4U7YA

Structure of the complex of vps4b mit and ist1 mim
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
83
structure length
83
Chain Sequence
MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein 4B
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 34
structure length 83
sequence length 83
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7yA00
2LRLA 1YXRA 3K1SA 2JQ9A 3ZT5A 4U7YA 2XZEA 4U2YA 4A5XA 3EABA 4CN4A 5CGMA 4U7IA 2LRKA 1WCRA 2MPKA 2K3WA 2V6XA 3ZSSA 2V6YB 2JQHA 2CRBA 2RPAA 2V6YA 5FVKA 2A9UA 4ZEYA 1WFDA 4U2ZA 1WR0A 4CN6A 4U3CA 2JQKA 4WZXA 2CPTA 4P1NA 5LB7B 2DL1A 4CN1A 4NIQA 4U33A 3ZSTA 4IT4A 3ZT6A 2W2UA 5FVLA 5CJ5A 3ZT7A 4U31A 2WY2A 2WWVA
chains in the Genus database with same CATH superfamily
1XMOT 5AQSB 3UUBA 4IDPA 4ZS2A 4GKJT 3AA1B 3GN5A 5IUXA 4PW8A 1U4QA 4KP3C 2V1DB 4YHHT 5JQGE 4H9PC 2NW8A 3X1DA 4DNDA 3EHZA 2FJAA 1YXRA 5ABEA 4QKNA 4LF4T 4PAGA 4H9RC 5LBMA 1MMAA 5LJMA 5L4EA 3ANWA 4U2ZA 5M4YA 3RHWA 4DBRA 3PUSA 5FXZA 4X20E 2JQQA 5FY7A 3VRBA 4WBNE 1KNPA 5L4HA 3AEBA 2LT3A 4P09A 3F57A 2YK0A 5J0ZA 3RGLA 3ZCJA 2BS3A 1MIVA 4G63A 4DR2T 1HNXT 4E7ZA 3RIFA 2VL0A 3KVAA 2IAKA 4DR1T 3O9XA 2LM2A 2HN2A 3OBVE 3GA8A 1D0YA 2K5BB 1MMGA 3TLUA 1MNEA 1W09A 1XDOA 3PDYA 4AKHA 3RIUA 2MOZA 2BG9C 5L47A 3ZYKA 5H6RB 5IWAT 4YJ2E 3AB3B 3QB5K 2LHRA 1WRDA 3SFDA 3AEEA 5LHIB 2UUAT 3ZEFB 1FJGT 2XAFB 3VRAA 4AKLA 4TNVA 2VKOA 5C8YE 2D9DA 4I0UA 2LSGA 1KNZA 3FB2A 2BKPA 5AQVB 5CA1E 2WS3A 3O1HA 2SPCA 1B7TA 2H7VC 3W15B 4F6RC 4YJ3E 2XY8B 3AA6B 3EDVA 4H63V 2LE8A 3FZHB 2MAWA 2FJEA 2EHOA 4WBOA 3F2EA 2I6HA 2FUPA 5FXXA 3ABVA 5JDFA 3OVUA 4QHOA 4YSYA 4ANJA 4DMWA 2E9XA 3P4PA 4G2AA 2DL1A 4NXMT 1BR0A 3KBTA 3TLSA 4GOUA 3AE7A 4U31A 3SOLA 5JVDE 3RIAA 1YKHB 5HCJA 2UU9T 5FY0A 2CBJA 5ABFA 2VVNA 3CKDA 2BS4A 5L3DB 3ZC1A 4PK5A 4H9NC 5FVLA 4O8SA 2J47A 2VKDA 4IHJE 4IIJE 4YFSA 2I0MA 1G8XA 2VK9A 3P4RA 3EI0A 4QWNB 4LFBT 3PU3A 4IDOA 3ZN1B 3UUXB 4MALA 3RC8A 4U33A 2NP9A 3ZSTA 4COFA 2NTYA 5HYAA 4JI3T 3FBLA 1FIOA 5ABHA 4NXNT 2VWAA 2XASB 1OEDA 5HXRA 5L3EB 2XQ3A 2JJ9A 2MBGA 5DQWA 4CXXA 3PTRB 4ILCA 4GYSA 4HFEA 3C4ZA 3PUAA 3LK42 2DHRA 4WW0A 2Q9QA 2OA5A 4CI1B 2YDRA 4IGUA 4TV8E 2Y8DA 4PFPA 2KSRA 5IYZE 4KBMB 4N78D 4DV3T 3PUGA 2OLTA 2HPLA 4WNKA 4IL4A 3QB5A 4A97A 1XDPA 3CIRA 4QXHB 1NENA 5CGMA 2LKHA 3AE5A 3C50A 5LOVE 3NKZA 3RIUC 3O4XE 2X0LB 1XMQT 3PUYF 5LA6E 4MHCA 1D1CA 5HXEA 5LB7B 4TV9E 3ZMSB 4DR7T 4OK0A 4EAHA 4CI2B 2BBJA 4I55E 4ZZCA 2DNXA 1MMDA 5FP3A 2XQ8A 5FMNA 2PFVA 2PTFA 2H89A 5FXWA 5TAOA 4MBQA 2CXLA 4LF9T 3R6NA 4B3MT 3RYCE 5HXHA 2G0UA 4TWFA 3ONXA 3R84B 5LG4A 3O1JA 2K9AA 5FKYA 3E22E 4P1NA 2YKSA 3C64A 1IBKT 4UEMA 2W63A 5HCMA 3ZJ2A 3VHLA 3Q5EA 2WQYA 4DV4T 3Q5XA 4NUUA 1JNRA 4ILAA 5FYMA 2X9HA 4HWDA 2BKNA 2V7KA 2N2NA 5EK2A 5DQVA 3CX7B 3F31A 4X62T 4ASKA 3M65A 4IREA 3UT5E 2KINB 4EZHA 3AXJA 1ZEEA 3LSVA 2ODVA 2CCQA 2KXPB 1HNZT 1FMVA 1HCIA 1WFDA 