4U7YA

Structure of the complex of vps4b mit and ist1 mim
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
83
structure length
83
Chain Sequence
MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein 4B
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 83
sequence length 83
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7yA00
3ZSTA 2V6YA 2W2UA 2XZEA 5FVLA 5CJ5A 4CN1A 2JQHA 2DL1A 3ZSSA 2RPAA 4U7IA 2WWVA 4U31A 2K3WA 3ZT5A 4ZEYA 4U2YA 2LRKA 2A9UA 2CPTA 3ZT6A 2JQKA 4U7YA 1WFDA 2V6XA 4A5XA 2LRLA 4WZXA 3ZT7A 5LB7B 2V6YB 1YXRA 4U33A 2WY2A 5CGMA 2JQ9A 4U2ZA 3K1SA 4U3CA 4IT4A 4CN4A 4NIQA 3EABA 4CN6A 1WCRA 4P1NA 2CRBA 1WR0A 2MPKA 5FVKA
chains in the Genus database with same CATH superfamily
4AQFC 4TNWA 5JR9C 4DR2T 2N2NA 2IC9A 2M6BA 5HYAA 3PUAA 2LOPA 1JNRA 1BR4A 2V7JA 4UF0B 4DR4T 3UULA 2XHEB 1IZNB 1J5ET 4LMLA 5JDHA 3C64A 4QXBB 4KP3C 3T1YT 3DP7A 1I6ZA 5FKYA 3I1AA 3ZN1B 4O4HE 3ONJA 4PK4A 4EB6E 3RRCA 3ZCIA 5FL1A 2L8KA 4YY3T 4P1NA 4DV4T 5AQSB 5L3DB 4AKHA 3AEGA 2AE9A 5HEGA 4HKAA 2V7IA 5J0ZA 1YD8G 5ETWA 2HH7A 4QHOA 1D1BA 1S94A 4QH1A 2IUBA 4ADZA 2D0UA 5CGMA 4BJNA 3PV0F 4CI1B 4YTMA 3A7MA 2FUPA 2QYWA 4BJMA 2R6GF 2V26A 4EZHA 3AA0B 4LF9T 3CVRA 2BBJA 4TZ4C 3FXDB 2VK9A 2HPLA 3JAEA 4O4JE 2UU9T 3EABA 1KEYA 4H63H 3RC3A 3P8CD 1UGOA 3OBVE 2UUAT 1XDPA 2VL0A 3ONXA 3MXZA 3NZQA 2XAJB 3KINB 2LRKA 5FY7A 4CXWA 2EHOD 4F6RC 1QSDA 4LFAT 2VQET 2W00A 3HL6A 3MACA 4NXNT 5HWXA 2HN2A 3EAMA 3AAEB 1VRBA 2WWUA 5IHYA 3ZT5A 3BQIA 4CZZB 4UR9A 2V7MA 3TKLB 3EDVA 5AQMB 5KDMC 4U3CA 2K48A 3WI3A 5FL0A 3H3AA 2LLYA 4KHZF 3RYCE 3AXJB 2XPKA 4ZEYA 2CE7A 2VKJA 2YDRA 1L0VA 3AA1B 4IIJE 2LT3A 2ZMAA 3LBXB 3P4PA 5FXVA 3I9WA 4DR5T 3PUYF 2CLYB 1R8IA 1LVFA 5J2TE 1B7TA 4JLEA 2V8SV 5LJNA 4JI5T 4H9SE 3FBZA 3AE8A 3QK6A 5HAXA 4MBQA 3VRAA 4CXYA 2VKOA 2JQ9A 3C98B 5HXRA 4P0AA 4LFBT 2VURA 2A3DA 2GK9A 4OK0A 2SPCA 2XSBA 2NR4A 3L8RA 4OYKA 3QNUA 5EK4A 3ZN0B 4XAXB 4YJ3E 3ZT7A 4GK5E 5H6QB 2BKNA 3E22E 1GQEA 1HNWT 4EZ4A 5J2UE 4X1YE 3TLSA 2DI4A 2E5VA 4YHJA 2X9HA 1MIYA 2JMHA 1IBLT 2A9UA 4WNKA 2I6HA 3JC6C 3LG7A 3Q9DA 5FNVE 5JRCB 3C4WA 2FJDA 5LB7B 1FJGT 4NPPA 4HWFA 4YTPA 4AISA 1D0XA 5JQGE 4CN1A 1HS7A 1D1AA 3UU3A 3RPUA 5L3CB 3CQXC 1WFDA 4JEUB 5LBMA 4AKRB 5LMNT 3RHWA 2JIWA 2N1GA 5ABGA 5LHIB 4QXCB 2NOXA 5L3GB 3AA7B 1MMNA 2JQHA 2WM9A 4U31A 5HEHA 5JDQA 3AB3B 5LCYA 3P4QA 2BS3A 2V7KA 2BG9C 2JPFA 4I50E 2EHOA 3H37A 3M65A 2XSAA 3PJAA 5L3BB 2KNDA 3ZKRA 4YLHA 1V9DA 4Z90A 3PU8A 2UUCT 5AFUL 3ESLA 3LDQB 3IBPA 5AQUB 2J1DG 4QWNB 2E9XC 2WBLA 4A98A 2ZM8A 2KWHA 4NXMT 4JYAT 2H88A 3EUHA 4YJ2E 4H9PC 3ZYMA 2AXDS 5JVDE 2W4XA 3IEEA 3CK6A 3ZSTA 3KBUA 3Q5EA 1YKHB 2FJEA 2Q9QB 2NWBA 3E0ZA 5JH7E 2D2SA 2CM0A 2CBIA 1OEDB 4DNDA 1LKXA 3HA4A 4DR7T 2QA7A 4G63A 5J1GA 3C51A 2DCFA 4NIQA 5F3JA 3RF1A 3RIAA 3RLFF 5L2LA 4X65T 4GKJT 5BR8T 2IC6A 2P9BA 2E2AA 4EEDA 1LVKA 5L3FB 1MMDA 4U33A 3AEBA 