2UXCT

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uxcT00
1IBMT 2UXDT 2UU9T 2HHHT 4LF7T 1I94T 4B3MT 4DV7T 2E5LT 4K0KT 4LFAT 1FJGT 4AQYT 4JI0T 2UUAT 2UXCT 4JI5T 2VQET 4JI6T 1HNXT 1HNZT 3T1YT 1J5ET 1HNWT 4DR7T 1XMOT 4DR4T 2UUCT 1IBKT 4DUZT 5LMUT 4LF9T 4LF8T 4DV0T 4DR3T 4DV2T 3OTOT 4JYAT 4JI3T 4NXMT 2UXBT 4JI2T 2UUBT 4X62T 4B3RT 4YHHT 4JI7T 5IWAT 5BR8T 1XNQT 4DUYT 2ZM6T 4B3ST 4LFCT 4NXNT 4DR2T 4DR6T 4JI4T 4B3TT 2F4VT 2VQFT 4GKJT 5LMNT 1N34T 4JV5T 4X66T 4DR5T 4X64T 4DV6T 1N36T 1XNRT 4JI8T 4DV1T 1XMQT 4KHPT 1HR0T 4GKKT 1N32T 3T1HT 4OX9T 4JI1T 4DV3T 4YY3T 4X65T 4LF4T 4LFBT 4LF6T 4DV5T 1IBLT 4DR1T 1N33T 4LF5T 4DV4T
chains in the Genus database with same CATH superfamily
4IDZA 3PUZF 2FUPA 4F8HA 1J1JA 3TLTA 4COFA 3A5XA 4PW8A 4QXHB 5FVKA 3CQGB 3EUHA 3AAEB 4V1Av 5AQMB 1KNPA 2EHOB 3EVYA 2RP4A 4UXNB 2ES0A 3K3NA 1UX5A 3LSVA 2HPLA 4LFAT 3LBXB 3B5MA 1FJGT 1YQ3A 4AQYT 1LVKA 1WR0A 2V5DA 3LK2B 4JI0T 2UXXB 4IGUA 4P09A 4GYSA 4C91A 2BZBA 3Q5EA 2QGSA 5LOVE 2CE7A 4A56A 4JI6T 2WZHA 3I9YA 1OEDC 4ZS2A 1XDOA 1HNXT 1XZYA 1HFAA 3RKOA 2B76A 2BVLA 2JIWA 4EAHA 5L3EB 3KVAA 5FL0A 5JREA 1JNRA 2OV9A 2YDSA 4IDNA 3RC3A 4YSZA 1L0VA 4DR4T 1OWAA 5AFUL 2MBGA 1IBKT 2V5CA 3LFMA 3NZPA 4AQGA 4E7SA 3AXJB 3EDVA 3FXDB 4MFRA 5LNKA 3AEGA 3RGLA 5H6RB 3R84B 4HFDA 3RI5A 3W15B 4M1PA 3A7MA 4A98A 5DJQC 2XAJB 3AE7A 2CMRA 5L3FB 3V5SA 4JBWF 2JQ9A 3C4XA 3GA8A 4ZEYA 2XQ5A 4JYAT 2K9AA 5J0ZA 4NXMT 2KLQA 3GN5B 4JI2T 3I0OA 2BDEA 5HXCA 3L39A 1HX8A 4ZHQE 4UVAB 2BG9E 3ANWA 4U31A 2SPCA 2WZIA 2NWBA 3AVSA 3N2KE 3P4RA 4GK5E 4QKNA 4I43B 5FNVE 2H7VC 3QB5K 4A5XA 4EZHA 2CLYB 1XDPA 4B3RT 1JNZA 2XPKA 2MAWA 4ZZBA 1V9DA 4AQFC 4JI7T 2C5JA 3FB2A 5E0OA 1XNQT 5BMVE 2A9UA 2IMLA 3AECA 4TWDA 5L3GB 4XBFB 2WDRA 4O4HE 4CI1B 2W63A 1BR2A 3ZCJA 5HEHA 4DR2T 4BJNA 3ETVA 1E7PA 1NENA 2JRKA 2H88A 2VKDA 4X1YE 5JDHA 3AEFA 4O8SA 3NVOA 2XHEB 4EXTA 3M65A 4HFEA 4QH1A 5HEUA 2F4VT 3L3PA 2VK9A 2YN6A 2BKOA 3LBXA 3BQKA 2XASB 2XAQB 3KV9A 4U2ZA 2VVNA 5ETWA 4ILBA 2E2AA 5CB4E 4GKJT 2H7OA 3ZLIA 3QOFA 4U7YA 4G2AA 3NRYA 2CXDA 4X66T 2PJQA 3HI2A 4DR5T 4TV8E 4X64T 2LT3A 4DV6T 4OYKA 3FZKB 3UU4A 2WMNA 4PFOA 2CBJA 3VRAA 2DI4A 2GK9A 2IHR1 4UELA 3G06A 1N36T 1IZNB 3HKEE 3P4WA 3N9NA 2E8IA 3HL6A 5LGNB 3AA6B 1G8XA 2WSSV 4WYVA 5AQHB 4HWCA 4DV1T 5KDMC 4DMVA 1WCRA 5LGUB 4PJJA 2WDVA 1WFDA 3AE9A 2BG9A 4AISA 1OEDA 4B6XA 2J47A 1HF8A 3O1JA 4GYRA 3NZQA 3U78A 4Z91A 3ZMUB 1MIVA 1MNEA 1US7B 3PUSA 2W67A 3ZYLA 4IDPA 3AAIA 2E9XC 2BS2A 4LFBT 2JQQA 2VL0A 2I0MA 5LHIB 5KMGP 3FZLB 3R6NA 5KX5E 4AKLA 2DL1A 4DIDB 2N9DA 2Z6EA 4Z90A 4TN7B 3VKHA 3P7IA 1UGOA 3AB3B 3M3ZB 3UU8A 3KINB 4CN4A 3CWZB 4U33A 4X1IE 1U4QA 4JEHB 1IJ6A 3PU8A 4ZI3C 2UXDT 3VR8A 4DO0A 2HHHT 3N9PA 3ZT7A 3HKDE 5AQPB 5IYZE 1G73A 2Q9QA 3KDSE 2LKGA 3MKDA 1IJ5A 2PG8A 2W4XA 3O1HA 2X0YA 4PJMA 4UF0B 4UVCB 5LCYA 3RYCE 2E5VA 3KVBA 1WYBA 2YEVC 2E5LT 5CFBA 4HWHA 5AQKB 2KWHA 5HXHA 1BR4A 3RKGA 3OJAA 5LHHB 3HKBE 3RLFF 4AIUA 4U72A 5LP6E 3MK7C 5JR9C 4NPPA 2Y6XA 2UXCT 3I1AA 3Q2MA 1MMDA 5F8PA 