4U7YA

Structure of the complex of vps4b mit and ist1 mim
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
83
structure length
83
Chain Sequence
MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein 4B
total genus 34
structure length 83
sequence length 83
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7yA00
2JQHA 2V6YB 4U7IA 2K3WA 2CRBA 2JQKA 1YXRA 2LRLA 4U2ZA 4CN6A 4U31A 4ZEYA 2LRKA 3EABA 5LB7B 4NIQA 3ZT6A 4IT4A 2XZEA 4P1NA 4A5XA 2V6XA 2WWVA 3K1SA 2A9UA 4CN1A 5FVKA 2RPAA 1WCRA 2MPKA 2V6YA 2CPTA 2DL1A 2W2UA 4U7YA 3ZSSA 4CN4A 3ZSTA 4U3CA 5CJ5A 4U33A 5CGMA 3ZT7A 5FVLA 1WFDA 1WR0A 2WY2A 4WZXA 3ZT5A 4U2YA 2JQ9A
chains in the Genus database with same CATH superfamily
1NEKA 2H88A 4AQGA 3W15B 3C4ZA 3UFEA 1H7CA 2CM0A 2E9XD 1HFAA 1UX5A 3JAEA 5BR8T 3OBVE 5JRCB 4WBNE 4DUYT 1KK7A 4JYAT 2LEHA 2FBWA 4PJNA 5DABA 1L0VA 3T8OA 4DV5T 3VRAA 4JI0T 1S94A 1KNZA 2V6XA 3N2OA 4UF0A 4YHJA 4FI5A 1U5PA 3FBZA 3LJCA 3MKDA 4KHZF 3LBXA 4KHPT 3C4XA 2BBHA 5JDLA 1E2AA 1X79A 2DI4A 2XQ3A 4X65T 2N2NA 2CXDA 2QYWA 3A7MA 1MNDA 3IA3A 4HWIB 4QHOA 4U3CA 2CWYA 2IW5B 2DLRA 3I9WA 4DVDA 3CK6A 1MIYA 1ZHCA 4WBOA 5AQIB 5LJNA 3RYHE 2UUBT 2NR4A 3VU7H 4ZZBA 1IBMT 3JADA 4L5GA 4EAHA 2QRXA 3AVRA 3GWHA 4H9NC 4JLEA 3ETVA 3N9QA 4TNVA 4DNDA 5KXJA 4EZHA 5HWXA 4YT0A 5J2TE 3EVYA 4NXMT 1OXZA 5JH7E 1XMQT 4H63V 5JDMA 5LP6E 1MIWA 3P4QA 4P1NA 1I94T 3H3MA 3RIUC 1WR6A 1HG5A 3FXEB 3LK3B 1D0ZA 3ONXA 2V7JA 2MBGA 4ZHQE 5IHYA 5HXEA 2HPLA 3OVUA 4GOUA 3RQUA 1WRDA 3I1AA 2EHOB 4IDQA 4WNKA 5H6RB 3TKLB 3UU6A 3UUNA 3N9OA 2VK9A 3SRZA 4CXXA 4Z8XA 4LF7T 1LKXA 2XJ7A 2NTXA 5KMGP 2SPCA 2JMKA 1XDOA 1IBLT 3I0OA 2FJBA 2WB5A 1UX4A 4G63A 5JDQA 2J62A 3RC3A 3PUXF 3J7Yq 2WS3A 2C5KT 2PBIA 2BKPA 2OLTA 3SOLA 4YY3T 4I55E 5HXHA 1T7SA 4PK4A 4UVCB 5JDHA 1JNRA 4JI7T 4HWFA 1SUMB 5AFUL 1ZOYA 2I0MA 4U31A 2PTFA 4CXYA 4TNWA 4U74A 3NRYA 5FKYA 1QLBA 4IE7A 2VASA 5L3FB 1X9BA 4KMCA 5CA0E 4DV3T 1J1JA 1OWAA 4JI8T 4LMKA 4LF6T 2VKOA 3BQLA 4HEAA 2YDSA 4XAXB 5GONE 3P4WA 5JR9C 5LGTB 3AAIA 3RI5A 3RYFE 3Q5DA 1HX1B 3CMLA 3SWHA 4JEHB 4YSXA 4X62T 2V1DB 1Z8UA 4HTEA 2W2UA 3LBXB 4H9QC 4OHFA 4QWNB 3VKGA 3ETUA 4ZS2A 4UF0B 2V5DA 4I43B 1YQ4A 2ACZA 2WP9A 3AE3A 3JAFA 3Q5EA 2KT9A 4O4JE 2VL0A 4N78D 3LFMA 4O2AE 4QKNA 3SFEA 3ZLIA 5HYAA 4JI1T 4LFAT 3FXDB 2H7OA 3OKQA 4ZI2C 3RKOA 3ZJ2A 4OYJA 3GA8A 4P0AA 4DR7T 2OA5A 1M62A 2CA5A 5JQGE 3L8RA 4EIWA 3CPZA 4ISSA 3KFWX 3OTOT 3HKDE 1MNEA 5ABGA 5HXCA 4CQIA 1I6ZA 2X66A 4DR6T 3AXJB 3ANWA 2X9HA 4AQFC 4DIDB 2VKHA 3PUSA 4EYUA 2HN1A 4UEMA 5FMNA 3J9X1 4UVBB 4CN1A 5IYZE 5HEOA 1XZYA 2R6GF 4B3MT 3AECA 1D0XA 3L09A 3LDQB 5AQJB 2D0UA 1BR1A 2BS4A 4MFRA 3V5SA 1HTJF 2Y8DA 4UIGA 3UQ4A 2XY8B 3C50A 4BJNA 5FYMA 3RPUA 5FVLA 3ZT7A 1SA0E 5CFBA 5IUXA 5L47A 2WSSV 4DR2T 4O8SA 3EDVA 1GQEA 2V5CA 3ZYLA 4EEBA 1HNZT 3L3PA 4LF8T 1HNXT 2M6IA 3ZCIA 3QB5A 5L4HA 5DQVA 2H3RA 2X9XA 3FBLA 3IHRA 1UUSA 