;  3B13 A;  1S35 A;  3N9M A;  2DWG A;  2NP9 A;  5HCM A;  5HXC A;  4CXX A;  4A97 A;  3Q5X A;  2CE7 A;  2CLY C;  5ETW A;  2CXL A;  1E2A A;  3EI0 A;  2R6G F;  3FBL A;  4BAY B;  2KWI B;  2LRL A;  5KMG P;  4IRE A;  3QOF A;  3RPU A;  4EED A;  4IDN A;  1QLB A;  5HXH A;  2NW8 A;  3JCF A;  5AQO B;  2WQY A;  1WCR A;  3AAI A;  1XNR T;  4ASK A;  2CRB A;  5LOV E;  3O9X A;  3RIF A;  2YKS A;  2BG9 E;  3V5U A;  1M7K A;  2IAK A;  2X9H A;  3HA4 A;  4EB6 E;  3EAM A;  4X66 T;  3UFG A;  1HX8 A;  1UGO A;  4CI1 B;  3ONX A;  3AE3 A;  4UV9 B;  2W66 A;  3ZEF B;  4ZHQ E;  5J2U E;  2Y8D A;  5FVK A;  2IW5 B;  5DQV A;  2VKJ A;  5DJQ C;  2JQQ A;  2LSK A;  2KWH A;  2X9X A;  4JI6 T;  4PJJ A;  2XQ8 A;  4HWD A;  4Z8X A;  2RPA A;  1YW0 A;  3PJA A;  1JNZ A;  4IST A;  4DV1 T;  2VVS A;  4O4L E;  2V8S V;  4U33 A;  4OYJ A;  5KXJ A;  2UXC T;  2XQY A;  2XZE A;  3AE4 A;  3UU6 A;  1MIW A;  1W0B A;  3BQI A;  2X9Y A;  1WFD A;  3RYH E;  1GQE A;  2XAS B;  3TLU A;  1W9R A;  3P4P A;  5JTG A;  2CMR A;  2ZMA A;  3ZMV B;  3NVO A;  1LRZ A;  4J2C A;  4C91 A;  1YQ4 A;  2EHO A;  2LLY A;  4YSZ A;  3C4Z A;  2NW9 A;  4UV8 B;  5JDQ A;  4PK4 A;  4NIQ A;  2XAJ B;  4WZX A;  4LF6 T;  4U2Y A;  1MIV A;  3NWI A;  2HPL A;  1KNR A;  3PJA J;  2A3D A;  3UU5 A;  3OTO T;  2NR4 A;  4K0U A;  2LSG A;  4PNI A;  3R84 B;  4I55 E;  4X65 T;  2JRK A;  2ZLY A;  3ZCJ A;  5CFB A;  5LGT B;  1I6Z A;  1E1H B;  4YHJ A;  2JIW A;  1YKH B;  4CI3 B;  5L2L A;  5AQN B;  3AVR A;  4HWH A;  1OXZ A;  5LJN A;  2Y48 B;  4GK0 E;  2UXX B;  2LKG A;  4GOU A;  3UFE A;  2VVN A;  1XDO A;  4YJ2 E;  1MMG A;  2Y6X A;  5J1G A;  4EXT A;  4B3S T;  3VKH A;  3CK6 A;  1WR6 A;  5AQG B;  4DMV A;  2W0G A;  4UXN B;  4AKL A;  3PUW F;  3IEE A;  2W2U A;  5AQQ B;  5J0Z A;  4X62 T;  5HEO A;  3VR8 A;  4IE7 A;  2WDV A;  3VHL A;  2BZB A;  1S94 A;  3LSV A;  3VRA A;  3AAE B;  3RIA A;  2N9D A;  1WLX A;  4UR9 A;  5LHI B;  2VQE T;  1R8I A;  3AEF A;  5AQF B;  2KND A;  4H9Q C;  2ODU A;  3ZPO A;  4OX9 T;  3PUR A;  1IAP A;  3OKQ A;  2VK9 A;  3ZKR A;  3A7M A;  3ONL C;  3GWH A;  3ZMT B;  4EGW A;  1D0Y A;  3IA3 A;  1VCS A;  5E0O A;  1T8B A;  3MK7 C;  2LSY A;  2XQ9 A;  3RQU A;  1FMW A;  3LBX A;  2BS2 A;  1XMQ T;  3M3Z B;  1UCU A;  2YK0 A;  4ILC A;  1Y01 A;  2LM2 A;  4IL9 A;  2CEA A;  2N1G A;  2FJE A;  2LM9 A;  4YFS A;  1CUN A;  4JBW F;  2CHO A;  1KNP A;  3ZN0 B;  4AQF C;  3T8O A;  2L3L A;  4U72 A;  1DU2 A;  3CKD A;  4JI4 T;  3AE6 A;  2CM0 A;  2IC9 A;  2CA5 A;  3CQX C;  4L5G A;  3EVY A;  1VOM A;  5BMV E;  2LE8 A;  3W15 B;  1ZOY A;  2WAU A;  2WBL A;  1MMD A;  3RIU A;  2XAQ B;  1KNZ A;  3Q2M A;  1M62 A;  5EK4 A;  2HN1 A;  3UUX B;  