3JAFA 2QRXA 4JI4T 4OYJA 2VVSA 2VKJA 3AAAB 2ACZA 3BQLA 3BQIA 1AJ3A 3OJAA 4DVDA 2E8IA 2WDVA 1SUMB 5L3CB 3AA7B 3ZC0A 2ZLYA 4LF5T 4JBWF 2FJDA 2BVMA 1N32T 5DJQC 3KFWX 3N2KE 1HG2A 3QOFA 4IE0A 5LMUT 4EGWA 1ZHCA 1NWMX 1N36T 2RPAA 3WAJA 4B6XA 4AI6A 2XQAA 1U5PA 1KK7A 2A3DA 3N5LA 3AE8A 4YHJA 4CXWA 4IDQA 2MTQA 1W9RA 4JLEA 4PK4A 3UU8A 1OEDC 2NR4A 2K24A 3ZKRA 3K8PC 2CWYA 4HFVA 5LNKA 5JDNA 2ZMAA 2KMFA 4MLKA 3KV4A 5J1GA 3TKLB 2YOEA 3AE3A 3HKDE 2J62A 3ZYLA 2WWVA 2Q9QC 5HWXA 2D0TA 4B3RT 2JIWA 4GIWA 3MXZA 1T8BA 3ONJA 2V5CA 1V9DA 1IZNB 1US7B 1HX1B 3J9X1 2IHR1 4KMCA 1W0AA 3AEFA 4CZZB 4O2AE 2WZHA 2W0GA 3QUJA 4IDNA 5JDLA 2K48A 2BKOA 4DMVA 1M62A 1YD8G 2C5IT 2A2FX 5C3JA 3N9MA 3IF8B 5AQKB 5C2TA 1YQ4A 3JC6D 3CQCB 5AFUL 4H9QC 2CHNA 5AQRB 4IE5A 4J2CA 2I59A 2JQ9A 3P7IA 3RH3A 4BA9A 3DJBA 3NRXA 4UF0A 1D1BA 2A9UA 2YN6A 4O2BE 2LJLA 3MKDA 3J7Yq 3FZLB 3FBZA 3RRCA 2UXDT 4U74A 4YSXA 4YTMA 4FI5A 3LK2B 5JDQA 4A98A 3OYXA 3K3NA 2WBLA 4ILBA 3CX8B 3V5SA 3P50A 4BJNA 3PJAA 4HWIB 1HG5A 3L39A 4OYKA 5JRCB 2W2UA 3VR8A 3VKGA 2C0SA 1QUUA 3UUNA 2X9WA 2V6XA 4GYRA 2BDEA 2XUEA 2LHNA 4X66T 1ZV4X 4Q25A 3O1IA 1T98A 2LOPA 2LSYA 4TWDA 4L9IA 2M6IA 4DV1T 1BR2A 3EDUA 4DV6T 5LXTE 2DWGA 5CA0E 4PK6A 2BG9E 3CK6A 5LG3A 2H7OA 3CX6B 5ABGA 1QSDA 3UU5A 3KV5A 2V7JA 3K1SA 2LKGA 2MYSA 4XZCA 3CMLA 1UUSA 3LK3B 1XNQT 2KT9A 4LF7T 3RYIE 3TLTA 3ZLIA 4X64T 2IMLA 1SA0E 2B76A 1BR4A 2KNDA 4ZI3D 4JI5T 3OYZA 3AE6A 1I94T 4QH1A 4IDZA 3RQWA 2XAJB 4A5XA 3EVYA 2LRKA 2WP9A 3NRYA 4HEAA 5L3GB 2NWBA 4OX9T 3I9YA 5LBQB 1UGOA 1IBLT 2R6GF 4DR3T 1DU2A 1HR0T 3P4QA 2WU5A 4JYAT 2WDRA 2E2AA 4ZI2D 3I0QA 2A72A 3MA9A 3C4WA 5AQNB 4ADZA 2CWOA 3AEAA 3UQ4A 2JMHA 2L9QA 2X9YA 4AISA 2CLYB 2XAHB 2XSBA 3ZT5A 3PURA 2X66A 3GMIA 4UV8B 2V8SV 3RYFE 3MJXA 3N9OA 1D1AA 3RPUA 3JAEA 4HE8A 5AQIB 5AQHB 3OTOT 5KXJA 2LM9A 5JH7E 2CE7A 4PJJA 3P4SA 3RF1A 1LKXA 3DTOA 1Y01A 4I4TE 1EZ3A 4AQGA 4O4LE 2OV9A 4V1Av 4IE6A 4TNWA 5LHGB 4BAYB 5H6QB 5JTGA 4DR6T 3ANWB 1M7KA 4LMKA 2PJQA 1UCUA 4O4IE 2JQKA 3I1AA 3UU3A 3OKQA 4TWHA 5HEHA 2DLRA 4TUYE 4HN9A 2EHOD 2IIUA 3LBXA 2AE9A 3RC3A 2GK9A 3RQUA 1HNWT 2X51A 3P8CD 3ZPOA 2ACXA 3FZFB 2XJ7A 2E9XD 3NZQA 2W67A 5LGUB 4BJMA 1N34T 5GONE 4HWCA 4CN4A 4DUZT 3L09A 4AXPA 5CFBA 2L8KA 1QLBA 3NWIA 2UXNB 3AEGA 3FZMB 1CHUA 2D2SA 4JUYA 4MFRA 2J1DG 3U78A 4OHFA 1MMNA 3EABA 2UXBT 2IW5B 1UURA 3MZKB 2AXDS 3UUMA 4K0UA 4GKKT 3AECA 5CJ5A 1ZP0A 4DV7T 1UK5A 4P0AA 2IC6A 4UR9A 5BMVE 4UELA 4DBQA 3HA4A 4ZEYA 4OFZA 1T72A 2V7IA 3ZMUB 3M3ZB 2FJBA 1E2AA 4KHPT 3SS1A 1YKEB 2UXCT 5EZYE 2WB5A 2DCFA 2C5JA 1XNRT 4AQYT 2XSAA 2E5LT 4CQIA 3FHNA 4U2YA 2Y6XA 2CA5A 3CQXC 3KDSE 3IHRA 4CN6A 2Q9QD 2HN1A 3V5UA 2EHOB 2CXDA 3ZT6A 2IDOB 2M6BA 4E7SA 4AIUA 2JRKA 2WWUA 2HPJA 2LRLA 4UVAB 3B13A 2VURA 2X0YA 4ZOLE 2H3RA 5JR9B 4Z8XA 3AVRA 4B3ST 2E9XB 3T1HT 3HKEE 1FMWA 4HFBA 2XM2A 2X68A 4JI8T 3E0ZA 2BZBA 1FEWA 4DUYT 2BVLA 3KV9A 2CHOA 3VU7H 4NUVA 3TLVA 2RA1A 4O4JE 3UTKA 5AQQB 2XZEA 3AE9A 3WI3A 3RKOA 1KF6A 4YY3T 5ABFB 5LMNT 3LJCA 2PBIA 5AQFB 3ZMZB 5J2TE 3NZPA 5LP6E 4IE4A 1MIYA 4NIQA 3N9PA 1S35A 4HFIA 4L0RA 2B1EA 4AQFC 3CQGB 3ZSSA 5HEUA 3HR0A 3ESLA 2XQ5A 2UXXB 1MNDA 4CN1A 5AQMB 2NW7A 2CM0A 4TN7B 2M67A 1XWMA 3ZYMA 5FY1A 3EUHA 2W66A 5AQPB 3MACA 4X5TA 1ZKEA 5LGNB 4DO0A 4I43B 3Q5WA 4HFCA 3D0TA 4AKIA 3RKGA 4ZZBA 4ERRA 4YT0A 4U72A 2V7MA 4GK5E 2ODUA 5HEGA 4C91A 1KFYA 2Q9QB 4PFOA 2X9XA 1S94A 5F3JA 2NW9A 1OEDE 2XPKA 2XQ9A 1HF8A 5HEOA 1D0ZA 1WR0A 2Z6EA 3ZMTB 4YSZA 2BBHA 4H63H 3ZJ1A 5DABA 2YINA 1YW0A 4H9OC 1T7SA 3L3PA 2DWKA 1KNRA 2D5UA 3FXDB 4UIGA 1W0BA 3RX6A 4JEHB 5LHHB 4UVBB 5LJNA 4KX6A 4HFHA 2ZM0A 1LVFA 3FZKB 2FBWA 4X65T 3PUVF 1ZOYA 1VCTA 2XM1A 4ZI7E 2CBIA 5JREA 4FJOA 4ISTA 5AQLB 3IEEA 3Q2MA 4X1YE 3CWZB 5ETWA 2XAQB 1I6ZA 4HWHA 1WR6A 3KVBA 3G06A 2X0HA 4JI7T 4PJNA 3KV6A 2XTLA 2IC9A 2L3LA 2XQ7A 3PE0A 4QX7B 3N2OA 1UX4A 2ZM6T 1BR1A 3LDQB 3I9WA 4ILUA 3A5XA 4UXNB 3LFMA 4LMJA 2UUCT 4EZ4A 1IBMT 2CRBA 2CMRA 3Q5DA 5FVKA 4EYUA 5KX5E 5J2UE 3AAEB 2BG9B 3HKCE 3RRWA 3AXJB 4EB6E 1SHZC 1J5ET 4JV5T 1X9BA 2V6YB 4QXBB 3ZN0B 5F8PA 4LF6T 3N9NA 4B3TT 1SE7A 5KDMC 4L5GA 2VQFT 4PJLA 3UFGA 3KBUA 1IJ6A 1Y64B 1J1JA 2JPFA 5HEJA 4EEBA 3JADA 2QGSA 3H3AA 4NPPA 2CEAA 3I0OA 1R8IA 2CPTA 1E1HB 4HGAA 1VCSA 4C90A 4HTEA 5E0OA 1G73A 1L0VA 2WU2A 3JC6C 2K3WA 1WYCA 3HI2A 2RP4A 4Z90A 3C98B 3JCFA 4K0KT 4KHZF 2QA7A 2LOSA 5HAXA 2WAUA 2W00A 3KINB 1HX8A 5FL1A 5JDGA 4HFDA 2NTXA 5F5WA 1NEKA 5FXVA 2KWHA 2XAGB 2W61A 2WM9A 3N9QA 3ONLC 1CUNA 4AKGA 4DV2T 4ZHQE 3PUQA 3UULA 2PG8A 5A1LA 2KLQA 4TZ4C 5JR9A 4XBFB 4U3CA 1HTJF 2ES0A 2N9DA 2CLYC 3E08A 1OWAA 5AQTB 4EEDA 2Y48B 2KWIB 4WYVA 1IJ5A 4AQFA 5EK4A 3GN5B 4JI1T 5JDHA 2N1GA 3CVRA 1LRZA 1HFAA 4H9SE 4Z91A 3UFEA 1WLXA 4DV5T 4ZS3A 1Z0PA 3AA0B 3AE4A 5L3BB 2V26A 4UF0B 5HXSA 4JI6T 4EOZB 5HWYA 4DR4T 3RYHE 2UUBT 4EYYR 5BR8T 3L8RA 1O3XA 2XHEB 3CPZA 4X1KE 4P0BA 1YQ3A 3A8YC 2V7LA 4XAXB 4ZI3C 4JI2T 3IBPA 4KUMB 3U3IA 3N9LA 1MIWA 5CB4E 2CXFA 2YEVC 2LEHA 2WY2A 3QK6A 3T8OA 4UV9B 1D0XA 3LG7A 2C5KT 5LGTB 5L3FB 3C51A 5L2LA 2JQHA 4UVCB 4QX8B 1X79A 3HKBE 2QVAA 1HS7A 2VKHA 2ZM2A 4ZI2C 4EIWA 2QYWA 4CI3B 2P9BA 2LSJA 3Q9DA 3UQ7A 3ETUA 1WYBA 3PJAJ 3MK7C 4F8HA 2JMKA 3AE2A 3AEDA 1OXZA 4HWFA 2WMOA 1JNZA 2XQYA 5AQOB 3N2GE 4JEUB 4JI0T 2YU1A 2MPKA 2KZ7B 2WSSV 4DV0T 3AVSA 3AE1A 4IL9A 2VB6A 4WZXA 3OPCA 4GK0E 3H37A 4LFCT 3IA3A 3K3QC 2BS2A 2V5DA 4O4HE 3VKHA 4QXCB 4EV6A 1WCRA 5JDMA 2YU2A 2WZIA 4YLHA 1LVKA 1J5WA 4AKRB 2ZM8A 2DI4A 5JRCA 3B5MA 3ETVA 5ADXL 4TX5A 4DIDB 4YXDA 5AQJB 2IUBA 2NOXA 2LLYA 4A56A 4HKAA 2EHOC 5AQUB 2BG9A 3ZT7A 2VL8A 2H88A 2LSKA 4LFAT 1Z8UA 3BK9A 2W4XA 5JR9C 4ZXLA 2E9XC 2V6YA 5FNVE 4LMLA 4DR5T 2J4GA 3UU4A 2WDQA 4M1PA 2WCAA 4LF8T 2LSIA 4YTPA 3UU6A 3P4WA 3DP7A 4PNIA 2YDSA 1E7PA 3TLWA 1N33T 3PV0F 5LYJE 5AQGB 2XQ4A 3FXEB 1XZYA 2WMNA 3WAKA 4EXTA 3RLFF 3PUWF 3ZCIA 2YDQA 3RI5A 3K3OA 4ISSA 3QC9A 1VRBA 4CXYA 4U7IA 2VQET 3H3MA 5IHYA 3SFEA 1OEDB 3AAIA 5FL0A 3T1YT 2VASA 3NVOA 3PUXF 4I50E 5LCYA 2HH7A 3SWHA 2D0UA 3S4UA 3PU8A 3LBXB 3VR9A 1IAPA 4U7YA 5KMGP 3NBXX 3B57A 4IE7A 3ZMVB 1NAFA 5EK3A 3PUZF 4PJMA 5HXCA 4IT4A 3EAMA 3HL6A 1GQEA 1UX5A 3BQKA 2HHHT 1KEYA 3C4XA 2XQ6A 4X1IE 1H7CA 2W62A 4QH4A 3SRZA 3GWHA 1VOMA 2X67A 2F4VT 3A7MA 4KI0F 3QNUA 4YTNA 4QH5A 2E5VA