4M1PA 4Z90A 3AAEB 4U2ZA 4YTPA 2MOZA 5F5WA 2F4VT 3AEGA 5AQHB 5LB7B 1KNPA 3P7IA 1E1HB 1KEYA 3NWIA 5HXSA 3PUWF 5J0ZA 4DBQA 2WDRA 5L3CB 3JCFA 4AKIA 2JQQA 4B3TT 2K24A 2K48A 3LG7A 4PJMA 2JRKA 3N5LA 2KWHA 4GKJT 4AI6A 4PFPA 1FMWA 4IE4A 2NW9A 3CKDA 4QXHB 5AQKB 4ZI3C 4DBRA 5A1LA 4P0BA 4H9RC 5EK2A 2XHEB 3RC8A 1OEDA 2MAWA 1LVKA 3C64A 4HE8A 5HEGA 5ETWA 3RH3A 2BG9E 2VKJA 3B57A 4GK5E 3R84B 1WR0A 2XQAA 4GK0E 4BA9A 1G8XA 2Q9QD 5LMUT 3PV0F 4L0RA 2D5UA 3CVRA 2A72A 2JQHA 2V6YB 3CIRA 4HWCA 3ZMSB 2K3WA 3AEBA 5ABHA 5JREA 2VQET 4AKHA 2KNDA 3IF8B 3CX8B 1FMVA 3PU3A 4H9PC 5F8PA 4L9IA 2WM9A 3QNUA 1YW0A 1NENA 3V5UA 4X20E 5AQRB 3K3OA 4TWDA 5L2LA 2ZM0A 5JTGA 1IAPA 2ZM6T 3WI3A 3ZJ1A 4EB6E 3P4SA 4QXBB 3TLTA 2A9UA 3QC9A 5ABFB 2KSRA 4P09A 4X64T 3C98B 3BQIA 2KLQA 2XQ8A 4ANJA 2FJAA 2LHRA 2LSGA 3RRWA 2XAHB 3PUQA 2IHR1 3TLUA 5LGUB 4DV0T 3FZHB 4YHHT 4X1KE 3N9MA 4MHCA 1WFDA 1S35A 3CWZB 2W4XA 3WAKA 4LMJA 3U78A 4E7ZA 2UUCT 5KDMC 4EZ4A 2A3DA 2C0SA 2NTYA 2WDVA 3BQKA 3PJAJ 1KF6A 2NW7A 4FJOA 3FZFB 2VVNA 5AQSB 2LT3A 1VCSA 3PURA 4K0UA 1T72A 1VCTA 3AE5A 3AE2A 3AAAB 3C51A 5AQPB 4YLHA 2IC6A 3AE4A 2QVAA 1ZV4X 4O4HE 3ZCJA 4DV2T 4G2AA 3X1DA 3GMIA 4CI1B 2JPFA 4IT4A 3T1YT 2BS2A 2C5IT 4IL4A 2BG9B 4X1IE 2IIUA 3PDYA 4E7SA 4OX9T 1Y64B 5ABFA 4X5TA 1MMDA 1US7B 2V7IA 5CJ5A 3N2GE 2ZLYA 3E08A 5LHIB 1WCRA 1LRZA 1WYCA 1W0BA 2MPKA 2ACXA 2CPTA 3HKEE 4Q25A 2LJLA 4TWFA 4IHJE 2Z6EA 2CMRA 2CHNA 3AB3B 3F57A 3OYXA 4ZOLE 5LJMA 3AA0B 4AKRB 1HF8A 5LHHB 5F3JA 4JI6T 1HNWT 3DJBA 4HWDA 1QSDA 3FZLB 4PW8A 2UU9T 1KFYA 3GN5A 1T8BA 4ISTA 5J2UE 3H3AA 4DV7T 2XM2A 4UV8B 2UXDT 3N9PA 1N33T 4TZ4C 2UXCT 4XZCA 2ZMAA 2LRKA 3AEDA 2K9AA 4V1Av 1DU2A 2E9XB 2VQFT 2XTLA 3QB5K 5AQOB 2D2SA 5LG4A 5AQNB 2XAQB 3AEEA 4YFSA 4AQFA 4ZZCA 3SFDA 1G73A 1AJ3A 4YJ2E 2QA7A 2CE7A 2V8SV 3MZKB 3UTKA 2W00A 3UU3A 5FVKA 2QGSA 2V7LA 2KWIB 3PUYF 3UUMA 4H63H 3ZKRA 2DL1A 4YSYA 2LHNA 3QUJA 3L39A 2P9BA 1IJ6A 3N9LA 3OJAA 1OEDE 1T98A 3B5MA 4TWHA 5AQTB 5FY0A 2H89A 4CXWA 2M6BA 2MTQA 3RHWA 1QUUA 3PJAA 4ERRA 2YEVC 1IJ5A 2LLYA 2VURA 5JDFA 5LGNB 4PAGA 2EHOA 3VHLA 5HEJA 2X0LB 3EUHA 2CRBA 1WLXA 3NRXA 2A2FX 2XQ5A 1BR4A 2IDOB 1YKHB 2V26A 3OYZA 3UU5A 3UT5E 3EABA 3VR8A 4TUYE 4COFA 4JI4T 1R8IA 3E22E 3NZQA 3QOFA 4JI5T 1SE7A 4U72A 5L3GB 4F6RC 4DR1T 1WYBA 2ZM8A 5FL0A 4UELA 2WU2A 3KV6A 3P50A 4AIUA 3PTRB 4DMWA 4NXNT 1BR2A 2WZIA 2NW8A 5FXZA 5EZYE 3ZMTB 5BMVE 5FL1A 2XAGB 5HWYA 4HN9A 1N36T 3NBXX 3P4PA 4UVAB 5LHGB 4KP3C 1D1AA 2Q9QC 1CUNA 2LM2A 4Z91A 2LE8A 3RLFF 2DCFA 1FEWA 2XQYA 1HX8A 2XUEA 4MALA 5FP3A 2JQ9A 3PU8A 2CXFA 4DR4T 4ADZA 5FNVE 3VKHA 5HCMA 2PG8A 4QXCB 2CCQA 4DV4T 3G06A 4LF5T 1U4QA 2UXNB 3E0ZA 5EK3A 5AQUB 4AKLA 5J1GA 4IE0A 4CI2B 1JNZA 2XPKA 1HCIA 4NIQA 4WW0A 2ODVA 3RYCE 2W61A 5LYJE 2UXXB 5JR9A 5H6QB 2XSAA 4AISA 1D0YA 2X9YA 4XBFB 3U3IA 2WWVA 4PJJA 3UFGA 3FZKB 4DR3T 3ABVA 5TAOA 2RPAA 5LCYA 5L3BB 2N1GA 2Y48B 3O1JA 2LSKA 