2UXCT

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uxcT00
4X64T 4B3TT 1HNXT 5IWAT 4DR2T 4DR3T 2F4VT 1IBMT 4DUYT 2UUBT 4DR7T 4LFBT 4DV5T 1J5ET 4DV6T 4DV0T 1N36T 4X66T 4LF8T 4JI0T 4JI2T 4YY3T 4DV2T 1IBKT 4JI4T 3T1HT 4LF9T 2UXDT 4B3MT 4JI6T 1HR0T 4DV1T 2UUCT 1N32T 4LF7T 4LFCT 4LF4T 2HHHT 4JI5T 1HNZT 4JI1T 4DV3T 1XNQT 4DV7T 4X62T 2UUAT 2UXBT 4OX9T 4GKKT 1XMOT 1HNWT 5LMNT 4DR1T 4X65T 5BR8T 4DR4T 1XNRT 4LF6T 4KHPT 5LMUT 4JI8T 1IBLT 4AQYT 4YHHT 4LF5T 2ZM6T 4DV4T 1N34T 1FJGT 4LFAT 4JI7T 1N33T 4B3RT 4NXMT 1I94T 4NXNT 4GKJT 4JYAT 4DUZT 4DR6T 3T1YT 2UU9T 3OTOT 4B3ST 4DR5T 2VQET 4JV5T 2VQFT 4JI3T 4K0KT 2UXCT 2E5LT 1XMQT
chains in the Genus database with same CATH superfamily
3P4WA 4QHOA 1LRZA 4X64T 1D0XA 1EZ3A 3ABVA 4EZ4A 1WYCA 1T8BA 2BVLA 3E0ZA 2BG9C 2EHOA 3N9PA 4I50E 4ISTA 3UUBA 4DR3T 2F4VT 3C4WA 1B7TA 2YDRA 4HGAA 4TV9E 2IMLA 2BS4A 2ZM8A 2X68A 3E22E 3RX6A 3ZMUB 4DUYT 5LBQB 3CX7B 2UUBT 4DR7T 1Z8UA 1HX1B 3AEDA 1MMDA 2LRKA 3N9OA 2VWAA 3N2OA 4HFHA 4OFZA 2LSIA 4U33A 2NW9A 2LRLA 2VK9A 4IDPA 2KNDA 3BQLA 4IL9A 2FJBA 4WNKA 4DBQA 2CE7A 4P0BA 4DVDA 3SFEA 5AFUL 1HTJF 2J47A 3D0TA 4CXWA 2H7OA 5EK2A 1J5ET 1X9BA 4WBNE 5LHIB 4HTEA 5J1GA 1VCTA 1WRDA 4UEMA 4O4HE 2L9QA 2ZLYA 1OEDB 1YQ4A 3UULA 3PUWF 3ONXA 1T72A 3RI5A 1HCIA 3MK7C 4ZOLE 1UX5A 2MBGA 3TLVA 4YLHA 3ZLIA 4U72A 3RKOA 2A3DA 3KVBA 5EK3A 2IC9A 4DMWA 4HE8A 4LF9T 3PUXF 1CUNA 1SUMB 2W2UA 4TN7B 5JRCA 2E2AA 4FI5A 2HH7A 4JI6T 4COFA 1SA0E 2K5BB 5GONE 5AQRB 1FEWA 3KDSE 2LSJA 3L39A 1OEDC 4TZ4C 1N32T 1UCUA 3CVRA 1D1BA 3RC8A 3CX8B 1UX4A 2XJ7A 2QGSA 3NKZA 3OYZA 3QB5K 3U78A 3JC6C 3UU6A 3AEGA 3AA6B 5L4HA 1T98A 3I1AA 4QH4A 3GN5B 2KINB 4HN9A 3LK2B 4ILCA 4KP3C 4NUVA 4YTMA 2D5UA 2CLYC 5ETWA 3RYIE 2KZ7B 2VVSA 3KINB 1NAFA 2A2FX 3F31A 2UUAT 2UXBT 2ACZA 3ZYLA 4CN6A 4LMLA 2FUPA 5JR9B 2WSSV 5AQHB 3SOLA 3ZMSB 2Q9QD 1WLXA 5HCMA 4BJMA 2XQ5A 2UXNB 2X0LB 4NPPA 2J62A 2JQ9A 3RC3A 2J1DG 2E9XB 4P1NA 1SHZC 4HWFA 2IHR1 1D1CA 5HEGA 1DU2A 1E2AA 1G73A 2UXXB 2V5DA 4AQGA 2WAUA 1E7PA 2ES0A 3P7IA 2QA7A 3JC6D 4U31A 2RPAA 4JV5T 2H89A 3DTOA 3RQWA 3LFMA 5DQVA 2BDEA 3ZMVB 5LMUT 3ZC0A 3GN5A 3IF8B 3C64A 5LNKA 3H37A 4TWHA 1Y01A 5CFBA 2J4GA 1ZOYA 2W66A 3CWZB 4DV4T 4XZCA 1N34T 1O3XA 2V1DB 1MMAA 3FXDB 2N9DA 2V6YB 3VHLA 5TAOA 2WZIA 3ONJA 3IBPA 3HA4A 2XASB 4GOUA 3LBXA 3RIUC 3N9NA 1XZYA 2YN6A 3ESLA 3TLSA 2LE8A 2SPCA 4YSYA 4B3RT 1MIVA 3Q9DA 5HCJA 2IW5B 2NOXA 4EV6A 1V9DA 2NW7A 4GIWA 3PV0F 4PJMA 2V26A 1W09A 4H9RC 1I94T 1W0AA 4HWDA 2CBJA 3SRZA 4KBMB 2KLQA 4ZS2A 3O1JA 4MALA 3CK6A 3ZC1A 1IJ6A 4DR6T 1W0BA 2JMHA 3PUSA 3AA7B 3KVAA 3V5UA 2LJLA 3NZPA 1T7SA 3KV6A 5HEJA 2QRXA 2A9UA 3AA1B 2UU9T 1UUSA 3I9WA 5J0ZA 2WMNA 1KNRA 1ZHCA 4DR5T 5LP6E 4CXYA 2VQET 2CRBA 2BG9A 3I0QA 2DL1A 4WYVA 3UU4A 2JJ9A 2X51A 3Q5EA 4IDOA 4CXXA 5KXJA 1ZV4X 3UUXB 2E9XC 3K8PC 5F5WA 2RP4A 5FXXA 1WFDA 4HKAA 4PJLA 3ZN0B 5JDMA 5FNVE 2W67A 5JR9C 1HF8A 2EHOC 3AA0B 5EK4A 2VB6A 4JBWF 2G0UA 2FBWA 5AQJB 3O1IA 3RH3A 3ZYMA 4ADZA 4WBOA 4ILBA 5HEOA 4H63V 1BR2A 4KHZF 4UIGA 