chains in the Genus database with same CATH topology
2LRLA 1YXRA 3K1SA 2JQ9A 3ZT5A 4U7YA 2XZEA 4U2YA 4A5XA 3EABA 4CN4A 5CGMA 4U7IA 2LRKA 1WCRA 2MPKA 2K3WA 2V6XA 3ZSSA 2V6YB 2JQHA 2CRBA 2RPAA 2V6YA 5FVKA 2A9UA 4ZEYA 1WFDA 4U2ZA 1WR0A 4CN6A 4U3CA 2JQKA 4WZXA 2CPTA 4P1NA 5LB7B 2DL1A 4CN1A 4NIQA 4U33A 3ZSTA 4IT4A 3ZT6A 2W2UA 5FVLA 5CJ5A 3ZT7A 4U31A 2WY2A 2WWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRL A;  1YXR A;  3K1S A;  2JQ9 A;  3ZT5 A;  4U7Y A;  2XZE A;  4U2Y A;  4A5X A;  3EAB A;  4CN4 A;  5CGM A;  4U7I A;  2LRK A;  1WCR A;  2MPK A;  2K3W A;  2V6X A;  3ZSS A;  2V6Y B;  2JQH A;  2CRB A;  2RPA A;  2V6Y A;  5FVK A;  2A9U A;  4ZEY A;  1WFD A;  4U2Z A;  1WR0 A;  4CN6 A;  4U3C A;  2JQK A;  4WZX A;  2CPT A;  4P1N A;  5LB7 B;  2DL1 A;  4CN1 A;  4NIQ A;  4U33 A;  3ZST A;  4IT4 A;  3ZT6 A;  2W2U A;  5FVL A;  5CJ5 A;  3ZT7 A;  4U31 A;  2WY2 A;  2WWV A; 
#chains in the Genus database with same CATH topology
 1XMO T;  5AQS B;  3UUB A;  4IDP A;  4ZS2 A;  4GKJ T;  3AA1 B;  3GN5 A;  5IUX A;  4PW8 A;  1U4Q A;  4KP3 C;  2V1D B;  4YHH T;  5JQG E;  4H9P C;  2NW8 A;  3X1D A;  4DND A;  3EHZ A;  2FJA A;  1YXR A;  5ABE A;  4QKN A;  4LF4 T;  4PAG A;  4H9R C;  5LBM A;  1MMA A;  5LJM A;  5L4E A;  3ANW A;  4U2Z A;  5M4Y A;  3RHW A;  4DBR A;  3PUS A;  5FXZ A;  4X20 E;  2JQQ A;  5FY7 A;  3VRB A;  4WBN E;  1KNP A;  5L4H A;  3AEB A;  2LT3 A;  4P09 A;  3F57 A;  2YK0 A;  5J0Z A;  3RGL A;  3ZCJ A;  2BS3 A;  1MIV A;  4G63 A;  4DR2 T;  1HNX T;  4E7Z A;  3RIF A;  2VL0 A;  3KVA A;  2IAK A;  4DR1 T;  3O9X A;  2LM2 A;  2HN2 A;  3OBV E;  3GA8 A;  1D0Y A;  2K5B B;  1MMG A;  3TLU A;  1MNE A;  1W09 A;  1XDO A;  3PDY A;  4AKH A;  3RIU A;  2MOZ A;  2BG9 C;  5L47 A;  3ZYK A;  5H6R B;  5IWA T;  4YJ2 E;  3AB3 B;  3QB5 K;  2LHR A;  1WRD A;  3SFD A;  3AEE A;  5LHI B;  2UUA T;  3ZEF B;  1FJG T;  2XAF B;  3VRA A;  4AKL A;  4TNV A;  2VKO A;  5C8Y E;  2D9D A;  4I0U A;  2LSG A;  1KNZ A;  3FB2 A;  2BKP A;  5AQV B;  5CA1 E;  2WS3 A;  3O1H A;  2SPC A;  1B7T A;  2H7V C;  3W15 B;  4F6R C;  4YJ3 E;  2XY8 B;  3AA6 B;  3EDV A;  4H63 V;  2LE8 A;  3FZH B;  2MAW A;  2FJE A;  2EHO A;  4WBO A;  3F2E A;  2I6H A;  2FUP A;  5FXX A;  3ABV A;  5JDF A;  3OVU A;  4QHO A;  4YSY A;  4ANJ A;  4DMW A;  2E9X A;  3P4P A;  4G2A A;  2DL1 A;  4NXM T;  1BR0 A;  3KBT A;  3TLS A;  4GOU A;  3AE7 A;  4U31 A;  3SOL A;  5JVD E;  3RIA A;  1YKH B;  5HCJ A;  2UU9 T;  5FY0 A;  2CBJ A;  5ABF A;  2VVN A;  3CKD A;  2BS4 A;  5L3D B;  3ZC1 A;  4PK5 A;  4H9N C;  5FVL A;  4O8S A;  2J47 A;  2VKD A;  4IHJ E;  4IIJ E;  4YFS A;  2I0M A;  1G8X A;  2VK9 A;  3P4R A;  3EI0 A;  4QWN B;  4LFB T;  3PU3 A;  4IDO A;  3ZN1 B;  3UUX B;  4MAL A;  3RC8 A;  4U33 A;  2NP9 A;  3ZST A;  4COF A;  2NTY A;  5HYA A;  4JI3 T;  3FBL A;  1FIO A;  5ABH A;  4NXN T;  2VWA A;  2XAS B;  1OED A;  5HXR A;  5L3E B;  2XQ3 A;  2JJ9 A;  2MBG A;  5DQW A;  4CXX A;  3PTR B;  4ILC A;  4GYS A;  4HFE A;  3C4Z A;  3PUA A;  3LK4 2;  2DHR A;  4WW0 A;  2Q9Q A;  2OA5 A;  4CI1 B;  2YDR A;  4IGU A;  4TV8 E;  2Y8D A;  4PFP A;  2KSR A;  5IYZ E;  4KBM B;  4N78 D;  4DV3 T;  3PUG A;  2OLT A;  2HPL A;  4WNK A;  4IL4 A;  3QB5 A;  4A97 A;  1XDP A;  3CIR A;  4QXH B;  1NEN A;  5CGM A;  2LKH A;  3AE5 A;  3C50 A;  5LOV E;  3NKZ A;  3RIU C;  3O4X E;  2X0L B;  1XMQ T;  3PUY F;  5LA6 E;  4MHC A;  1D1C A;  5HXE A;  5LB7 B;  4TV9 E;  3ZMS B;  4DR7 T;  4OK0 A;  4EAH A;  4CI2 B;  2BBJ A;  4I55 E;  4ZZC A;  2DNX A;  1MMD A;  5FP3 A;  2XQ8 A;  5FMN A;  2PFV A;  2PTF A;  2H89 A;  5FXW A;  5TAO A;  4MBQ A;  2CXL A;  4LF9 T;  3R6N A;  4B3M T;  3RYC E;  5HXH A;  2G0U A;  4TWF A;  3ONX A;  3R84 B;  5LG4 A;  3O1J A;  2K9A A;  5FKY A;  3E22 E;  4P1N A;  2YKS A;  3C64 A;  1IBK T;  4UEM A;  2W63 A;  5HCM A;  3ZJ2 A;  3VHL A;  3Q5E A;  2WQY A;  4DV4 T;  3Q5X A;  4NUU A;  1JNR A;  4ILA A;  5FYM A;  2X9H A;  4HWD A;  2BKN A;  2V7K A;  2N2N A;  5EK2 A;  5DQV A;  3CX7 B;  3F31 A;  4X62 T;  4ASK A;  3M65 A;  4IRE A;  3UT5 E;  2KIN B;  4EZH A;  3AXJ A;  1ZEE A;  3LSV A;  2ODV A;  2CCQ A;  2KXP B;  1HNZ T;  1FMV A;  1HCI A;  1WFD A;  3JAF A;  2QRX A;  4JI4 T;  4OYJ A;  2VVS A;  2VKJ A;  3AAA B;  2ACZ A;  3BQL A;  3BQI A;  1AJ3 A;  3OJA A;  4DVD A;  2E8I A;  2WDV A;  1SUM B;  5L3C B;  3AA7 B;  3ZC0 A;  2ZLY A;  4LF5 T;  4JBW F;  2FJD A;  2BVM A;  1N32 T;  5DJQ C;  3KFW X;  3N2K E;  1HG2 A;  3QOF A;  4IE0 A;  5LMU T;  4EGW A;  1ZHC A;  1NWM X;  1N36 T;  2RPA A;  3WAJ A;  4B6X A;  4AI6 A;  2XQA A;  1U5P A;  1KK7 A;  2A3D A;  3N5L A;  3AE8 A;  4YHJ A;  4CXW A;  4IDQ A;  2MTQ A;  1W9R A;  4JLE A;  4PK4 A;  3UU8 A;  1OED C;  2NR4 A;  2K24 A;  3ZKR A;  3K8P C;  2CWY A;  4HFV A;  5LNK A;  5JDN A;  2ZMA A;  2KMF A;  4MLK A;  3KV4 A;  5J1G A;  3TKL B;  2YOE A;  3AE3 A;  3HKD E;  2J62 A;  3ZYL A;  2WWV A;  2Q9Q C;  5HWX A;  2D0T A;  4B3R T;  2JIW A;  4GIW A;  3MXZ A;  1T8B A;  3ONJ A;  2V5C A;  1V9D A;  1IZN B;  1US7 B;  1HX1 B;  3J9X 1;  2IHR 1;  4KMC A;  1W0A A;  3AEF A;  4CZZ B;  4O2A E;  2WZH A;  2W0G A;  3QUJ A;  4IDN A;  5JDL A;  2K48 A;  2BKO A;  4DMV A;  1M62 A;  1YD8 G;  2C5I T;  2A2F X;  5C3J A;  3N9M A;  3IF8 B;  5AQK B;  5C2T A;  1YQ4 A;  3JC6 D;  3CQC B;  5AFU L;  4H9Q C;  2CHN A;  5AQR B;  4IE5 A;  4J2C A;  2I59 A;  2JQ9 A;  3P7I A;  3RH3 A;  4BA9 A;  