2UXCT

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uxcT00
4DV3T 1IBKT 2UXCT 4JI2T 4DR4T 4X62T 3T1HT 4JI0T 3OTOT 4B3MT 2ZM6T 4DR3T 1HNZT 1HNXT 4DV5T 2UUBT 1FJGT 1XNRT 4NXMT 4DR5T 4LF8T 4DUZT 4JV5T 4LF6T 1N36T 4DR1T 4DV2T 4GKKT 5LMNT 4LF4T 2UUCT 4DV4T 4JYAT 4DR2T 1XMOT 5IWAT 4DV6T 5BR8T 4DV1T 4LFAT 4JI4T 4B3ST 4KHPT 1IBMT 1XNQT 4GKJT 4DR6T 4DUYT 4JI7T 2UUAT 4DV7T 4DV0T 4LFCT 5LMUT 4JI1T 4DR7T 1I94T 4LF9T 4B3RT 4LFBT 4X65T 4JI3T 4LF7T 4K0KT 4B3TT 3T1YT 4JI5T 4NXNT 4JI8T 4X66T 2VQET 4X64T 4OX9T 2UU9T 2F4VT 1N34T 2UXDT 2UXBT 1XMQT 1N33T 4JI6T 1HR0T 4YY3T 4YHHT 2HHHT 1J5ET 2VQFT 2E5LT 1N32T 1IBLT 4AQYT 4LF5T 1HNWT
chains in the Genus database with same CATH superfamily
1IBKT 4DMWA 3JC6C 4O4LE 4EOZB 1X9BA 1KF6A 1HNZT 4BJNA 1BR0A 4DUZT 4UV8B 4QKNA 4HFVA 1JNRA 3LG7A 5FXXA 4IE0A 3R84B 3IF8B 3PUVF 2VL8A 3AE8A 1IJ6A 2XAHB 3N9QA 2LM9A 3M65A 2V6YB 3ZMTB 5H6QB 4IDZA 2V6YA 5C2TA 5KDMC 5L3GB 5LHIB 2YU1A 4QH5A 3BQIA 4IE7A 1ZKEA 3EVYA 4HFEA 3LJCA 1WR6A 2PG8A 4H63H 2BKNA 5LNKA 5AQPB 5L47A 4ANJA 5AQGB 4NIQA 4K0KT 2MTQA 4KI0F 1XWMA 2Q9QD 1E1HB 1LVKA 2UXDT 2NTXA 4FJOA 3PUWF 3SWHA 3RGLA 3U78A 2D0TA 2E5LT 4DBRA 1IBLT 2LJLA 4QH4A 5FP3A 1D1BA 4CI2B 3TLUA 3MA9A 4HFIA 2Y8DA 4H9NC 3ZMUB 2YOEA 3PUAA 2UUBT 5FL0A 5FY7A 3AA0B 5KXJA 3P7IA 4ZS2A 2QVAA 2X51A 5HWXA 5AQVB 2QGSA 2UUCT 2CHOA 1UK5A 3ZKRA 4PNIA 3C4XA 4L9IA 4B3ST 4AQGA 3ZT7A 3CIRA 5LBQB 3HKEE 3FZKB 3UFGA 4EYYR 1QUUA 2XQ9A 2XQ6A 4B3RT 3AE7A 3MKDA 2WQYA 3GN5A 4UELA 2CRBA 1R8IA 1JNZA 5ABGA 4GK5E 2CLYC 5FNVE 4YTPA 3P8CD 3KVBA 4U31A 5EK4A 4AXPA 4TZ4C 5EK3A 2CBJA 3AA6B 1OEDA 4ZS3A 4X62T 1LRZA 1B7TA 5LCYA 1WR0A 2W2UA 4XBFB 2CMRA 4HFCA 4PJLA 2UXXB 3AE4A 2BKPA 2IC6A 2E8IA 5JR9C 2Z6EA 3L09A 4BAYB 4CXWA 4ADZA 4TWDA 2JQHA 2ZM8A 1UX5A 3L39A 2WS3A 3FXEB 2QYWA 2KNDA 3ZYKA 3AE9A 5LB7B 2LOPA 3UFEA 2RPAA 2ACZA 5JR9B 2X66A 4ZHQE 3EHZA 3AEDA 4HWFA 3KINB 3F57A 5FMNA 2WAUA 2Q9QB 1S94A 4UF0B 3LFMA 5L2LA 3W15B 5ABFB 2Q9QA 2KINB 4U72A 2H3RA 3MACA 4UF0A 3RYIE 4DO0A 5JRCA 4ERRA 3I9YA 3UUMA 3VR8A 3SRZA 2V26A 4AQFC 5H6RB 1WRDA 2E2AA 2PBIA 4YHJA 1MMGA 1WLXA 3OYZA 4YY3T 3BK9A 2RP4A 4I4TE 5JVDE 3CX7B 2EHOD 1J5ET 1MIWA 2WB5A 2WZHA 4KX6A 4UXNB 3BQLA 2M67A 3AAEB 2WDVA 4MALA 1QLBA 2CE7A 3RI5A 2J1DG 4MLKA 5LGUB 5JQGE 1SUMB 1W0BA 3P4SA 4CN6A 4TN7B 3ETUA 2MAWA 3OYXA 3E08A 3UT5E 3ZJ1A 4GIWA 4GKKT 2LLYA 3PJAA 4IE4A 3O1HA 1WYBA 2KWIB 1VCSA 3ZN0B 2VL0A 4TV9E 3J7Yq 4JUYA 3F31A 1XZYA 2VK9A 3ZSSA 5FKYA 4NUVA 4CXYA 2YDSA 2IDOB 5FY1A 1XNQT 2WDRA 3JC6D 2LRLA 3RIUC 1SHZC 2BS4A 3FZLB 4PJNA 1IZNB 2XHEB 4B3TT 3B57A 3ABVA 3EI0A 5DJQC 1ZV4X 2A72A 3EDUA 5M4YA 4O4HE 1XDOA 2YK0A 1XMQT 4IGUA 3RH3A 2HN2A 3LSVA 2V7LA 3M3ZB 2LHNA 3TKLB 3TLWA 2CWYA 3MZKB 2J47A 3RLFF 5LXTE 5F8PA 3O9XA 4WBNE 2NWBA 4QX8B 4CI1B 1DU2A 1HNXT 2E9XD 3KFWX 2ODVA 3F2EA 1HX1B 4P0AA 4GYSA 4IE5A 2W4XA 4EEBA 3VRAA 2LRKA 2CXLA 2JJ9A 3I1AA 3O1IA 4IDNA 2MOZA 5C3JA 3JCFA 4DV2T 4YXDA 2X9HA 3UQ7A 4PAGA 4NUUA 1HG5A 3E0ZA 1BR4A 3ZCIA 1MNEA 3LBXB 5J0ZA 4EYUA 2ES0A 