2UXCT

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uxcT00
2HHHT 4DR3T 1FJGT 2F4VT 4JV5T 4DV4T 4LFAT 4LF9T 4KHPT 4X62T 1J5ET 1HNZT 4LFBT 4JI0T 4DV3T 1HNWT 2UUBT 4LF7T 4AQYT 5BR8T 4DUYT 4X66T 4GKJT 1N32T 4LF8T 1N34T 4JI7T 4LF5T 4DV2T 4DR2T 2UUCT 1IBLT 1XNRT 4DV1T 1N36T 2VQFT 2UXDT 4DV5T 4DV7T 4DR7T 4NXMT 4JI5T 4DR1T 5LMNT 4LFCT 1HNXT 4JI1T 1IBKT 1XMQT 4JI2T 4DV0T 4OX9T 3T1HT 4JI3T 4YHHT 2E5LT 4K0KT 4DR6T 4X65T 4YY3T 1XMOT 1IBMT 4LF4T 4DR4T 2UXBT 4B3ST 5IWAT 4JYAT 4DUZT 2UU9T 2VQET 1N33T 4DR5T 5LMUT 2UXCT 4NXNT 3OTOT 4DV6T 4X64T 4JI8T 3T1YT 4B3TT 4B3MT 1HR0T 4JI6T 1XNQT 4GKKT 2UUAT 4LF6T 2ZM6T 4B3RT 1I94T 4JI4T
chains in the Genus database with same CATH superfamily
2E5VA 4KMCA 5ABHA 1MNEA 3BQLA 3TLVA 3AA1B 2RPAA 3UU8A 4U2YA 4QX8B 1D1AA 3ZT6A 2SPCA 4F6RC 2IC6A 3HA4A 1US7B 2NW9A 4ZI3D 3ZT5A 5EK2A 3R6NA 2MYSA 3N9LA 3I0QA 3A7MA 3N2KE 4DR7T 4TNWA 1U5PA 2N2NA 1VCTA 4ZS2A 1FIOA 4G63A 3F31A 3ZPOA 2LLYA 5JDHA 3RIUC 5LNKA 2BVMA 2KINB 4O8SA 2Y6XA 2XAGB 1OEDA 3SFDA 3AA6B 5KXJA 3RH3A 3UT5E 2BKOA 1MIWA 2XM1A 3W15B 3AECA 2ZM2A 5JDQA 4JYAT 3PUWF 2WBLA 5FXZA 1IJ5A 3AEFA 4B3TT 2M67A 2VKJA 3F2EA 3CVRA 2BZBA 4TWHA 4B6XA 1T8BA 2YEVC 4OYJA 5J0ZA 2LE8A 4HEAA 2ACZA 3RX6A 4DV3T 3C4WA 3PUZF 1DU2A 2GK9A 3I1AA 2B76A 1UK5A 3R84B 2CWYA 4ZI3C 4QX7B 2H89A 2CXLA 4OFZA 3IEEA 5FKYA 3FZHB 2KXPB 4U3CA 3Q5XA 2W4XA 3I9WA 3P4RA 3PU8A 3CX8B 2Q9QA 2CHNA 4JI2T 4O4HE 4AKGA 2DLRA 3ONXA 2E5LT 1L0VA 3EAMA 4AKHA 3KV5A 1R8IA 3MK7C 4KX6A 4YJ2E 3B13A 3C98B 1XMOT 4Z8XA 2H7OA 1UX4A 2JMHA 3NWIA 2EHOB 1FEWA 4A97A 4CI2B 3QB5K 5L3GB 1KF6A 2W63A 3RQUA 5HXEA 2NR4A 4K0UA 4HFVA 3ZCIA 3B57A 3RIUA 1I94T 2X0YA 4JI4T 5L3DB 4DR3T 2X9XA 4HWFA 4JLEA 3EABA 2CXDA 2XSAA 2LHRA 1W9RA 3LK2B 3LK42 2PTFA 3PJAA 4U72A 2A72A 4UVAB 2LSJA 3LK3B 2LSKA 3AAAB 4C91A 3VR8A 3C51A 1N34T 4MFRA 4A98A 1Z8UA 4CI3B 1XZYA 1ZV4X 2VKHA 3QOFA 4QXCB 4LMKA 4IHJE 5FNVE 4I50E 3ZJ2A 4DR1T 1V9DA 2JPFA 3LBXA 4HWDA 1W0BA 4P1NA 3GA8A 1VOMA 4GYSA 4EXTA 4J2CA 5M4YA 1IZNB 4IL9A 1B7TA 4I0UA 3J9X1 3RRCA 5CFBA 5IUXA 5JRCB 5EZYE 4DR4T 5LHIB 2XSBA 4TX5A 2RA1A 1MNDA 4AKIA 3FHNA 3AXJA 4EZHA 4DUZT 4UIGA 4AQGA 3OKQA 2X68A 4DV6T 2FJEA 3ZYMA 1D0ZA 4IDPA 2V6YA 3K8PC 4IE7A 4IE4A 2ZM6T 3A8YC 3AE9A 2W2UA 1E1HB 2J62A 5CJ5A 2K24A 4XZCA 2J1DG 1D1CA 3DJBA 1NEKA 3CPZA 2NP9A 3C4XA 2I59A 2IUBA 1M7KA 5C3JA 2L3LA 4A5XA 1HCIA 4G2AA 4PJJA 3C50A 4Q25A 4U2ZA 1G73A 3UQ4A 4DV1T 3JCFA 2WM9A 2M6BA 2PG8A 3I0OA 3AEDA 1MMDA 2UXDT 5JR9B 2CHOA 3RYIE 3F57A 4DV7T 3K3QC 4UVBB 4MLKA 3QUJA 4IE5A 2KLQA 3CK6A 4EIWA 5AQQB 3CX6B 5FYMA 5AQTB 3PU3A 2WU5A 4MHCA 2WSSV 4QH5A 2NTXA 2LSGA 1IBMT 3FZKB 3IA3A 5JH7E 4CXXA 4IE6A 3AE1A 2UU9T 5LMUT 3TLTA 4JI8T 3IHRA 3SS1A 5KDMC 4P0AA 4YLHA 2K3WA 2FBWA 5AQPB 4PW8A 2V7LA 2L8KA 4QH1A 2KMFA 3I9YA 1WYBA 2HPJA 5FVKA 3ZLIA 4AKRB 2PJQA 2JQQA 4QWNB 1HNZT 4LFBT 2BG9E 2CMRA 3PV0F 2LEHA 1HNWT 4EYUA 3HKEE 5BR8T 3EDVA 5AFUL 1N32T 3Q5DA 2HN1A 2G0UA 2Q9QD 2VK9A 2V6XA 5AQKB 3M65A 2LRKA 1FMVA 3KV6A 1GQEA 3PDYA 3RQWA 4YXDA 