2BDEA 4ZI2C 2E5LT 4PJMA 1W09A 3N9OA 2VL8A 3CX7B 3BK9A 4OFZA 4LFCT 4PJLA 4X20E 1ZOYA 1T72A 4HEAA 2X9YA 3N9NA 1U4QA 2YINA 4CN4A 4IE5A 1XZYA 5L47A 1ZKEA 4U74A 5HEUA 4X64T 2BS4A 3IF8B 1KNRA 3HKEE 1YQ3A 3A5XA 2CXFA 2FJBA 5EK3A 4JI2T 3TLTA 2XQ8A 2A72A 2CBJA 1HNZT 3J7Yq 1N34T 4HFBA 5JDFA 3UUBA 1J5WA 3AE4A 5L4HA 2KSRA 2H7OA 4KUMB 4O2BE 1OWAA 4KI0F 1HFAA 3KVAA 2H7VC 2QRXA 2LOSA 4QKNA 4DV3T 2V6YA 4DV0T 3LSVA 2BG9B 4JI3T 2LSGA 5AQKB 3O4XE 3VU7H 3NBXX 4M1PA 2F4VT 4HN9A 2LRLA 4HFHA 5F8PA 3UQ7A 5EZYE 5JDLA 3C4XA 4L9IA 5FVLA 3TLVA 4E7SA 4ASKA 3ZC0A 4YFSA 1US7B 2NW7A 5LMUT 5LP6E 2X9XA 3NVOA 5LGUB 3MK7C 1BR2A 4EAHA 4UVCB 4LF7T 1MNDA 3UU8A 2E9XA 3PUWF 1M62A 3LFMA 3KFWX 2MYSA 5C2TA 4X1IE 2W66A 4DUYT 3LK2B 3ZMVB 3KV6A 3UUMA 2DWKA 2KINB 4AQGA 3ZJ1A 3CMLA 2YDQA 3PTRB 3E08A 2ACXA 3LK42 4EEBA 4ZI3D 2FJAA 4CI3B 5CJ5A 2IIUA 2YEVC 1KK7A 2V6XA 2K24A 4TWDA 3UT5E 2DNXA 4Z91A 1UX4A 4UF0A 2IHR1 1KF6A 2NTXA 4ANJA 5FVKA 3KV4A 2CWYA 2XQ6A 3RYFE 4PK5A 4IE4A 3WAJA 1KFYA 4CXXA 3UU6A 4AI6A 2V5DA 1ZP0A 2NP9A 5LHHB 3ZMSB 2PBIA 3RQUA 3ONLC 2WU5A 2XQ3A 2LSIA 5ADXL 4IE0A 4IDZA 1HR0T 3HKCE 1IJ5A 3FBLA 1XWMA 3CIRA 2V5CA 3EI0A 3KV5A 2H3RA 2QVAA 3CX8B 4LMKA 4GOUA 4HFEA 4ZZCA 3ZYKA 4CN6A 4AQYT 5HWYA 4NUVA 5L4EA 4KBMB 2N9DA 3L39A 2K3WA 5AQOB 2EHOC 2JMKA 5DQWA 4PFPA 2XQ9A 4QX8B 3P50A 5CFBA 3O1IA 2I59A 2W62A 4H9NC 3SS1A 1HG2A 4U2YA 4XZCA 2CPTA 1XDOA 2LKHA 1MMGA 5LG3A 4J2CA 4JI8T 3ZLIA 2X68A 3CWZB 1HX1B 3CPZA 5DJQC 5GONE 2CHNA 1JNZA 5HEOA 4TWHA 2WQYA 2LSJA 4U7YA 4I55E 1OXZA 3P4WA 3UU4A 4EOZB 5L3EB 4B3MT 1FMWA 4OYJA 2LSYA 2YN6A 4ZHQE 3AAAB 3MA9A 4P09A 5E0OA 3AAIA 3PDYA 4LMJA 2IAKA 4LF6T 2Y8DA 5JR9B 1T98A 3PUSA 3AXJA 4WBNE 2XM2A 3GN5B 3AEAA 2LE8A 2UXNB 2WAUA 2Q9QD 5AQNB 3JCFA 4DV1T 3LBXA 4O8SA 3MKDA 4UVAB 1HTJF 3Q2MA 2WMNA 3RKGA 2UXBT 4HWHA 4O4LE 1SA0E 4F8HA 1WCRA 4C91A 4IL9A 2Y6XA 4DV2T 2CXLA 5LYJE 3F2EA 1QUUA 3AE9A 3D0TA 3RYIE 1FIOA 4AXPA 2JJ9A 1XMQT 1NWMX 4TX5A 1D0YA 3FZKB 4GYSA 2UXXB 4HTEA 3ETVA 1Z8UA 5AQPB 2ZM0A 1WYCA 4DMWA 5AQHB 2BKOA 1W0BA 4BA9A 2JQKA 2KT9A 3FZFB 1SUMB 4IHJE 3VRBA 4DIDB 2LHNA 2D5UA 1S35A 2BVLA 2KWIB 3AEDA 3PURA 2X66A 2H89A 2WZIA 1KNZA 3Q5WA 2HHHT 5HXSA 3SWHA 2WWVA 2I0MA 4Q25A 4MLKA 5F5WA 4TV8E 3HR0A 2QGSA 2WDQA 2VB6A 4YSXA 2WP9A 4UEMA 1CUNA 2WB5A 3FXEB 5AQFB 1KNPA 3SFEA 2RPAA 4DR3T 3VR9A 3U3IA 3I9YA 4KMCA 1UK5A 1VCTA 1WLXA 5LOVE 2VVNA 4JI6T 2XY8B 2WSSV 2KMFA 2CMRA 3ANWA 2BBHA 4UELA 4PAGA 1IBMT 2C5IT 2IW5B 3O1HA 3NKZA 2MBGA 4DMVA 3ZYLA 1MIWA 4K0UA 2IMLA 4H63V 2C5KT 3ZEFB 2X0YA 2WDRA 2XQAA 3UTKA 1XNQT 3LK3B 3OPCA 4FJOA 1YW0A 3T8OA 4IDOA 4YSYA 4UV8B 3EHZA 1X79A 5ABHA 3L3PA 2WMOA 4JI7T 5BMVE 3QUJA 2HN1A 2XUEA 3K3NA 4HFCA 2J62A 3ETUA 3AECA 1J1JA 4EXTA 2OV9A 2Q9QA 4E7ZA 1OEDA 4X66T 2BVMA 3UUXB 5HEJA 4DR6T 1WR0A 5AQGB 2DLRA 4IDNA 4P0BA 2JQQA 3CQGB 4A97A 2UUBT 5AQRB 2L3LA 4DV6T 1MMAA 5HXEA 4DV5T 2WDVA 2PFVA 2YKSA 4IE6A 