4O2BE 1YD8G 2X9WA 2XQ9A 5HWYA 2CCQA 2ACZA 2KT9A 5IUXA 2PTFA 2VKJA 3AEBA 2VKOA 3FHNA 2NTYA 1FEWA 4IIJE 4X20E 4ISTA 5EK3A 1FMWA 2E9XB 1HNZT 2M6BA 4PAGA 4UV8B 5LGTB 2C5KT 1X9BA 2J4GA 2XQ4A 2AXDS 3QNUA 3ZSSA 1J5ET 1XMOT 4L5GA 2IC6A 4QH5A 2BKNA 5FYMA 3RYIE 2H3RA 2C5IT 3QC9A 4IE6A 5L4HA 5LG3A 2UUCT 4U2YA 5LG4A 2V26A 5ABFA 4PK4A 3N9OA 3RYHE 4WBNE 5LMUT 2V7IA 5CA0E 1KEYA 3O9XA 5L4EA 3MXZA 2QRXA 2FJDA 2XAFB 2CHNA 2EHOD 4DR3T 2CWYA 3OBVE 4DV2T 5HEGA 2MYSA 3PUGA 5HXRA 5FP3A 5ABEA 1MMAA 3ZMVB 5AQOB 2LJLA 1Z8UA 2FBWA 2I6HA 2UXBT 4KP3C 2CRBA 1WRDA 4BAYB 3NKZA 3LK3B 1YQ4A 2XQ8A 3HR0A 5JH7E 5F3JA 5KXJA 2R6GF 2W0GA 4UVBB 5IHYA 3UFEA 1X79A 3FZHB 3SRZA 2CXFA 3EABA 3LJCA 3F57A 4ERRA 3UUNA 2E9XD 4ASKA 4NUUA 3ETUA 4ANJA 1YW0A 1SUMB 4JLEA 5FXXA 4O4LE 3EI0A 3UU3A 1UK5A 2JQHA 5AQVB 2D5UA 3ZYKA 4FJOA 1QUUA 3AE5A 4QWNB 5ADXL 4B3ST 2I59A 2XAHB 1U5PA 5EZYE 5FXWA 4NXNT 3WI3A 2N1GA 2XSAA 3AAAB 3AA0B 4EIWA 3ONLC 3N9MA 2CA5A 2L9QA 3AVRA 5FMNA 4PFPA 3H3MA 3J7Yq 3OVUA 4HFBA 2RA1A 1CHUA 3A8YC 2LSYA 3I0QA 4QX7B 1M62A 4TUYE 3C98B 3MZKB 3ONXA 3Q5XA 4HN9A 4L0RA 3TLSA 3ZEFB 3UU5A 4IE0A 5LMNT 4DUYT 1N34T 2HPJA 2WY2A 4X1KE 3ZSTA 5FY1A 2BG9C 4IL9A 3PV0F 2DHRA 4WZXA 4CN1A 5CA1E 4JV5T 2XQ7A 2ZM0A 2MPKA 4KMCA 4IE5A 5AQUB 1T98A 3JC6C 4EZ4A 1MIYA 5HAXA 2W61A 3RIAA 1OXZA 3UU6A 1W09A 2V7JA 4MBQA 5JDLA 1B7TA 1Y01A 5ABGA 2KSRA 3C4WA 2XQYA 5LA6E 4A97A 4QXCB 1SHZC 5LHGB 4JI8T 3BK9A 4KHPT 2NOXA 2WU2A 1VCSA 1D1AA 1W9RA 2LRLA 2X9YA 3C51A 2WBLA 3ESLA 2X51A 4WW0A 2A3DA 4EGWA 4X62T 3AE6A 3BQIA 2H89A 3IBPA 5JDQA 4CXXA 4HE8A 3GN5A 2XUEA 3UUXB 3SS1A 5AQNB 3KBUA 3P4QA 1KNZA 1UX4A 3ANWB 1D0YA 3AE2A 3MA9A 4DV3T 3N9LA 3KFWX 1OEDE 2CHOA 2IAKA 1MMNA 1ZP0A 3FZMB 3PUQA 4DBQA 2ZLYA 3NBXX 2UXNB 2KMFA 2E9XA 2LHNA 2YDRA 4PK5A 4QXBB 3KV6A 4I50E 5FKYA 5C3JA 5L47A 4DV5T 4GK0E 3EAMA 2BKPA 3UFGA 1IBLT 4DR1T 3E22E 4KUMB 3SFEA 2ACXA 4ZI3D 4LF5T 2ODUA 5FL1A 4I4TE 1S94A 4H63H 2IW5B 5L3DB 2K24A 3LDQB 1IBMT 3CK6A 3RYFE 1J5WA 2UU9T 2JMHA 2VB6A 4TNVA 5HEOA 1WYCA 3IA3A 2PFVA 2J62A 4B3MT 5LJNA 4DV7T 3RIFA 1MIWA 3E0ZA 2D0UA 4U7IA 2L8KA 4QHOA 1LVFA 3SOLA 3RF1A 2W62A 3FXEB 2X9HA 4GOUA 2UUAT 4JI5T 1HS7A 1IAPA 5FXZA 3RQWA 1E1HB 2BS4A 3CKDA 2WB5A 3P50A 3RHWA 2VQET 2ZM2A 2XM1A 1MMGA 2CEAA 3E08A 4EOZB 2WS3A 1BR1A 4YTNA 4IL4A 2X68A 4PNIA 1HG2A 4ZI2D 2V8SV 2X66A 3PE0A 4YXDA 2OA5A 2A72A 1HNWT 2NW9A 2WWVA 3J9X1 4CZZB 2WQYA 4DR7T 3D0TA 3LG7A 5AQLB 3CVRA 5EK2A 2LSJA 4OK0A 2LSKA 3SWHA 4WNKA 1M7KA 3TLUA 2QVAA 2KINB 4DUZT 2HH7A 2YDQA 2V6YA 1LKXA 5HEJA 2EHOC 3L8RA 4IT4A 2HN1A 4LF8T 3CMLA 4YFSA 3UTKA 5LXTE 4ISSA 5J2UE 2X9XA 1D0XA 1KF6A 2IIUA 3B57A 4HWDA 2WCAA 3CQXC 4UF0A 2OLTA 3RQUA 3EDUA 3PUXF 5AQFB 3FBLA 3OYZA 4JI3T 3F31A 1SA0E 2XY8B 3KV4A 3RRWA 3T8OA 5HXSA 2D0TA 3PU3A 3WAJA 3ZCIA 2NP9A 2LEHA 3HKCE 5A1LA 2WWUA 1E2AA 1WLXA 2DCFA 3O4XE 2UUBT 4EV6A 2KWIB 4ILUA 2NW8A 1DU2A 4HWFA 3OKQA 4H9PC 4OHFA 2BBJA 4YHHT 4ZXLA 4CI2B 3C64A 4H9OC 1EZ3A 4NUVA 5HWXA 4HFCA 4I55E 5BR8T 5JRCA 2FJBA 4LMKA 4ZOLE 2WP9A 3AE3A 5J2TE 