5FXXA 2YDSA 3EDUA 4CXWA 1W09A 1O3XA 4L9IA 4TNVA 2MTQA 3GWHA 4EEBA 2W61A 4P09A 3MA9A 4A56A 5LB7B 2IDOB 4PNIA 3FBLA 3CKDA 1LVKA 4H9PC 5JVDE 1X79A 3JADA 4X65T 3UUNA 5F8PA 3BQIA 3RKOA 4ISTA 4YSYA 2E2AA 2FUPA 2WCAA 5ADXL 3AE3A 1OWAA 2X51A 3GMIA 3N9NA 3V5SA 4QKNA 2YDRA 2BG9B 3T1YT 5DQVA 5ABEA 4WNKA 5L3BB 3OJAA 3AE7A 2X0HA 3L09A 2HPLA 5AQLB 4QXHB 4ILBA 5LBMA 2MBGA 2CEAA 4X66T 1AJ3A 2CLYB 4FI5A 2QVAA 2WWUA 1J1JA 2JIWA 2YOEA 2Q9QC 4NUUA 2NWBA 4C90A 3ANWB 3VU7H 2ZMAA 3ZYKA 2VB6A 4LFCT 1HNXT 4JI1T 4YT0A 1LVFA 1XMQT 3KV4A 2XQ7A 4O2AE 4CN1A 3FXEB 1Y64B 3GN5B 3RIAA 2YINA 4JI3T 2ZM0A 2LSIA 4YHHT 2DCFA 5LBQB 3CX7B 5HYAA 5LGNB 3E08A 3S4UA 2ES0A 3QB5A 2LOPA 2A3DA 1Z0PA 5IWAT 2DI4A 1FMWA 4PK5A 5JREA 5JDFA 3HL6A 5F5WA 3ZSSA 2VQET 1QSDA 2IHR1 5HWYA 1WYCA 3OYXA 1NWMX 2MPKA 3UU4A 1HR0T 3T8OA 2KSRA 5JDMA 1XNQT 2UUAT 5IHYA 4U31A 3P4PA 4KHZF 4EB6E 2JQKA 2K5BB 3OVUA 3P50A 2WDVA 3X1DA 2A9UA 4ERRA 5GONE 3CQCB 3ZYLA 1XNRT 4HFEA 3AEEA 4QHOA 3NRYA 4E7SA 4UVCB 2ODUA 1IBKT 5HWXA 4GYRA 4YTMA 3MZKB 5HCJA 3ZJ1A 2I0MA 3ZN1B 4EZ4A 2N1GA 4BA9A 1IAPA 3UU5A 1BR0A 4B3ST 2D0UA 2XPKA 4H9QC 3ZEFB 1S35A 4DIDB 3O1IA 4EGWA 4PK6A 1HG2A 2DHRA 4X64T 2UXNB 1OEDB 2ACXA 2CBJA 3UTKA 2VASA 5JRCA 2XJ7A 2WWVA 3AA7B 3FB2A 4BAYB 3FZMB 4IGUA 2BS2A 1XDPA 2CM0A 4PFOA 4AQYT 4UV8B 4LF8T 2YN6A 5JDLA 3ZSTA 5EK4A 1WRDA 3RIFA 3ZMTB 1HG5A 3PJAJ 1N36T 2FJAA 2V1DB 2OLTA 4HFBA 2NTYA 4DV5T 1HS7A 3ZN0B 1KNZA 3LSVA 2MAWA 1YD8G 1ZP0A 2WY2A 3LFMA 1ZEEA 3PUXF 4LMJA 4KI0F 2QGSA 3TLSA 2CBIA 2WAUA 4PFPA 2NOXA 2DL1A 3IF8B 3MACA 3AVRA 4CI1B 4YTPA 2W67A 3RF1A 4H63H 1VRBA 2JQ9A 2XQYA 5AQOB 3VRAA 2KWHA 2E8IA 4DR5T 3P4WA 1XWMA 5FXVA 4NXNT 5FL1A 3OYZA 1E2AA 5HEUA 5LP6E 4NPPA 4N78D 2IAKA 2LHNA 4JEUB 5TAOA 5J2UE 1KNPA 3B5MA 2JMKA 2XQ6A 4GIWA 3TLUA 4KHPT 2PFVA 2XZEA 2UUBT 4PAGA 1YQ3A 2X9WA 5LGTB 5FVLA 4X5TA 2W0GA 4QH4A 4V1Av 5LJMA 4LF5T 2QA7A 3K3OA 4H9NC 2XQ3A 5L2LA 4XAXB 5HXHA 2X9HA 3HI2A 3JC6D 3ZMZB 5A1LA 4ZZBA 3WAJA 3ZC0A 3NRXA 3PUSA 3SOLA 3QNUA 5LJNA 5KX5E 4COFA 3OPCA 4YSXA 2KZ7B 2VVNA 1KFYA 3MKDA 4ZS3A 5CB4E 4HFIA 5H6QB 4K0KT 2BBJA 5FY1A 5JTGA 2P9BA 4U33A 2UXBT 2M6IA 3VKGA 3ABVA 4DBQA 4X1KE 3H37A 3LBXB 3WAKA 2BKNA 3ETVA 3VRBA 2UXCT 2XQ8A 3CQXC 1KK7A 4H9OC 2K9AA 2W00A 4BJNA 4O4JE 3PTRB 4PJNA 3N5LA 5AQSB 2EHOD 1NENA 3KFWX 4IDQA 2HHHT 3ESLA 4U74A 4ZXLA 4LFAT 4LF9T 5LHGB 4X62T 3L39A 1KEYA 4LF7T 4DUYT 3KBUA 4HKAA 5HXSA 2A2FX 3PUYF 2DNXA 4AXPA 5HAXA 4DR2T 2BG9A 2V5DA 4UF0B 3RC3A 2E9XB 2LJLA 4WYVA 1BR1A 3VHLA 2NW8A 1WR6A 2W66A 3QC9A 3JC6C 4AIUA 1T72A 5ABFB 4KBMB 3UFGA 1OXZA 4X20E 4NUVA 4IE0A 2C5IT 4X1YE 2CWOA 4TWFA 2JQHA 5AQUB 3AE2A 5HCMA 1D0XA 3KDSE 1M62A 4O4LE 4ILUA 3PUQA 5JDGA 4Z90A 1WLXA 4L5GA 2N9DA 4TZ4C 3RLFF 2B1EA 3A5XA 5AQVB 3PUAA 2ZLYA 5L3CB 5AQFB 2EHOC 3GN5A 1CHUA 4B3RT 4CZZB 4UR9A 2LKHA 3AB3B 3FZFB 4F8HA 5ETWA 4ADZA 1MMAA 2LM9A 3CIRA 3G06A 2WMNA 4TV8E 5LYJE 3UQ7A 2XAQB 3H3MA 1QLBA 3D0TA 5F3JA 3KV9A 2W62A 5IYZE 2YK0A 2CXFA 4YFSA 4ZZCA 1WFDA 4JI7T 4HWIB 1XDOA 2Y48B 3P4QA 2V7JA 1MIYA 