2KXPB 4QX7B 3UU5A 3K3QC 3ZMTB 2XZEA 4YHHT 1M7KA 3B13A 2OA5A 3PJAJ 3OTOT 2ZM2A 3KBTA 4PK6A 3HKDE 2L9QA 3H3MA 2ACZA 2XAQB 3V5UA 2UXDT 2YK0A 5LG4A 4B3ST 4U2ZA 5FXXA 1WR6A 4HWIB 3QB5A 5AQJB 4EYUA 4CQIA 5ABFA 4WYVA 5HXCA 4AKIA 4ERRA 2ODUA 3S4UA 3P7IA 1E2AA 2WU2A 3ZT6A 2XASB 4YSZA 5HXHA 2V6YB 2CXDA 1T7SA 5KX5E 3CKDA 5AQVB 2BS2A 4C90A 1G8XA 2VQFT 3RKOA 2XAHB 1Y64B 5LBQB 3OKQA 1N32T 5LJMA 2DHRA 4LF4T 1NAFA 5CA1E 1YXRA 3RIUA 4TN7B 2YU1A 2M6IA 4ZOLE 4ZZBA 2FBWA 5JTGA 4I0UA 3RC8A 4GK0E 4H9QC 3UFEA 1WYBA 1ZEEA 2BZBA 2NW8A 3GMIA 4EIWA 1WRDA 4QH4A 2E9XB 3AE7A 5LXTE 4DV7T 5M4YA 2E8IA 2XAFB 1E1HB 3O1JA 3FHNA 5AQIB 4CI2B 2X9WA 3OJAA 2C0SA 5LHGB 4B6XA 2M67A 3Q5DA 4V1Av 4KX6A 2CA5A 5FY0A 4AIUA 2VASA 2CLYC 3I0OA 2CEAA 3N9MA 5HCMA 2ZLYA 1NEKA 2XQYA 4ZI3C 5C8YE 5FP3A 2MAWA 3BQLA 3KVBA 2W67A 4H9OC 3CQCB 3OYXA 2BKPA 4JV5T 2VWAA 1UX5A 3ABVA 3RI5A 5TAOA 3PUGA 3RQWA 5LGNB 3K3OA 3PUZF 1FEWA 3HI2A 4ILAA 4TNVA 4U72A 1IBKT 2DWGA 3C4ZA 4MHCA 4IDPA 2WS3A 3RH3A 3ZSSA 1N33T 3RGLA 4KHPT 3W15B 3UFGA 3ZJ2A 1YQ4A 1T8BA 4O4IE 3ZMZB 4OHFA 4ILUA 1Z0PA 3RX6A 5HCJA 4ISSA 1SE7A 2DL1A 5AQQB 2HPJA 5FYMA 1I94T 1DU2A 2X0LB 3VKHA 3FB2A 2NW9A 1G73A 3N2OA 3P4SA 3EDUA 3AE3A 3GA8A 2V1DB 5IUXA 3VHLA 5CA0E 4UVBB 4HE8A 4U7IA 3PUXF 1MIVA 1HG5A 3SRZA 4EV6A 1X9BA 3SFDA 3JAFA 1HX8A 3MJXA 2PG8A 3QB5K 5ABEA 3U78A 2OLTA 3VR8A 3J9X1 3F31A 4PNIA 4ILBA 5LNKA 5JREA 4IDQA 3TLWA 2MPKA 4ZS3A 4Z8XA 2MOZA 3OYZA 1OEDE 3NWIA 2Y48B 4JI0T 4HFVA 4G2AA 3AE2A 4MALA 3JADA 4WZXA 3FZMB 3PU3A 1D0ZA 4X1KE 3AA6B 5FY1A 2LJLA 5JDGA 2Q9QC 1OEDC 4L5GA 2IDOB 2XAGB 2XQ4A 1UCUA 2J47A 3N5LA 4UIGA 2NTYA 3DJBA 2D9DA 4AQFA 5JR9A 4DBRA 3HKBE 3EVYA 3PUVF 1XNRT 3GN5A 3N2GE 3B5MA 1FMVA 1YKEB 3SOLA 4YT0A 4HFIA 3NZPA 3IHRA 4A5XA 4HWCA 1VCSA 4I43B 4X62T 3ZC1A 3GWHA 4JEHB 4AKGA 2W2UA 2VVSA 2ES0A 5EK2A 3MZKB 1HCIA 1W9RA 3NRYA 3AE1A 4GIWA 1MNEA 3JC6D 2LM2A 4GKKT 4TV9E 4PFOA 1O3XA 3RRWA 2LEHA 2D0TA 4DO0A 5CB4E 5JRCA 2JRKA 4JI1T 2K9AA 4BAYB 3ZMUB 1IJ6A 5KMGP 3N2KE 1SHZC 2W63A 2CWOA 5FXZA 4ISTA 3CX6B 3AEEA 2CHOA 4H9RC 2B1EA 3R6NA 2EHOB 4X5TA 4HGAA 3RIUC 1CHUA 1N36T 2BG9E 4B3RT 4ZS2A 3Q5XA 1LRZA 3AE6A 4N78D 1BR1A 4IE7A 4JI4T 3WAKA 4DR1T 4JUYA 4I4TE 4EYYR 4DVDA 3ANWB 4UV9B 5LGTB 4YXDA 4XBFB 4OX9T 3VKGA 2UXCT 2WCAA 3BQKA 3UUNA 3B57A 3F57A 3FZHB 2WY2A 4JBWF 2ODVA 5FXWA 3O9XA 5FMNA 2VKHA 1QLBA 2E9XD 1UURA 4A56A 1Y01A 3P4RA 3K8PC 2YOEA 3N9PA 3C50A 4TWFA 3UQ4A 2XQ5A 2WZHA 2LM9A 4MFRA 2RP4A 2CRBA 4PW8A 4YTNA 2XQ7A 4FI5A 4DUZT 4IL4A 1E7PA 2B76A 5JDNA 1VOMA 4WW0A 2PTFA 2V7LA 3AVRA 3AEFA 5DABA 4K0KT 5KXJA 2ZM6T 3NRXA 3ZCJA 5IWAT 2CCQA 3ZPOA 3L09A 3K1SA 3PUQA 4PJNA 4LF5T 5A1LA 4QXHB 2Z6EA 5AQLB 4DBQA 4ILCA 3KV9A 3X1DA 2G0UA 3RIFA 2YDSA 2XJ7A 4LF8T 4ZI7E 5H6RB 3RYHE 3AE5A 3PE0A 4ZI2D 3QC9A 2K5BB 2MTQA 2LSKA 4PJJA 3KDSE 4ZXLA 3R84B 5AQTB 2X0HA 3FZLB 2W0GA 2KLQA 4WBOA 5ABFB 4TUYE 2J4GA 4EGWA 4GYRA 1IAPA 1NENA 5JDMA 3OVUA 1AJ3A 2PJQA 1BR0A 5IYZE 2A2FX 3M3ZB 2LKGA 1UUSA 1XMOT 4B3TT 4L0RA 3G06A 4O2AE 3LJCA 2YU2A 2W61A 3T1HT 3AVSA 3DTOA 2X67A 5C3JA 3V5SA 3N9LA 5DQVA 4HFDA 4AKLA 4UXNB 2C5JA 3I0QA 2X51A 1H7CA 1W0AA 1HF8A 1D1CA 2XTLA 4COFA 2KZ7B 3QOFA 2BG9A 4IGUA 3TLUA 1ZHCA 2RA1A 4IT4A 4NUUA 1HNXT 1U5PA 3N9QA 1ZV4X 1EZ3A 4QH5A 3A8YC 4IREA 3IA3A 2XM1A 4HWDA 5LA6E 2LHRA 2VKDA