3RH3A 4H9QC 1NEKA 1MNDA 3AE8A 2ZM6T 4KBMB 4AKHA 4LFCT 3PTRB 1ZOYA 3C4ZA 3QB5A 4IE4A 4X5TA 5AQJB 2YU2A 5L3CB 1I94T 3JADA 3Q9DA 2YOEA 3V5UA 3QK6A 5HYAA 3ZKRA 3UT5E 3PURA 4DR6T 3UQ4A 2X67A 2YU1A 3H3AA 4TNWA 5FY0A 4AXPA 4JI4T 2VKHA 1T8BA 2DLRA 2K48A 4IHJE 2W00A 5JVDE 2XQ3A 5J1GA 1W0BA 3PUVF 5H6QB 3GWHA 3VHLA 2LE8A 3UUMA 1AJ3A 3FBZA 4UR9A 2V1DB 4ADZA 3IHRA 4ILAA 4CXWA 3IF8B 2NW7A 5CGMA 1NAFA 2JPFA 2CXLA 4QX8B 4IE7A 5HCMA 2BBHA 1WR6A 3K8PC 5CJ5A 5JTGA 2LRKA 4H9RC 3Q5DA 4MLKA 2D2SA 4YTPA 2EHOA 2NR4A 2AE9A 2XQAA 3AA7B 4PJLA 5ABFB 3UQ7A 4IDOA 1XNRT 2YK0A 2QYWA 3DJBA 3RIUA 2FJEA 3ZC0A 4ZI2C 1XMQT 5ABHA 5JDNA 3ZMSB 4OFZA 3ZT5A 5LYJE 2LLYA 4LMJA 2MOZA 1N32T 4YSXA 2V6XA 4ZI7E 2DNXA 3CQCB 3T1HT 4TV9E 4JI1T 4E7ZA 5LJMA 2XTLA 3GMIA 5LBMA 3N5LA 5EK4A 2DWGA 4J2CA 4TZ4C 2XQ6A 3RC8A 3H37A 3AE1A 2LM9A 3VRBA 4Q25A 3CX7B 3AEEA 3CIRA 1H7CA 4UEMA 5JDFA 3ZN1B 4LF4T 4YJ3E 3ZYMA 3VU7H 4AKRB 2BG9B 2KNDA 5LB7B 4AKIA 3QUJA 4LF6T 1D1BA 4XZCA 1SE7A 2V7MA 3ABVA 2M67A 4YLHA 1R8IA 3JAEA 2W2UA 5AQGB 4BJMA 5DABA 4DV4T 2IUBA 5FVLA 3IEEA 2MTQA 3N2GE 3PDYA 4ZS3A 3S4UA 1YXRA 3JCFA 2BVMA 3VR9A 5L2LA 4LF7T 5TAOA 4FI5A 4H63V 2J1DG 4KI0F 4YTMA 3U3IA 4AI6A 4CI3B 5DQVA 3ZJ1A 1S35A 4HFHA 4K0KT 1Z0PA 3HA4A 2VL8A 3N2OA 3CPZA 2WU5A 3B13A 3DP7A 3ONJA 4P0AA 5AQSB 4HTEA 2CM0A 5AQTB 5JDGA 2LOPA 2V7LA 3X1DA 3I9WA 4AKGA 1ZKEA 3CX8B 5AQRB 3ZMZB 1OEDB 1T7SA 3L09A 2NTXA 3FZFB 4HEAA 2ZM8A 2D9DA 3T1YT 4WBOA 4CN6A 1KNRA 4YHJA 4DNDA 2K3WA 2VWAA 3PUYF 5HXEA 5JR9B 5AQIB 3KV5A 4G63A 5M4YA 3DTOA 3P4PA 4L9IA 1HTJF 2XJ7A 5FXVA 1ZHCA 1VOMA 2Q9QC 4U74A 3TLWA 4LF9T 3AEAA 3ZJ2A 3K3OA 3UUBA 4EYYR 4JEUB 4DV0T 4H9NC 4HFVA 5JDMA 4N78D 3ZMTB 4EEDA 4QH4A 4IDQA 4YSYA 4Z8XA 3F2EA 2ZMAA 3K1SA 2VURA 3NRXA 4HKAA 1HX1B 4UIGA 4O4JE 3OTOT 2YKSA 3CX6B 3AEDA 3PUAA 4OYJA 3LK42 2N2NA 5AQQB 1QLBA 1YKHB 2LSIA 4TX5A 2WAUA 1HCIA 2HN2A 2WDQA 2LHRA 2X0HA 3N9QA 3PUWF 2LSGA 4GIWA 4H9SE 4KX6A 5F5WA 5C8YE 3MJXA 4O4IE 5HCJA 4JUYA 5IWAT 1I6ZA 1QSDA 1HG5A 4PJNA 4UV9B 3TLVA 1FIOA 4EEBA 4YT0A 4MHCA 4TWFA 4K0UA 2L3LA 3ZPOA 4HWIB 5FY7A 2CBIA 2V7KA 2Y48B 3AXJA 3WAKA 2CLYC 4KHZF 3O1IA 3RRCA 4P1NA 3AE4A 1KK7A 3AA1B 2DWKA 4TWHA 2Y8DA 4B3TT 1W0AA 2PBIA 3ZC1A 1VCTA 3P4SA 1D0ZA 2V6YB 2C0SA 2XAGB 5L3BB 4U3CA 4BA9A 2IDOB 2K5BB 2XM2A 4I0UA 3SFDA 2VQFT 3BQLA 2WMOA 4HFIA 1VRBA 1FMVA 2LOSA 2BS3A 1UURA 2A2FX 3UULA 3ZN0B 2M6IA 4HGAA 3KBTA 4DMWA 5GONE 5C2TA 1T72A 4CQIA 4CXYA 2Q9QD 5JQGE 1ZEEA 2VVSA 3RX6A 4DVDA 1CUNA 2XSBA 2JQKA 2JMKA 1NWMX 3OYXA 4ILCA 3RIUC 2W66A 5JRCB 2QA7A 5LBQB 1Y64B 2X0LB 3VKGA 1YKEB 4O2AE 2CWOA 2XZEA 4XAXB 3OPCA 4IREA 3K3QC 2CPTA 1UCUA 1LRZA 3EHZA 2VASA 1ZV4X 1HR0T 4GKKT 3P8CD 4EB6E 3ZT6A 5DQWA 4EYUA 3PJAA 4OX9T 4C90A 3MACA 2P9BA 2YINA 1D1CA 2IC9A 4LMLA 4AQFA 3JC6D 4YJ2E 1XWMA 4NIQA 4P0BA 5JR9A 1O3XA 2LKHA 4YY3T 3PJAJ 2RPAA 4X65T 1BR0A 1GQEA 3NWIA 2LM2A 4PK6A 4ZZCA 2WM9A 1KFYA 2FJAA 3RPUA 1UUSA 2Q9QB 3C50A 3JAFA 2ODVA 4DBRA 3TKLB 2KXPB 2KZ7B 2JJ9A 4F6RC 1N33T 4MALA 2G0UA 3Q5WA 2B1EA