4I4TE 4LF4T 3F31A 3ZC0A 4AQYT 3PE0A 1XWMA 4ZI7E 2YDQA 4GYSA 5LBMA 5KX5E 2HHHT 2J1DG 2X9WA 3JC6C 1HG2A 3TLVA 3RRCA 2E2AA 3AXJA 5C3JA 5CB4E 2KMFA 1FIOA 2BS3A 2FUPA 2J4GA 4IDPA 2EHOD 4TV8E 3UULA 3O9XA 3KV5A 3LK2B 3ZN1B 2AXDS 3AA1B 4ILCA 2E5LT 2LSIA 2NWBA 2LOPA 2CBJA 1YXRA 2FJDA 1ZEEA 2LRLA 2VB6A 2X0YA 4HKAA 4GIWA 4O4LE 5HXRA 1MMNA 4O4IE 4CI3B 4A56A 4PK5A 4HGAA 2L8KA 3CQXC 3MACA 3H37A 2CLYB 3AE9A 3MJXA 3N2KE 1VRBA 2NOXA 2XAFB 3Q5XA 2IC9A 2HN2A 3D0TA 4PK6A 3UUXB 3ZMUB 2DWKA 3K1SA 4YTNA 1UK5A 3I0QA 3T1HT 5HEUA 3HR0A 4LF9T 5HAXA 2V6YA 4UV9B 2DWGA 3CQCB 2BDEA 3AA7B 2G0UA 2RP4A 3O1IA 4QH1A 5AQQB 3PUGA 4AKGA 3VR9A 3IEEA 2ZM2A 4TV9E 1HR0T 1NAFA 3MK7C 3M65A 1ZP0A 2WY2A 2Q9QA 3PUVF 3DTOA 4KBMB 1J5WA 3Q5WA 4J2CA 4JEUB 4I50E 4U2YA 2J47A 1BR0A 2NP9A 2L9QA 3RIFA 1MIVA 5IWAT 1B7TA 1OEDB 4DMVA 2LM9A 5JDNA 2HH7A 4LMLA 2JQKA 2XASB 3ONLC 4OFZA 3FB2A 3C4WA 4EYYR 2W67A 3KDSE 4ZXLA 3HKBE 5EK4A 2X68A 4C91A 5CA1E 2V7KA 3HL6A 3CX7B 2CHOA 2XZEA 2FJEA 4IE6A 4IDZA 3AVSA 4HFCA 4OYKA 1D1BA 3S4UA 4BAYB 4EXTA 3UUBA 2XAJB 2JIWA 1NWMX 2V7MA 3RIAA 3EAMA 4ASKA 1KNRA 4B3ST 2VWAA 2XQ9A 3IBPA 5AQLB 3K3NA 2YOEA 4HFEA 2WBLA 4HFIA 4ZI2D 4B6XA 2CWOA 2W66A 4O2BE 3O1HA 2K5BB 2CEAA 2JJ9A 1IZNB 2YDRA 4KX6A 4TX5A 5HCJA 4EV6A 2MYSA 3K8PC 2E9XA 4ILAA 4ILBA 1VOMA 1EZ3A 2CBIA 4NUVA 2BVLA 2YINA 4QX7B 5E0OA 3VRBA 3ZMZB 3ZPOA 3BK9A 2BVMA 2WWUA 4PNIA 2WCAA 3ANWB 3M3ZB 3LK42 2YKSA 4IREA 2B1EA 3OPCA 3HI2A 4UXNB 4C90A 2WQYA 4K0KT 2YN6A 5JR9B 4WYVA 2PJQA 3KBUA 2CLYC 5C8YE 4NUUA 2VKDA 2E5VA 4HFBA 2DNXA 3RF1A 5L3EB 5DJQC 3RX6A 2M67A 5L4EA 1MMAA 4JV5T 4U7YA 3ZSTA 4EEDA 5FY1A 5HEHA 1XNRT 3RGLA 2BG9A 1ZKEA 2W0GA 3FZMB 4ILUA 2WMOA 4MLKA 4QH5A 1XNQT 2CXLA 3MA9A 2RA1A 4IGUA 4JUYA 2W63A 1D1CA 2XQ4A 3MXZA 1Y01A 4JI3T 1XMOT 5LG3A 3LSVA 2BZBA 1OEDC 4YJ3E 5CGMA 3DP7A 1N34T 3K3QC 4F8HA 4CN6A 4KUMB 4IDNA 1UURA 4LFCT 3RYIE 1LVFA 4ZS3A 5FXXA 3KVBA 3TLWA 2IUBA 4KI0F 2Q9QB 3KVAA 4GYRA 4JI2T 4A5XA 4BJMA 4HWHA 5AQMB 5LBQB 3RIUA 4X1YE 3A5XA 4DUZT 2XQ6A 4AXPA 2N9DA 5LOVE 2HPJA 1YD8G 2L3LA 3ZN0B 4B3RT 3EDUA 4LFBT 2UUAT 2BKNA 1SHZC 3AE6A 3ONJA 3ZSSA 3I9YA 3AE1A 2I59A 1O3XA 2E8IA 4NPPA 2EHOC 3ESLA 1CHUA 4U33A 5FXVA 3ZYKA 3SS1A 4YSZA 3PUAA 3P4RA 1W09A 3AEAA 4WZXA 3AE7A 3FHNA 5L3DB 2BBJA 3JC6D 5AQVB 4DV1T 4DV6T 2X67A 3A8YC 1N32T 3UQ7A 2KXPB 2H7VC 2IAKA 2WAUA 4QH4A 4U7IA 4I0UA 2W62A 3TLSA 2LKHA 2YU1A 3PUZF 3HA4A 2LKGA 4HFDA 2PFVA 2GK9A 2XSBA 3ZT6A 3NKZA 2ES0A 5DQWA 4EOZB 4EGWA 3HKCE 4UR9A 1FJGT 2UXBT 2I6HA 4DO0A 4PJLA 4DR5T 3QK6A 5ADXL 2D9DA 2LSJA 4H9SE 4H9OC 4HFVA 1E7PA 3AE8A 3UU4A 4HFHA 4IDOA 1HS7A 1IBKT 3B13A 3CX6B 5ABEA 4TN7B 2LSYA 2OV9A 4IL9A 3ZMVB 3R6NA 1W0AA 2KINB 3UU8A 5LA6E 2E9XC 5JVDE 5AQFB 2WU5A 3GN5B 2DHRA 1XDPA 4QX8B 4X66T 2BG9C 1Z0PA 5LXTE 3AEFA 5C2TA 2X0HA 2XQ7A 3RKGA 2X51A 2JMHA 2VL8A 4MBQA 2VVSA 4YXDA 4GKKT 3P8CD 4ZEYA 2WZHA 2ODUA 3ZC1A 4ZI3D 4A97A 5FXWA 2LOSA 3N9NA 3Q9DA 4IIJE 1UGOA 2C5JA 3F2EA 3KINB 3NVOA 3KV4A 3RQWA 4CZZB 3NZPA 3ZYMA 3AA6B 4YTMA 1W9RA 3EI0A 2D0TA 4JBWF 5FY7A 3ZEFB 5JRCA 5M4YA 1MMGA 3O4XE 5LMNT 4A98A 3Q2MA 2IMLA 2WDQA 4PFOA 4CN4A 1YKEB 1V9DA 3CQGB 1J5ET 3WAJA 2WMNA 2B76A 3EHZA 4IE5A 5JDGA 2XM1A 5AQGB 2YK0A 2Y6XA 2BKOA 3KV9A 2YU2A 1M7KA 2KZ7B 3ZT5A 5LNKA 4OK0A 1UCUA 3KBTA 1YQ3A 2AE9A