1D0YA 1IBLT 2LM2A 4HTEA 3ZKRA 5C8YE 2WQYA 4E7ZA 3K3NA 4JI5T 3AE5A 1ZHCA 4LMLA 3AA0B 4KP3C 4WW0A 1Y01A 3E0ZA 2R6GF 2KT9A 4ZHQE 2C0SA 3N2OA 4HWCA 4I43B 5FY0A 4OHFA 3VKHA 4LF4T 2XTLA 1ZOYA 4U7YA 2BKPA 4OK0A 5FMNA 2IW5B 3AE8A 2NW7A 5LHHB 5DQWA 4AISA 4ZI7E 1N33T 3VR9A 3AAEB 4ZI2D 5HEOA 4YHJA 3KVAA 1IJ6A 3N9PA 4HGAA 5FL0A 2OV9A 1KNRA 2BBHA 1NAFA 2V26A 4ZOLE 1W0AA 3RI5A 3UFEA 1E7PA 4IDZA 2F4VT 4JEHB 2MOZA 1JNRA 1UCUA 3C64A 4HFHA 4ILCA 2VVSA 3LJCA 4KUMB 2ODVA 1G8XA 4PK4A 2VKDA 2E9XD 3RYHE 2BDEA 5JDNA 2X66A 2UUCT 2BVLA 3O4XE 4IIJE 5AQHB 1OEDE 4GK0E 3LDQB 2YDQA 3N2GE 2EHOA 3ZMUB 4UXNB 2DWGA 2XUEA 4DV0T 5AQNB 1X9BA 3TLWA 3V5UA 2D9DA 3K1SA 5JR9C 5ABGA 1HFAA 2JJ9A 1YKHB 4YJ3E 5FP3A 4ASKA 1CUNA 2LT3A 3AVSA 5KMGP 3N9MA 1YQ4A 2V7MA 2HH7A 4H63V 3AE6A 3AAIA 2IC9A 3WI3A 5LGUB 2J47A 3DP7A 4ZI2C 4WZXA 2CRBA 3PUVF 4TV9E 4LF6T 3RGLA 4ANJA 1EZ3A 2CCQA 1FJGT 4JV5T 4DV4T 3M3ZB 4CN4A 3UUBA 4TN7B 3NVOA 5DJQC 3FBZA 3UUXB 2C5JA 1UUSA 3ONLC 1HX8A 4QXBB 3O1HA 3RHWA 4X1IE 3NZPA 2E9XC 3JAEA 3P8CD 2YU2A 4YSZA 3HR0A 4AKLA 3P4SA 4IT4A 2VKOA 4WBNE 2JRKA 2YKSA 2X0LB 2WZHA 3HKBE 3J7Yq 4NXMT 2H3RA 3BK9A 2CA5A 4CQIA 1HF8A 5CGMA 4OX9T 3FXDB 3AEBA 4JUYA 4O4IE 3EI0A 3L8RA 2V7KA 3O1JA 1T7SA 3ZCJA 1UX5A 3ZMSB 2XHEB 5HEJA 3O9XA 2BS4A 4ILAA 2XAJB 4GOUA 5LA6E 4O2BE 3N9QA 2XM2A 4MALA 4EEDA 4HN9A 3NKZA 3OTOT 3SWHA 3Q9DA 3Q2MA 4ISSA 2FJDA 4AQFC 2WZIA 5JR9A 3PE0A 3BQKA 5J1GA 5DABA 5FXWA 2BG9C 2Q9QB 5L4HA 4CXYA 1J5ET 5LG4A 3QK6A 2XQ5A 3UU6A 3AE4A 2D2SA 3HKDE 2Z6EA 4WBOA 3PUGA 5LCYA 2QYWA 4IREA 2FJBA 4H9SE 1S94A 3SFEA 2LKGA 2XAFB 2RP4A 3MJXA 5CA1E 3U78A 2CLYC 2QRXA 2Y8DA 3FZLB 4PJMA 2KNDA 3LG7A 3E22E 5HXRA 3CMLA 1MIVA 4Z91A 4IDOA 5JQGE 4HWHA 2XY8B 5AQJB 1WR0A 5HEGA 2V7IA 3N9OA 4UF0A 4ZEYA 2E9XA 3L3PA 1SA0E 5ABFA 5BMVE 2KWIB 4XBFB 5HXCA 2H7VC 3TKLB 4I4TE 3DTOA 2XAHB 3CQGB 3UUMA 4GKKT 1MMGA 3H3AA 1HX1B 3Q5WA 2V5CA 2LSYA 5L4EA 1QUUA 2WS3A 2VWAA 5E0OA 2XASB 5FY7A 2WB5A 3U3IA 2X9YA 5LOVE 4OYKA 4MBQA 1VCSA 4GKJT 3EHZA 1LRZA 2D5UA 2XQAA 4DV2T 5AQIB 3KVBA 3IBPA 5LXTE 2WDRA 1H7CA 4P0BA 5HEHA 2VQFT 2H88A 2VL8A 4DVDA 3AXJB 2HN2A 4EAHA 4DNDA 3RPUA 3UU3A 3EVYA 3SRZA 4EOZB 4AQFA 4NIQA 3ZMVB 5AQRB 3RRWA 2V6YB 1YXRA 3T1HT 2AXDS 3AEGA 2CPTA 5AQMB 1YKEB 4I55E 4YY3T 1T98A 3NBXX 5EK3A 4DO0A 3RKGA 4DMVA 4EV6A 3ZC1A 2I6HA 1ZKEA 5CA0E 1HTJF 3C4ZA 5L3EB 4TWDA 2UXXB 1WCRA 3P7IA 4H9RC 3ONJA 4HFDA 2AE9A 2WU2A 4DMWA 1UGOA 4M1PA 2XQ4A 3OBVE 5L47A 1SHZC 3ANWA 2L9QA 2WMOA 5J2TE 4L0RA 3KINB 2ZM8A 4DBRA 2LOSA 3RYFE 4JI0T 1OEDC 2IIUA 1YW0A 2LRLA 4HFCA 3RC8A 1SE7A 4UEMA 3MXZA 4IDNA 2VURA 5LG3A 2XQ9A 1I6ZA 2BS3A 4TUYE 4BJMA 1UURA 2OA5A 5AQGB 5L3FB 2DWKA 5LMNT 2C5KT 2X67A 5H6RB 1D1BA 2WP9A 2J4GA 2VL0A 4PJLA 1J5WA 1U4QA 1JNZA 5C2TA 3ZT7A 1BR4A 4UV9B 2V8SV 4HE8A 3CWZB 2WDQA 3JAFA 4DR6T 2IMLA 4GK5E 4U7IA 3HKCE 4YTNA 4JBWF 2CE7A 3RYCE 3PURA 4IL4A 4FJOA 4EYYR 3KBTA 2K48A 2PBIA 3UULA 1MMNA 1SUMB 3NZQA 4UELA 4B3MT 4JI6T 4CN6A 2YU1A 3EUHA 1BR2A 1LKXA 3Q5EA 3AEAA 3ETUA 2D0TA 4AI6A