chains in the Genus database with same CATH topology
1IBMT 2UXDT 2UU9T 2HHHT 4LF7T 1I94T 4B3MT 4DV7T 2E5LT 4K0KT 4LFAT 1FJGT 4AQYT 4JI0T 2UUAT 2UXCT 4JI5T 2VQET 4JI6T 1HNXT 1HNZT 3T1YT 1J5ET 1HNWT 4DR7T 1XMOT 4DR4T 2UUCT 1IBKT 4DUZT 5LMUT 4LF9T 4LF8T 4DV0T 4DR3T 4DV2T 3OTOT 4JYAT 4JI3T 4NXMT 2UXBT 4JI2T 2UUBT 4X62T 4B3RT 4YHHT 4JI7T 5IWAT 5BR8T 1XNQT 4DUYT 2ZM6T 4B3ST 4LFCT 4NXNT 4DR2T 4DR6T 4JI4T 4B3TT 2F4VT 2VQFT 4GKJT 5LMNT 1N34T 4JV5T 4X66T 4DR5T 4X64T 4DV6T 1N36T 1XNRT 4JI8T 4DV1T 1XMQT 4KHPT 1HR0T 4GKKT 1N32T 3T1HT 4OX9T 4JI1T 4DV3T 4YY3T 4X65T 4LF4T 4LFBT 4LF6T 4DV5T 1IBLT 4DR1T 1N33T 4LF5T 4DV4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM T;  2UXD T;  2UU9 T;  2HHH T;  4LF7 T;  1I94 T;  4B3M T;  4DV7 T;  2E5L T;  4K0K T;  4LFA T;  1FJG T;  4AQY T;  4JI0 T;  2UUA T;  2UXC T;  4JI5 T;  2VQE T;  4JI6 T;  1HNX T;  1HNZ T;  3T1Y T;  1J5E T;  1HNW T;  4DR7 T;  1XMO T;  4DR4 T;  2UUC T;  1IBK T;  4DUZ T;  5LMU T;  4LF9 T;  4LF8 T;  4DV0 T;  4DR3 T;  4DV2 T;  3OTO T;  4JYA T;  4JI3 T;  4NXM T;  2UXB T;  4JI2 T;  2UUB T;  4X62 T;  4B3R T;  4YHH T;  4JI7 T;  5IWA T;  5BR8 T;  1XNQ T;  4DUY T;  2ZM6 T;  4B3S T;  4LFC T;  4NXN T;  4DR2 T;  4DR6 T;  4JI4 T;  4B3T T;  2F4V T;  2VQF T;  4GKJ T;  5LMN T;  1N34 T;  4JV5 T;  4X66 T;  4DR5 T;  4X64 T;  4DV6 T;  1N36 T;  1XNR T;  4JI8 T;  4DV1 T;  1XMQ T;  4KHP T;  1HR0 T;  4GKK T;  1N32 T;  3T1H T;  4OX9 T;  4JI1 T;  4DV3 T;  4YY3 T;  4X65 T;  4LF4 T;  4LFB T;  4LF6 T;  4DV5 T;  1IBL T;  4DR1 T;  1N33 T;  4LF5 T;  4DV4 T; 
#chains in the Genus database with same CATH topology
 4IDZ A;  3PUZ F;  2FUP A;  4F8H A;  1J1J A;  3TLT A;  4COF A;  3A5X A;  4PW8 A;  4QXH B;  5FVK A;  3CQG B;  3EUH A;  3AAE B;  4V1A v;  5AQM B;  1KNP A;  2EHO B;  3EVY A;  2RP4 A;  4UXN B;  2ES0 A;  3K3N A;  1UX5 A;  3LSV A;  2HPL A;  4LFA T;  3LBX B;  3B5M A;  1FJG T;  1YQ3 A;  4AQY T;  1LVK A;  1WR0 A;  2V5D A;  3LK2 B;  4JI0 T;  2UXX B;  4IGU A;  4P09 A;  4GYS A;  4C91 A;  2BZB A;  3Q5E A;  2QGS A;  5LOV E;  2CE7 A;  4A56 A;  4JI6 T;  2WZH A;  3I9Y A;  1OED C;  4ZS2 A;  1XDO A;  1HNX T;  1XZY A;  1HFA A;  3RKO A;  2B76 A;  2BVL A;  2JIW A;  4EAH A;  5L3E B;  3KVA A;  5FL0 A;  5JRE A;  1JNR A;  2OV9 A;  2YDS A;  4IDN A;  3RC3 A;  4YSZ A;  1L0V A;  4DR4 T;  1OWA A;  5AFU L;  2MBG A;  1IBK T;  2V5C A;  3LFM A;  3NZP A;  4AQG A;  4E7S A;  3AXJ B;  3EDV A;  3FXD B;  4MFR A;  5LNK A;  3AEG A;  3RGL A;  5H6R B;  3R84 B;  4HFD A;  3RI5 A;  3W15 B;  4M1P A;  3A7M A;  4A98 A;  5DJQ C;  2XAJ B;  3AE7 A;  2CMR A;  5L3F B;  3V5S A;  4JBW F;  2JQ9 A;  3C4X A;  3GA8 A;  4ZEY A;  2XQ5 A;  4JYA T;  2K9A A;  5J0Z A;  4NXM T;  2KLQ A;  3GN5 B;  4JI2 T;  3I0O A;  2BDE A;  5HXC A;  3L39 A;  1HX8 A;  4ZHQ E;  4UVA B;  2BG9 E;  3ANW A;  4U31 A;  2SPC A;  2WZI A;  2NWB A;  3AVS A;  3N2K E;  3P4R A;  4GK5 E;  4QKN A;  4I43 B;  5FNV E;  2H7V C;  3QB5 K;  4A5X A;  4EZH A;  2CLY B;  1XDP A;  4B3R T;  1JNZ A;  2XPK A;  2MAW