4ILA A;  1OED B;  2KSR A;  2E9X A;  3L09 A;  5L3D B;  1SUM B;  3HR0 A;  4OHF A;  4HGA A;  2V5D A;  4AIS A;  1SA0 E;  5JQG E;  2FUP A;  2L8K A;  4F6R C;  2X66 A;  3ZYK A;  3CML A;  3T1H T;  4YSY A;  2C5J A;  1U4Q A;  2V7I A;  4WYV A;  5L4E A;  1ZEE A;  3ABV A;  3FXD B;  3HKB E;  2RP4 A;  3C4W A;  3VR9 A;  4DND A;  2A72 A;  2V7J A;  4JLE A;  2XAF B;  3O1H A;  4IDQ A;  5AQP B;  2W00 A;  2D0U A;  1MNE A;  5CGM A;  2XPK A;  4UF0 A;  2ZM8 A;  4AQY T;  5JDH A;  4AI6 A;  5LBM A;  1T7S A;  2WB5 A;  3I9Y A;  3SFE A;  3UUB A;  5HXS A;  3ZJ1 A;  2BKO A;  3ZSS A;  4G2A A;  4LMK A;  1US7 B;  5ADX L;  1SHZ C;  3N2K E;  1HS7 A;  1YKE B;  3AE9 A;  4IT4 A;  2V6Y B;  4FI5 A;  5AQU B;  1D1A A;  1X79 A;  5FXX A;  4MFR A;  4DR3 T;  3KV5 A;  3N9L A;  2GK9 A;  3EHZ A;  5HEH A;  2WZI A;  3H37 A;  4IL4 A;  5JDL A;  4U74 A;  2LT3 A;  4ZI2 D;  5JRC B;  2C5K T;  4TN7 B;  1KF6 A;  5J2T E;  4DUZ T;  2BVM A;  4QX8 B;  1N36 T;  1CHU A;  3ZYM A;  3JAE A;  5JR9 A;  3NRX A;  2K3W A;  3IHR A;  2PG8 A;  3KVA A;  3GN5 B;  3PUA A;  3RGL A;  3WAK A;  1X9B A;  3I0O A;  5AQJ B;  2IDO B;  3ZT5 A;  3J7Y q;  1FIO A;  3LJC A;  2LOS A;  5AQT B;  1IBM T;  2QGS A;  2QRX A;  2KLQ A;  2JQH A;  2J62 A;  3ETU A;  4H9S E;  3MAC A;  3A5X A;  4IE5 A;  4O8S A;  2VAS A;  4EYY R;  1HF8 A;  4ERR A;  3UUL A;  5ABE A;  3TLW A;  1LVK A;  1U5P A;  2PTF A;  4IE4 A;  4EV6 A;  3PUV F;  1IZN B;  3AE2 A;  3AE1 A;  3VRB A;  5LG4 A;  4OK0 A;  5LGN B;  3GA8 A;  4ZZB A;  1HNZ T;  3H3A A;  4TV9 E;  3P7I A;  4DBR A;  4I4T E;  4PJN A;  4PJL A;  3RYI E;  1HG2 A;  4NXN T;  4A56 A;  1UK5 A;  3CX8 B;  5AQK B;  2C5I T;  4DV5 T;  4X5T A;  5L3B B;  1D1B A;  3QK6 A;  3RLF F;  2V5C A;  2H7O A;  3K3O A;  3Q5W A;  4JI5 T;  5H6Q B;  2HPJ A;  2KZ7 B;  3UU4 A;  1XZY A;  2D2S A;  4ZEY A;  3GN5 A;  3I0Q A;  3AA6 B;  4BJM A;  4COF A;  4ZI2 C;  1XMO T;  3RQW A;  2UXN B;  2JMK A;  2YDR A;  2IUB A;  2E9X B;  4ZOL E;  3RRW A;  2FJB A;  2A9U A;  2YU1 A;  5ABF A;  2LKH A;  4DUY T;  2KXP B;  4O2A E;  5FNV E;  4QKN A;  3ZMS B;  2AE9 A; 
#chains in the Genus database with same CATH homology
 2XZE A;  2V6Y B;  4U7Y A;  1WCR A;  4U2Z A;  5CJ5 A;  1WFD A;  2CRB A;  2DL1 A;  2WY2 A;  5LB7 B;  4NIQ A;  4WZX A;  3ZST A;  4U2Y A;  2MPK A;  2WWV A;  4A5X A;  4P1N A;  4U31 A;  3ZT6 A;  2CPT A;  2K3W A;  2JQ9 A;  5FVK A;  4CN4 A;  2JQK A;  3ZT5 A;  4CN1 A;  1WR0 A;  1YXR A;  2V6Y A;  4CN6 A;  3ZT7 A;  5CGM A;  4ZEY A;  2LRK A;  3K1S A;  2V6X A;  5FVL A;  2RPA A;  2JQH A;  2LRL A;  2A9U A;  4U7I A;  4U3C A;  4U33 A;  2W2U A;  3ZSS A;  4IT4 A;  3EAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...