chains in the Genus database with same CATH topology
3ZSTA 2V6YA 2W2UA 2XZEA 5FVLA 5CJ5A 4CN1A 2JQHA 2DL1A 3ZSSA 2RPAA 4U7IA 2WWVA 4U31A 2K3WA 3ZT5A 4ZEYA 4U2YA 2LRKA 2A9UA 2CPTA 3ZT6A 2JQKA 4U7YA 1WFDA 2V6XA 4A5XA 2LRLA 4WZXA 3ZT7A 5LB7B 2V6YB 1YXRA 4U33A 2WY2A 5CGMA 2JQ9A 4U2ZA 3K1SA 4U3CA 4IT4A 4CN4A 4NIQA 3EABA 4CN6A 1WCRA 4P1NA 2CRBA 1WR0A 2MPKA 5FVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZST A;  2V6Y A;  2W2U A;  2XZE A;  5FVL A;  5CJ5 A;  4CN1 A;  2JQH A;  2DL1 A;  3ZSS A;  2RPA A;  4U7I A;  2WWV A;  4U31 A;  2K3W A;  3ZT5 A;  4ZEY A;  4U2Y A;  2LRK A;  2A9U A;  2CPT A;  3ZT6 A;  2JQK A;  4U7Y A;  1WFD A;  2V6X A;  4A5X A;  2LRL A;  4WZX A;  3ZT7 A;  5LB7 B;  2V6Y B;  1YXR A;  4U33 A;  2WY2 A;  5CGM A;  2JQ9 A;  4U2Z A;  3K1S A;  4U3C A;  4IT4 A;  4CN4 A;  4NIQ A;  3EAB A;  4CN6 A;  1WCR A;  4P1N A;  2CRB A;  1WR0 A;  2MPK A;  5FVK A; 
#chains in the Genus database with same CATH topology
 4AQF C;  4TNW A;  5JR9 C;  4DR2 T;  2N2N A;  2IC9 A;  2M6B A;  5HYA A;  3PUA A;  2LOP A;  1JNR A;  1BR4 A;  2V7J A;  4UF0 B;  4DR4 T;  3UUL A;  2XHE B;  1IZN B;  1J5E T;  4LML A;  5JDH A;  3C64 A;  4QXB B;  4KP3 C;  3T1Y T;  3DP7 A;  1I6Z A;  5FKY A;  3I1A A;  3ZN1 B;  4O4H E;  3ONJ A;  4PK4 A;  4EB6 E;  3RRC A;  3ZCI A;  5FL1 A;  2L8K A;  4YY3 T;  4P1N A;  4DV4 T;  5AQS B;  5L3D B;  4AKH A;  3AEG A;  2AE9 A;  5HEG A;  4HKA A;  2V7I A;  5J0Z A;  1YD8 G;  5ETW A;  2HH7 A;  4QHO A;  1D1B A;  1S94 A;  4QH1 A;  2IUB A;  4ADZ A;  2D0U A;  5CGM A;  4BJN A;  3PV0 F;  4CI1 B;  4YTM A;  3A7M A;  2FUP A;  2QYW A;  4BJM A;  2R6G F;  2V26 A;  4EZH A;  3AA0 B;  4LF9 T;  3CVR A;  2BBJ A;  4TZ4 C;  3FXD B;  2VK9 A;  2HPL A;  3JAE A;  4O4J E;  2UU9 T;  3EAB A;  1KEY A;  4H63 H;  3RC3 A;  3P8C D;  1UGO A;  3OBV E;  2UUA T;  1XDP A;  2VL0 A;  3ONX A;  3MXZ A;  3NZQ A;  2XAJ B;  3KIN B;  2LRK A;  5FY7 A;  4CXW A;  2EHO D;  4F6R C;  1QSD A;  4LFA T;  2VQE T;  2W00 A;  3HL6 A;  3MAC A;  4NXN T;  5HWX A;  2HN2 A;  3EAM A;  3AAE B;  1VRB A;  2WWU A;  5IHY A;  3ZT5 A;  3BQI A;  4CZZ B;  4UR9 A;  2V7M A;  3TKL B;  3EDV A;  5AQM B;  5KDM C;  4U3C A;  2K48 A;  3WI3 A;  5FL0 A;  3H3A A;  2LLY A;  4KHZ F;  3RYC E;  3AXJ B;  2XPK A;  4ZEY A;  2CE7 A;  2VKJ A;  2YDR A;  1L0V A;  3AA1 B;  4IIJ E;  2LT3 A;  2ZMA A;  3LBX B;  3P4P A;  5FXV A;  3I9W A;  4DR5 T;  3PUY F;  2CLY B;  1R8I A;  1LVF A;  5J2T E;  1B7T A;  4JLE A;  2V8S V;  5LJN