A;  4ZZB A;  1V9D A;  4AQF C;  4JI7 T;  2C5J A;  3FB2 A;  5E0O A;  1XNQ T;  5BMV E;  2A9U A;  2IML A;  3AEC A;  4TWD A;  5L3G B;  4XBF B;  2WDR A;  4O4H E;  4CI1 B;  2W63 A;  1BR2 A;  3ZCJ A;  5HEH A;  4DR2 T;  4BJN A;  3ETV A;  1E7P A;  1NEN A;  2JRK A;  2H88 A;  2VKD A;  4X1Y E;  5JDH A;  3AEF A;  4O8S A;  3NVO A;  2XHE B;  4EXT A;  3M65 A;  4HFE A;  4QH1 A;  5HEU A;  2F4V T;  3L3P A;  2VK9 A;  2YN6 A;  2BKO A;  3LBX A;  3BQK A;  2XAS B;  2XAQ B;  3KV9 A;  4U2Z A;  2VVN A;  5ETW A;  4ILB A;  2E2A A;  5CB4 E;  4GKJ T;  2H7O A;  3ZLI A;  3QOF A;  4U7Y A;  4G2A A;  3NRY A;  2CXD A;  4X66 T;  2PJQ A;  3HI2 A;  4DR5 T;  4TV8 E;  4X64 T;  2LT3 A;  4DV6 T;  4OYK A;  3FZK B;  3UU4 A;  2WMN A;  4PFO A;  2CBJ A;  3VRA A;  2DI4 A;  2GK9 A;  2IHR 1;  4UEL A;  3G06 A;  1N36 T;  1IZN B;  3HKE E;  3P4W A;  3N9N A;  2E8I A;  3HL6 A;  5LGN B;  3AA6 B;  1G8X A;  2WSS V;  4WYV A;  5AQH B;  4HWC A;  4DV1 T;  5KDM C;  4DMV A;  1WCR A;  5LGU B;  4PJJ A;  2WDV A;  1WFD A;  3AE9 A;  2BG9 A;  4AIS A;  1OED A;  4B6X A;  2J47 A;  1HF8 A;  3O1J A;  4GYR A;  3NZQ A;  3U78 A;  4Z91 A;  3ZMU B;  1MIV A;  1MNE A;  1US7 B;  3PUS A;  2W67 A;  3ZYL A;  4IDP A;  3AAI A;  2E9X C;  2BS2 A;  4LFB T;  2JQQ A;  2VL0 A;  2I0M A;  5LHI B;  5KMG P;  3FZL B;  3R6N A;  5KX5 E;  4AKL A;  2DL1 A;  4DID B;  2N9D A;  2Z6E A;  4Z90 A;  4TN7 B;  3VKH A;  3P7I A;  1UGO A;  3AB3 B;  3M3Z B;  3UU8 A;  3KIN B;  4CN4 A;  3CWZ B;  4U33 A;  4X1I E;  1U4Q A;  4JEH B;  1IJ6 A;  3PU8 A;  4ZI3 C;  2UXD T;  3VR8 A;  4DO0 A;  2HHH T;  3N9P A;  3ZT7 A;  3HKD E;  5AQP B;  5IYZ E;  1G73 A;  2Q9Q A;  3KDS E;  2LKG A;  3MKD A;  1IJ5 A;  2PG8 A;  2W4X A;  3O1H A;  2X0Y A;  4PJM A;  4UF0 B;  4UVC B;  5LCY A;  3RYC E;  2E5V A;  3KVB A;  1WYB A;  2YEV C;  2E5L T;  5CFB A;  4HWH A;  5AQK B;  2KWH A;  5HXH A;  1BR4 A;  3RKG A;  3OJA A;  5LHH B;  3HKB E;  3RLF F;  4AIU A;  4U72 A;  5LP6 E;  3MK7 C;  5JR9 C;  4NPP A;  2Y6X A;  2UXC T;  3I1A A;  3Q2M A;  1MMD A;  5F8P A;  4O2B E;  1YD8 G;  2X9W A;  2XQ9 A;  5HWY A;  2CCQ A;  2ACZ A;  2KT9 A;  5IUX A;  2PTF A;  2VKJ A;  3AEB A;  2VKO A;  3FHN A;  2NTY A;  1FEW A;  4IIJ E;  4X20 E;  4IST A;  5EK3 A;  1FMW A;  2E9X B;  1HNZ T;  2M6B A;  4PAG A;  4UV8 B;  5LGT B;  2C5K T;  1X9B A;  2J4G A;  2XQ4 A;  2AXD S;  3QNU A;  3ZSS A;  1J5E T;  1XMO T;  4L5G A;  2IC6 A;  4QH5 A;  2BKN A;  5FYM A;  3RYI E;  2H3R A;  2C5I T;  3QC9 A;  4IE6 A;  5L4H A;  5LG3 A;  2UUC T;  4U2Y A;  5LG4 A;  2V26 A;  5ABF A;  4PK4 A;  3N9O A;  3RYH E;  4WBN E;  5LMU T;  2V7I A;  5CA0 E;  1KEY A;  3O9X A;  5L4E A;  3MXZ A;  2QRX A;  2FJD A;  2XAF B;  2CHN A;  2EHO D;  4DR3 T;  2CWY A;  3OBV E;  4DV2 T;  5HEG A;  2MYS A;  3PUG A;  5HXR A;  5FP3 A;  5ABE A;  1MMA A;  3ZMV B;  5AQO B;  2LJL A;  1Z8U A;  2FBW A;  2I6H A;  2UXB T;  4KP3 C;  2CRB A;  1WRD A;  4BAY B;  3NKZ A;  3LK3 B;  1YQ4 A;  2XQ8 A;  3HR0 A;  5JH7 E;  5F3J A;  5KXJ A;  2R6G F;  2W0G A;  4UVB B;  