1LKXA 1IBMT 1HFAA 3OBVE 4GYRA 1N33T 2W63A 3P4QA 1KF6A 4LFBT 5JRCB 3UU8A 3AECA 2NWBA 2BG9E 2I6HA 4QH5A 4PJJA 3AVRA 2CCQA 3PUQA 2Y6XA 2M6BA 4IE4A 3QC9A 4UXNB 5FY0A 4AIUA 4ZI2D 1J5WA 2Y48B 3HI2A 3NRXA 4DNDA 4UV8B 2WBLA 2X67A 3O4XE 3NRYA 4ZXLA 2V7KA 3MACA 4DV0T 1N36T 2QVAA 5L3FB 4LF8T 4U7YA 3NVOA 4QXBB 4JI0T 4MFRA 2Q9QB 2W4XA 2ODVA 2CA5A 3UFEA 5FXVA 2PG8A 4EAHA 3CX6B 4TWDA 4EEBA 2YDQA 3UT5E 4C90A 4TNVA 2V5CA 2ZMAA 3PUGA 3CQGB 4IGUA 5JR9A 4DV2T 4JI4T 4IE5A 4AKRB 1QLBA 5LYJE 2IUBA 4Z90A 2DI4A 2XQ3A 5HXEA 4AQFC 5JDNA 5E0OA 3ANWA 5EZYE 4O4IE 4IL4A 2I0MA 3N5LA 1W9RA 1MIYA 2WB5A 2YEVC 4O2AE 4DV1T 3FBZA 5HAXA 2P9BA 3UU5A 4O4JE 4BAYB 2NR4A 5J2UE 4U3CA 4A98A 1SE7A 3AEFA 5LHGB 2LM2A 4HFDA 1L0VA 2HHHT 3HKEE 4I4TE 4LMJA 5AQTB 3T8OA 1BR4A 2W00A 4M1PA 1D1AA 2H7VC 5HXSA 3FXEB 2PJQA 5JTGA 3AE3A 4HFIA 5KDMC 3WAJA 1XNQT 2E8IA 1M62A 4OX9T 3ZT5A 5L3BB 1YXRA 2WDRA 2IIUA 4QH1A 3S4UA 2V7IA 3FZKB 2DWKA 4HWHA 5FVKA 2CMRA 4A56A 2XQ9A 2DHRA 3FZLB 1JNRA 3ZMZB 3TLWA 5LMNT 1HNWT 5LA6E 3IA3A 5AQPB 2A72A 3DP7A 1ZP0A 3MZKB 3QNUA 4X65T 5BR8T 2CWYA 5F3JA 3UTKA 2OA5A 1UGOA 4DMVA 2BKOA 2HPLA 2JIWA 3NBXX 3PUVF 1R8IA 2L3LA 2XTLA 4EYUA 3EUHA 3F57A 4H9PC 2I59A 3CIRA 4KMCA 3CMLA 4PK6A 4PW8A 3ZMTB 2YDSA 5JVDE 3RYHE 1X79A 2XQAA 1IBLT 3CKDA 1FMVA 5LGNB 2BBJA 1S94A 3E08A 4GYSA 2Q9QA 3FB2A 2C5IT 4AQFA 5AQMB 2DCFA 2XSAA 2Q9QC 3PJAJ 5AQNB 3RIFA 5L3CB 5LXTE 1YW0A 2V6XA 2C5KT 2WM9A 3H3AA 2V6YA 2WP9A 2LKHA 4LMKA 2D9DA 2XAGB 4N78D 1U5PA 2LLYA 4B6XA 5CA0E 4P0AA 3AAIA 3QUJA 1BR1A 4I55E 3KBTA 4JYAT 4GKJT 3EDUA 2KT9A 4HFBA 4IDNA 5LG4A 4DUZT 2LOSA 5JDFA 3OPCA 3LDQB 4AI6A 4IE0A 4YT0A 5FP3A 3ANWB 4QXCB 2AXDS 3KBUA 4IIJE 3VU7H 1E1HB 3MA9A 5CA1E 2PBIA 1MNDA 3FZHB 1OEDE 2XAQB 3T1YT 3OTOT 4B3ST 3O9XA 1M7KA 3SWHA 1KFYA 4Q25A 4AXPA 3ZN1B 2W0GA 5C8YE 5LGUB 1YQ3A 3PJAA 2VQFT 2JMKA 3ZJ2A 1CHUA 2VL8A 1IZNB 4YSXA 2E5LT 4HWIB 2MTQA 4KI0F 4YHJA 4ZI2C 2CXDA 2D2SA 2EHOD 2IDOB 2JPFA 3ZCIA 4B3TT 2L8KA 4XAXB 4X1YE 4IE6A 1LVKA 5IWAT 4OYJA 3EAMA 3UFGA 2GK9A 2VKDA 3GWHA 2EHOB 4PAGA 4DR2T 1J1JA 2FJAA 2V8SV 3K1SA 2XZEA 3W15B 5LHHB 4AISA 1IAPA 2XQ6A 3RYFE 2RA1A 4DIDB 5C2TA 2D0UA 4YTPA 5HWXA 4JUYA 2HN1A 1WYBA 3Q2MA 2WZHA 2R6GF 5DJQC 3RHWA 3N9QA 2BBHA 3PUYF 2ACXA 5HEHA 3UQ4A 2ODUA 1XWMA 2ZM2A 3UUNA 5HXCA 5HYAA 4XBFB 3JADA 3HKDE 4EZHA 2E9XD 2YOEA 2KMFA 3AE8A 4CN1A 2LHRA 5HXRA 4PJNA 3BQKA 2C0SA 3KFWX 5DQWA 3VR8A 4DV6T 4E7ZA 4HFVA 4X66T 4ZEYA 2VURA 3KV9A 4JI2T 4ZI7E 1MIWA 3N9LA 4OK0A 5AQKB 3RF1A 5A1LA 5LGTB 3C4ZA 2PFVA 3B5MA 3FBLA 3AE7A 4U74A 5LJNA 1IBKT 4O2BE 1Z0PA 3RQUA 2LKGA 4PK4A 4ZI3C 4WZXA 3AAAB 3UUMA 1KNPA 4B3MT 2BKPA 2X0YA 3RRWA 4EXTA 5JDHA 4UVBB 4AKGA 4L5GA 3C4XA 5AQUB 3AB3B 4J2CA 1ZEEA 2BVMA 3ONLC 2UUCT 2XAFB 2K48A 3AE5A 2YINA 2HPJA 2MPKA 3PDYA 3PU8A 2YU1A 3ETVA 3VRBA 2WMOA 5JREA 4LF7T 2X9WA 5BMVE 1Y64B 4EOZB 2FJDA 4YJ3E 4JI1T 3OYXA 2M6IA 4DV3T 3AE9A 3JAEA 4P09A 3HKBE 4QX7B 5HWYA 4A5XA 3QK6A 3V5SA 4ASKA 2X0HA 2MYSA 2CHOA 2CLYB 2B76A 3AAEB 4QXHB 5LOVE 3L8RA 3LJCA 3AXJA 3PTRB 2X9HA 