chains in the Genus database with same CATH topology
2JQHA 2V6YB 4U7IA 2K3WA 2CRBA 2JQKA 1YXRA 2LRLA 4U2ZA 4CN6A 4U31A 4ZEYA 2LRKA 3EABA 5LB7B 4NIQA 3ZT6A 4IT4A 2XZEA 4P1NA 4A5XA 2V6XA 2WWVA 3K1SA 2A9UA 4CN1A 5FVKA 2RPAA 1WCRA 2MPKA 2V6YA 2CPTA 2DL1A 2W2UA 4U7YA 3ZSSA 4CN4A 3ZSTA 4U3CA 5CJ5A 4U33A 5CGMA 3ZT7A 5FVLA 1WFDA 1WR0A 2WY2A 4WZXA 3ZT5A 4U2YA 2JQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQH A;  2V6Y B;  4U7I A;  2K3W A;  2CRB A;  2JQK A;  1YXR A;  2LRL A;  4U2Z A;  4CN6 A;  4U31 A;  4ZEY A;  2LRK A;  3EAB A;  5LB7 B;  4NIQ A;  3ZT6 A;  4IT4 A;  2XZE A;  4P1N A;  4A5X A;  2V6X A;  2WWV A;  3K1S A;  2A9U A;  4CN1 A;  5FVK A;  2RPA A;  1WCR A;  2MPK A;  2V6Y A;  2CPT A;  2DL1 A;  2W2U A;  4U7Y A;  3ZSS A;  4CN4 A;  3ZST A;  4U3C A;  5CJ5 A;  4U33 A;  5CGM A;  3ZT7 A;  5FVL A;  1WFD A;  1WR0 A;  2WY2 A;  4WZX A;  3ZT5 A;  4U2Y A;  2JQ9 A; 
#chains in the Genus database with same CATH topology
 1NEK A;  2H88 A;  4AQG A;  3W15 B;  3C4Z A;  3UFE A;  1H7C A;  2CM0 A;  2E9X D;  1HFA A;  1UX5 A;  3JAE A;  5BR8 T;  3OBV E;  5JRC B;  4WBN E;  4DUY T;  1KK7 A;  4JYA T;  2LEH A;  2FBW A;  4PJN A;  5DAB A;  1L0V A;  3T8O A;  4DV5 T;  3VRA A;  4JI0 T;  1S94 A;  1KNZ A;  2V6X A;  3N2O A;  4UF0 A;  4YHJ A;  4FI5 A;  1U5P A;  3FBZ A;  3LJC A;  3MKD A;  4KHZ F;  3LBX A;  4KHP T;  3C4X A;  2BBH A;  5JDL A;  1E2A A;  1X79 A;  2DI4 A;  2XQ3 A;  4X65 T;  2N2N A;  2CXD A;  2QYW A;  3A7M A;  1MND A;  3IA3 A;  4HWI B;  4QHO A;  4U3C A;  2CWY A;  2IW5 B;  2DLR A;  3I9W A;  4DVD A;  3CK6 A;  1MIY A;  1ZHC A;  4WBO A;  5AQI B;  5LJN A;  3RYH E;  2UUB T;  2NR4 A;  3VU7 H;  4ZZB A;  1IBM T;  3JAD A;  4L5G A;  4EAH A;  2QRX A;  3AVR A;  3GWH A;  4H9N C;  4JLE A;  3ETV A;  3N9Q A;  4TNV A;  4DND A;  5KXJ A;  4EZH A;  5HWX A;  4YT0 A;  5J2T E;  3EVY A;  4NXM T;  1OXZ A;  5JH7 E;  1XMQ T;  4H63 V;  5JDM A;  5LP6 E;  1MIW A;  3P4Q A;  4P1N A;  1I94 T;  3H3M A;  3RIU C;  1WR6 A;  1HG5 A;  3FXE B;  3LK3 B;  1D0Z A;  3ONX A;  2V7J A;  2MBG A;  4ZHQ E;  5IHY A;  5HXE A;  2HPL A;  3OVU A;  4GOU A;  3RQU A;  1WRD A;  3I1A A;  2EHO B;  4IDQ A;  4WNK A;  5H6R B;  3TKL B;  3UU6 A;  3UUN A;  3N9O A;  2VK9 A;  3SRZ A;  4CXX A;  4Z8X A;  4LF7 T;  1LKX A;  2XJ7 A;  2NTX A;  5KMG P;  2SPC A;  2JMK A;  1XDO A;  1IBL T;  3I0O A;  2FJB A;  2WB5 A;  1UX4 A;  4G63 A;  5JDQ A;  2J62 A;  3RC3 A;  3PUX F;  3J7Y q;  2WS3 A;  2C5K T;  2PBI A;  2BKP A;  2OLT A;  