5IHY A;  3UFE A;  1X79 A;  3FZH B;  3SRZ A;  2CXF A;  3EAB A;  3LJC A;  3F57 A;  4ERR A;  3UUN A;  2E9X D;  4ASK A;  4NUU A;  3ETU A;  4ANJ A;  1YW0 A;  1SUM B;  4JLE A;  5FXX A;  4O4L E;  3EI0 A;  3UU3 A;  1UK5 A;  2JQH A;  5AQV B;  2D5U A;  3ZYK A;  4FJO A;  1QUU A;  3AE5 A;  4QWN B;  5ADX L;  4B3S T;  2I59 A;  2XAH B;  1U5P A;  5EZY E;  5FXW A;  4NXN T;  3WI3 A;  2N1G A;  2XSA A;  3AAA B;  3AA0 B;  4EIW A;  3ONL C;  3N9M A;  2CA5 A;  2L9Q A;  3AVR A;  5FMN A;  4PFP A;  3H3M A;  3J7Y q;  3OVU A;  4HFB A;  2RA1 A;  1CHU A;  3A8Y C;  2LSY A;  3I0Q A;  4QX7 B;  1M62 A;  4TUY E;  3C98 B;  3MZK B;  3ONX A;  3Q5X A;  4HN9 A;  4L0R A;  3TLS A;  3ZEF B;  3UU5 A;  4IE0 A;  5LMN T;  4DUY T;  1N34 T;  2HPJ A;  2WY2 A;  4X1K E;  3ZST A;  5FY1 A;  2BG9 C;  4IL9 A;  3PV0 F;  2DHR A;  4WZX A;  4CN1 A;  5CA1 E;  4JV5 T;  2XQ7 A;  2ZM0 A;  2MPK A;  4KMC A;  4IE5 A;  5AQU B;  1T98 A;  3JC6 C;  4EZ4 A;  1MIY A;  5HAX A;  2W61 A;  3RIA A;  1OXZ A;  3UU6 A;  1W09 A;  2V7J A;  4MBQ A;  5JDL A;  1B7T A;  1Y01 A;  5ABG A;  2KSR A;  3C4W A;  2XQY A;  5LA6 E;  4A97 A;  4QXC B;  1SHZ C;  5LHG B;  4JI8 T;  3BK9 A;  4KHP T;  2NOX A;  2WU2 A;  1VCS A;  1D1A A;  1W9R A;  2LRL A;  2X9Y A;  3C51 A;  2WBL A;  3ESL A;  2X51 A;  4WW0 A;  2A3D A;  4EGW A;  4X62 T;  3AE6 A;  3BQI A;  2H89 A;  3IBP A;  5JDQ A;  4CXX A;  4HE8 A;  3GN5 A;  2XUE A;  3UUX B;  3SS1 A;  5AQN B;  3KBU A;  3P4Q A;  1KNZ A;  1UX4 A;  3ANW B;  1D0Y A;  3AE2 A;  3MA9 A;  4DV3 T;  3N9L A;  3KFW X;  1OED E;  2CHO A;  2IAK A;  1MMN A;  1ZP0 A;  3FZM B;  3PUQ A;  4DBQ A;  2ZLY A;  3NBX X;  2UXN B;  2KMF A;  2E9X A;  2LHN A;  2YDR A;  4PK5 A;  4QXB B;  3KV6 A;  4I50 E;  5FKY A;  5C3J A;  5L47 A;  4DV5 T;  4GK0 E;  3EAM A;  2BKP A;  3UFG A;  1IBL T;  4DR1 T;  3E22 E;  4KUM B;  3SFE A;  2ACX A;  4ZI3 D;  4LF5 T;  2ODU A;  5FL1 A;  4I4T E;  1S94 A;  4H63 H;  2IW5 B;  5L3D B;  2K24 A;  3LDQ B;  1IBM T;  3CK6 A;  3RYF E;  1J5W A;  2UU9 T;  2JMH A;  2VB6 A;  4TNV A;  5HEO A;  1WYC A;  3IA3 A;  2PFV A;  2J62 A;  4B3M T;  5LJN A;  4DV7 T;  3RIF A;  1MIW A;  3E0Z A;  2D0U A;  4U7I A;  2L8K A;  4QHO A;  1LVF A;  3SOL A;  3RF1 A;  2W62 A;  3FXE B;  2X9H A;  4GOU A;  2UUA T;  4JI5 T;  1HS7 A;  1IAP A;  5FXZ A;  3RQW A;  1E1H B;  2BS4 A;  3CKD A;  2WB5 A;  3P50 A;  3RHW A;  2VQE T;  2ZM2 A;  2XM1 A;  1MMG A;  2CEA A;  3E08 A;  4EOZ B;  2WS3 A;  1BR1 A;  4YTN A;  4IL4 A;  2X68 A;  4PNI A;  1HG2 A;  4ZI2 D;  2V8S V;  2X66 A;  3PE0 A;  4YXD A;  2OA5 A;  2A72 A;  1HNW T;  2NW9 A;  2WWV A;  3J9X 1;  4CZZ B;  2WQY A;  4DR7 T;  3D0T A;  3LG7 A;  5AQL B;  3CVR A;  5EK2 A;  2LSJ A;  4OK0 A;  2LSK A;  3SWH A;  4WNK A;  1M7K A;  3TLU A;  2QVA A;  2KIN B;  4DUZ T;  2HH7 A;  2YDQ A;  2V6Y A;  1LKX A;  5HEJ A;  2EHO C;  3L8R A;  4IT4 A;  2HN1 A;  4LF8 T;  3CML A;  4YFS A;  3UTK A;  5LXT E;  4ISS A;  5J2U E;  2X9X A;  1D0X A;  1KF6 A;  2IIU A;  3B57 A;  4HWD A;  2WCA A;  3CQX C;  4UF0 A;  2OLT