4EZHA 3HA4A 2W62A 2IIUA 2V7KA 4TNVA 4YSXA 5BMVE 4JEUB 3RYCE 2X9WA 2H88A 5LP6E 1NWMX 4OYJA 3A8YC 5IHYA 4ISTA 2JMHA 4LMJA 5AQLB 1GQEA 3SFDA 4U2YA 3PUZF 4KP3C 2UXNB 4QHOA 2KXPB 2LEHA 2EHOA 3NKZA 4TNWA 4AKLA 5HYAA 2M6BA 2ZMAA 4UVCB 3SOLA 3Q5WA 4YT0A 3TLTA 1HF8A 2C5KT 3FHNA 4I50E 4IDOA 3PU3A 3O1JA 5DQVA 1J1JA 3U3IA 2H89A 5L3BB 4EIWA 4KBMB 5AQIB 3AXJA 5AFUL 4F6RC 1N36T 2J4GA 5E0OA 1YW0A 3H3AA 5KMGP 4IL9A 5ABHA 1UUSA 5AQUB 4DV6T 1D0YA 2BVLA 3D0TA 4PJJA 4JI4T 4LMLA 2NTYA 3V5SA 3A5XA 2XTLA 5ETWA 4DUYT 3QK6A 5ADXL 5LMUT 1M62A 3AE6A 3UU3A 3B13A 2LSGA 4LF7T 5HXHA 1HS7A 3UU4A 1LKXA 3PJAJ 5DABA 2NR4A 2E9XC 3VU7H 2YDRA 4X66T 2VQET 3GA8A 2VVSA 3OVUA 3C4WA 2HPJA 3IBPA 4YHHT 2H7VC 3AAAB 2DNXA 4IDPA 1OWAA 4COFA 2E9XB 4A56A 2BKOA 3OPCA 4DR4T 2XQAA 1Z0PA 2ZM6T 4EEDA 1NENA 4HWCA 2M6IA 3C64A 3AEBA 4NXMT 2L9QA 4HE8A 2ZM2A 3UQ4A 4DR5T 5LJMA 3GWHA 4CI3B 4IREA 5JDGA 1MIYA 2ZM0A 4U33A 3AEEA 2BDEA 3UUNA 2LM2A 3PV0F 3B5MA 4DV4T 3QB5K 2VASA 3ZSTA 1IJ5A 1WYCA 4ILCA 4F8HA 4HKAA 1I6ZA 3ZEFB 4FI5A 2C5IT 2AXDS 2BG9C 2KMFA 5F5WA 4AKGA 4ZEYA 2B76A 2BZBA 2OLTA 2XM2A 4LFBT 3ZT5A 4X65T 4HWDA 2WWVA 3T1YT 4EGWA 3ZMSB 3LK3B 3CQGB 3MXZA 1FIOA 3RKOA 2BG9B 2D2SA 2BG9E 2XQYA 3FZMB 2W00A 5J2UE 4OYKA 3T8OA 2VQFT 2WWUA 5FVLA 5IYZE 3MJXA 1T7SA 1NAFA 3PU8A 5FXZA 3ZYLA 2HH7A 1YD8G 1BR2A 4DR3T 2WM9A 2E5VA 3RQUA 2KZ7B 3P4PA 4QXBB 2W66A 3RQWA 4H9RC 4IDQA 2RA1A 4ZI2C 1ZEEA 2JQKA 3PUXF 4DBQA 3SS1A 1NEKA 2HPLA 2CLYB 3CVRA 3UU5A 4EV6A 2X9YA 3ONXA 4PK6A 1G8XA 2XAGB 3X1DA 2CBIA 1U5PA 2JQ9A 2DI4A 3UU6A 4O8SA 2VKDA 5LHGB 4ILAA 1UURA 4GYRA 3EAMA 5LHHB 3FZHB 2N9DA 3ESLA 1W09A 4JI1T 4DR7T 5JTGA 4X5TA 3RKGA 5LA6E 2IUBA 2AE9A 1KEYA 3ONLC 3RC8A 4NXNT 2JRKA 4JI8T 5LBMA 2A2FX 4BA9A 3AEAA 2W61A 2XQ4A 3ZYMA 1U4QA 2XSBA 5JR9A 3PUGA 5HWYA 3P50A 1N33T 5LGNB 5FXVA 3G06A 3ZCJA 5LYJE 4GOUA 2UXCT 3FZFB 3L8RA 2QA7A 2BS3A 1VOMA 5FY0A 2GK9A 4JI0T 2WP9A 5ABFA 4C90A 3KV6A 4ZOLE 2LSIA 3UULA 2WY2A 1XNRT 3KV9A 3Q9DA 1T98A 4J2CA 2VKHA 1X79A 3N9OA 1MMNA 1IAPA 3UU8A 5LG4A 3IEEA 2LSKA 4PFPA 4LF4T 4DR2T 4AQFA 2CM0A 3KVAA 4H9PC 5LJNA 3C51A 3Q5EA 4HFBA 3QOFA 3ZMZB 2SPCA 1D1CA 2WMNA 4MHCA 4H9QC 3E22E 2XUEA 3K8PC 4AISA 2UUAT 3CQXC 5HEOA 3KV5A 4TWFA 1LVFA 3I9WA 4LF9T 4IT4A 4E7SA 1D1AA 4HFDA 3LK2B 2PTFA 2PFVA 4P09A 1SA0E 1M7KA 3ZJ2A 5JDHA 3CX6B 2KSRA 3NRXA 1FMVA 2XQ3A 2NW8A 3RRWA 4ZI7E 4AKHA 3ZMVB 4YFSA 2KT9A 3NRYA 3AA7B 3UUXB 1HCIA 3ANWB 5HAXA 2ZLYA 5CFBA 2FJEA 3FBZA 3A7MA 2WCAA 3ANWA 2J62A 3RC3A 4QXCB 5A1LA 2WU2A 1E7PA 2CXFA 3J9X1 3RIUA 3VHLA 5F3JA 4CXXA 4IE6A 2OA5A 5J2TE 4I43B 4HWHA 3O4XE 5AQQB 3RIFA 4U7YA 1BR1A 4JYAT 5HEUA 2CCQA 4HEAA 5BR8T 2R6GF 3N2GE 4H9SE 4L5GA 1UX4A 4HWIB 2WMOA 3PE0A 3PUSA 4QWNB 3CK6A 3FBLA 4PK4A 3CX8B 4LFCT 1Y64B 3V5UA 4EAHA 4O2BE 4DMVA 2A9UA 3AE5A 3N9LA 4YJ3E 3DP7A 5JDNA 2FJBA 4OK0A 4X64T 4G2AA 4A97A 4MFRA 4PK5A 1D0XA 5L3CB 3QC9A 3LBXA 5JH7E 5HXRA 1YQ3A 2V7JA 1AJ3A 4YTNA 2K3WA 2V1DB 3NZQA 4YSYA 2HHHT 3LDQB 1G73A 2LOSA 3DTOA 5JDMA 3AE1A 2XQ7A 2L3LA 4DV3T 2YKSA 2IC9A 3HL6A 3PUQA 1ZP0A 3RX6A 3RF1A 4EZ4A 5AQFB 2LSJA 5CGMA 1WCRA 3EUHA 1YKEB 4KHZF 3N5LA 3SFEA 5HCMA 4AIUA 3IA3A 3PUYF 3ONJA 5FVKA 3RHWA 4DR1T 2Y6XA 4YLHA 1W0AA 1FMWA 3VKHA 5AQMB 2XM1A 3GMIA 1YQ4A 1VCTA 2N1GA 2IW5B 4DV1T 2XY8B 5TAOA 3KBTA 3TLVA 2N2NA 5AQKB 1D0ZA 1ZOYA 4DR6T 4YJ2E 3AA1B 3EDVA 4DV0T 2P9BA 2I59A 1YXRA 4ZZCA 2KLQA 3AE2A 3VR9A 4HFHA 3P4RA 3P4QA 1OXZA 5L3FB 1J5WA 1CHUA 5HCJA 4ZI2D 4N78D 3CPZA 2C0SA 4JI6T 1ZHCA 2NW7A 3PURA 5L3DB 3AE3A 1HNWT 2MBGA 2B1EA 2CHNA 5HXSA 5FXWA 4X1IE 1EZ3A 1KFYA 2BS2A 4DV5T 2X0LB 1KNZA 4JV5T 4WZXA 3ETVA 3ZN1B 4LF6T 3P4WA 2X68A 4UR9A 4O4IE 2V5CA 2NP9A 5LMNT 2E9XA 2VKOA 3Q5XA 4KUMB 4P1NA 2FBWA 3AEGA 4JEHB 3OBVE 2I0MA 2XQ5A 3I0QA 2PJQA 4U3CA 2BBHA 2D9DA 4GKJT 4DV7T 1L0VA 3CWZB 4CN4A 2K5BB 1I94T 4U74A 5HEGA 2XAQB 3H37A 3EABA 4WNKA 3L3PA 4ILUA 1Z8UA 2VKJA 4AKRB 5L4HA 5L4EA 2F4VT 3CKDA 2MYSA 3RPUA 3WI3A 2UXBT 1QSDA 2XZEA 2C5JA 4CQIA 2LKGA 2MPKA 1MIVA 4IHJE 4ILBA 4LF5T 3NBXX 4IIJE 4CZZB 2OV9A 4U7IA 2YN6A 3T1HT 5J1GA 4E7ZA 4U2ZA 3RRCA 3N9NA 3OTOT 2ACXA 3AB3B 5FL1A 3NVOA 4K0UA 1KNPA 2DWGA 2LHRA 2BG9A 3FXDB 3OJAA 1T72A 1MMAA 3VKGA 1HG2A 2DHRA 5AQNB 4A98A 2IHR1 4ZI3C 2LT3A 3AVSA 3Q5DA 4EXTA 1UGOA 3PDYA 3UTKA 1UCUA 1Y01A 2X9XA 4EB6E 1HX8A 1XMOT 3GN5B 1OEDC 2JPFA 3N9MA 3AECA 5EZYE 3QUJA 1HTJF 5JDQA 4OFZA 3N2OA 2DL1A 1MMDA 3HKDE 2XJ7A 3HKBE 3PTRB 4V1Av 4LMKA 2V7IA 3ZC0A 2XQ8A 4DNDA 3KDSE 2KWHA 3QNUA 2ODUA 2X0HA 4X1YE 4OHFA 3C98B 2D5UA 1OEDB 4JI3T 2HN1A 5CA1E 1OEDE 1SE7A 1O3XA 2DLRA 3WAKA 4BJMA 2WBLA 2YU2A 4H9OC 3K3QC 3K3NA 1S35A 3LK42 3Q2MA 2DCFA 3UUBA 2FJAA 3JAEA 2V5DA 4AQYT 4DIDB 2QRXA 2CEAA 4WYVA 3R6NA 5CA0E 1HFAA 2Y48B 5LOVE 1T8BA 2CWOA 5DQWA 2Q9QC 3I0OA 2K48A 3ZPOA 2FJDA 4NPPA 4Z8XA 3NZPA 2H7OA 4LF8T 5LGTB 3HR0A 5AQOB 4HN9A 5AQSB 4UEMA 2W63A 4M1PA 2VWAA 4Z91A 4XAXB 4UVBB 3CQCB 4TV8E 4PJMA 5IWAT 5JRCB 4PW8A 3KV4A 5IUXA 4XZCA 4X1KE 1XDPA 3RIAA 2CPTA 3RYFE 5CJ5A 1IBMT 4AI6A 4YTMA 3OKQA 2IMLA 3JADA 3C4ZA 2VURA 4X20E 3FB2A 2JMKA 3QB5A 3S4UA 2BBJA 5AQHB 2NOXA 5AQTB 2DWKA 2CXDA 4QH1A 4OX9T 3H3MA 1HR0T 4MBQA 5JDLA 3HI2A 4H63V 4P0BA 4JBWF 1FEWA 4KMCA 2WU5A 1H7CA 2X67A 4WBOA 3NWIA 4B3MT 3TLSA 5KX5E 5L3EB 2K9AA 4DVDA 4WW0A 2V6XA 4I0UA 3C50A 1W9RA 2V7MA 5HEJA 3ZLIA 4YSZA 2YEVC 1V9DA 2WDQA 5JDFA 1KNRA 1MNDA 2V8SV 3ZC1A 2XASB 4QXHB 4UVAB 2W67A 2YDQA 4O2AE 3VRBA 2VB6A 4PFOA 4KHPT 1YKHB 4HTEA 4UV9B 2LKHA 4HGAA 5ABEA 5HXCA 4AKIA 2WSSV 5GONE 2D0UA 3K1SA 2W0GA 2BVMA 5CB4E 1US7B 3K3OA 4JI5T 2LSYA 3BQKA 2XSAA 2XAFB 4Z90A 5LG3A 4QX7B 2X0YA 4TX5A 4IL4A 1N34T 3MK7C 2NW9A 4GK0E 5FYMA 4ISSA 2L8KA 5C8YE 2I6HA 2WZIA 4Q25A 1N32T 5JREA 3HKCE 2A3DA 5HEHA 4JI2T 3ZT6A 5EK2A 5AQJB 2YINA 3N9PA 4ZZBA 1VRBA 4L0RA 1FJGT 2FUPA 2CA5A 1WFDA 4I55E 2VVNA 2JIWA 2EHOC 4O4JE 5AQRB 4G63A 2G0UA 2LE8A 4ASKA 4TUYE 4LFAT 3CMLA 3KBUA 3DJBA 2EHOB 3IHRA 4JI7T 3AEFA 4JLEA 1CUNA 4C91A 3JAFA 1KK7A 4UIGA 2XAJB 3N2KE 3WAJA 3AVRA 2UU9T 2XPKA 4B6XA 2K24A 5HXEA 2JQQA 4A5XA 4ZXLA 3AXJB 4TWHA 3AAIA 1E2AA 4CN1A 2IAKA 4ZI3D 3RYHE