3SOL A;  4YY3 T;  4I55 E;  5HXH A;  1T7S A;  4PK4 A;  4UVC B;  5JDH A;  1JNR A;  4JI7 T;  4HWF A;  1SUM B;  5AFU L;  1ZOY A;  2I0M A;  4U31 A;  2PTF A;  4CXY A;  4TNW A;  4U74 A;  3NRY A;  5FKY A;  1QLB A;  4IE7 A;  2VAS A;  5L3F B;  1X9B A;  4KMC A;  5CA0 E;  4DV3 T;  1J1J A;  1OWA A;  4JI8 T;  4LMK A;  4LF6 T;  2VKO A;  3BQL A;  4HEA A;  2YDS A;  4XAX B;  5GON E;  3P4W A;  5JR9 C;  5LGT B;  3AAI A;  3RI5 A;  3RYF E;  3Q5D A;  1HX1 B;  3CML A;  3SWH A;  4JEH B;  4YSX A;  4X62 T;  2V1D B;  1Z8U A;  4HTE A;  2W2U A;  3LBX B;  4H9Q C;  4OHF A;  4QWN B;  3VKG A;  3ETU A;  4ZS2 A;  4UF0 B;  2V5D A;  4I43 B;  1YQ4 A;  2ACZ A;  2WP9 A;  3AE3 A;  3JAF A;  3Q5E A;  2KT9 A;  4O4J E;  2VL0 A;  4N78 D;  3LFM A;  4O2A E;  4QKN A;  3SFE A;  3ZLI A;  5HYA A;  4JI1 T;  4LFA T;  3FXD B;  2H7O A;  3OKQ A;  4ZI2 C;  3RKO A;  3ZJ2 A;  4OYJ A;  3GA8 A;  4P0A A;  4DR7 T;  2OA5 A;  1M62 A;  2CA5 A;  5JQG E;  3L8R A;  4EIW A;  3CPZ A;  4ISS A;  3KFW X;  3OTO T;  3HKD E;  1MNE A;  5ABG A;  5HXC A;  4CQI A;  1I6Z A;  2X66 A;  4DR6 T;  3AXJ B;  3ANW A;  2X9H A;  4AQF C;  4DID B;  2VKH A;  3PUS A;  4EYU A;  2HN1 A;  4UEM A;  5FMN A;  3J9X 1;  4UVB B;  4CN1 A;  5IYZ E;  5HEO A;  1XZY A;  2R6G F;  4B3M T;  3AEC A;  1D0X A;  3L09 A;  3LDQ B;  5AQJ B;  2D0U A;  1BR1 A;  2BS4 A;  4MFR A;  3V5S A;  1HTJ F;  2Y8D A;  4UIG A;  3UQ4 A;  2XY8 B;  3C50 A;  4BJN A;  5FYM A;  3RPU A;  5FVL A;  3ZT7 A;  1SA0 E;  5CFB A;  5IUX A;  5L47 A;  2WSS V;  4DR2 T;  4O8S A;  3EDV A;  1GQE A;  2V5C A;  3ZYL A;  4EEB A;  1HNZ T;  3L3P A;  4LF8 T;  1HNX T;  2M6I A;  3ZCI A;  3QB5 A;  5L4H A;  5DQV A;  2H3R A;  2X9X A;  3FBL A;  3IHR A;  1UUS A;  4M1P A;  4Z90 A;  3AAE B;  4U2Z A;  4YTP A;  2MOZ A;  5F5W A;  2F4V T;  3AEG A;  5AQH B;  5LB7 B;  1KNP A;  3P7I A;  1E1H B;  1KEY A;  3NWI A;  5HXS A;  3PUW F;  5J0Z A;  4DBQ A;  2WDR A;  5L3C B;  3JCF A;  4AKI A;  2JQQ A;  4B3T T;  2K24 A;  2K48 A;  3LG7 A;  4PJM A;  2JRK A;  3N5L A;  2KWH A;  4GKJ T;  4AI6 A;  4PFP A;  1FMW A;  4IE4 A;  2NW9 A;  3CKD A;  4QXH B;  5AQK B;  4ZI3 C;  4DBR A;  5A1L A;  4P0B A;  4H9R C;  5EK2 A;  2XHE B;  3RC8 A;  1OED A;  2MAW A;  1LVK A;  3C64 A;  4HE8 A;  5HEG A;  5ETW A;  3RH3 A;  2BG9 E;  2VKJ A;  3B57 A;  4GK5 E;  3R84 B;  1WR0 A;  2XQA A;  4GK0 E;  4BA9 A;  1G8X A;  2Q9Q D;  5LMU T;  3PV0 F;  4L0R A;  2D5U A;  3CVR A;  2A72 A;  2JQH A;  2V6Y B;  3CIR A;  4HWC A;  3ZMS B;  2K3W A;  3AEB A;  5ABH A;  5JRE A;  2VQE T;  4AKH A;  2KND A;  3IF8 B;  3CX8 B;  1FMV A;  3PU3 A;  4H9P C;  5F8P A;  4L9I A;  2WM9 A;  3QNU A;  1YW0 A;  1NEN A;  3V5U A;  4X20 E;  5AQR B;  3K3O A;  4TWD A;  5L2L A;  2ZM0 A;  5JTG A;  1IAP A;  2ZM6 T;  3WI3 A;  3ZJ1 A;  4EB6 E;  3P4S A;  4QXB B;  3TLT A;  2A9U A;  3QC9 A;  5ABF B;  2KSR A;  4P09 A;  4X64 T;  3C98 B;  3BQI A;  2KLQ A;  2XQ8 A;  4ANJ A;  2FJA A;  2LHR A;  2LSG A;  3RRW A;  2XAH B;  3PUQ A;  2IHR 1;  3TLU A;  5LGU B;  4DV0 T;  3FZH B;  4YHH T;  4X1K E;  3N9M A;  4MHC A;  1WFD A;  1S35 A;  3CWZ B;  2W4X A;  3WAK A;  4LMJ A;  3U78 A;  4E7Z A;  2UUC T;  5KDM C;  4EZ4 A;  2A3D A;  2C0S A;  2NTY A;  2WDV A;  3BQK A;  3PJA J;  1KF6 A;  2NW7 A;  4FJO A;  3FZF B;  2VVN A;  5AQS B;  2LT3 A;  1VCS A;  3PUR A;  4K0U A;  1T72 A;  1VCT A;  3AE5 A;  3AE2 A;  3AAA B;  3C51 A;  5AQP B;  4YLH A;  2IC6 A;  3AE4 A;  2QVA A;  1ZV4 X;  4O4H E;  3ZCJ A;  4DV2 T;  4G2A A;  3X1D A;  3GMI A;  4CI1 B;  2JPF A;  4IT4 A;  3T1Y T;  2BS2 A;  2C5I T;  4IL4 A;  2BG9 B;  4X1I E;  2IIU A;  3PDY A;  4E7S A;  4OX9 T;  1Y64 B;  5ABF A;  4X5T A;  1MMD A;  1US7 B;  2V7I A;  5CJ5 A;  3N2G E;  2ZLY A;  3E08 A;  5LHI B;  1WCR A;  1LRZ A;  1WYC A;  1W0B A;  2MPK A;  2ACX A;  2CPT A;  3HKE E;  4Q25 A;  2LJL A;  4TWF A;  4IHJ E;  2Z6E A;  2CMR A;  2CHN A;  3AB3 B;  3F57 A;  3OYX A;  4ZOL E;  5LJM A;  3AA0 B;  4AKR B;  1HF8 A;  5LHH B;  5F3J A;  4JI6 T;  1HNW T;  3DJB A;  4HWD A;  1QSD A;  3FZL B;  4PW8 A;  2UU9 T;  1KFY A;  3GN5 A;  1T8B A;  4IST A;  5J2U E;  3H3A A;  4DV7 T;  2XM2 A;  4UV8 B;  2UXD T;  3N9P A;  1N33 T;  4TZ4 C;  2UXC T;  4XZC A;  2ZMA A;  2LRK A;  3AED A;  2K9A A;  4V1A v;  1DU2 A;  2E9X B;  2VQF T;  2XTL A;  3QB5 K;  5AQO B;  2D2S A;  5LG4 A;  5AQN B;  2XAQ B;  3AEE A;  4YFS A;  4AQF A;  4ZZC A;  3SFD A;  1G73 A;  1AJ3 A;  4YJ2 E;  2QA7 A;  2CE7 A;  2V8S V;  3MZK B;  3UTK A;  2W00 A;  3UU3 A;  5FVK A;  2QGS A;  2V7L A;  2KWI B;  3PUY F;  3UUM A;  4H63 H;  3ZKR A;  2DL1 A;  4YSY A;  2LHN A;  3QUJ A;  3L39 A;  2P9B A;  1IJ6 A;  3N9L A;  3OJA A;  1OED E;  1T98 A;  3B5M A;  4TWH A;  5AQT B;  5FY0 A;  2H89 A;  4CXW A;  2M6B A;  2MTQ A;  3RHW A;  1QUU A;  3PJA A;  4ERR A;  2YEV C;  1IJ5 A;  2LLY A;  2VUR A;  5JDF A;  5LGN B;  4PAG A;  2EHO A;  3VHL A;  5HEJ A;  2X0L B;  3EUH A;  2CRB A;  1WLX A;  3NRX A;  2A2F X;  2XQ5 A;  1BR4 A;  2IDO B;  1YKH B;  2V26 A;  3OYZ A;  3UU5 A;  3UT5 E;  3EAB A;  3VR8 A;  4TUY E;  4COF A;  4JI4 T;  1R8I A;  3E22 E;  3NZQ A;  3QOF A;  4JI5 T;  1SE7 A;  4U72 A;  5L3G B;  4F6R C;  4DR1 T;  1WYB A;  2ZM8 A;  5FL0 A;  4UEL A;  2WU2 A;  3KV6 A;  3P50 A;  4AIU A;  3PTR B;  4DMW A;  4NXN T;  1BR2 A;  2WZI A;  2NW8 A;  5FXZ A;  5EZY E;  3ZMT B;  5BMV E;  5FL1 A;  2XAG B;  5HWY A;  4HN9 A;  1N36 T;  3NBX X;  3P4P A;  4UVA B;  5LHG B;  4KP3 C;  1D1A A;  2Q9Q C;  1CUN A;  2LM2 A;  4Z91 A;  2LE8 A;  3RLF F;  2DCF A;  1FEW A;  2XQY A;  1HX8 A;  2XUE A;  4MAL A;  5FP3 A;  2JQ9 A;  3PU8 A;  2CXF A;  4DR4 T;  4ADZ A;  5FNV E;  3VKH A;  5HCM A;  2PG8 A;  4QXC B;  2CCQ A;  4DV4 T;  3G06 A;  4LF5 T;  1U4Q A;  2UXN B;  3E0Z A;  5EK3 A;  5AQU B;  4AKL A;  5J1G A;  4IE0 A;  4CI2 B;  1JNZ A;  2XPK A;  1HCI A;  4NIQ A;  4WW0 A;  2ODV A;  3RYC E;  2W61 A;  5LYJ E;  2UXX B;  5JR9 A;  5H6Q B;  2XSA A;  4AIS A;  1D0Y A;  2X9Y A;  4XBF B;  3U3I A;  2WWV A;  4PJJ A;  3UFG A;  3FZK B;  4DR3 T;  3ABV A;  5TAO A;  2RPA A;  5LCY A;  5L3B B;  2N1G A;  2Y48 B;  3O1J A;  2LSK A;  4I4T E;  4LF4 T;  3F31 A;  3ZC0 A;  4AQY T;  3PE0 A;  1XWM A;  4ZI7 E;  2YDQ A;  4GYS A;  5LBM A;  5KX5 E;  2HHH T;  2J1D G;  2X9W A;  3JC6 C;  1HG2 A;  3TLV A;  3RRC A;  2E2A A;  3AXJ A;  5C3J A;  5CB4 E;  2KMF A;  1FIO A;  2BS3 A;  2FUP A;  2J4G A;  4IDP A;  2EHO D;  4TV8 E;  3UUL A;  3O9X A;  3KV5 A;  3LK2 B;  3ZN1 B;  2AXD S;  3AA1 B;  4ILC A;  2E5L T;  2LSI A;  2NWB A;  2LOP A;  2CBJ A;  1YXR A;  2FJD A;  1ZEE A;  2LRL A;  2VB6 A;  2X0Y A;  4HKA A;  4GIW A;  4O4L E;  5HXR A;  1MMN A;  4O4I E;  4CI3 B;  4A56 A;  4PK5 A;  4HGA A;  2L8K A;  3CQX C;  3MAC A;  3H37 A;  2CLY B;  3AE9 A;  3MJX A;  3N2K E;  1VRB A;  2NOX A;  2XAF B;  3Q5X A;  2IC9 A;  2HN2 A;  3D0T A;  4PK6 A;  3UUX B;  3ZMU B;  2DWK A;  3K1S A;  4YTN A;  1UK5 A;  3I0Q A;  3T1H T;  5HEU A;  3HR0 A;  4LF9 T;  5HAX A;  2V6Y A;  4UV9 B;  2DWG A;  3CQC B;  2BDE A;  3AA7 B;  2G0U A;  2RP4 A;  3O1I A;  4QH1 A;  5AQQ B;  3PUG A;  4AKG A;  3VR9 A;  3IEE A;  2ZM2 A;  4TV9 E;  1HR0 T;  1NAF A;  3MK7 C;  3M65 A;  1ZP0 A;  2WY2 A;  2Q9Q A;  3PUV F;  3DTO A;  4KBM B;  1J5W A;  3Q5W A;  4J2C A;  4JEU B;  4I50 E;  4U2Y A;  2J47 A;  1BR0 A;  2NP9 A;  2L9Q A;  3RIF A;  1MIV A;  5IWA T;  1B7T A;  1OED B;  4DMV A;  2LM9 A;  5JDN A;  2HH7 A;  4LML A;  2JQK A;  2XAS B;  3ONL C;  4OFZ A;  3FB2 A;  3C4W A;  4EYY R;  2W67 A;  3KDS E;  4ZXL A;  3HKB E;  5EK4 A;  2X68 A;  4C91 A;  5CA1 E;  2V7K A;  3HL6 A;  3CX7 B;  2CHO A;  2XZE A;  2FJE A;  4IE6 A;  4IDZ A;  3AVS A;  4HFC A;  4OYK A;  1D1B A;  3S4U A;  4BAY B;  4EXT A;  3UUB A;  2XAJ B;  2JIW A;  1NWM X;  2V7M A;  3RIA A;  3EAM A;  4ASK A;  1KNR A;  4B3S T;  2VWA A;  2XQ9 A;  3IBP A;  5AQL B;  3K3N A;  2YOE A;  4HFE A;  2WBL A;  4HFI A;  4ZI2 D;  4B6X A;  2CWO A;  2W66 A;  4O2B E;  3O1H A;  2K5B B;  2CEA A;  2JJ9 A;  1IZN B;  2YDR A;  4KX6 A;  4TX5 A;  5HCJ A;  4EV6 A;  2MYS A;  3K8P C;  2E9X A;  4ILA A;  4ILB A;  1VOM A;  1EZ3 A;  2CBI A;  4NUV A;  2BVL A;  2YIN A;  4QX7 B;  5E0O A;  3VRB A;  3ZMZ B;  3ZPO A;  3BK9 A;  2BVM A;  2WWU A;  4PNI A;  2WCA A;  3ANW B;  3M3Z B;  3LK4 2;  2YKS A;  4IRE A;  2B1E A;  3OPC A;  3HI2 A;  4UXN B;  4C90 A;  2WQY A;  4K0K T;  2YN6 A;  5JR9 B;  4WYV A;  2PJQ A;  3KBU A;  2CLY C;  5C8Y E;  4NUU A;  2VKD A;  2E5V A;  4HFB A;  2DNX A;  3RF1 A;  5L3E B;  5DJQ C;  3RX6 A;  2M67 A;  5L4E A;  1MMA A;  4JV5 T;  4U7Y A;  3ZST A;  4EED A;  5FY1 A;  5HEH A;  1XNR T;  3RGL A;  2BG9 A;  1ZKE A;  2W0G A;  3FZM B;  4ILU A;  2WMO A;  4MLK A;  4QH5 A;  1XNQ T;  2CXL A;  3MA9 A;  2RA1 A;  4IGU A;  4JUY A;  2W63 A;  