A;  3RQU A;  3EDU A;  3PUX F;  5AQF B;  3FBL A;  3OYZ A;  4JI3 T;  3F31 A;  1SA0 E;  2XY8 B;  3KV4 A;  3RRW A;  3T8O A;  5HXS A;  2D0T A;  3PU3 A;  3WAJ A;  3ZCI A;  2NP9 A;  2LEH A;  3HKC E;  5A1L A;  2WWU A;  1E2A A;  1WLX A;  2DCF A;  3O4X E;  2UUB T;  4EV6 A;  2KWI B;  4ILU A;  2NW8 A;  1DU2 A;  4HWF A;  3OKQ A;  4H9P C;  4OHF A;  2BBJ A;  4YHH T;  4ZXL A;  4CI2 B;  3C64 A;  4H9O C;  1EZ3 A;  4NUV A;  5HWX A;  4HFC A;  4I55 E;  5BR8 T;  5JRC A;  2FJB A;  4LMK A;  4ZOL E;  2WP9 A;  3AE3 A;  5J2T E;  3RH3 A;  4H9Q C;  1NEK A;  1MND A;  3AE8 A;  2ZM6 T;  4KBM B;  4AKH A;  4LFC T;  3PTR B;  1ZOY A;  3C4Z A;  3QB5 A;  4IE4 A;  4X5T A;  5AQJ B;  2YU2 A;  5L3C B;  1I94 T;  3JAD A;  3Q9D A;  2YOE A;  3V5U A;  3QK6 A;  5HYA A;  3ZKR A;  3UT5 E;  3PUR A;  4DR6 T;  3UQ4 A;  2X67 A;  2YU1 A;  3H3A A;  4TNW A;  5FY0 A;  4AXP A;  4JI4 T;  2VKH A;  1T8B A;  2DLR A;  2K48 A;  4IHJ E;  2W00 A;  5JVD E;  2XQ3 A;  5J1G A;  1W0B A;  3PUV F;  5H6Q B;  3GWH A;  3VHL A;  2LE8 A;  3UUM A;  1AJ3 A;  3FBZ A;  4UR9 A;  2V1D B;  4ADZ A;  3IHR A;  4ILA A;  4CXW A;  3IF8 B;  2NW7 A;  5CGM A;  1NAF A;  2JPF A;  2CXL A;  4QX8 B;  4IE7 A;  5HCM A;  2BBH A;  1WR6 A;  3K8P C;  5CJ5 A;  5JTG A;  2LRK A;  4H9R C;  3Q5D A;  4MLK A;  2D2S A;  4YTP A;  2EHO A;  2NR4 A;  2AE9 A;  2XQA A;  3AA7 B;  4PJL A;  5ABF B;  3UQ7 A;  4IDO A;  1XNR T;  2YK0 A;  2QYW A;  3DJB A;  3RIU A;  2FJE A;  3ZC0 A;  4ZI2 C;  1XMQ T;  5ABH A;  5JDN A;  3ZMS B;  4OFZ A;  3ZT5 A;  5LYJ E;  2LLY A;  4LMJ A;  2MOZ A;  1N32 T;  4YSX A;  2V6X A;  4ZI7 E;  2DNX A;  3CQC B;  3T1H T;  4TV9 E;  4JI1 T;  4E7Z A;  5LJM A;  2XTL A;  3GMI A;  5LBM A;  3N5L A;  5EK4 A;  2DWG A;  4J2C A;  4TZ4 C;  2XQ6 A;  3RC8 A;  3H37 A;  3AE1 A;  2LM9 A;  3VRB A;  4Q25 A;  3CX7 B;  3AEE A;  3CIR A;  1H7C A;  4UEM A;  5JDF A;  3ZN1 B;  4LF4 T;  4YJ3 E;  3ZYM A;  3VU7 H;  4AKR B;  2BG9 B;  2KND A;  5LB7 B;  4AKI A;  3QUJ A;  4LF6 T;  1D1B A;  4XZC A;  1SE7 A;  2V7M A;  3ABV A;  2M67 A;  4YLH A;  1R8I A;  3JAE A;  2W2U A;  5AQG B;  4BJM A;  5DAB A;  4DV4 T;  2IUB A;  5FVL A;  3IEE A;  2MTQ A;  3N2G E;  3PDY A;  4ZS3 A;  3S4U A;  1YXR A;  3JCF A;  2BVM A;  3VR9 A;  5L2L A;  4LF7 T;  5TAO A;  4FI5 A;  4H63 V;  2J1D G;  4KI0 F;  4YTM A;  3U3I A;  4AI6 A;  4CI3 B;  5DQV A;  3ZJ1 A;  1S35 A;  4HFH A;  4K0K T;  1Z0P A;  3HA4 A;  2VL8 A;  3N2O A;  3CPZ A;  2WU5 A;  3B13 A;  3DP7 A;  3ONJ A;  4P0A A;  5AQS B;  4HTE A;  2CM0 A;  5AQT B;  5JDG A;  2LOP A;  2V7L A;  3X1D A;  3I9W A;  4AKG A;  1ZKE A;  3CX8 B;  5AQR B;  3ZMZ B;  1OED B;  1T7S A;  3L09 A;  2NTX A;  3FZF B;  4HEA A;  2ZM8 A;  2D9D A;  3T1Y T;  4WBO A;  4CN6 A;  1KNR A;  4YHJ A;  4DND A;  2K3W A;  2VWA A;  3PUY F;  5HXE A;  5JR9 B;  5AQI B;  3KV5 A;  4G63 A;  5M4Y A;  3DTO A;  3P4P A;  4L9I A;  1HTJ F;  2XJ7 A;  5FXV A;  1ZHC A;  1VOM A;  2Q9Q C;  4U74 A;  3TLW A;  4LF9 T;  3AEA A;  3ZJ2 A;  3K3O A;  3UUB A;  4EYY R;  4JEU B;  4DV0 T;  