A;  4JI5 T;  4H9S E;  3FBZ A;  3AE8 A;  3QK6 A;  5HAX A;  4MBQ A;  3VRA A;  4CXY A;  2VKO A;  2JQ9 A;  3C98 B;  5HXR A;  4P0A A;  4LFB T;  2VUR A;  2A3D A;  2GK9 A;  4OK0 A;  2SPC A;  2XSB A;  2NR4 A;  3L8R A;  4OYK A;  3QNU A;  5EK4 A;  3ZN0 B;  4XAX B;  4YJ3 E;  3ZT7 A;  4GK5 E;  5H6Q B;  2BKN A;  3E22 E;  1GQE A;  1HNW T;  4EZ4 A;  5J2U E;  4X1Y E;  3TLS A;  2DI4 A;  2E5V A;  4YHJ A;  2X9H A;  1MIY A;  2JMH A;  1IBL T;  2A9U A;  4WNK A;  2I6H A;  3JC6 C;  3LG7 A;  3Q9D A;  5FNV E;  5JRC B;  3C4W A;  2FJD A;  5LB7 B;  1FJG T;  4NPP A;  4HWF A;  4YTP A;  4AIS A;  1D0X A;  5JQG E;  4CN1 A;  1HS7 A;  1D1A A;  3UU3 A;  3RPU A;  5L3C B;  3CQX C;  1WFD A;  4JEU B;  5LBM A;  4AKR B;  5LMN T;  3RHW A;  2JIW A;  2N1G A;  5ABG A;  5LHI B;  4QXC B;  2NOX A;  5L3G B;  3AA7 B;  1MMN A;  2JQH A;  2WM9 A;  4U31 A;  5HEH A;  5JDQ A;  3AB3 B;  5LCY A;  3P4Q A;  2BS3 A;  2V7K A;  2BG9 C;  2JPF A;  4I50 E;  2EHO A;  3H37 A;  3M65 A;  2XSA A;  3PJA A;  5L3B B;  2KND A;  3ZKR A;  4YLH A;  1V9D A;  4Z90 A;  3PU8 A;  2UUC T;  5AFU L;  3ESL A;  3LDQ B;  3IBP A;  5AQU B;  2J1D G;  4QWN B;  2E9X C;  2WBL A;  4A98 A;  2ZM8 A;  2KWH A;  4NXM T;  4JYA T;  2H88 A;  3EUH A;  4YJ2 E;  4H9P C;  3ZYM A;  2AXD S;  5JVD E;  2W4X A;  3IEE A;  3CK6 A;  3ZST A;  3KBU A;  3Q5E A;  1YKH B;  2FJE A;  2Q9Q B;  2NWB A;  3E0Z A;  5JH7 E;  2D2S A;  2CM0 A;  2CBI A;  1OED B;  4DND A;  1LKX A;  3HA4 A;  4DR7 T;  2QA7 A;  4G63 A;  5J1G A;  3C51 A;  2DCF A;  4NIQ A;  5F3J A;  3RF1 A;  3RIA A;  3RLF F;  5L2L A;  4X65 T;  4GKJ T;  5BR8 T;  2IC6 A;  2P9B A;  2E2A A;  4EED A;  1LVK A;  5L3F B;  1MMD A;  4U33 A;  3AEB A;  2BDE A;  4ZI2 C;  2E5L T;  4PJM A;  1W09 A;  3N9O A;  2VL8 A;  3CX7 B;  3BK9 A;  4OFZ A;  4LFC T;  4PJL A;  4X20 E;  1ZOY A;  1T72 A;  4HEA A;  2X9Y A;  3N9N A;  1U4Q A;  2YIN A;  4CN4 A;  4IE5 A;  1XZY A;  5L47 A;  1ZKE A;  4U74 A;  5HEU A;  4X64 T;  2BS4 A;  3IF8 B;  1KNR A;  3HKE E;  1YQ3 A;  3A5X A;  2CXF A;  2FJB A;  5EK3 A;  4JI2 T;  3TLT A;  2XQ8 A;  2A72 A;  2CBJ A;  1HNZ T;  3J7Y q;  1N34 T;  4HFB A;  5JDF A;  3UUB A;  1J5W A;  3AE4 A;  5L4H A;  2KSR A;  2H7O A;  4KUM B;  4O2B E;  1OWA A;  4KI0 F;  1HFA A;  3KVA A;  2H7V C;  2QRX A;  2LOS A;  4QKN A;  4DV3 T;  2V6Y A;  4DV0 T;  3LSV A;  2BG9 B;  4JI3 T;  2LSG A;  5AQK B;  3O4X E;  3VU7 H;  3NBX X;  4M1P A;  2F4V T;  4HN9 A;  2LRL A;  4HFH A;  5F8P A;  3UQ7 A;  5EZY E;  5JDL A;  3C4X A;  4L9I A;  5FVL A;  3TLV A;  4E7S A;  4ASK A;  3ZC0 A;  4YFS A;  1US7 B;  2NW7 A;  5LMU T;  5LP6 E;  2X9X A;  3NVO A;  5LGU B;  3MK7 C;  1BR2 A;  4EAH A;  4UVC B;  4LF7 T;  1MND A;  3UU8 A;  2E9X A;  3PUW F;  1M62 A;  3LFM A;  3KFW X;  2MYS A;  5C2T A;  4X1I E;  2W66 A;  4DUY T;  3LK2 B;  3ZMV B;  3KV6 A;  3UUM A;  2DWK A;  2KIN B;  4AQG A;  3ZJ1 A;  3CML A;  2YDQ A;  3PTR B;  3E08 A;  2ACX A;  3LK4 2;  4EEB A;  4ZI3 D;  2FJA A;  4CI3 B;  5CJ5 A;  2IIU A;  2YEV C;  1KK7 A;  2V6X A;  2K24 A;  4TWD A;  3UT5 E;  2DNX A;  4Z91 A;  1UX4 A;  4UF0 A;  2IHR 1;  1KF6 A;  2NTX A;  4ANJ A;  5FVK A;  3KV4 A;  2CWY A;  2XQ6 A;  3RYF E;  4PK5 A;  4IE4 A;  3WAJ A;  1KFY A;  4CXX A;  3UU6 A;  4AI6 A;  2V5D A;  1ZP0 A;  2NP9 A;  5LHH B;  3ZMS B;  2PBI A;  3RQU A;  3ONL C;  2WU5 A;  2XQ3 A;  2LSI A;  5ADX L;  4IE0 A;  4IDZ A;  1HR0 T;  3HKC E;  1IJ5 A;  3FBL A;  1XWM A;  3CIR A;  2V5C A;  3EI0 A;  3KV5 A;  2H3R A;  2QVA A;  3CX8 B;  4LMK A;  4GOU A;  4HFE A;  4ZZC A;  3ZYK A;  4CN6 A;  4AQY T;  5HWY A;  4NUV A;  5L4E A;  4KBM B;  2N9D A;  3L39 A;  2K3W A;  5AQO B;  2EHO C;  2JMK A;  5DQW A;  4PFP A;  2XQ9 A;  4QX8 B;  3P50 A;  5CFB A;  3O1I A;  2I59 A;  2W62 A;  4H9N C;  3SS1 A;  1HG2 A;  4U2Y A;  4XZC A;  2CPT A;  1XDO A;  2LKH A;  1MMG A;  5LG3 A;  4J2C A;  4JI8 T;  3ZLI A;  2X68 A;  3CWZ B;  1HX1 B;  3CPZ A;  5DJQ C;  5GON E;  2CHN A;  1JNZ A;  5HEO A;  4TWH A;  2WQY A;  2LSJ A;  4U7Y A;  4I55 E;  1OXZ A;  3P4W A;  3UU4 A;  4EOZ B;  5L3E B;  4B3M T;  1FMW A;  4OYJ A;  2LSY A;  2YN6 A;  4ZHQ E;  3AAA B;  3MA9 A;  4P09 A;  5E0O A;  3AAI A;  3PDY A;  4LMJ A;  2IAK A;  4LF6 T;  2Y8D A;  5JR9 B;  1T98 A;  3PUS A;  3AXJ A;  4WBN E;  2XM2 A;  3GN5 B;  3AEA A;  2LE8 A;  2UXN B;  2WAU A;  2Q9Q D;  5AQN B;  3JCF A;  4DV1 T;  3LBX A;  4O8S A;  3MKD A;  4UVA B;  1HTJ F;  3Q2M A;  2WMN A;  3RKG A;  2UXB T;  4HWH A;  4O4L E;  1SA0 E;  4F8H A;  1WCR A;  4C91 A;  4IL9 A;  2Y6X A;  4DV2 T;  2CXL A;  5LYJ E;  3F2E A;  1QUU A;  3AE9 A;  3D0T A;  3RYI E;  1FIO A;  4AXP A;  2JJ9 A;  1XMQ T;  1NWM X;  4TX5 A;  1D0Y A;  3FZK B;  4GYS A;  2UXX B;  4HTE A;  3ETV A;  1Z8U A;  5AQP B;  2ZM0 A;  1WYC A;  4DMW A;  5AQH B;  2BKO A;  1W0B A;  4BA9 A;  2JQK A;  2KT9 A;  3FZF B;  1SUM B;  4IHJ E;  3VRB A;  4DID B;  2LHN A;  2D5U A;  1S35 A;  2BVL A;  2KWI B;  3AED A;  3PUR A;  2X66 A;  2H89 A;  2WZI A;  1KNZ A;  3Q5W A;  2HHH T;  5HXS A;  3SWH A;  2WWV A;  2I0M A;  4Q25 A;  4MLK A;  5F5W A;  4TV8 E;  3HR0 A;  2QGS A;  2WDQ A;  2VB6 A;  4YSX A;  2WP9 A;  4UEM A;  1CUN A;  2WB5 A;  3FXE B;  5AQF B;  1KNP A;  3SFE A;  2RPA A;  4DR3 T;  3VR9 A;  3U3I A;  3I9Y A;  4KMC A;  1UK5 A;  1VCT A;  1WLX A;  5LOV E;  2VVN A;  4JI6 T;  2XY8 B;  2WSS V;  2KMF A;  2CMR A;  3ANW A;  2BBH A;  4UEL A;  4PAG A;  1IBM T;  2C5I T;  2IW5 B;  3O1H A;  3NKZ A;  2MBG A;  4DMV A;  3ZYL A;  1MIW A;  4K0U A;  2IML A;  4H63 V;  2C5K T;  3ZEF B;  2X0Y A;  2WDR A;  2XQA A;  3UTK A;  1XNQ T;  3LK3 B;  3OPC A;  4FJO A;  1YW0 A;  3T8O A;  4IDO A;  4YSY A;  4UV8 B;  3EHZ A;  1X79 A;  5ABH A;  3L3P A;  2WMO A;  4JI7 T;  5BMV E;  3QUJ A;  2HN1 A;  2XUE A;  3K3N A;  4HFC A;  2J62 A;  3ETU A;  3AEC A;  1J1J A;  4EXT A;  2OV9 A;  2Q9Q