3RGLA 3AE4A 1LVFA 2FJEA 1VOMA 3P8CD 4TNWA 3GMIA 3VR9A 4CQIA 1XMOT 3TKLB 4HFEA 1GQEA 3Q5DA 3TLUA 5JQGE 2K24A 2OLTA 4DR1T 1HG5A 2PTFA 1KEYA 1XDOA 3LK42 1OEDA 4PK5A 5ABGA 4EB6E 2D0TA 4JLEA 1XNRT 5L3EB 4LF6T 1IJ5A 3MXZA 5AQIB 2BG9B 2VVNA 3SFDA 3AEAA 3IHRA 5L3DB 2WCAA 3K3NA 3KV5A 4I43B 1FIOA 3NZQA 4L9IA 1U4QA 5JH7E 3EDVA 3FHNA 4PFPA 5LCYA 4LF5T 3WI3A 2XUEA 4IREA 2ZM6T 2CM0A 1UK5A 2WY2A 4H9OC 2JQQA 4IE7A 4YSZA 5ABHA 3MKDA 3B57A 5ADXL 1OWAA 4A97A 4ZZBA 5ABFA 4LFAT 4AKHA 2OV9A 2XAJB 3LBXB 1WR6A 1ZKEA 3PURA 4Z91A 5AQOB 2XHEB 3RLFF 3EHZA 4JI7T 3UU3A 5AQFB 4CI3B 2X9YA 5C3JA 2WU5A 5L3GB 1HS7A 2C5JA 4H63H 4IT4A 3CPZA 5J2TE 4GK0E 2LSKA 2XQ7A 4ILUA 4BJNA 3CQXC 3R84B 3RRCA 5AQLB 3N2GE 4OYKA 4UR9A 3RPUA 5AQVB 5FY7A 3EABA 2XQ8A 2DNXA 4NUUA 2E9XA 3G06A 3VRAA 2WS3A 3GA8A 3ZJ1A 3K3QC 5ABEA 2KXPB 2LHNA 2V7JA 5M4YA 2W62A 4ZZCA 2XM2A 3PUAA 4HEAA 3A5XA 3FZMB 1WR0A 3TLTA 4BA9A 1NWMX 3CQCB 2CBIA 2CHNA 4U2YA 4WW0A 3RKGA 4TWFA 4ERRA 4EEDA 2UXCT 2NP9A 3ETUA 4JEUB 1MMNA 4LF4T 3MJXA 2DWGA 2YKSA 4UF0A 2VKHA 2XM1A 1YKHB 3B13A 4PNIA 5FL1A 3C50A 5FXZA 4DBRA 1JNZA 3ZKRA 1HNXT 2HN2A 3VKHA 3P4PA 4G63A 1NEKA 2V7LA 5CGMA 2VASA 2YU2A 3P50A 4MBQA 4Z8XA 2Z6EA 4QKNA 2CXLA 2LSGA 4K0UA 2XQ4A 3X1DA 4EGWA 3LSVA 2WDVA 4ISSA 3OKQA 3Q5XA 2DLRA 4FJOA 4PFOA 4CI2B 1KNZA 3AEEA 4O8SA 4X5TA 1VCSA 3AE2A 3C98B 2XPKA 3J7Yq 5HXHA 2NTYA 3BQIA 4MHCA 4DV5T 5CJ5A 4UF0B 2H3RA 1OXZA 2K3WA 2ZM0A 4QWNB 2XQYA 4TX5A 5LB7B 3UQ7A 2KWIB 2X9XA 4OHFA 1WCRA 3FZFB 3QOFA 5ABFB 5KMGP 2XSBA 1HNZT 1XDPA 5JDQA 2LT3A 2CEAA 3N9MA 5FXWA 2Y8DA 5LBMA 4YY3T 3AXJB 3ZEFB 1AJ3A 5HEUA 5AQQB 4TV8E 3T1HT 3ZYKA 4TUYE 2CXFA 3IEEA 3Q5WA 4MLKA 4QX8B 2BS3A 2M67A 3A8YC 2BZBA 2UXDT 4F6RC 4ZHQE 2W61A 1HR0T 3F2EA 2JQKA 1D0ZA 3HR0A 3I9YA 4YXDA 3A7MA 3P4RA 5F8PA 2KWHA 2XAHB 4LFCT 2NW8A 2H88A 5FYMA 4YJ2E 2CWOA 3ZT7A 5IHYA 3JCFA 4NIQA 4I0UA 4JI5T 4HWCA 3ZSTA 2E5VA 3ZPOA 1D0YA 1S35A 2B1EA 4X62T 4DV7T 5AQGB 5IUXA 4IDQA 4GKKT 2VL0A 3AVSA 4JEHB 5DABA 4ZS3A 2LSYA 3WAKA 3H3MA 3QB5A 4YTNA 2X66A 2LEHA 3AE1A 3LG7A 4U7IA 4AKLA 1BR0A 1HX8A 2LM9A 5L4EA 4IHJE 4YFSA 2WWVA 4DR4T 1QSDA 2CPTA 2VKJA 2YK0A 2BKNA 3PE0A 4L0RA 4X20E 5FY1A 4CZZB 4ZI3D 5H6RB 4KHPT 3OJAA 5LG3A 4H9SE 4UELA 4O4LE 4UVCB 3AEBA 3M65A 4IDZA 3HKCE 4JI8T 2K9AA 2N2NA 5FVLA 1I6ZA 5CB4E 5JDLA 4AQYT 4YHHT 2KSRA 5FKYA 1QUUA 3J9X1 1YKEB 4EIWA 4AKIA 2MOZA 1NENA 2LOPA 1FJGT 2JRKA 4KX6A 4DO0A 4H9NC 2XY8B 5L2LA 2MAWA 3R6NA 1HG2A 2AE9A 4X1KE 2BS2A 3BK9A 4EYYR 2WQYA 4UV9B 3N2KE 3ZSSA 3DJBA 4V1Av 3EI0A 4E7SA 4NXMT 5FL0A 5FMNA 1YD8G 4KUMB 3PUZF 4X1IE 3I0OA 4CI1B 5KX5E 3C51A 1KK7A 1MNEA 3O1HA 4UVAB 5IYZE 3U3IA 4NXNT 2VKOA 1H7CA 3M3ZB 3JAFA 3ZCJA 4GK5E 2JQHA 4U2ZA 5JDGA 2WWUA 3EVYA 3KV4A 1UURA 2V7MA 3AE6A 2N1GA 2IC6A 4ILAA 3RIUA 3NWIA 3RYCE 3SS1A 3L09A 5L47A 1MMGA 4ANJA 2QYWA 2IAKA 4HFCA 2WDQA 4CN4A 3OVUA 1VRBA 3LK3B 3K3OA 3RIAA 3HL6A 3P4SA 4G2AA 5H6QB 4C91A 4H9QC 3ZT6A 1G8XA 5AQSB 1FMWA 3VKGA 4JI3T 5LJMA 4K0KT 4F8HA 2WU2A 3PU3A 2NTXA 3L3PA 1XMQT 1US7B