4H9N C;  4HFV A;  5JDM A;  4N78 D;  3ZMT B;  4EED A;  4QH4 A;  4IDQ A;  4YSY A;  4Z8X A;  3F2E A;  2ZMA A;  3K1S A;  2VUR A;  3NRX A;  4HKA A;  1HX1 B;  4UIG A;  4O4J E;  3OTO T;  2YKS A;  3CX6 B;  3AED A;  3PUA A;  4OYJ A;  3LK4 2;  2N2N A;  5AQQ B;  1QLB A;  1YKH B;  2LSI A;  4TX5 A;  2WAU A;  1HCI A;  2HN2 A;  2WDQ A;  2LHR A;  2X0H A;  3N9Q A;  3PUW F;  2LSG A;  4GIW A;  4H9S E;  4KX6 A;  5F5W A;  5C8Y E;  3MJX A;  4O4I E;  5HCJ A;  4JUY A;  5IWA T;  1I6Z A;  1QSD A;  1HG5 A;  4PJN A;  4UV9 B;  3TLV A;  1FIO A;  4EEB A;  4YT0 A;  4MHC A;  4TWF A;  4K0U A;  2L3L A;  3ZPO A;  4HWI B;  5FY7 A;  2CBI A;  2V7K A;  2Y48 B;  3AXJ A;  3WAK A;  2CLY C;  4KHZ F;  3O1I A;  3RRC A;  4P1N A;  3AE4 A;  1KK7 A;  3AA1 B;  2DWK A;  4TWH A;  2Y8D A;  4B3T T;  1W0A A;  2PBI A;  3ZC1 A;  1VCT A;  3P4S A;  1D0Z A;  2V6Y B;  2C0S A;  2XAG B;  5L3B B;  4U3C A;  4BA9 A;  2IDO B;  2K5B B;  2XM2 A;  4I0U A;  3SFD A;  2VQF T;  3BQL A;  2WMO A;  4HFI A;  1VRB A;  1FMV A;  2LOS A;  2BS3 A;  1UUR A;  2A2F X;  3UUL A;  3ZN0 B;  2M6I A;  4HGA A;  3KBT A;  4DMW A;  5GON E;  5C2T A;  1T72 A;  4CQI A;  4CXY A;  2Q9Q D;  5JQG E;  1ZEE A;  2VVS A;  3RX6 A;  4DVD A;  1CUN A;  2XSB A;  2JQK A;  2JMK A;  1NWM X;  3OYX A;  4ILC A;  3RIU C;  2W66 A;  5JRC B;  2QA7 A;  5LBQ B;  1Y64 B;  2X0L B;  3VKG A;  1YKE B;  4O2A E;  2CWO A;  2XZE A;  4XAX B;  3OPC A;  4IRE A;  3K3Q C;  2CPT A;  1UCU A;  1LRZ A;  3EHZ A;  2VAS A;  1ZV4 X;  1HR0 T;  4GKK T;  3P8C D;  4EB6 E;  3ZT6 A;  5DQW A;  4EYU A;  3PJA A;  4OX9 T;  4C90 A;  3MAC A;  2P9B A;  2YIN A;  1D1C A;  2IC9 A;  4LML A;  4AQF A;  3JC6 D;  4YJ2 E;  1XWM A;  4NIQ A;  4P0B A;  5JR9 A;  1O3X A;  2LKH A;  4YY3 T;  3PJA J;  2RPA A;  4X65 T;  1BR0 A;  1GQE A;  3NWI A;  2LM2 A;  4PK6 A;  4ZZC A;  2WM9 A;  1KFY A;  2FJA A;  3RPU A;  1UUS A;  2Q9Q B;  3C50 A;  3JAF A;  2ODV A;  4DBR A;  3TKL B;  2KXP B;  2KZ7 B;  2JJ9 A;  4F6R C;  1N33 T;  4MAL A;  2G0U A;  3Q5W A;  2B1E A; 
#chains in the Genus database with same CATH homology
 1IBM T;  2UXD T;  2UU9 T;  2HHH T;  4LF7 T;  1I94 T;  4B3M T;  4DV7 T;  2E5L T;  4K0K T;  4LFA T;  1FJG T;  4AQY T;  4JI0 T;  2UUA T;  2UXC T;  4JI5 T;  2VQE T;  4JI6 T;  1HNX T;  1HNZ T;  3T1Y T;  1J5E T;  1HNW T;  4DR7 T;  1XMO T;  4DR4 T;  2UUC T;  1IBK T;  4DUZ T;  5LMU T;  4LF9 T;  4LF8 T;  4DV0 T;  4DR3 T;  4DV2 T;  3OTO T;  4JYA T;  4JI3 T;  4NXM T;  2UXB T;  4JI2 T;  2UUB T;  4X62 T;  4B3R T;  4YHH T;  4JI7 T;  5IWA T;  5BR8 T;  1XNQ T;  4DUY T;  2ZM6 T;  4B3S T;  4LFC T;  4NXN T;  4DR2 T;  4DR6 T;  4JI4 T;  4B3T T;  2F4V T;  2VQF T;  4GKJ T;  5LMN T;  1N34 T;  4JV5 T;  4X66 T;  4DR5 T;  4X64 T;  4DV6 T;  1N36 T;  1XNR T;  4JI8 T;  4DV1 T;  1XMQ T;  4KHP T;  1HR0 T;  4GKK T;  1N32 T;  3T1H T;  4OX9 T;  4JI1 T;  4DV3 T;  4YY3 T;  4X65 T;  4LF4 T;  4LFB T;  4LF6 T;  4DV5 T;  1IBL T;  4DR1 T;  1N33 T;  4LF5 T;  4DV4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...