chains in the Genus database with same CATH topology
4DV3T 1IBKT 2UXCT 4JI2T 4DR4T 4X62T 3T1HT 4JI0T 3OTOT 4B3MT 2ZM6T 4DR3T 1HNZT 1HNXT 4DV5T 2UUBT 1FJGT 1XNRT 4NXMT 4DR5T 4LF8T 4DUZT 4JV5T 4LF6T 1N36T 4DR1T 4DV2T 4GKKT 5LMNT 4LF4T 2UUCT 4DV4T 4JYAT 4DR2T 1XMOT 5IWAT 4DV6T 5BR8T 4DV1T 4LFAT 4JI4T 4B3ST 4KHPT 1IBMT 1XNQT 4GKJT 4DR6T 4DUYT 4JI7T 2UUAT 4DV7T 4DV0T 4LFCT 5LMUT 4JI1T 4DR7T 1I94T 4LF9T 4B3RT 4LFBT 4X65T 4JI3T 4LF7T 4K0KT 4B3TT 3T1YT 4JI5T 4NXNT 4JI8T 4X66T 2VQET 4X64T 4OX9T 2UU9T 2F4VT 1N34T 2UXDT 2UXBT 1XMQT 1N33T 4JI6T 1HR0T 4YY3T 4YHHT 2HHHT 1J5ET 2VQFT 2E5LT 1N32T 1IBLT 4AQYT 4LF5T 1HNWT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 T;  1IBK T;  2UXC T;  4JI2 T;  4DR4 T;  4X62 T;  3T1H T;  4JI0 T;  3OTO T;  4B3M T;  2ZM6 T;  4DR3 T;  1HNZ T;  1HNX T;  4DV5 T;  2UUB T;  1FJG T;  1XNR T;  4NXM T;  4DR5 T;  4LF8 T;  4DUZ T;  4JV5 T;  4LF6 T;  1N36 T;  4DR1 T;  4DV2 T;  4GKK T;  5LMN T;  4LF4 T;  2UUC T;  4DV4 T;  4JYA T;  4DR2 T;  1XMO T;  5IWA T;  4DV6 T;  5BR8 T;  4DV1 T;  4LFA T;  4JI4 T;  4B3S T;  4KHP T;  1IBM T;  1XNQ T;  4GKJ T;  4DR6 T;  4DUY T;  4JI7 T;  2UUA T;  4DV7 T;  4DV0 T;  4LFC T;  5LMU T;  4JI1 T;  4DR7 T;  1I94 T;  4LF9 T;  4B3R T;  4LFB T;  4X65 T;  4JI3 T;  4LF7 T;  4K0K T;  4B3T T;  3T1Y T;  4JI5 T;  4NXN T;  4JI8 T;  4X66 T;  2VQE T;  4X64 T;  4OX9 T;  2UU9 T;  2F4V T;  1N34 T;  2UXD T;  2UXB T;  1XMQ T;  1N33 T;  4JI6 T;  1HR0 T;  4YY3 T;  4YHH T;  2HHH T;  1J5E T;  2VQF T;  2E5L T;  1N32 T;  1IBL T;  4AQY T;  4LF5 T;  1HNW T; 
#chains in the Genus database with same CATH topology
 1IBK T;  4DMW A;  3JC6 C;  4O4L E;  4EOZ B;  1X9B A;  1KF6 A;  1HNZ T;  4BJN A;  1BR0 A;  4DUZ T;  4UV8 B;  4QKN A;  4HFV A;  1JNR A;  3LG7 A;  5FXX A;  4IE0 A;  3R84 B;  3IF8 B;  3PUV F;  2VL8 A;  3AE8 A;  1IJ6 A;  2XAH B;  3N9Q A;  2LM9 A;  3M65 A;  2V6Y B;  3ZMT B;  5H6Q B;  4IDZ A;  2V6Y A;  5C2T A;  5KDM C;  5L3G B;  5LHI B;  2YU1 A;  4QH5 A;  3BQI A;  4IE7 A;  1ZKE A;  3EVY A;  4HFE A;  3LJC A;  1WR6 A;  2PG8 A;  4H63 H;  2BKN A;  5LNK A;  5AQP B;  5L47 A;  4ANJ A;  5AQG B;  4NIQ A;  4K0K T;  2MTQ A;  4KI0 F;  1XWM A;  2Q9Q D;  1E1H B;  1LVK A;  2UXD T;  2NTX A;  4FJO A;  3PUW F;  3SWH A;  3RGL A;  3U78 A;  2D0T A;  2E5L T;  4DBR A;  1IBL T;  2LJL A;  4QH4 A;  5FP3 A;  1D1B A;  4CI2 B;  3TLU A;  3MA9 A;  4HFI A;  2Y8D A;  4H9N C;  3ZMU B;  2YOE A;  3PUA A;  2UUB T;  5FL0 A;  5FY7 A;  3AA0 B;  5KXJ A;  3P7I A;  4ZS2 A;  2QVA A;  2X51 A;  5HWX A;  5AQV B;  2QGS A;  2UUC T;  2CHO A;  1UK5 A;  3ZKR A;  4PNI A;  3C4X A;  4L9I A;  4B3S T;  4AQG A;  3ZT7 A;  3CIR A;  5LBQ B;  3HKE E;  3FZK B;  3UFG A;  4EYY R;  1QUU A;  2XQ9 A;  2XQ6 A;  4B3R T;  3AE7 A;  3MKD A;  2WQY A;  3GN5 A;  4UEL A;  2CRB A;  1R8I A;  1JNZ A;  5ABG A;  4GK5 E;  2CLY C;  5FNV E;  4YTP A;  3P8C D;  3KVB A;  4U31 A;  5EK4 A;  4AXP A;  4TZ4 C;  5EK3 A;  2CBJ A;  3AA6 B;  1OED A;  4ZS3 A;  4X62 T;  1LRZ A;  1B7T A;  5LCY A;  1WR0 