A;  4E7Z A;  1OED A;  4X66 T;  2BVM A;  3UUX B;  5HEJ A;  4DR6 T;  1WR0 A;  5AQG B;  2DLR A;  4IDN A;  4P0B A;  2JQQ A;  3CQG B;  4A97 A;  2UUB T;  5AQR B;  2L3L A;  4DV6 T;  1MMA A;  5HXE A;  4DV5 T;  2WDV A;  2PFV A;  2YKS A;  4IE6 A;  2KXP B;  4QX7 B;  3UU5 A;  3K3Q C;  3ZMT B;  2XZE A;  4YHH T;  1M7K A;  3B13 A;  2OA5 A;  3PJA J;  3OTO T;  2ZM2 A;  3KBT A;  4PK6 A;  3HKD E;  2L9Q A;  3H3M A;  2ACZ A;  2XAQ B;  3V5U A;  2UXD T;  2YK0 A;  5LG4 A;  4B3S T;  4U2Z A;  5FXX A;  1WR6 A;  4HWI B;  3QB5 A;  5AQJ B;  4EYU A;  4CQI A;  5ABF A;  4WYV A;  5HXC A;  4AKI A;  4ERR A;  2ODU A;  3S4U A;  3P7I A;  1E2A A;  2WU2 A;  3ZT6 A;  2XAS B;  4YSZ A;  5HXH A;  2V6Y B;  2CXD A;  1T7S A;  5KX5 E;  3CKD A;  5AQV B;  2BS2 A;  4C90 A;  1G8X A;  2VQF T;  3RKO A;  2XAH B;  1Y64 B;  5LBQ B;  3OKQ A;  1N32 T;  5LJM A;  2DHR A;  4LF4 T;  1NAF A;  5CA1 E;  1YXR A;  3RIU A;  4TN7 B;  2YU1 A;  2M6I A;  4ZOL E;  4ZZB A;  2FBW A;  5JTG A;  4I0U A;  3RC8 A;  4GK0 E;  4H9Q C;  3UFE A;  1WYB A;  1ZEE A;  2BZB A;  2NW8 A;  3GMI A;  4EIW A;  1WRD A;  4QH4 A;  2E9X B;  3AE7 A;  5LXT E;  4DV7 T;  5M4Y A;  2E8I A;  2XAF B;  1E1H B;  3O1J A;  3FHN A;  5AQI B;  4CI2 B;  2X9W A;  3OJA A;  2C0S A;  5LHG B;  4B6X A;  2M67 A;  3Q5D A;  4V1A v;  4KX6 A;  2CA5 A;  5FY0 A;  4AIU A;  2VAS A;  2CLY C;  3I0O A;  2CEA A;  3N9M A;  5HCM A;  2ZLY A;  1NEK A;  2XQY A;  4ZI3 C;  5C8Y E;  5FP3 A;  2MAW A;  3BQL A;  3KVB A;  2W67 A;  4H9O C;  3CQC B;  3OYX A;  2BKP A;  4JV5 T;  2VWA A;  1UX5 A;  3ABV A;  3RI5 A;  5TAO A;  3PUG A;  3RQW A;  5LGN B;  3K3O A;  3PUZ F;  1FEW A;  3HI2 A;  4ILA A;  4TNV A;  4U72 A;  1IBK T;  2DWG A;  3C4Z A;  4MHC A;  4IDP A;  2WS3 A;  3RH3 A;  3ZSS A;  1N33 T;  3RGL A;  4KHP T;  3W15 B;  3UFG A;  3ZJ2 A;  1YQ4 A;  1T8B A;  4O4I E;  3ZMZ B;  4OHF A;  4ILU A;  1Z0P A;  3RX6 A;  5HCJ A;  4ISS A;  1SE7 A;  2DL1 A;  5AQQ B;  2HPJ A;  5FYM A;  1I94 T;  1DU2 A;  2X0L B;  3VKH A;  3FB2 A;  2NW9 A;  1G73 A;  3N2O A;  3P4S A;  3EDU A;  3AE3 A;  3GA8 A;  2V1D B;  5IUX A;  3VHL A;  5CA0 E;  4UVB B;  4HE8 A;  4U7I A;  3PUX F;  1MIV A;  1HG5 A;  3SRZ A;  4EV6 A;  1X9B A;  3SFD A;  3JAF A;  1HX8 A;  3MJX A;  2PG8 A;  3QB5 K;  5ABE A;  3U78 A;  2OLT A;  3VR8 A;  3J9X 1;  3F31 A;  4PNI A;  4ILB A;  5LNK A;  5JRE A;  4IDQ A;  3TLW A;  2MPK A;  4ZS3 A;  4Z8X A;  2MOZ A;  3OYZ A;  1OED E;  3NWI A;  2Y48 B;  4JI0 T;  4HFV A;  4G2A A;  3AE2 A;  4MAL A;  3JAD A;  4WZX A;  3FZM B;  3PU3 A;  1D0Z A;  4X1K E;  3AA6 B;  5FY1 A;  2LJL A;  5JDG A;  2Q9Q C;  1OED C;  4L5G A;  2IDO B;  2XAG B;  2XQ4 A;  1UCU A;  2J47 A;  3N5L A;  4UIG A;  2NTY A;  3DJB A;  2D9D A;  4AQF A;  5JR9 A;  4DBR A;  3HKB E;  3EVY A;  3PUV F;  1XNR T;  3GN5 A;  3N2G E;  3B5M A;  1FMV A;  1YKE B;  3SOL A;  4YT0 A;  4HFI A;  3NZP A;  3IHR A;  4A5X A;  4HWC