chains in the Genus database with same CATH topology
2HHHT 4DR3T 1FJGT 2F4VT 4JV5T 4DV4T 4LFAT 4LF9T 4KHPT 4X62T 1J5ET 1HNZT 4LFBT 4JI0T 4DV3T 1HNWT 2UUBT 4LF7T 4AQYT 5BR8T 4DUYT 4X66T 4GKJT 1N32T 4LF8T 1N34T 4JI7T 4LF5T 4DV2T 4DR2T 2UUCT 1IBLT 1XNRT 4DV1T 1N36T 2VQFT 2UXDT 4DV5T 4DV7T 4DR7T 4NXMT 4JI5T 4DR1T 5LMNT 4LFCT 1HNXT 4JI1T 1IBKT 1XMQT 4JI2T 4DV0T 4OX9T 3T1HT 4JI3T 4YHHT 2E5LT 4K0KT 4DR6T 4X65T 4YY3T 1XMOT 1IBMT 4LF4T 4DR4T 2UXBT 4B3ST 5IWAT 4JYAT 4DUZT 2UU9T 2VQET 1N33T 4DR5T 5LMUT 2UXCT 4NXNT 3OTOT 4DV6T 4X64T 4JI8T 3T1YT 4B3TT 4B3MT 1HR0T 4JI6T 1XNQT 4GKKT 2UUAT 4LF6T 2ZM6T 4B3RT 1I94T 4JI4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH T;  4DR3 T;  1FJG T;  2F4V T;  4JV5 T;  4DV4 T;  4LFA T;  4LF9 T;  4KHP T;  4X62 T;  1J5E T;  1HNZ T;  4LFB T;  4JI0 T;  4DV3 T;  1HNW T;  2UUB T;  4LF7 T;  4AQY T;  5BR8 T;  4DUY T;  4X66 T;  4GKJ T;  1N32 T;  4LF8 T;  1N34 T;  4JI7 T;  4LF5 T;  4DV2 T;  4DR2 T;  2UUC T;  1IBL T;  1XNR T;  4DV1 T;  1N36 T;  2VQF T;  2UXD T;  4DV5 T;  4DV7 T;  4DR7 T;  4NXM T;  4JI5 T;  4DR1 T;  5LMN T;  4LFC T;  1HNX T;  4JI1 T;  1IBK T;  1XMQ T;  4JI2 T;  4DV0 T;  4OX9 T;  3T1H T;  4JI3 T;  4YHH T;  2E5L T;  4K0K T;  4DR6 T;  4X65 T;  4YY3 T;  1XMO T;  1IBM T;  4LF4 T;  4DR4 T;  2UXB T;  4B3S T;  5IWA T;  4JYA T;  4DUZ T;  2UU9 T;  2VQE T;  1N33 T;  4DR5 T;  5LMU T;  2UXC T;  4NXN T;  3OTO T;  4DV6 T;  4X64 T;  4JI8 T;  3T1Y T;  4B3T T;  4B3M T;  1HR0 T;  4JI6 T;  1XNQ T;  4GKK T;  2UUA T;  4LF6 T;  2ZM6 T;  4B3R T;  1I94 T;  4JI4 T; 
#chains in the Genus database with same CATH topology
 2E5V A;  4KMC A;  5ABH A;  1MNE A;  3BQL A;  3TLV A;  3AA1 B;  2RPA A;  3UU8 A;  4U2Y A;  4QX8 B;  1D1A A;  3ZT6 A;  2SPC A;  4F6R C;  2IC6 A;  3HA4 A;  1US7 B;  2NW9 A;  4ZI3 D;  3ZT5 A;  5EK2 A;  3R6N A;  2MYS A;  3N9L A;  3I0Q A;  3A7M A;  3N2K E;  4DR7 T;  4TNW A;  1U5P A;  2N2N A;  1VCT A;  4ZS2 A;  1FIO A;  4G63 A;  3F31 A;  3ZPO A;  2LLY A;  5JDH A;  3RIU C;  5LNK A;  2BVM A;  2KIN B;  4O8S A;  2Y6X A;  2XAG B;  1OED A;  3SFD A;  3AA6 B;  5KXJ A;  3RH3 A;  3UT5 E;  2BKO A;  1MIW A;  2XM1 A;  3W15 B;  3AEC A;  2ZM2 A;  5JDQ A;  4JYA T;  3PUW F;  2WBL A;  5FXZ A;  1IJ5 A;  3AEF A;  4B3T T;  2M67 A;  2VKJ A;  3F2E A;  3CVR A;  2BZB A;  4TWH A;  4B6X A;  1T8B A;  2YEV C;  4OYJ A;  5J0Z A;  2LE8 A;  4HEA A;  2ACZ A;  3RX6 A;  4DV3 T;  3C4W A;  3PUZ F;  1DU2 A;  2GK9 A;  3I1A A;  2B76 A;  1UK5 A;  3R84 B;  2CWY A;  4ZI3 C;  4QX7 B;  2H89 A;  2CXL A;  4OFZ A;  3IEE A;  5FKY A;  3FZH B;  2KXP B;  4U3C A;  3Q5X A;  2W4X A;  3I9W A;  3P4R A;  3PU8 A;  3CX8 B;  2Q9Q A;  2CHN A;  4JI2 T;  4O4H E;  4AKG A;  2DLR A;  3ONX A;  2E5L T;  1L0V A;  3EAM A;  4AKH A;  3KV5 A;  1R8I A;  3MK7 C;  4KX6 A;  4YJ2 E;  3B13 A;  3C98 B;  1XMO T;  4Z8X A;  2H7O A;  1UX4 A;  2JMH A;  3NWI A;  2EHO B;  1FEW A;  4A97 A;  4CI2 B;  3QB5 K;  5L3G B;  1KF6 A;  2W63 A;  3RQU A;  5HXE A;  2NR4 A;  4K0U A;  4HFV A;  3ZCI A;  3B57 