A;  2W2U A;  4XBF B;  2CMR A;  4HFC A;  4PJL A;  2UXX B;  3AE4 A;  2BKP A;  2IC6 A;  2E8I A;  5JR9 C;  2Z6E A;  3L09 A;  4BAY B;  4CXW A;  4ADZ A;  4TWD A;  2JQH A;  2ZM8 A;  1UX5 A;  3L39 A;  2WS3 A;  3FXE B;  2QYW A;  2KND A;  3ZYK A;  3AE9 A;  5LB7 B;  2LOP A;  3UFE A;  2RPA A;  2ACZ A;  5JR9 B;  2X66 A;  4ZHQ E;  3EHZ A;  3AED A;  4HWF A;  3KIN B;  3F57 A;  5FMN A;  2WAU A;  2Q9Q B;  1S94 A;  4UF0 B;  3LFM A;  5L2L A;  3W15 B;  5ABF B;  2Q9Q A;  2KIN B;  4U72 A;  2H3R A;  3MAC A;  4UF0 A;  3RYI E;  4DO0 A;  5JRC A;  4ERR A;  3I9Y A;  3UUM A;  3VR8 A;  3SRZ A;  2V26 A;  4AQF C;  5H6R B;  1WRD A;  2E2A A;  2PBI A;  4YHJ A;  1MMG A;  1WLX A;  3OYZ A;  4YY3 T;  3BK9 A;  2RP4 A;  4I4T E;  5JVD E;  3CX7 B;  2EHO D;  1J5E T;  1MIW A;  2WB5 A;  2WZH A;  4KX6 A;  4UXN B;  3BQL A;  2M67 A;  3AAE B;  2WDV A;  4MAL A;  1QLB A;  2CE7 A;  3RI5 A;  2J1D G;  4MLK A;  5LGU B;  5JQG E;  1SUM B;  1W0B A;  3P4S A;  4CN6 A;  4TN7 B;  3ETU A;  2MAW A;  3OYX A;  3E08 A;  3UT5 E;  3ZJ1 A;  4GIW A;  4GKK T;  2LLY A;  3PJA A;  4IE4 A;  3O1H A;  1WYB A;  2KWI B;  1VCS A;  3ZN0 B;  2VL0 A;  4TV9 E;  3J7Y q;  4JUY A;  3F31 A;  1XZY A;  2VK9 A;  3ZSS A;  5FKY A;  4NUV A;  4CXY A;  2YDS A;  2IDO B;  5FY1 A;  1XNQ T;  2WDR A;  3JC6 D;  2LRL A;  3RIU C;  1SHZ C;  2BS4 A;  3FZL B;  4PJN A;  1IZN B;  2XHE B;  4B3T T;  3B57 A;  3ABV A;  3EI0 A;  5DJQ C;  1ZV4 X;  2A72 A;  3EDU A;  5M4Y A;  4O4H E;  1XDO A;  2YK0 A;  1XMQ T;  4IGU A;  3RH3 A;  2HN2 A;  3LSV A;  2V7L A;  3M3Z B;  2LHN A;  3TKL B;  3TLW A;  2CWY A;  3MZK B;  2J47 A;  3RLF F;  5LXT E;  5F8P A;  3O9X A;  4WBN E;  2NWB A;  4QX8 B;  4CI1 B;  1DU2 A;  1HNX T;  2E9X D;  3KFW X;  2ODV A;  3F2E A;  1HX1 B;  4P0A A;  4GYS A;  4IE5 A;  2W4X A;  4EEB A;  3VRA A;  2LRK A;  2CXL A;  2JJ9 A;  3I1A A;  3O1I A;  4IDN A;  2MOZ A;  5C3J A;  3JCF A;  4DV2 T;  4YXD A;  2X9H A;  3UQ7 A;  4PAG A;  4NUU A;  1HG5 A;  3E0Z A;  1BR4 A;  3ZCI A;  1MNE A;  3LBX B;  5J0Z A;  4EYU A;  2ES0 A;  4EZH A;  3HA4 A;  2W62 A;  2IIU A;  2V7K A;  4TNV A;  4YSX A;  5BMV E;  4JEU B;  3RYC E;  2X9W A;  2H88 A;  5LP6 E;  1NWM X;  4OYJ A;  3A8Y C;  5IHY A;  4IST A;  2JMH A;  4LMJ A;  5AQL B;  1GQE A;  3SFD A;  4U2Y A;  3PUZ F;  4KP3 C;  2UXN B;  4QHO A;  2KXP B;  2LEH A;  2EHO A;  3NKZ A;  4TNW A;  4AKL A;  5HYA A;  2M6B A;  2ZMA A;  4UVC B;  3SOL A;  3Q5W A;  4YT0 A;  3TLT A;  1HF8 A;  2C5K T;  3FHN A;  4I50 E;  4IDO A;  3PU3 A;  3O1J A;  5DQV A;  1J1J A;  3U3I A;  2H89 A;  5L3B B;  4EIW A;  4KBM B;  5AQI B;  3AXJ A;  5AFU L;  4F6R C;  1N36 T;  2J4G A;  5E0O A;  1YW0 A;  3H3A A;  5KMG P;  4IL9 A;  5ABH A;  1UUS A;  5AQU B;  4DV6 T;  1D0Y A;  2BVL A;  3D0T A;  4PJJ A;  4JI4 T;  4LML A;  2NTY A;  3V5S A;  3A5X A;  2XTL A;  5ETW A;  4DUY T;  3QK6 A;  5ADX L;  5LMU T;  1M62 A;  3AE6 A;  3UU3 A;  3B13 A;  2LSG A;  4LF7 T;  5HXH A;  1HS7 A;  3UU4 A;  1LKX A;  3PJA J;  5DAB A;  2NR4 A;  2E9X C;  3VU7 H;  2YDR A;  