chains in the Genus database with same CATH topology
4X64T 4B3TT 1HNXT 5IWAT 4DR2T 4DR3T 2F4VT 1IBMT 4DUYT 2UUBT 4DR7T 4LFBT 4DV5T 1J5ET 4DV6T 4DV0T 1N36T 4X66T 4LF8T 4JI0T 4JI2T 4YY3T 4DV2T 1IBKT 4JI4T 3T1HT 4LF9T 2UXDT 4B3MT 4JI6T 1HR0T 4DV1T 2UUCT 1N32T 4LF7T 4LFCT 4LF4T 2HHHT 4JI5T 1HNZT 4JI1T 4DV3T 1XNQT 4DV7T 4X62T 2UUAT 2UXBT 4OX9T 4GKKT 1XMOT 1HNWT 5LMNT 4DR1T 4X65T 5BR8T 4DR4T 1XNRT 4LF6T 4KHPT 5LMUT 4JI8T 1IBLT 4AQYT 4YHHT 4LF5T 2ZM6T 4DV4T 1N34T 1FJGT 4LFAT 4JI7T 1N33T 4B3RT 4NXMT 1I94T 4NXNT 4GKJT 4JYAT 4DUZT 4DR6T 3T1YT 2UU9T 3OTOT 4B3ST 4DR5T 2VQET 4JV5T 2VQFT 4JI3T 4K0KT 2UXCT 2E5LT 1XMQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 T;  4B3T T;  1HNX T;  5IWA T;  4DR2 T;  4DR3 T;  2F4V T;  1IBM T;  4DUY T;  2UUB T;  4DR7 T;  4LFB T;  4DV5 T;  1J5E T;  4DV6 T;  4DV0 T;  1N36 T;  4X66 T;  4LF8 T;  4JI0 T;  4JI2 T;  4YY3 T;  4DV2 T;  1IBK T;  4JI4 T;  3T1H T;  4LF9 T;  2UXD T;  4B3M T;  4JI6 T;  1HR0 T;  4DV1 T;  2UUC T;  1N32 T;  4LF7 T;  4LFC T;  4LF4 T;  2HHH T;  4JI5 T;  1HNZ T;  4JI1 T;  4DV3 T;  1XNQ T;  4DV7 T;  4X62 T;  2UUA T;  2UXB T;  4OX9 T;  4GKK T;  1XMO T;  1HNW T;  5LMN T;  4DR1 T;  4X65 T;  5BR8 T;  4DR4 T;  1XNR T;  4LF6 T;  4KHP T;  5LMU T;  4JI8 T;  1IBL T;  4AQY T;  4YHH T;  4LF5 T;  2ZM6 T;  4DV4 T;  1N34 T;  1FJG T;  4LFA T;  4JI7 T;  1N33 T;  4B3R T;  4NXM T;  1I94 T;  4NXN T;  4GKJ T;  4JYA T;  4DUZ T;  4DR6 T;  3T1Y T;  2UU9 T;  3OTO T;  4B3S T;  4DR5 T;  2VQE T;  4JV5 T;  2VQF T;  4JI3 T;  4K0K T;  2UXC T;  2E5L T;  1XMQ T; 
#chains in the Genus database with same CATH topology
 3P4W A;  4QHO A;  1LRZ A;  4X64 T;  1D0X A;  1EZ3 A;  3ABV A;  4EZ4 A;  1WYC A;  1T8B A;  2BVL A;  3E0Z A;  2BG9 C;  2EHO A;  3N9P A;  4I50 E;  4IST A;  3UUB A;  4DR3 T;  2F4V T;  3C4W A;  1B7T A;  2YDR A;  4HGA A;  4TV9 E;  2IML A;  2BS4 A;  2ZM8 A;  2X68 A;  3E22 E;  3RX6 A;  3ZMU B;  4DUY T;  5LBQ B;  3CX7 B;  2UUB T;  4DR7 T;  1Z8U A;  1HX1 B;  3AED A;  1MMD A;  2LRK A;  3N9O A;  2VWA A;  3N2O A;  4HFH A;  4OFZ A;  2LSI A;  4U33 A;  2NW9 A;  2LRL A;  2VK9 A;  4IDP A;  2KND A;  3BQL A;  4IL9 A;  2FJB A;  4WNK A;  4DBQ A;  2CE7 A;  4P0B A;  4DVD A;  3SFE A;  5AFU L;  1HTJ F;  2J47 A;  3D0T A;  4CXW A;  2H7O A;  5EK2 A;  1J5E T;  1X9B A;  4WBN E;  5LHI B;  4HTE A;  5J1G A;  1VCT A;  1WRD A;  4UEM A;  4O4H E;  2L9Q A;  2ZLY A;  1OED B;  1YQ4 A;  3UUL A;  3PUW F;  3ONX A;  1T72 A;  3RI5 A;  1HCI A;  3MK7 C;  4ZOL E;  1UX5 A;  2MBG A;  3TLV A;  4YLH A;  3ZLI A;  4U72 A;  3RKO A;  2A3D A;  3KVB A;  5EK3 A;  2IC9 A;  4DMW A;  4HE8 A;  4LF9 T;  3PUX F;  1CUN A;  1SUM B;  2W2U A;  4TN7 B;  5JRC A;  2E2A A;  4FI5 A;  2HH7 A;  4JI6 T;  4COF A;  1SA0 E;  2K5B B;  5GON E;  5AQR B;  1FEW A;  3KDS E;  2LSJ A;  3L39 A;  1OED C;  4TZ4 C;  1N32 T;  1UCU A;  3CVR A;  1D1B A;  3RC8 A;  3CX8 B;  1UX4 A;  2XJ7 A;  2QGS A;  3NKZ A;  3OYZ A;  3QB5 K;  3U78 A;  3JC6 C;  3UU6 A;  3AEG A;  3AA6 B;  5L4H A;  1T98 A;  3I1A