A;  3RIU A;  1I94 T;  2X0Y A;  4JI4 T;  5L3D B;  4DR3 T;  2X9X A;  4HWF A;  4JLE A;  3EAB A;  2CXD A;  2XSA A;  2LHR A;  1W9R A;  3LK2 B;  3LK4 2;  2PTF A;  3PJA A;  4U72 A;  2A72 A;  4UVA B;  2LSJ A;  3LK3 B;  2LSK A;  3AAA B;  4C91 A;  3VR8 A;  3C51 A;  1N34 T;  4MFR A;  4A98 A;  1Z8U A;  4CI3 B;  1XZY A;  1ZV4 X;  2VKH A;  3QOF A;  4QXC B;  4LMK A;  4IHJ E;  5FNV E;  4I50 E;  3ZJ2 A;  4DR1 T;  1V9D A;  2JPF A;  3LBX A;  4HWD A;  1W0B A;  4P1N A;  3GA8 A;  1VOM A;  4GYS A;  4EXT A;  4J2C A;  5M4Y A;  1IZN B;  4IL9 A;  1B7T A;  4I0U A;  3J9X 1;  3RRC A;  5CFB A;  5IUX A;  5JRC B;  5EZY E;  4DR4 T;  5LHI B;  2XSB A;  4TX5 A;  2RA1 A;  1MND A;  4AKI A;  3FHN A;  3AXJ A;  4EZH A;  4DUZ T;  4UIG A;  4AQG A;  3OKQ A;  2X68 A;  4DV6 T;  2FJE A;  3ZYM A;  1D0Z A;  4IDP A;  2V6Y A;  3K8P C;  4IE7 A;  4IE4 A;  2ZM6 T;  3A8Y C;  3AE9 A;  2W2U A;  1E1H B;  2J62 A;  5CJ5 A;  2K24 A;  4XZC A;  2J1D G;  1D1C A;  3DJB A;  1NEK A;  3CPZ A;  2NP9 A;  3C4X A;  2I59 A;  2IUB A;  1M7K A;  5C3J A;  2L3L A;  4A5X A;  1HCI A;  4G2A A;  4PJJ A;  3C50 A;  4Q25 A;  4U2Z A;  1G73 A;  3UQ4 A;  4DV1 T;  3JCF A;  2WM9 A;  2M6B A;  2PG8 A;  3I0O A;  3AED A;  1MMD A;  2UXD T;  5JR9 B;  2CHO A;  3RYI E;  3F57 A;  4DV7 T;  3K3Q C;  4UVB B;  4MLK A;  3QUJ A;  4IE5 A;  2KLQ A;  3CK6 A;  4EIW A;  5AQQ B;  3CX6 B;  5FYM A;  5AQT B;  3PU3 A;  2WU5 A;  4MHC A;  2WSS V;  4QH5 A;  2NTX A;  2LSG A;  1IBM T;  3FZK B;  3IA3 A;  5JH7 E;  4CXX A;  4IE6 A;  3AE1 A;  2UU9 T;  5LMU T;  3TLT A;  4JI8 T;  3IHR A;  3SS1 A;  5KDM C;  4P0A A;  4YLH A;  2K3W A;  2FBW A;  5AQP B;  4PW8 A;  2V7L A;  2L8K A;  4QH1 A;  2KMF A;  3I9Y A;  1WYB A;  2HPJ A;  5FVK A;  3ZLI A;  4AKR B;  2PJQ A;  2JQQ A;  4QWN B;  1HNZ T;  4LFB T;  2BG9 E;  2CMR A;  3PV0 F;  2LEH A;  1HNW T;  4EYU A;  3HKE E;  5BR8 T;  3EDV A;  5AFU L;  1N32 T;  3Q5D A;  2HN1 A;  2G0U A;  2Q9Q D;  2VK9 A;  2V6X A;  5AQK B;  3M65 A;  2LRK A;  1FMV A;  3KV6 A;  1GQE A;  3PDY A;  3RQW A;  4YXD A;  5FXX A;  2YDS A;  3EDU A;  4CXW A;  1W09 A;  1O3X A;  4L9I A;  4TNV A;  2MTQ A;  3GWH A;  4EEB A;  2W61 A;  4P09 A;  3MA9 A;  4A56 A;  5LB7 B;  2IDO B;  4PNI A;  3FBL A;  3CKD A;  1LVK A;  4H9P C;  5JVD E;  1X79 A;  3JAD A;  4X65 T;  3UUN A;  5F8P A;  3BQI A;  3RKO A;  4IST A;  4YSY A;  2E2A A;  2FUP A;  2WCA A;  5ADX L;  3AE3 A;  1OWA A;  2X51 A;  3GMI A;  3N9N A;  3V5S A;  4QKN A;  2YDR A;  2BG9 B;  3T1Y T;  5DQV A;  5ABE A;  4WNK A;  5L3B B;  3OJA A;  3AE7 A;  2X0H A;  3L09 A;  2HPL A;  5AQL B;  4QXH B;  4ILB A;  5LBM A;  2MBG A;  2CEA A;  4X66 T;  1AJ3 A;  2CLY B;  4FI5 A;  2QVA A;  2WWU A;  1J1J A;  2JIW A;  2YOE A;  2Q9Q C;  4NUU A;  2NWB A;  4C90 A;  3ANW B;  3VU7 H;  2ZMA A;  3ZYK A;  2VB6 A;  4LFC T;  1HNX T;  4JI1 T;  4YT0 A;  1LVF A;  1XMQ T;  3KV4 A;  2XQ7 A;  4O2A E;  4CN1 A;  3FXE B;  1Y64 B;  3GN5 B;  3RIA A;  2YIN A;  4JI3 T;  2ZM0 A;  2LSI A;  4YHH T;  2DCF A;  5LBQ B;  3CX7 B;  5HYA A;  