3DJB A;  3NRX A;  4UF0 A;  1D1B A;  2A9U A;  2YN6 A;  4O2B E;  2LJL A;  3MKD A;  3J7Y q;  3FZL B;  3FBZ A;  3RRC A;  2UXD T;  4U74 A;  4YSX A;  4YTM A;  4FI5 A;  3LK2 B;  5JDQ A;  4A98 A;  3OYX A;  3K3N A;  2WBL A;  4ILB A;  3CX8 B;  3V5S A;  3P50 A;  4BJN A;  3PJA A;  4HWI B;  1HG5 A;  3L39 A;  4OYK A;  5JRC B;  2W2U A;  3VR8 A;  3VKG A;  2C0S A;  1QUU A;  3UUN A;  2X9W A;  2V6X A;  4GYR A;  2BDE A;  2XUE A;  2LHN A;  4X66 T;  1ZV4 X;  4Q25 A;  3O1I A;  1T98 A;  2LOP A;  2LSY A;  4TWD A;  4L9I A;  2M6I A;  4DV1 T;  1BR2 A;  3EDU A;  4DV6 T;  5LXT E;  2DWG A;  5CA0 E;  4PK6 A;  2BG9 E;  3CK6 A;  5LG3 A;  2H7O A;  3CX6 B;  5ABG A;  1QSD A;  3UU5 A;  3KV5 A;  2V7J A;  3K1S A;  2LKG A;  2MYS A;  4XZC A;  3CML A;  1UUS A;  3LK3 B;  1XNQ T;  2KT9 A;  4LF7 T;  3RYI E;  3TLT A;  3ZLI A;  4X64 T;  2IML A;  1SA0 E;  2B76 A;  1BR4 A;  2KND A;  4ZI3 D;  4JI5 T;  3OYZ A;  3AE6 A;  1I94 T;  4QH1 A;  4IDZ A;  3RQW A;  2XAJ B;  4A5X A;  3EVY A;  2LRK A;  2WP9 A;  3NRY A;  4HEA A;  5L3G B;  2NWB A;  4OX9 T;  3I9Y A;  5LBQ B;  1UGO A;  1IBL T;  2R6G F;  4DR3 T;  1DU2 A;  1HR0 T;  3P4Q A;  2WU5 A;  4JYA T;  2WDR A;  2E2A A;  4ZI2 D;  3I0Q A;  2A72 A;  3MA9 A;  3C4W A;  5AQN B;  4ADZ A;  2CWO A;  3AEA A;  3UQ4 A;  2JMH A;  2L9Q A;  2X9Y A;  4AIS A;  2CLY B;  2XAH B;  2XSB A;  3ZT5 A;  3PUR A;  2X66 A;  3GMI A;  4UV8 B;  2V8S V;  3RYF E;  3MJX A;  3N9O A;  1D1A A;  3RPU A;  3JAE A;  4HE8 A;  5AQI B;  5AQH B;  3OTO T;  5KXJ A;  2LM9 A;  5JH7 E;  2CE7 A;  4PJJ A;  3P4S A;  3RF1 A;  1LKX A;  3DTO A;  1Y01 A;  4I4T E;  1EZ3 A;  4AQG A;  4O4L E;  2OV9 A;  4V1A v;  4IE6 A;  4TNW A;  5LHG B;  4BAY B;  5H6Q B;  5JTG A;  4DR6 T;  3ANW B;  1M7K A;  4LMK A;  2PJQ A;  1UCU A;  4O4I E;  2JQK A;  3I1A A;  3UU3 A;  3OKQ A;  4TWH A;  5HEH A;  2DLR A;  4TUY E;  4HN9 A;  2EHO D;  2IIU A;  3LBX A;  2AE9 A;  3RC3 A;  2GK9 A;  3RQU A;  1HNW T;  2X51 A;  3P8C D;  3ZPO A;  2ACX A;  3FZF B;  2XJ7 A;  2E9X D;  3NZQ A;  2W67 A;  5LGU B;  4BJM A;  1N34 T;  5GON E;  4HWC A;  4CN4 A;  4DUZ T;  3L09 A;  4AXP A;  5CFB A;  2L8K A;  1QLB A;  3NWI A;  2UXN B;  3AEG A;  3FZM B;  1CHU A;  2D2S A;  4JUY A;  4MFR A;  2J1D G;  3U78 A;  4OHF A;  1MMN A;  3EAB A;  2UXB T;  2IW5 B;  1UUR A;  3MZK B;  2AXD S;  3UUM A;  4K0U A;  4GKK T;  3AEC A;  5CJ5 A;  1ZP0 A;  4DV7 T;  1UK5 A;  4P0A A;  2IC6 A;  4UR9 A;  5BMV E;  4UEL A;  4DBQ A;  3HA4 A;  4ZEY A;  4OFZ A;  1T72 A;  2V7I A;  3ZMU B;  3M3Z B;  2FJB A;  1E2A A;  4KHP T;  3SS1 A;  1YKE B;  2UXC T;  5EZY E;  2WB5 A;  2DCF A;  2C5J A;  1XNR T;  4AQY T;  2XSA A;  2E5L T;  4CQI A;  3FHN A;  4U2Y A;  2Y6X A;  2CA5 A;  3CQX C;  3KDS E;  3IHR A;  4CN6 A;  2Q9Q D;  2HN1 A;  3V5U A;  2EHO B;  2CXD A;  3ZT6 A;  2IDO B;  2M6B A;  4E7S A;  4AIU A;  2JRK A;  2WWU A;  2HPJ A;  2LRL A;  4UVA B;  3B13 A;  