A;  4QH4 A;  3GN5 B;  2KIN B;  4HN9 A;  3LK2 B;  4ILC A;  4KP3 C;  4NUV A;  4YTM A;  2D5U A;  2CLY C;  5ETW A;  3RYI E;  2KZ7 B;  2VVS A;  3KIN B;  1NAF A;  2A2F X;  3F31 A;  2UUA T;  2UXB T;  2ACZ A;  3ZYL A;  4CN6 A;  4LML A;  2FUP A;  5JR9 B;  2WSS V;  5AQH B;  3SOL A;  3ZMS B;  2Q9Q D;  1WLX A;  5HCM A;  4BJM A;  2XQ5 A;  2UXN B;  2X0L B;  4NPP A;  2J62 A;  2JQ9 A;  3RC3 A;  2J1D G;  2E9X B;  4P1N A;  1SHZ C;  4HWF A;  2IHR 1;  1D1C A;  5HEG A;  1DU2 A;  1E2A A;  1G73 A;  2UXX B;  2V5D A;  4AQG A;  2WAU A;  1E7P A;  2ES0 A;  3P7I A;  2QA7 A;  3JC6 D;  4U31 A;  2RPA A;  4JV5 T;  2H89 A;  3DTO A;  3RQW A;  3LFM A;  5DQV A;  2BDE A;  3ZMV B;  5LMU T;  3ZC0 A;  3GN5 A;  3IF8 B;  3C64 A;  5LNK A;  3H37 A;  4TWH A;  1Y01 A;  5CFB A;  2J4G A;  1ZOY A;  2W66 A;  3CWZ B;  4DV4 T;  4XZC A;  1N34 T;  1O3X A;  2V1D B;  1MMA A;  3FXD B;  2N9D A;  2V6Y B;  3VHL A;  5TAO A;  2WZI A;  3ONJ A;  3IBP A;  3HA4 A;  2XAS B;  4GOU A;  3LBX A;  3RIU C;  3N9N A;  1XZY A;  2YN6 A;  3ESL A;  3TLS A;  2LE8 A;  2SPC A;  4YSY A;  4B3R T;  1MIV A;  3Q9D A;  5HCJ A;  2IW5 B;  2NOX A;  4EV6 A;  1V9D A;  2NW7 A;  4GIW A;  3PV0 F;  4PJM A;  2V26 A;  1W09 A;  4H9R C;  1I94 T;  1W0A A;  4HWD A;  2CBJ A;  3SRZ A;  4KBM B;  2KLQ A;  4ZS2 A;  3O1J A;  4MAL A;  3CK6 A;  3ZC1 A;  1IJ6 A;  4DR6 T;  1W0B A;  2JMH A;  3PUS A;  3AA7 B;  3KVA A;  3V5U A;  2LJL A;  3NZP A;  1T7S A;  3KV6 A;  5HEJ A;  2QRX A;  2A9U A;  3AA1 B;  2UU9 T;  1UUS A;  3I9W A;  5J0Z A;  2WMN A;  1KNR A;  1ZHC A;  4DR5 T;  5LP6 E;  4CXY A;  2VQE T;  2CRB A;  2BG9 A;  3I0Q A;  2DL1 A;  4WYV A;  3UU4 A;  2JJ9 A;  2X51 A;  3Q5E A;  4IDO A;  4CXX A;  5KXJ A;  1ZV4 X;  3UUX B;  2E9X C;  3K8P C;  5F5W A;  2RP4 A;  5FXX A;  1WFD A;  4HKA A;  4PJL A;  3ZN0 B;  5JDM A;  5FNV E;  2W67 A;  5JR9 C;  1HF8 A;  2EHO C;  3AA0 B;  5EK4 A;  2VB6 A;  4JBW F;  2G0U A;  2FBW A;  5AQJ B;  3O1I A;  3RH3 A;  3ZYM A;  4ADZ A;  4WBO A;  4ILB A;  5HEO A;  4H63 V;  1BR2 A;  4KHZ F;  4UIG A;  1LKX A;  1IBM T;  1HFA A;  3OBV E;  4GYR A;  1N33 T;  2W63 A;  3P4Q A;  1KF6 A;  4LFB T;  5JRC B;  3UU8 A;  3AEC A;  2NWB A;  2BG9 E;  2I6H A;  4QH5 A;  4PJJ A;  3AVR A;  2CCQ A;  3PUQ A;  2Y6X A;  2M6B A;  4IE4 A;  3QC9 A;  4UXN B;  5FY0 A;  4AIU A;  4ZI2 D;  1J5W A;  2Y48 B;  3HI2 A;  3NRX A;  4DND A;  4UV8 B;  2WBL A;  2X67 A;  3O4X E;  3NRY A;  4ZXL A;  2V7K A;  3MAC A;  4DV0 T;  1N36 T;  2QVA A;  5L3F B;  4LF8 T;  4U7Y A;  3NVO A;  4QXB B;  4JI0 T;  4MFR A;  2Q9Q B;  2W4X A;  2ODV A;  2CA5 A;  3UFE A;  5FXV A;  2PG8 A;  4EAH A;  3CX6 B;  4TWD A;  4EEB A;  2YDQ A;  3UT5 E;  4C90 A;  4TNV A;  2V5C A;  2ZMA A;  3PUG A;  3CQG B;  4IGU A;  5JR9 A;  4DV2 T;  4JI4 T;  4IE5 A;  4AKR B;  1QLB A;  5LYJ E;  2IUB A;  4Z90 A;  2DI4 A;  2XQ3 A;  5HXE A;  4AQF C;  5JDN A;  5E0O A;  3ANW A;  5EZY E;  4O4I E;  4IL4 A;  2I0M A;  3N5L A;  1W9R A;  1MIY A;  2WB5 A;  2YEV C;  4O2A E;  4DV1 T;  3FBZ A;  5HAX A;  2P9B A;  