5LGN B;  3E08 A;  3S4U A;  2ES0 A;  3QB5 A;  2LOP A;  2A3D A;  1Z0P A;  5IWA T;  2DI4 A;  1FMW A;  4PK5 A;  5JRE A;  5JDF A;  3HL6 A;  5F5W A;  3ZSS A;  2VQE T;  1QSD A;  2IHR 1;  5HWY A;  1WYC A;  3OYX A;  1NWM X;  2MPK A;  3UU4 A;  1HR0 T;  3T8O A;  2KSR A;  5JDM A;  1XNQ T;  2UUA T;  5IHY A;  4U31 A;  3P4P A;  4KHZ F;  4EB6 E;  2JQK A;  2K5B B;  3OVU A;  3P50 A;  2WDV A;  3X1D A;  2A9U A;  4ERR A;  5GON E;  3CQC B;  3ZYL A;  1XNR T;  4HFE A;  3AEE A;  4QHO A;  3NRY A;  4E7S A;  4UVC B;  2ODU A;  1IBK T;  5HWX A;  4GYR A;  4YTM A;  3MZK B;  5HCJ A;  3ZJ1 A;  2I0M A;  3ZN1 B;  4EZ4 A;  2N1G A;  4BA9 A;  1IAP A;  3UU5 A;  1BR0 A;  4B3S T;  2D0U A;  2XPK A;  4H9Q C;  3ZEF B;  1S35 A;  4DID B;  3O1I A;  4EGW A;  4PK6 A;  1HG2 A;  2DHR A;  4X64 T;  2UXN B;  1OED B;  2ACX A;  2CBJ A;  3UTK A;  2VAS A;  5JRC A;  2XJ7 A;  2WWV A;  3AA7 B;  3FB2 A;  4BAY B;  3FZM B;  4IGU A;  2BS2 A;  1XDP A;  2CM0 A;  4PFO A;  4AQY T;  4UV8 B;  4LF8 T;  2YN6 A;  5JDL A;  3ZST A;  5EK4 A;  1WRD A;  3RIF A;  3ZMT B;  1HG5 A;  3PJA J;  1N36 T;  2FJA A;  2V1D B;  2OLT A;  4HFB A;  2NTY A;  4DV5 T;  1HS7 A;  3ZN0 B;  1KNZ A;  3LSV A;  2MAW A;  1YD8 G;  1ZP0 A;  2WY2 A;  3LFM A;  1ZEE A;  3PUX F;  4LMJ A;  4KI0 F;  2QGS A;  3TLS A;  2CBI A;  2WAU A;  4PFP A;  2NOX A;  2DL1 A;  3IF8 B;  3MAC A;  3AVR A;  4CI1 B;  4YTP A;  2W67 A;  3RF1 A;  4H63 H;  1VRB A;  2JQ9 A;  2XQY A;  5AQO B;  3VRA A;  2KWH A;  2E8I A;  4DR5 T;  3P4W A;  1XWM A;  5FXV A;  4NXN T;  5FL1 A;  3OYZ A;  1E2A A;  5HEU A;  5LP6 E;  4NPP A;  4N78 D;  2IAK A;  2LHN A;  4JEU B;  5TAO A;  5J2U E;  1KNP A;  3B5M A;  2JMK A;  2XQ6 A;  4GIW A;  3TLU A;  4KHP T;  2PFV A;  2XZE A;  2UUB T;  4PAG A;  1YQ3 A;  2X9W A;  5LGT B;  5FVL A;  4X5T A;  2W0G A;  4QH4 A;  4V1A v;  5LJM A;  4LF5 T;  2QA7 A;  3K3O A;  4H9N C;  2XQ3 A;  5L2L A;  4XAX B;  5HXH A;  2X9H A;  3HI2 A;  3JC6 D;  3ZMZ B;  5A1L A;  4ZZB A;  3WAJ A;  3ZC0 A;  3NRX A;  3PUS A;  3SOL A;  3QNU A;  5LJN A;  5KX5 E;  4COF A;  3OPC A;  4YSX A;  2KZ7 B;  2VVN A;  1KFY A;  3MKD A;  4ZS3 A;  5CB4 E;  4HFI A;  5H6Q B;  4K0K T;  2BBJ A;  5FY1 A;  5JTG A;  2P9B A;  4U33 A;  2UXB T;  2M6I A;  3VKG A;  3ABV A;  4DBQ A;  4X1K E;  3H37 A;  3LBX B;  3WAK A;  2BKN A;  3ETV A;  3VRB A;  2UXC T;  2XQ8 A;  3CQX C;  1KK7 A;  4H9O C;  2K9A A;  2W00 A;  4BJN A;  4O4J E;  3PTR B;  4PJN A;  3N5L A;  5AQS B;  2EHO D;  1NEN A;  3KFW X;  4IDQ A;  2HHH T;  3ESL A;  4U74 A;  4ZXL A;  4LFA T;  4LF9 T;  5LHG B;  4X62 T;  3L39 A;  1KEY A;  4LF7 T;  4DUY T;  3KBU A;  4HKA A;  5HXS A;  2A2F X;  3PUY F;  2DNX A;  4AXP A;  5HAX A;  4DR2 T;  2BG9 A;  2V5D A;  4UF0 B;  3RC3 A;  2E9X B;  2LJL A;  4WYV A;  1BR1 A;  3VHL A;  2NW8 A;  1WR6 A;  2W66 A;  3QC9 A;  3JC6 C;  4AIU A;  1T72 A;  5ABF B;  4KBM B;  3UFG A;  1OXZ A;  4X20 E;  4NUV A;  4IE0 A;  2C5I T;  4X1Y E;  2CWO A;  4TWF A;  2JQH A;  5AQU B;  3AE2 A;  5HCM A;  1D0X A;  3KDS E;  1M62 A;  4O4L