2VUR A;  2X0Y A;  4ZOL E;  2H3R A;  5JR9 B;  4Z8X A;  3AVR A;  4B3S T;  2E9X B;  3T1H T;  3HKE E;  1FMW A;  4HFB A;  2XM2 A;  2X68 A;  4JI8 T;  3E0Z A;  2BZB A;  1FEW A;  4DUY T;  2BVL A;  3KV9 A;  2CHO A;  3VU7 H;  4NUV A;  3TLV A;  2RA1 A;  4O4J E;  3UTK A;  5AQQ B;  2XZE A;  3AE9 A;  3WI3 A;  3RKO A;  1KF6 A;  4YY3 T;  5ABF B;  5LMN T;  3LJC A;  2PBI A;  5AQF B;  3ZMZ B;  5J2T E;  3NZP A;  5LP6 E;  4IE4 A;  1MIY A;  4NIQ A;  3N9P A;  1S35 A;  4HFI A;  4L0R A;  2B1E A;  4AQF C;  3CQG B;  3ZSS A;  5HEU A;  3HR0 A;  3ESL A;  2XQ5 A;  2UXX B;  1MND A;  4CN1 A;  5AQM B;  2NW7 A;  2CM0 A;  4TN7 B;  2M67 A;  1XWM A;  3ZYM A;  5FY1 A;  3EUH A;  2W66 A;  5AQP B;  3MAC A;  4X5T A;  1ZKE A;  5LGN B;  4DO0 A;  4I43 B;  3Q5W A;  4HFC A;  3D0T A;  4AKI A;  3RKG A;  4ZZB A;  4ERR A;  4YT0 A;  4U72 A;  2V7M A;  4GK5 E;  2ODU A;  5HEG A;  4C91 A;  1KFY A;  2Q9Q B;  4PFO A;  2X9X A;  1S94 A;  5F3J A;  2NW9 A;  1OED E;  2XPK A;  2XQ9 A;  1HF8 A;  5HEO A;  1D0Z A;  1WR0 A;  2Z6E A;  3ZMT B;  4YSZ A;  2BBH A;  4H63 H;  3ZJ1 A;  5DAB A;  2YIN A;  1YW0 A;  4H9O C;  1T7S A;  3L3P A;  2DWK A;  1KNR A;  2D5U A;  3FXD B;  4UIG A;  1W0B A;  3RX6 A;  4JEH B;  5LHH B;  4UVB B;  5LJN A;  4KX6 A;  4HFH A;  2ZM0 A;  1LVF A;  3FZK B;  2FBW A;  4X65 T;  3PUV F;  1ZOY A;  1VCT A;  2XM1 A;  4ZI7 E;  2CBI A;  5JRE A;  4FJO A;  4IST A;  5AQL B;  3IEE A;  3Q2M A;  4X1Y E;  3CWZ B;  5ETW A;  2XAQ B;  1I6Z A;  4HWH A;  1WR6 A;  3KVB A;  3G06 A;  2X0H A;  4JI7 T;  4PJN A;  3KV6 A;  2XTL A;  2IC9 A;  2L3L A;  2XQ7 A;  3PE0 A;  4QX7 B;  3N2O A;  1UX4 A;  2ZM6 T;  1BR1 A;  3LDQ B;  3I9W A;  4ILU A;  3A5X A;  4UXN B;  3LFM A;  4LMJ A;  2UUC T;  4EZ4 A;  1IBM T;  2CRB A;  2CMR A;  3Q5D A;  5FVK A;  4EYU A;  5KX5 E;  5J2U E;  3AAE B;  2BG9 B;  3HKC E;  3RRW A;  3AXJ B;  4EB6 E;  1SHZ C;  1J5E T;  4JV5 T;  1X9B A;  2V6Y B;  4QXB B;  3ZN0 B;  5F8P A;  4LF6 T;  3N9N A;  4B3T T;  1SE7 A;  5KDM C;  4L5G A;  2VQF T;  4PJL A;  3UFG A;  3KBU A;  1IJ6 A;  1Y64 B;  1J1J A;  2JPF A;  5HEJ A;  4EEB A;  3JAD A;  2QGS A;  3H3A A;  4NPP A;  2CEA A;  3I0O A;  1R8I A;  2CPT A;  1E1H B;  4HGA A;  1VCS A;  4C90 A;  4HTE A;  5E0O A;  1G73 A;  1L0V A;  2WU2 A;  3JC6 C;  2K3W A;  1WYC A;  3HI2 A;  2RP4 A;  4Z90 A;  3C98 B;  3JCF A;  4K0K T;  4KHZ F;  2QA7 A;  2LOS A;  5HAX A;  2WAU A;  2W00 A;  3KIN B;  1HX8 A;  5FL1 A;  5JDG A;  4HFD A;  2NTX A;  5F5W A;  1NEK A;  5FXV A;  2KWH A;  2XAG B;  2W61 A;  2WM9 A;  3N9Q A;  3ONL C;  1CUN A;  4AKG A;  4DV2 T;  4ZHQ E;  3PUQ A;  3UUL A;  2PG8 A;  5A1L A;  2KLQ A;  4TZ4 C;  5JR9 A;  4XBF B;  4U3C A;  1HTJ F;  2ES0 A;  2N9D A;  2CLY C;  3E08 A;  1OWA A;  5AQT B;  4EED A;  2Y48 B;  2KWI B;  4WYV A;  1IJ5 A;  4AQF A;  5EK4 A;  3GN5 B;  4JI1 T;  5JDH A;  2N1G A;  3CVR A;  1LRZ A;  1HFA A;  4H9S E;  4Z91 A;  3UFE