4X66 T;  2VQE T;  3GA8 A;  2VVS A;  3OVU A;  3C4W A;  2HPJ A;  3IBP A;  4YHH T;  2H7V C;  3AAA B;  2DNX A;  4IDP A;  1OWA A;  4COF A;  2E9X B;  4A56 A;  2BKO A;  3OPC A;  4DR4 T;  2XQA A;  1Z0P A;  2ZM6 T;  4EED A;  1NEN A;  4HWC A;  2M6I A;  3C64 A;  3AEB A;  4NXM T;  2L9Q A;  4HE8 A;  2ZM2 A;  3UQ4 A;  4DR5 T;  5LJM A;  3GWH A;  4CI3 B;  4IRE A;  5JDG A;  1MIY A;  2ZM0 A;  4U33 A;  3AEE A;  2BDE A;  3UUN A;  2LM2 A;  3PV0 F;  3B5M A;  4DV4 T;  3QB5 K;  2VAS A;  3ZST A;  1IJ5 A;  1WYC A;  4ILC A;  4F8H A;  4HKA A;  1I6Z A;  3ZEF B;  4FI5 A;  2C5I T;  2AXD S;  2BG9 C;  2KMF A;  5F5W A;  4AKG A;  4ZEY A;  2B76 A;  2BZB A;  2OLT A;  2XM2 A;  4LFB T;  3ZT5 A;  4X65 T;  4HWD A;  2WWV A;  3T1Y T;  4EGW A;  3ZMS B;  3LK3 B;  3CQG B;  3MXZ A;  1FIO A;  3RKO A;  2BG9 B;  2D2S A;  2BG9 E;  2XQY A;  3FZM B;  2W00 A;  5J2U E;  4OYK A;  3T8O A;  2VQF T;  2WWU A;  5FVL A;  5IYZ E;  3MJX A;  1T7S A;  1NAF A;  3PU8 A;  5FXZ A;  3ZYL A;  2HH7 A;  1YD8 G;  1BR2 A;  4DR3 T;  2WM9 A;  2E5V A;  3RQU A;  2KZ7 B;  3P4P A;  4QXB B;  2W66 A;  3RQW A;  4H9R C;  4IDQ A;  2RA1 A;  4ZI2 C;  1ZEE A;  2JQK A;  3PUX F;  4DBQ A;  3SS1 A;  1NEK A;  2HPL A;  2CLY B;  3CVR A;  3UU5 A;  4EV6 A;  2X9Y A;  3ONX A;  4PK6 A;  1G8X A;  2XAG B;  3X1D A;  2CBI A;  1U5P A;  2JQ9 A;  2DI4 A;  3UU6 A;  4O8S A;  2VKD A;  5LHG B;  4ILA A;  1UUR A;  4GYR A;  3EAM A;  5LHH B;  3FZH B;  2N9D A;  3ESL A;  1W09 A;  4JI1 T;  4DR7 T;  5JTG A;  4X5T A;  3RKG A;  5LA6 E;  2IUB A;  2AE9 A;  1KEY A;  3ONL C;  3RC8 A;  4NXN T;  2JRK A;  4JI8 T;  5LBM A;  2A2F X;  4BA9 A;  3AEA A;  2W61 A;  2XQ4 A;  3ZYM A;  1U4Q A;  2XSB A;  5JR9 A;  3PUG A;  5HWY A;  3P50 A;  1N33 T;  5LGN B;  5FXV A;  3G06 A;  3ZCJ A;  5LYJ E;  4GOU A;  2UXC T;  3FZF B;  3L8R A;  2QA7 A;  2BS3 A;  1VOM A;  5FY0 A;  2GK9 A;  4JI0 T;  2WP9 A;  5ABF A;  4C90 A;  3KV6 A;  4ZOL E;  2LSI A;  3UUL A;  2WY2 A;  1XNR T;  3KV9 A;  3Q9D A;  1T98 A;  4J2C A;  2VKH A;  1X79 A;  3N9O A;  1MMN A;  1IAP A;  3UU8 A;  5LG4 A;  3IEE A;  2LSK A;  4PFP A;  4LF4 T;  4DR2 T;  4AQF A;  2CM0 A;  3KVA A;  4H9P C;  5LJN A;  3C51 A;  3Q5E A;  4HFB A;  3QOF A;  3ZMZ B;  2SPC A;  1D1C A;  2WMN A;  4MHC A;  4H9Q C;  3E22 E;  2XUE A;  3K8P C;  4AIS A;  2UUA T;  3CQX C;  5HEO A;  3KV5 A;  4TWF A;  1LVF A;  3I9W A;  4LF9 T;  4IT4 A;  4E7S A;  1D1A A;  4HFD A;  3LK2 B;  2PTF A;  2PFV A;  4P09 A;  1SA0 E;  1M7K A;  3ZJ2 A;  5JDH A;  3CX6 B;  2KSR A;  3NRX A;  1FMV A;  2XQ3 A;  2NW8 A;  3RRW A;  4ZI7 E;  4AKH A;  3ZMV B;  4YFS A;  2KT9 A;  3NRY A;  3AA7 B;  3UUX B;  1HCI A;  3ANW B;  5HAX A;  2ZLY A;  5CFB A;  2FJE A;  3FBZ A;  3A7M A;  2WCA A;  3ANW A;  2J62 A;  3RC3 A;  4QXC B;  5A1L A;  2WU2 A;  1E7P A;  2CXF A;  3J9X 1;  3RIU A;  3VHL A;  5F3J A;  4CXX A;  4IE6 A;  2OA5 A;  5J2T E;  4I43 B;  4HWH A;  3O4X E;  5AQQ B;  3RIF A;  4U7Y A;  1BR1 A;  4JYA T;  5HEU A;  2CCQ A;  4HEA A;  5BR8 T;  2R6G F;  3N2G E;  4H9S E;  4L5G