E;  4ILU A;  3PUQ A;  5JDG A;  4Z90 A;  1WLX A;  4L5G A;  2N9D A;  4TZ4 C;  3RLF F;  2B1E A;  3A5X A;  5AQV B;  3PUA A;  2ZLY A;  5L3C B;  5AQF B;  2EHO C;  3GN5 A;  1CHU A;  4B3R T;  4CZZ B;  4UR9 A;  2LKH A;  3AB3 B;  3FZF B;  4F8H A;  5ETW A;  4ADZ A;  1MMA A;  2LM9 A;  3CIR A;  3G06 A;  2WMN A;  4TV8 E;  5LYJ E;  3UQ7 A;  2XAQ B;  3H3M A;  1QLB A;  3D0T A;  5F3J A;  3KV9 A;  2W62 A;  5IYZ E;  2YK0 A;  2CXF A;  4YFS A;  4ZZC A;  1WFD A;  4JI7 T;  4HWI B;  1XDO A;  2Y48 B;  3P4Q A;  2V7J A;  1MIY A;  1D0Y A;  1IBL T;  2LM2 A;  4HTE A;  3ZKR A;  5C8Y E;  2WQY A;  4E7Z A;  3K3N A;  4JI5 T;  3AE5 A;  1ZHC A;  4LML A;  3AA0 B;  4KP3 C;  4WW0 A;  1Y01 A;  3E0Z A;  2R6G F;  2KT9 A;  4ZHQ E;  2C0S A;  3N2O A;  4HWC A;  4I43 B;  5FY0 A;  4OHF A;  3VKH A;  4LF4 T;  2XTL A;  1ZOY A;  4U7Y A;  2BKP A;  4OK0 A;  5FMN A;  2IW5 B;  3AE8 A;  2NW7 A;  5LHH B;  5DQW A;  4AIS A;  4ZI7 E;  1N33 T;  3VR9 A;  3AAE B;  4ZI2 D;  5HEO A;  4YHJ A;  3KVA A;  1IJ6 A;  3N9P A;  4HGA A;  5FL0 A;  2OV9 A;  1KNR A;  2BBH A;  1NAF A;  2V26 A;  4ZOL E;  1W0A A;  3RI5 A;  3UFE A;  1E7P A;  4IDZ A;  2F4V T;  4JEH B;  2MOZ A;  1JNR A;  1UCU A;  3C64 A;  4HFH A;  4ILC A;  2VVS A;  3LJC A;  4KUM B;  2ODV A;  1G8X A;  4PK4 A;  2VKD A;  2E9X D;  3RYH E;  2BDE A;  5JDN A;  2X66 A;  2UUC T;  2BVL A;  3O4X E;  4IIJ E;  5AQH B;  1OED E;  4GK0 E;  3LDQ B;  2YDQ A;  3N2G E;  2EHO A;  3ZMU B;  4UXN B;  2DWG A;  2XUE A;  4DV0 T;  5AQN B;  1X9B A;  3TLW A;  3V5U A;  2D9D A;  3K1S A;  5JR9 C;  5ABG A;  1HFA A;  2JJ9 A;  1YKH B;  4YJ3 E;  5FP3 A;  4ASK A;  1CUN A;  2LT3 A;  3AVS A;  5KMG P;  3N9M A;  1YQ4 A;  2V7M A;  2HH7 A;  4H63 V;  3AE6 A;  3AAI A;  2IC9 A;  3WI3 A;  5LGU B;  2J47 A;  3DP7 A;  4ZI2 C;  4WZX A;  2CRB A;  3PUV F;  4TV9 E;  4LF6 T;  3RGL A;  4ANJ A;  1EZ3 A;  2CCQ A;  1FJG T;  4JV5 T;  4DV4 T;  3M3Z B;  4CN4 A;  3UUB A;  4TN7 B;  3NVO A;  5DJQ C;  3FBZ A;  3UUX B;  2C5J A;  1UUS A;  3ONL C;  1HX8 A;  4QXB B;  3O1H A;  3RHW A;  4X1I E;  3NZP A;  2E9X C;  3JAE A;  3P8C D;  2YU2 A;  4YSZ A;  3HR0 A;  4AKL A;  3P4S A;  4IT4 A;  2VKO A;  4WBN E;  2JRK A;  2YKS A;  2X0L B;  2WZH A;  3HKB E;  3J7Y q;  4NXM T;  2H3R A;  3BK9 A;  2CA5 A;  4CQI A;  1HF8 A;  5CGM A;  4OX9 T;  3FXD B;  3AEB A;  4JUY A;  4O4I E;  3EI0 A;  3L8R A;  2V7K A;  3O1J A;  1T7S A;  3ZCJ A;  1UX5 A;  3ZMS B;  2XHE B;  5HEJ A;  3O9X A;  2BS4 A;  4ILA A;  2XAJ B;  4GOU A;  5LA6 E;  4O2B E;  3N9Q A;  2XM2 A;  4MAL A;  4EED A;  4HN9 A;  3NKZ A;  3OTO T;  3SWH A;  3Q9D A;  3Q2M A;  4ISS A;  2FJD A;  4AQF C;  2WZI A;  5JR9 A;  3PE0 A;  3BQK A;  5J1G A;  5DAB A;  5FXW A;  2BG9 C;  2Q9Q B;  5L4H A;  4CXY A;  1J5E T;  5LG4 A;  3QK6 A;  2XQ5 A;  3UU6 A;  3AE4 A;  2D2S A;  3HKD E;  2Z6E A;  4WBO A;  3PUG A;  5LCY A;  2QYW A;  4IRE A;  2FJB A;  4H9S E;  1S94 A;  3SFE A;  2LKG A;  2XAF B;  2RP4 A;  3MJX A;  5CA1 E;  3U78 A;  2CLY C;  2QRX A;  2Y8D A;  3FZL B;  4PJM A;  2KND A;  