3UU5 A;  4O4J E;  4BAY B;  2NR4 A;  5J2U E;  4U3C A;  4A98 A;  1SE7 A;  3AEF A;  5LHG B;  2LM2 A;  4HFD A;  1L0V A;  2HHH T;  3HKE E;  4I4T E;  4LMJ A;  5AQT B;  3T8O A;  1BR4 A;  2W00 A;  4M1P A;  1D1A A;  2H7V C;  5HXS A;  3FXE B;  2PJQ A;  5JTG A;  3AE3 A;  4HFI A;  5KDM C;  3WAJ A;  1XNQ T;  2E8I A;  1M62 A;  4OX9 T;  3ZT5 A;  5L3B B;  1YXR A;  2WDR A;  2IIU A;  4QH1 A;  3S4U A;  2V7I A;  3FZK B;  2DWK A;  4HWH A;  5FVK A;  2CMR A;  4A56 A;  2XQ9 A;  2DHR A;  3FZL B;  1JNR A;  3ZMZ B;  3TLW A;  5LMN T;  1HNW T;  5LA6 E;  3IA3 A;  5AQP B;  2A72 A;  3DP7 A;  1ZP0 A;  3MZK B;  3QNU A;  4X65 T;  5BR8 T;  2CWY A;  5F3J A;  3UTK A;  2OA5 A;  1UGO A;  4DMV A;  2BKO A;  2HPL A;  2JIW A;  3NBX X;  3PUV F;  1R8I A;  2L3L A;  2XTL A;  4EYU A;  3EUH A;  3F57 A;  4H9P C;  2I59 A;  3CIR A;  4KMC A;  3CML A;  4PK6 A;  4PW8 A;  3ZMT B;  2YDS A;  5JVD E;  3RYH E;  1X79 A;  2XQA A;  1IBL T;  3CKD A;  1FMV A;  5LGN B;  2BBJ A;  1S94 A;  3E08 A;  4GYS A;  2Q9Q A;  3FB2 A;  2C5I T;  4AQF A;  5AQM B;  2DCF A;  2XSA A;  2Q9Q C;  3PJA J;  5AQN B;  3RIF A;  5L3C B;  5LXT E;  1YW0 A;  2V6X A;  2C5K T;  2WM9 A;  3H3A A;  2V6Y A;  2WP9 A;  2LKH A;  4LMK A;  2D9D A;  2XAG B;  4N78 D;  1U5P A;  2LLY A;  4B6X A;  5CA0 E;  4P0A A;  3AAI A;  3QUJ A;  1BR1 A;  4I55 E;  3KBT A;  4JYA T;  4GKJ T;  3EDU A;  2KT9 A;  4HFB A;  4IDN A;  5LG4 A;  4DUZ T;  2LOS A;  5JDF A;  3OPC A;  3LDQ B;  4AI6 A;  4IE0 A;  4YT0 A;  5FP3 A;  3ANW B;  4QXC B;  2AXD S;  3KBU A;  4IIJ E;  3VU7 H;  1E1H B;  3MA9 A;  5CA1 E;  2PBI A;  1MND A;  3FZH B;  1OED E;  2XAQ B;  3T1Y T;  3OTO T;  4B3S T;  3O9X A;  1M7K A;  3SWH A;  1KFY A;  4Q25 A;  4AXP A;  3ZN1 B;  2W0G A;  5C8Y E;  5LGU B;  1YQ3 A;  3PJA A;  2VQF T;  2JMK A;  3ZJ2 A;  1CHU A;  2VL8 A;  1IZN B;  4YSX A;  2E5L T;  4HWI B;  2MTQ A;  4KI0 F;  4YHJ A;  4ZI2 C;  2CXD A;  2D2S A;  2EHO D;  2IDO B;  2JPF A;  3ZCI A;  4B3T T;  2L8K A;  4XAX B;  4X1Y E;  4IE6 A;  1LVK A;  5IWA T;  4OYJ A;  3EAM A;  3UFG A;  2GK9 A;  2VKD A;  3GWH A;  2EHO B;  4PAG A;  4DR2 T;  1J1J A;  2FJA A;  2V8S V;  3K1S A;  2XZE A;  3W15 B;  5LHH B;  4AIS A;  1IAP A;  2XQ6 A;  3RYF E;  2RA1 A;  4DID B;  5C2T A;  2D0U A;  4YTP A;  5HWX A;  4JUY A;  2HN1 A;  1WYB A;  3Q2M A;  2WZH A;  2R6G F;  5DJQ C;  3RHW A;  3N9Q A;  2BBH A;  3PUY F;  2ACX A;  5HEH A;  3UQ4 A;  2ODU A;  1XWM A;  2ZM2 A;  3UUN A;  5HXC A;  5HYA A;  4XBF B;  3JAD A;  3HKD E;  4EZH A;  2E9X D;  2YOE A;  2KMF A;  3AE8 A;  4CN1 A;  2LHR A;  5HXR A;  4PJN A;  3BQK A;  2C0S A;  3KFW X;  5DQW A;  3VR8 A;  4DV6 T;  4E7Z A;  4HFV A;  4X66 T;  4ZEY A;  2VUR A;  3KV9 A;  4JI2 T;  4ZI7 E;  1MIW A;  3N9L A;  4OK0 A;  5AQK B;  3RF1 A;  5A1L A;  5LGT B;  3C4Z A;  2PFV A;  3B5M A;  3FBL A;  3AE7 A;  4U74 A;  5LJN A;  1IBK T;  4O2B E;  1Z0P A;  3RQU A;  2LKG A;  4PK4 A;  4ZI3 C;  4WZX A;  3AAA B;  3UUM A;  1KNP A;  4B3M T;  2BKP A;  2X0Y A;  3RRW A;  4EXT A;  5JDH A;  4UVB B;  4AKG