A;  1VCS A;  4I43 B;  4X62 T;  3ZC1 A;  3GWH A;  4JEH B;  4AKG A;  2W2U A;  2VVS A;  2ES0 A;  5EK2 A;  3MZK B;  1HCI A;  1W9R A;  3NRY A;  3AE1 A;  4GIW A;  1MNE A;  3JC6 D;  2LM2 A;  4GKK T;  4TV9 E;  4PFO A;  1O3X A;  3RRW A;  2LEH A;  2D0T A;  4DO0 A;  5CB4 E;  5JRC A;  2JRK A;  4JI1 T;  2K9A A;  4BAY B;  3ZMU B;  1IJ6 A;  5KMG P;  3N2K E;  1SHZ C;  2W63 A;  2CWO A;  5FXZ A;  4IST A;  3CX6 B;  3AEE A;  2CHO A;  4H9R C;  2B1E A;  3R6N A;  2EHO B;  4X5T A;  4HGA A;  3RIU C;  1CHU A;  1N36 T;  2BG9 E;  4B3R T;  4ZS2 A;  3Q5X A;  1LRZ A;  3AE6 A;  4N78 D;  1BR1 A;  4IE7 A;  4JI4 T;  3WAK A;  4DR1 T;  4JUY A;  4I4T E;  4EYY R;  4DVD A;  3ANW B;  4UV9 B;  5LGT B;  4YXD A;  4XBF B;  4OX9 T;  3VKG A;  2UXC T;  2WCA A;  3BQK A;  3UUN A;  3B57 A;  3F57 A;  3FZH B;  2WY2 A;  4JBW F;  2ODV A;  5FXW A;  3O9X A;  5FMN A;  2VKH A;  1QLB A;  2E9X D;  1UUR A;  4A56 A;  1Y01 A;  3P4R A;  3K8P C;  2YOE A;  3N9P A;  3C50 A;  4TWF A;  3UQ4 A;  2XQ5 A;  2WZH A;  2LM9 A;  4MFR A;  2RP4 A;  2CRB A;  4PW8 A;  4YTN A;  2XQ7 A;  4FI5 A;  4DUZ T;  4IL4 A;  1E7P A;  2B76 A;  5JDN A;  1VOM A;  4WW0 A;  2PTF A;  2V7L A;  3AVR A;  3AEF A;  5DAB A;  4K0K T;  5KXJ A;  2ZM6 T;  3NRX A;  3ZCJ A;  5IWA T;  2CCQ A;  3ZPO A;  3L09 A;  3K1S A;  3PUQ A;  4PJN A;  4LF5 T;  5A1L A;  4QXH B;  2Z6E A;  5AQL B;  4DBQ A;  4ILC A;  3KV9 A;  3X1D A;  2G0U A;  3RIF A;  2YDS A;  2XJ7 A;  4LF8 T;  4ZI7 E;  5H6R B;  3RYH E;  3AE5 A;  3PE0 A;  4ZI2 D;  3QC9 A;  2K5B B;  2MTQ A;  2LSK A;  4PJJ A;  3KDS E;  4ZXL A;  3R84 B;  5AQT B;  2X0H A;  3FZL B;  2W0G A;  2KLQ A;  4WBO A;  5ABF B;  4TUY E;  2J4G A;  4EGW A;  4GYR A;  1IAP A;  1NEN A;  5JDM A;  3OVU A;  1AJ3 A;  2PJQ A;  1BR0 A;  5IYZ E;  2A2F X;  3M3Z B;  2LKG A;  1UUS A;  1XMO T;  4B3T T;  4L0R A;  3G06 A;  4O2A E;  3LJC A;  2YU2 A;  2W61 A;  3T1H T;  3AVS A;  3DTO A;  2X67 A;  5C3J A;  3V5S A;  3N9L A;  5DQV A;  4HFD A;  4AKL A;  4UXN B;  2C5J A;  3I0Q A;  2X51 A;  1H7C A;  1W0A A;  1HF8 A;  1D1C A;  2XTL A;  4COF A;  2KZ7 B;  3QOF A;  2BG9 A;  4IGU A;  3TLU A;  1ZHC A;  2RA1 A;  4IT4 A;  4NUU A;  1HNX T;  1U5P A;  3N9Q A;  1ZV4 X;  1EZ3 A;  4QH5 A;  3A8Y C;  4IRE A;  3IA3 A;  2XM1 A;  4HWD A;  5LA6 E;  2LHR A;  2VKD A; 
#chains in the Genus database with same CATH homology
 3ZST A;  2V6Y A;  2W2U A;  2XZE A;  5FVL A;  5CJ5 A;  4CN1 A;  2JQH A;  2DL1 A;  3ZSS A;  2RPA A;  4U7I A;  2WWV A;  4U31 A;  2K3W A;  3ZT5 A;  4ZEY A;  4U2Y A;  2LRK A;  2A9U A;  2CPT A;  3ZT6 A;  2JQK A;  4U7Y A;  1WFD A;  2V6X A;  4A5X A;  2LRL A;  4WZX A;  3ZT7 A;  5LB7 B;  2V6Y B;  1YXR A;  4U33 A;  2WY2 A;  5CGM A;  2JQ9 A;  4U2Z A;  3K1S A;  4U3C A;  4IT4 A;  4CN4 A;  4NIQ A;  3EAB A;  4CN6 A;  1WCR A;  4P1N A;  2CRB A;  1WR0 A;  2MPK A;  5FVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...