3LG7 A;  3E22 E;  5HXR A;  3CML A;  1MIV A;  4Z91 A;  4IDO A;  5JQG E;  4HWH A;  2XY8 B;  5AQJ B;  1WR0 A;  5HEG A;  2V7I A;  3N9O A;  4UF0 A;  4ZEY A;  2E9X A;  3L3P A;  1SA0 E;  5ABF A;  5BMV E;  2KWI B;  4XBF B;  5HXC A;  2H7V C;  3TKL B;  4I4T E;  3DTO A;  2XAH B;  3CQG B;  3UUM A;  4GKK T;  1MMG A;  3H3A A;  1HX1 B;  3Q5W A;  2V5C A;  2LSY A;  5L4E A;  1QUU A;  2WS3 A;  2VWA A;  5E0O A;  2XAS B;  5FY7 A;  2WB5 A;  3U3I A;  2X9Y A;  5LOV E;  4OYK A;  4MBQ A;  1VCS A;  4GKJ T;  3EHZ A;  1LRZ A;  2D5U A;  2XQA A;  4DV2 T;  5AQI B;  3KVB A;  3IBP A;  5LXT E;  2WDR A;  1H7C A;  4P0B A;  5HEH A;  2VQF T;  2H88 A;  2VL8 A;  4DVD A;  3AXJ B;  2HN2 A;  4EAH A;  4DND A;  3RPU A;  3UU3 A;  3EVY A;  3SRZ A;  4EOZ B;  4AQF A;  4NIQ A;  3ZMV B;  5AQR B;  3RRW A;  2V6Y B;  1YXR A;  3T1H T;  2AXD S;  3AEG A;  2CPT A;  5AQM B;  1YKE B;  4I55 E;  4YY3 T;  1T98 A;  3NBX X;  5EK3 A;  4DO0 A;  3RKG A;  4DMV A;  4EV6 A;  3ZC1 A;  2I6H A;  1ZKE A;  5CA0 E;  1HTJ F;  3C4Z A;  5L3E B;  4TWD A;  2UXX B;  1WCR A;  3P7I A;  4H9R C;  3ONJ A;  4HFD A;  2AE9 A;  2WU2 A;  4DMW A;  1UGO A;  4M1P A;  2XQ4 A;  3OBV E;  5L47 A;  1SHZ C;  3ANW A;  2L9Q A;  2WMO A;  5J2T E;  4L0R A;  3KIN B;  2ZM8 A;  4DBR A;  2LOS A;  3RYF E;  4JI0 T;  1OED C;  2IIU A;  1YW0 A;  2LRL A;  4HFC A;  3RC8 A;  1SE7 A;  4UEM A;  3MXZ A;  4IDN A;  2VUR A;  5LG3 A;  2XQ9 A;  1I6Z A;  2BS3 A;  4TUY E;  4BJM A;  1UUR A;  2OA5 A;  5AQG B;  5L3F B;  2DWK A;  5LMN T;  2C5K T;  2X67 A;  5H6R B;  1D1B A;  2WP9 A;  2J4G A;  2VL0 A;  4PJL A;  1J5W A;  1U4Q A;  1JNZ A;  5C2T A;  3ZT7 A;  1BR4 A;  4UV9 B;  2V8S V;  4HE8 A;  3CWZ B;  2WDQ A;  3JAF A;  4DR6 T;  2IML A;  4GK5 E;  4U7I A;  3HKC E;  4YTN A;  4JBW F;  2CE7 A;  3RYC E;  3PUR A;  4IL4 A;  4FJO A;  4EYY R;  3KBT A;  2K48 A;  2PBI A;  3UUL A;  1MMN A;  1SUM B;  3NZQ A;  4UEL A;  4B3M T;  4JI6 T;  4CN6 A;  2YU1 A;  3EUH A;  1BR2 A;  1LKX A;  3Q5E A;  3AEA A;  3ETU A;  2D0T A;  4AI6 A; 
#chains in the Genus database with same CATH homology
 2HHH T;  4DR3 T;  1FJG T;  2F4V T;  4JV5 T;  4DV4 T;  4LFA T;  4LF9 T;  4KHP T;  4X62 T;  1J5E T;  1HNZ T;  4LFB T;  4JI0 T;  4DV3 T;  1HNW T;  2UUB T;  4LF7 T;  4AQY T;  5BR8 T;  4DUY T;  4X66 T;  4GKJ T;  1N32 T;  4LF8 T;  1N34 T;  4JI7 T;  4LF5 T;  4DV2 T;  4DR2 T;  2UUC T;  1IBL T;  1XNR T;  4DV1 T;  1N36 T;  2VQF T;  2UXD T;  4DV5 T;  4DV7 T;  4DR7 T;  4NXM T;  4JI5 T;  4DR1 T;  5LMN T;  4LFC T;  1HNX T;  4JI1 T;  1IBK T;  1XMQ T;  4JI2 T;  4DV0 T;  4OX9 T;  3T1H T;  4JI3 T;  4YHH T;  2E5L T;  4K0K T;  4DR6 T;  4X65 T;  4YY3 T;  1XMO T;  1IBM T;  4LF4 T;  4DR4 T;  2UXB T;  4B3S T;  5IWA T;  4JYA T;  4DUZ T;  2UU9 T;  2VQE T;  1N33 T;  4DR5 T;  5LMU T;  2UXC T;  4NXN T;  3OTO T;  4DV6 T;  4X64 T;  4JI8 T;  3T1Y T;  4B3T T;  4B3M T;  1HR0 T;  4JI6 T;  1XNQ T;  4GKK T;  2UUA T;  4LF6 T;  2ZM6 T;  4B3R T;  1I94 T;  4JI4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...