1D1C A;  2XQ4 A;  3MXZ A;  1Y01 A;  4JI3 T;  1XMO T;  5LG3 A;  3LSV A;  2BZB A;  1OED C;  4YJ3 E;  5CGM A;  3DP7 A;  1N34 T;  3K3Q C;  4F8H A;  4CN6 A;  4KUM B;  4IDN A;  1UUR A;  4LFC T;  3RYI E;  1LVF A;  4ZS3 A;  5FXX A;  3KVB A;  3TLW A;  2IUB A;  4KI0 F;  2Q9Q B;  3KVA A;  4GYR A;  4JI2 T;  4A5X A;  4BJM A;  4HWH A;  5AQM B;  5LBQ B;  3RIU A;  4X1Y E;  3A5X A;  4DUZ T;  2XQ6 A;  4AXP A;  2N9D A;  5LOV E;  2HPJ A;  1YD8 G;  2L3L A;  3ZN0 B;  4B3R T;  3EDU A;  4LFB T;  2UUA T;  2BKN A;  1SHZ C;  3AE6 A;  3ONJ A;  3ZSS A;  3I9Y A;  3AE1 A;  2I59 A;  1O3X A;  2E8I A;  4NPP A;  2EHO C;  3ESL A;  1CHU A;  4U33 A;  5FXV A;  3ZYK A;  3SS1 A;  4YSZ A;  3PUA A;  3P4R A;  1W09 A;  3AEA A;  4WZX A;  3AE7 A;  3FHN A;  5L3D B;  2BBJ A;  3JC6 D;  5AQV B;  4DV1 T;  4DV6 T;  2X67 A;  3A8Y C;  1N32 T;  3UQ7 A;  2KXP B;  2H7V C;  2IAK A;  2WAU A;  4QH4 A;  4U7I A;  4I0U A;  2W62 A;  3TLS A;  2LKH A;  2YU1 A;  3PUZ F;  3HA4 A;  2LKG A;  4HFD A;  2PFV A;  2GK9 A;  2XSB A;  3ZT6 A;  3NKZ A;  2ES0 A;  5DQW A;  4EOZ B;  4EGW A;  3HKC E;  4UR9 A;  1FJG T;  2UXB T;  2I6H A;  4DO0 A;  4PJL A;  4DR5 T;  3QK6 A;  5ADX L;  2D9D A;  2LSJ A;  4H9S E;  4H9O C;  4HFV A;  1E7P A;  3AE8 A;  3UU4 A;  4HFH A;  4IDO A;  1HS7 A;  1IBK T;  3B13 A;  3CX6 B;  5ABE A;  4TN7 B;  2LSY A;  2OV9 A;  4IL9 A;  3ZMV B;  3R6N A;  1W0A A;  2KIN B;  3UU8 A;  5LA6 E;  2E9X C;  5JVD E;  5AQF B;  2WU5 A;  3GN5 B;  2DHR A;  1XDP A;  4QX8 B;  4X66 T;  2BG9 C;  1Z0P A;  5LXT E;  3AEF A;  5C2T A;  2X0H A;  2XQ7 A;  3RKG A;  2X51 A;  2JMH A;  2VL8 A;  4MBQ A;  2VVS A;  4YXD A;  4GKK T;  3P8C D;  4ZEY A;  2WZH A;  2ODU A;  3ZC1 A;  4ZI3 D;  4A97 A;  5FXW A;  2LOS A;  3N9N A;  3Q9D A;  4IIJ E;  1UGO A;  2C5J A;  3F2E A;  3KIN B;  3NVO A;  3KV4 A;  3RQW A;  4CZZ B;  3NZP A;  3ZYM A;  3AA6 B;  4YTM A;  1W9R A;  3EI0 A;  2D0T A;  4JBW F;  5FY7 A;  3ZEF B;  5JRC A;  5M4Y A;  1MMG A;  3O4X E;  5LMN T;  4A98 A;  3Q2M A;  2IML A;  2WDQ A;  4PFO A;  4CN4 A;  1YKE B;  1V9D A;  3CQG B;  1J5E T;  3WAJ A;  2WMN A;  2B76 A;  3EHZ A;  4IE5 A;  5JDG A;  2XM1 A;  5AQG B;  2YK0 A;  2Y6X A;  2BKO A;  3KV9 A;  2YU2 A;  1M7K A;  2KZ7 B;  3ZT5 A;  5LNK A;  4OK0 A;  1UCU A;  3KBT A;  1YQ3 A;  2AE9 A; 
#chains in the Genus database with same CATH homology
 2JQH A;  2V6Y B;  4U7I A;  2K3W A;  2CRB A;  2JQK A;  1YXR A;  2LRL A;  4U2Z A;  4CN6 A;  4U31 A;  4ZEY A;  2LRK A;  3EAB A;  5LB7 B;  4NIQ A;  3ZT6 A;  4IT4 A;  2XZE A;  4P1N A;  4A5X A;  2V6X A;  2WWV A;  3K1S A;  2A9U A;  4CN1 A;  5FVK A;  2RPA A;  1WCR A;  2MPK A;  2V6Y A;  2CPT A;  2DL1 A;  2W2U A;  4U7Y A;  3ZSS A;  4CN4 A;  3ZST A;  4U3C A;  5CJ5 A;  4U33 A;  5CGM A;  3ZT7 A;  5FVL A;  1WFD A;  1WR0 A;  2WY2 A;  4WZX A;  3ZT5 A;  4U2Y A;  2JQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...