A;  1WLX A;  4DV5 T;  4ZS3 A;  1Z0P A;  3AA0 B;  3AE4 A;  5L3B B;  2V26 A;  4UF0 B;  5HXS A;  4JI6 T;  4EOZ B;  5HWY A;  4DR4 T;  3RYH E;  2UUB T;  4EYY R;  5BR8 T;  3L8R A;  1O3X A;  2XHE B;  3CPZ A;  4X1K E;  4P0B A;  1YQ3 A;  3A8Y C;  2V7L A;  4XAX B;  4ZI3 C;  4JI2 T;  3IBP A;  4KUM B;  3U3I A;  3N9L A;  1MIW A;  5CB4 E;  2CXF A;  2YEV C;  2LEH A;  2WY2 A;  3QK6 A;  3T8O A;  4UV9 B;  1D0X A;  3LG7 A;  2C5K T;  5LGT B;  5L3F B;  3C51 A;  5L2L A;  2JQH A;  4UVC B;  4QX8 B;  1X79 A;  3HKB E;  2QVA A;  1HS7 A;  2VKH A;  2ZM2 A;  4ZI2 C;  4EIW A;  2QYW A;  4CI3 B;  2P9B A;  2LSJ A;  3Q9D A;  3UQ7 A;  3ETU A;  1WYB A;  3PJA J;  3MK7 C;  4F8H A;  2JMK A;  3AE2 A;  3AED A;  1OXZ A;  4HWF A;  2WMO A;  1JNZ A;  2XQY A;  5AQO B;  3N2G E;  4JEU B;  4JI0 T;  2YU1 A;  2MPK A;  2KZ7 B;  2WSS V;  4DV0 T;  3AVS A;  3AE1 A;  4IL9 A;  2VB6 A;  4WZX A;  3OPC A;  4GK0 E;  3H37 A;  4LFC T;  3IA3 A;  3K3Q C;  2BS2 A;  2V5D A;  4O4H E;  3VKH A;  4QXC B;  4EV6 A;  1WCR A;  5JDM A;  2YU2 A;  2WZI A;  4YLH A;  1LVK A;  1J5W A;  4AKR B;  2ZM8 A;  2DI4 A;  5JRC A;  3B5M A;  3ETV A;  5ADX L;  4TX5 A;  4DID B;  4YXD A;  5AQJ B;  2IUB A;  2NOX A;  2LLY A;  4A56 A;  4HKA A;  2EHO C;  5AQU B;  2BG9 A;  3ZT7 A;  2VL8 A;  2H88 A;  2LSK A;  4LFA T;  1Z8U A;  3BK9 A;  2W4X A;  5JR9 C;  4ZXL A;  2E9X C;  2V6Y A;  5FNV E;  4LML A;  4DR5 T;  2J4G A;  3UU4 A;  2WDQ A;  4M1P A;  2WCA A;  4LF8 T;  2LSI A;  4YTP A;  3UU6 A;  3P4W A;  3DP7 A;  4PNI A;  2YDS A;  1E7P A;  3TLW A;  1N33 T;  3PV0 F;  5LYJ E;  5AQG B;  2XQ4 A;  3FXE B;  1XZY A;  2WMN A;  3WAK A;  4EXT A;  3RLF F;  3PUW F;  3ZCI A;  2YDQ A;  3RI5 A;  3K3O A;  4ISS A;  3QC9 A;  1VRB A;  4CXY A;  4U7I A;  2VQE T;  3H3M A;  5IHY A;  3SFE A;  1OED B;  3AAI A;  5FL0 A;  3T1Y T;  2VAS A;  3NVO A;  3PUX F;  4I50 E;  5LCY A;  2HH7 A;  3SWH A;  2D0U A;  3S4U A;  3PU8 A;  3LBX B;  3VR9 A;  1IAP A;  4U7Y A;  5KMG P;  3NBX X;  3B57 A;  4IE7 A;  3ZMV B;  1NAF A;  5EK3 A;  3PUZ F;  4PJM A;  5HXC A;  4IT4 A;  3EAM A;  3HL6 A;  1GQE A;  1UX5 A;  3BQK A;  2HHH T;  1KEY A;  3C4X A;  2XQ6 A;  4X1I E;  1H7C A;  2W62 A;  4QH4 A;  3SRZ A;  3GWH A;  1VOM A;  2X67 A;  2F4V T;  3A7M A;  4KI0 F;  3QNU A;  4YTN A;  4QH5 A;  2E5V A; 
#chains in the Genus database with same CATH homology
 2LRL A;  1YXR A;  3K1S A;  2JQ9 A;  3ZT5 A;  4U7Y A;  2XZE A;  4U2Y A;  4A5X A;  3EAB A;  4CN4 A;  5CGM A;  4U7I A;  2LRK A;  1WCR A;  2MPK A;  2K3W A;  2V6X A;  3ZSS A;  2V6Y B;  2JQH A;  2CRB A;  2RPA A;  2V6Y A;  5FVK A;  2A9U A;  4ZEY A;  1WFD A;  4U2Z A;  1WR0 A;  4CN6 A;  4U3C A;  2JQK A;  4WZX A;  2CPT A;  4P1N A;  5LB7 B;  2DL1 A;  4CN1 A;  4NIQ A;  4U33 A;  3ZST A;  4IT4 A;  3ZT6 A;  2W2U A;  5FVL A;  5CJ5 A;  3ZT7 A;  4U31 A;  2WY2 A;  2WWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...