A;  4L5G A;  3C4X A;  5AQU B;  3AB3 B;  4J2C A;  1ZEE A;  2BVM A;  3ONL C;  2UUC T;  2XAF B;  2K48 A;  3AE5 A;  2YIN A;  2HPJ A;  2MPK A;  3PDY A;  3PU8 A;  2YU1 A;  3ETV A;  3VRB A;  2WMO A;  5JRE A;  4LF7 T;  2X9W A;  5BMV E;  1Y64 B;  4EOZ B;  2FJD A;  4YJ3 E;  4JI1 T;  3OYX A;  2M6I A;  4DV3 T;  3AE9 A;  3JAE A;  4P09 A;  3HKB E;  4QX7 B;  5HWY A;  4A5X A;  3QK6 A;  3V5S A;  4ASK A;  2X0H A;  2MYS A;  2CHO A;  2CLY B;  2B76 A;  3AAE B;  4QXH B;  5LOV E;  3L8R A;  3LJC A;  3AXJ A;  3PTR B;  2X9H A;  3RGL A;  3AE4 A;  1LVF A;  2FJE A;  1VOM A;  3P8C D;  4TNW A;  3GMI A;  3VR9 A;  4CQI A;  1XMO T;  3TKL B;  4HFE A;  1GQE A;  3Q5D A;  3TLU A;  5JQG E;  2K24 A;  2OLT A;  4DR1 T;  1HG5 A;  2PTF A;  1KEY A;  1XDO A;  3LK4 2;  1OED A;  4PK5 A;  5ABG A;  4EB6 E;  2D0T A;  4JLE A;  1XNR T;  5L3E B;  4LF6 T;  1IJ5 A;  3MXZ A;  5AQI B;  2BG9 B;  2VVN A;  3SFD A;  3AEA A;  3IHR A;  5L3D B;  2WCA A;  3K3N A;  3KV5 A;  4I43 B;  1FIO A;  3NZQ A;  4L9I A;  1U4Q A;  5JH7 E;  3EDV A;  3FHN A;  4PFP A;  5LCY A;  4LF5 T;  3WI3 A;  2XUE A;  4IRE A;  2ZM6 T;  2CM0 A;  1UK5 A;  2WY2 A;  4H9O C;  2JQQ A;  4IE7 A;  4YSZ A;  5ABH A;  3MKD A;  3B57 A;  5ADX L;  1OWA A;  4A97 A;  4ZZB A;  5ABF A;  4LFA T;  4AKH A;  2OV9 A;  2XAJ B;  3LBX B;  1WR6 A;  1ZKE A;  3PUR A;  4Z91 A;  5AQO B;  2XHE B;  3RLF F;  3EHZ A;  4JI7 T;  3UU3 A;  5AQF B;  4CI3 B;  2X9Y A;  5C3J A;  2WU5 A;  5L3G B;  1HS7 A;  2C5J A;  4H63 H;  4IT4 A;  3CPZ A;  5J2T E;  4GK0 E;  2LSK A;  2XQ7 A;  4ILU A;  4BJN A;  3CQX C;  3R84 B;  3RRC A;  5AQL B;  3N2G E;  4OYK A;  4UR9 A;  3RPU A;  5AQV B;  5FY7 A;  3EAB A;  2XQ8 A;  2DNX A;  4NUU A;  2E9X A;  3G06 A;  3VRA A;  2WS3 A;  3GA8 A;  3ZJ1 A;  3K3Q C;  5ABE A;  2KXP B;  2LHN A;  2V7J A;  5M4Y A;  2W62 A;  4ZZC A;  2XM2 A;  3PUA A;  4HEA A;  3A5X A;  3FZM B;  1WR0 A;  3TLT A;  4BA9 A;  1NWM X;  3CQC B;  2CBI A;  2CHN A;  4U2Y A;  4WW0 A;  3RKG A;  4TWF A;  4ERR A;  4EED A;  2UXC T;  2NP9 A;  3ETU A;  4JEU B;  1MMN A;  4LF4 T;  3MJX A;  2DWG A;  2YKS A;  4UF0 A;  2VKH A;  2XM1 A;  1YKH B;  3B13 A;  4PNI A;  5FL1 A;  3C50 A;  5FXZ A;  4DBR A;  1JNZ A;  3ZKR A;  1HNX T;  2HN2 A;  3VKH A;  3P4P A;  4G63 A;  1NEK A;  2V7L A;  5CGM A;  2VAS A;  2YU2 A;  3P50 A;  4MBQ A;  4Z8X A;  2Z6E A;  4QKN A;  2CXL A;  2LSG A;  4K0U A;  2XQ4 A;  3X1D A;  4EGW A;  3LSV A;  2WDV A;  4ISS A;  3OKQ A;  3Q5X A;  2DLR A;  4FJO A;  4PFO A;  4CI2 B;  1KNZ A;  3AEE A;  4O8S A;  4X5T A;  1VCS A;  3AE2 A;  3C98 B;  2XPK A;  3J7Y q;  5HXH A;  2NTY A;  3BQI A;  4MHC A;  4DV5 T;  5CJ5 A;  4UF0 B;  2H3R A;  1OXZ A;  2K3W A;  2ZM0 A;  4QWN B;  2XQY A;  4TX5 A;  5LB7 B;  3UQ7 A;  2KWI B;  2X9X A;  4OHF A;  1WCR A;  3FZF B;  3QOF A;  5ABF B;  5KMG P;  2XSB A;  1HNZ T;  1XDP A;  5JDQ A;  2LT3 A;  2CEA A;  3N9M A;  5FXW A;  2Y8D A;  5LBM A;  4YY3 T;  3AXJ B;  3ZEF B;  1AJ3 A;  5HEU A;  5AQQ B;  4TV8 E;  3T1H T;  3ZYK A;  4TUY E;  2CXF A;  3IEE A;  