A;  1UX4 A;  4HWI B;  2WMO A;  3PE0 A;  3PUS A;  4QWN B;  3CK6 A;  3FBL A;  4PK4 A;  3CX8 B;  4LFC T;  1Y64 B;  3V5U A;  4EAH A;  4O2B E;  4DMV A;  2A9U A;  3AE5 A;  3N9L A;  4YJ3 E;  3DP7 A;  5JDN A;  2FJB A;  4OK0 A;  4X64 T;  4G2A A;  4A97 A;  4MFR A;  4PK5 A;  1D0X A;  5L3C B;  3QC9 A;  3LBX A;  5JH7 E;  5HXR A;  1YQ3 A;  2V7J A;  1AJ3 A;  4YTN A;  2K3W A;  2V1D B;  3NZQ A;  4YSY A;  2HHH T;  3LDQ B;  1G73 A;  2LOS A;  3DTO A;  5JDM A;  3AE1 A;  2XQ7 A;  2L3L A;  4DV3 T;  2YKS A;  2IC9 A;  3HL6 A;  3PUQ A;  1ZP0 A;  3RX6 A;  3RF1 A;  4EZ4 A;  5AQF B;  2LSJ A;  5CGM A;  1WCR A;  3EUH A;  1YKE B;  4KHZ F;  3N5L A;  3SFE A;  5HCM A;  4AIU A;  3IA3 A;  3PUY F;  3ONJ A;  5FVK A;  3RHW A;  4DR1 T;  2Y6X A;  4YLH A;  1W0A A;  1FMW A;  3VKH A;  5AQM B;  2XM1 A;  3GMI A;  1YQ4 A;  1VCT A;  2N1G A;  2IW5 B;  4DV1 T;  2XY8 B;  5TAO A;  3KBT A;  3TLV A;  2N2N A;  5AQK B;  1D0Z A;  1ZOY A;  4DR6 T;  4YJ2 E;  3AA1 B;  3EDV A;  4DV0 T;  2P9B A;  2I59 A;  1YXR A;  4ZZC A;  2KLQ A;  3AE2 A;  3VR9 A;  4HFH A;  3P4R A;  3P4Q A;  1OXZ A;  5L3F B;  1J5W A;  1CHU A;  5HCJ A;  4ZI2 D;  4N78 D;  3CPZ A;  2C0S A;  4JI6 T;  1ZHC A;  2NW7 A;  3PUR A;  5L3D B;  3AE3 A;  1HNW T;  2MBG A;  2B1E A;  2CHN A;  5HXS A;  5FXW A;  4X1I E;  1EZ3 A;  1KFY A;  2BS2 A;  4DV5 T;  2X0L B;  1KNZ A;  4JV5 T;  4WZX A;  3ETV A;  3ZN1 B;  4LF6 T;  3P4W A;  2X68 A;  4UR9 A;  4O4I E;  2V5C A;  2NP9 A;  5LMN T;  2E9X A;  2VKO A;  3Q5X A;  4KUM B;  4P1N A;  2FBW A;  3AEG A;  4JEH B;  3OBV E;  2I0M A;  2XQ5 A;  3I0Q A;  2PJQ A;  4U3C A;  2BBH A;  2D9D A;  4GKJ T;  4DV7 T;  1L0V A;  3CWZ B;  4CN4 A;  2K5B B;  1I94 T;  4U74 A;  5HEG A;  2XAQ B;  3H37 A;  3EAB A;  4WNK A;  3L3P A;  4ILU A;  1Z8U A;  2VKJ A;  4AKR B;  5L4H A;  5L4E A;  2F4V T;  3CKD A;  2MYS A;  3RPU A;  3WI3 A;  2UXB T;  1QSD A;  2XZE A;  2C5J A;  4CQI A;  2LKG A;  2MPK A;  1MIV A;  4IHJ E;  4ILB A;  4LF5 T;  3NBX X;  4IIJ E;  4CZZ B;  2OV9 A;  4U7I A;  2YN6 A;  3T1H T;  5J1G A;  4E7Z A;  4U2Z A;  3RRC A;  3N9N A;  3OTO T;  2ACX A;  3AB3 B;  5FL1 A;  3NVO A;  4K0U A;  1KNP A;  2DWG A;  2LHR A;  2BG9 A;  3FXD B;  3OJA A;  1T72 A;  1MMA A;  3VKG A;  1HG2 A;  2DHR A;  5AQN B;  4A98 A;  2IHR 1;  4ZI3 C;  2LT3 A;  3AVS A;  3Q5D A;  4EXT A;  1UGO A;  3PDY A;  3UTK A;  1UCU A;  1Y01 A;  2X9X A;  4EB6 E;  1HX8 A;  1XMO T;  3GN5 B;  1OED C;  2JPF A;  3N9M A;  3AEC A;  5EZY E;  3QUJ A;  1HTJ F;  5JDQ A;  4OFZ A;  3N2O A;  2DL1 A;  1MMD A;  3HKD E;  2XJ7 A;  3HKB E;  3PTR B;  4V1A v;  4LMK A;  2V7I A;  3ZC0 A;  2XQ8 A;  4DND A;  3KDS E;  2KWH A;  3QNU A;  2ODU A;  2X0H A;  4X1Y E;  4OHF A;  3C98 B;  2D5U A;  1OED B;  4JI3 T;  2HN1 A;  5CA1 E;  1OED E;  1SE7 A;  1O3X A;  2DLR A;  3WAK A;  4BJM A;  2WBL A;  2YU2 A;  4H9O C;  3K3Q C;  3K3N A;  1S35 A;  3LK4 2;  3Q2M A;  2DCF A;  3UUB A;  2FJA A;  3JAE A;  2V5D A;  4AQY T;  4DID B;  2QRX A;  2CEA A;  4WYV A;  3R6N A;  5CA0 E;  1HFA A;  2Y48 B;  5LOV E;  1T8B A;  2CWO A;  5DQW A;  2Q9Q C;  3I0O A;  2K48 A;  3ZPO A;  2FJD A;  4NPP A;  4Z8X A;  3NZP A;  2H7O A;  4LF8 T;  5LGT B;  3HR0 A;  5AQO B;  4HN9 A;  5AQS B;  4UEM A;  2W63 A;  4M1P A;  2VWA A;  4Z91 A;  4XAX B;  4UVB B;  3CQC B;  4TV8 E;  4PJM A;  5IWA T;  5JRC B;  4PW8 A;  3KV4 A;  5IUX A;  4XZC A;  4X1K E;  1XDP A;  3RIA A;  2CPT A;  3RYF E;  5CJ5 A;  1IBM T;  4AI6 A;  4YTM A;  3OKQ A;  2IML A;  3JAD A;  3C4Z A;  2VUR A;  4X20 E;  3FB2 A;  2JMK A;  3QB5 A;  3S4U A;  2BBJ A;  5AQH B;  2NOX A;  5AQT B;  2DWK A;  2CXD A;  4QH1 A;  4OX9 T;  3H3M A;  1HR0 T;  4MBQ A;  5JDL A;  3HI2 A;  4H63 V;  4P0B A;  4JBW F;  1FEW A;  4KMC A;  2WU5 A;  1H7C A;  2X67 A;  4WBO A;  3NWI A;  4B3M T;  3TLS A;  5KX5 E;  5L3E B;  2K9A A;  4DVD A;  4WW0 A;  2V6X A;  4I0U A;  3C50 A;  1W9R A;  2V7M A;  5HEJ A;  3ZLI A;  4YSZ A;  2YEV C;  1V9D A;  2WDQ A;  5JDF A;  1KNR A;  1MND A;  2V8S V;  3ZC1 A;  2XAS B;  4QXH B;  4UVA B;  2W67 A;  2YDQ A;  4O2A E;  3VRB A;  2VB6 A;  4PFO A;  4KHP T;  1YKH B;  4HTE A;  4UV9 B;  2LKH A;  4HGA A;  5ABE A;  5HXC A;  4AKI A;  2WSS V;  5GON E;  2D0U A;  3K1S A;  2W0G A;  2BVM A;  5CB4 E;  1US7 B;  3K3O A;  4JI5 T;  2LSY A;  3BQK A;  2XSA A;  2XAF B;  4Z90 A;  5LG3 A;  4QX7 B;  2X0Y A;  4TX5 A;  4IL4 A;  1N34 T;  3MK7 C;  2NW9 A;  4GK0 E;  5FYM A;  4ISS A;  2L8K A;  5C8Y E;  2I6H A;  2WZI A;  4Q25 A;  1N32 T;  5JRE A;  3HKC E;  2A3D A;  5HEH A;  4JI2 T;  3ZT6 A;  5EK2 A;  5AQJ B;  2YIN A;  3N9P A;  4ZZB A;  1VRB A;  4L0R A;  1FJG T;  2FUP A;  2CA5 A;  1WFD A;  4I55 E;  2VVN A;  2JIW A;  2EHO C;  4O4J E;  5AQR B;  4G63 A;  2G0U A;  2LE8 A;  4ASK A;  4TUY E;  4LFA T;  3CML A;  3KBU A;  3DJB A;  2EHO B;  3IHR A;  4JI7 T;  3AEF A;  4JLE A;  1CUN A;  4C91 A;  3JAF A;  1KK7 A;  4UIG A;  2XAJ B;  3N2K E;  3WAJ A;  3AVR A;  2UU9 T;  2XPK A;  4B6X A;  2K24 A;  5HXE A;  2JQQ A;  4A5X A;  4ZXL A;  3AXJ B;  4TWH A;  3AAI A;  1E2A A;  4CN1 A;  2IAK A;  4ZI3 D;  3RYH E; 
#chains in the Genus database with same CATH homology
 4DV3 T;  1IBK T;  2UXC T;  4JI2 T;  4DR4 T;  4X62 T;  3T1H T;  4JI0 T;  3OTO T;  4B3M T;  2ZM6 T;  4DR3 T;  1HNZ T;  1HNX T;  4DV5 T;  2UUB T;  1FJG T;  1XNR T;  4NXM T;  4DR5 T;  4LF8 T;  4DUZ T;  4JV5 T;  4LF6 T;  1N36 T;  4DR1 T;  4DV2 T;  4GKK T;  5LMN T;  4LF4 T;  2UUC T;  4DV4 T;  4JYA T;  4DR2 T;  1XMO T;  5IWA T;  4DV6 T;  5BR8 T;  4DV1 T;  4LFA T;  4JI4 T;  4B3S T;  4KHP T;  1IBM T;  1XNQ T;  4GKJ T;  4DR6 T;  4DUY T;  4JI7 T;  2UUA T;  4DV7 T;  4DV0 T;  4LFC T;  5LMU T;  4JI1 T;  4DR7 T;  1I94 T;  4LF9 T;  4B3R T;  4LFB T;  4X65 T;  4JI3 T;  4LF7 T;  4K0K T;  4B3T T;  3T1Y T;  4JI5 T;  4NXN T;  4JI8 T;  4X66 T;  2VQE T;  4X64 T;  4OX9 T;  2UU9 T;  2F4V T;  1N34 T;  2UXD T;  2UXB T;  1XMQ T;  1N33 T;  4JI6 T;  1HR0 T;  4YY3 T;  4YHH T;  2HHH T;  1J5E T;  2VQF T;  2E5L T;  1N32 T;  1IBL T;  4AQY T;  4LF5 T;  1HNW T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...