3Q5W A;  4MLK A;  4QX8 B;  2BS3 A;  2M67 A;  3A8Y C;  2BZB A;  2UXD T;  4F6R C;  4ZHQ E;  2W61 A;  1HR0 T;  3F2E A;  2JQK A;  1D0Z A;  3HR0 A;  3I9Y A;  4YXD A;  3A7M A;  3P4R A;  5F8P A;  2KWH A;  2XAH B;  4LFC T;  2NW8 A;  2H88 A;  5FYM A;  4YJ2 E;  2CWO A;  3ZT7 A;  5IHY A;  3JCF A;  4NIQ A;  4I0U A;  4JI5 T;  4HWC A;  3ZST A;  2E5V A;  3ZPO A;  1D0Y A;  1S35 A;  2B1E A;  4X62 T;  4DV7 T;  5AQG B;  5IUX A;  4IDQ A;  4GKK T;  2VL0 A;  3AVS A;  4JEH B;  5DAB A;  4ZS3 A;  2LSY A;  3WAK A;  3H3M A;  3QB5 A;  4YTN A;  2X66 A;  2LEH A;  3AE1 A;  3LG7 A;  4U7I A;  4AKL A;  1BR0 A;  1HX8 A;  2LM9 A;  5L4E A;  4IHJ E;  4YFS A;  2WWV A;  4DR4 T;  1QSD A;  2CPT A;  2VKJ A;  2YK0 A;  2BKN A;  3PE0 A;  4L0R A;  4X20 E;  5FY1 A;  4CZZ B;  4ZI3 D;  5H6R B;  4KHP T;  3OJA A;  5LG3 A;  4H9S E;  4UEL A;  4O4L E;  4UVC B;  3AEB A;  3M65 A;  4IDZ A;  3HKC E;  4JI8 T;  2K9A A;  2N2N A;  5FVL A;  1I6Z A;  5CB4 E;  5JDL A;  4AQY T;  4YHH T;  2KSR A;  5FKY A;  1QUU A;  3J9X 1;  1YKE B;  4EIW A;  4AKI A;  2MOZ A;  1NEN A;  2LOP A;  1FJG T;  2JRK A;  4KX6 A;  4DO0 A;  4H9N C;  2XY8 B;  5L2L A;  2MAW A;  3R6N A;  1HG2 A;  2AE9 A;  4X1K E;  2BS2 A;  3BK9 A;  4EYY R;  2WQY A;  4UV9 B;  3N2K E;  3ZSS A;  3DJB A;  4V1A v;  3EI0 A;  4E7S A;  4NXM T;  5FL0 A;  5FMN A;  1YD8 G;  4KUM B;  3PUZ F;  4X1I E;  3I0O A;  4CI1 B;  5KX5 E;  3C51 A;  1KK7 A;  1MNE A;  3O1H A;  4UVA B;  5IYZ E;  3U3I A;  4NXN T;  2VKO A;  1H7C A;  3M3Z B;  3JAF A;  3ZCJ A;  4GK5 E;  2JQH A;  4U2Z A;  5JDG A;  2WWU A;  3EVY A;  3KV4 A;  1UUR A;  2V7M A;  3AE6 A;  2N1G A;  2IC6 A;  4ILA A;  3RIU A;  3NWI A;  3RYC E;  3SS1 A;  3L09 A;  5L47 A;  1MMG A;  4ANJ A;  2QYW A;  2IAK A;  4HFC A;  2WDQ A;  4CN4 A;  3OVU A;  1VRB A;  3LK3 B;  3K3O A;  3RIA A;  3HL6 A;  3P4S A;  4G2A A;  5H6Q B;  4C91 A;  4H9Q C;  3ZT6 A;  1G8X A;  5AQS B;  1FMW A;  3VKG A;  4JI3 T;  5LJM A;  4K0K T;  4F8H A;  2WU2 A;  3PU3 A;  2NTX A;  3L3P A;  1XMQ T;  1US7 B; 
#chains in the Genus database with same CATH homology
 4X64 T;  4B3T T;  1HNX T;  5IWA T;  4DR2 T;  4DR3 T;  2F4V T;  1IBM T;  4DUY T;  2UUB T;  4DR7 T;  4LFB T;  4DV5 T;  1J5E T;  4DV6 T;  4DV0 T;  1N36 T;  4X66 T;  4LF8 T;  4JI0 T;  4JI2 T;  4YY3 T;  4DV2 T;  1IBK T;  4JI4 T;  3T1H T;  4LF9 T;  2UXD T;  4B3M T;  4JI6 T;  1HR0 T;  4DV1 T;  2UUC T;  1N32 T;  4LF7 T;  4LFC T;  4LF4 T;  2HHH T;  4JI5 T;  1HNZ T;  4JI1 T;  4DV3 T;  1XNQ T;  4DV7 T;  4X62 T;  2UUA T;  2UXB T;  4OX9 T;  4GKK T;  1XMO T;  1HNW T;  5LMN T;  4DR1 T;  4X65 T;  5BR8 T;  4DR4 T;  1XNR T;  4LF6 T;  4KHP T;  5LMU T;  4JI8 T;  1IBL T;  4AQY T;  4YHH T;  4LF5 T;  2ZM6 T;  4DV4 T;  1N34 T;  1FJG T;  4LFA T;  4JI7 T;  1N33 T;  4B3R T;  4NXM T;  1I94 T;  4NXN T;  4GKJ T;  4JYA T;  4DUZ T;  4DR6 T;  3T1Y T;  2UU9 T;  3OTO T;  4B3S T;  4DR5 T;  2VQE T;  4JV5 T;  2VQF T;  4JI3 T;  4K0K T;  2UXC T;  2E5L T;  1XMQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...