3R6NA

Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin plakin domain
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
450
structure length
450
Chain Sequence
b'SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Desmoplakin
publication title Crystal structure of a rigid four-spectrin-repeat fragment of the human desmoplakin plakin domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 171
structure length 450
sequence length 450
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17902 SH3_10 SH3 domain
A PF18373 Spectrin_like Spectrin like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1060 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA02
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3r6nA03
4GBQA 4F17A 4GLMA 5GJVB 1PWTA 1NYGA 2ED0A 2O9SA 2F2XA 1AWOA 3EG1A 1HJDA 2DILA 2LX7A 2FPDA 3THKA 4OMPA 1NEBA 5I22A 2RQWA 1N5ZA 2P4RA 2JT4A 1E6GA 3KBUA 2KE9A 2RPNA 2M0YA 1X2QA 1WFWA 2K79A 3REBB 1M30A 2L3SA 3H41A 2DYBA 1SPKA 2F2VA 4J9GA 2CUDA 1RLPC 1QKXA 3GBQA 4OMLA 4Y92A 2FRWA 4A63B 1RUWA 1U3OA 2ROTA 1NEGA 3EG2A 1J3TA 1KSWA 2JM8A 4OMMA 1ZLMA 1ABOA 2K7AA 1CKAA 1RLQC 1PRLC 3NGPA 1JU5C 4KRTA 4OMOA 2DL3A 1KFZA 1OOTA 1UJYA 3U23A 2V1QA 1A0NB 3QWYA 1K1ZA 2MIOA 2EYWA 1UTIA 1OEBA 2A28A 1PRMC 2CUBA 3PDYA 1YWPA 2VWFA 1NLPC 4AG2C 1ARKA 1OPKA 2EYZA 3IQLA 1Y57A 4WCIA 1VYVA 3UF4A 2K3BA 2BTTA 2HDAA 1XOVA 2JW4A 1HD3A 1ZX6A 1U5SA 2KYBA 4ORZA 1WX6A 4J9FA 5IHKA 1H3HA 1JXOA 1PNJA 2FEIA 4FSSA 4E6RA 1VYTA 1SRLA 2CSQA 1B3QA 3VS0A 1FYNA 2K2MA 1WLPB 2GQIA 3EGUA 2KNBB 3I5SA 1K4US 2V1RA 1G2BA 1S1NA 1KJWA 3TSZA 1PKTA 2EYXA 2PZ1A 4OMQA 1SSHA 1T0HA 1IO6A 1MV3A 2B86A 1AEYA 2O2OA 4J9BA 2LZ6B 4F16A 1AOJA 2OI3A 1GFCA 2A37A 2KYMA 2K6DA 4K11A 2JS0A 4LUDA 2HSPA 4HVUA 2ECZA 4OMNA 1LCKA 2EKHA 1G8XA 1X43A 2KT8A 4AFUC 2AZSA 2EW3A 2LQWA 3CQTA 1WYXA 1GFDA 2JTEA 3EDUA 2YUQA 1WXTA 5FWBA 1M8MA 2KBTA 1KIKA 1YCSB 1K9AA 3EHQA 4J9IA 1TUCA 2DBMA 1Y0MA 1I1JA 2AKLA 2L3QA 2NUZA 2EGAA 2DNUA 4CC4B 3UA7A 2MOXA 1UJ0A 2DRKA 2W0ZA 1WIEA 2J6KA 3M0UA 2EBPA 2RMOA 3M0QA 1UUEA 1SHGA 4AG1C 3M0TA 1ZBJA 1H92A 1WDXA 1QLYA 4HVWA 1PHTA 2YUNA 1E6HA 1PKSA 1X6BA 4CC3A 1GBRA 2LJ0A 1B07A 2VKNA 2CREA 4M4ZA 5ECAA 2JM9A 1OV3A 2O88A 3TVTA 2HCKA 2CT4A 2X3WD 2ED1A 4J9HA 4RTUA 2CT3A 2KRNA 2J05A 4AFZC 5IHIA 1ZUUA 3O5ZA 1UHFA 1X6GA 2J6FA 2JXBA 5HCKA 1M3CA 4LNPA 3VRZA 2O31A 2IIMA 4RTWA 1NM7A 2KR3A 2DM1A 1V1CA 1BB9A 1YN8A 1T0JA 4F14A 2EPDA 2JMAA 1X2KA 2X3XD 4RTXA 1I0CA 1BBZA 2O9VA 2KXCA 1GBQA 1G83A 1JQQA 3H0IA 1QCFA 2KXDA 2W10A 2K9GA 2D8HA 1RI9A 2ENMA 2XMFA 1JXMA 1ZUYA 2KRMA 3I9QA 1K0XA 2I0NA 2FRYA 2BZXA 4D8DA 1AZEA 1AWJA 4HVVA 2DL4A 4LUEA 3TSWA 3QWXX 2CDTA 2DX1A 4JJCA 4EIKA 2DMOA 3M0PA 4Z8AA 3VS1A 1ZUKA 3NPFA 2C0TA 2LJ1A 3VS6A 4RTTA 2CH4W 2MCNA 3UA6A 2GTJA 3C0CA 2SEMA 2OAWA 1MV0B 4JJBA 4ESRA 4JZ3A 2AK5A 3R6NA 1JO8A 2DBKA 2NWMA 1UFFA 2EGCA 3NHNA 2H8HA 1K76A 1SEMA 3H0HA 4DEXA 2DVJA 3VS5A 1W6XA 1QKWA 1X69A 2EGEA 2KEAA 4R0KA 2ESWA 2LMJA 4RTYA 3VS4A 1CKBA 4J9DA 5FW9A 2KROA 1UDLA 4RUGA 2JS2A 2CH4A 4RTVA 4RTZA 5IXFA 4JZ4A 1WA7A 2RQTA 2IAKA 3ULRB 1TUDA 2RQVA 1BU1A 2JMCA 2AZVA 2A36A 1GCQA 2RNAA 1UECA 2GTOA 3RBBB 1X27A 1T3LA 2FPFA 1VA7A 4JPBW 2KGTA 1EFNA 1GCQC 2DE0X 3NMZC 4LE9A 2DL7A 1H8KA 1U06A 5IH2A 1YWOA 2DRMA 3I35A 2EVRA 3SEMA 3FJ5A 1YP5A 4ZNXA 2BZYA 4AFQC 1YNZA 2BZ8A 2L3PA 1E7OA 1UHCA 2D1XA 1I07A 3VS2A 1AVZC 2J6OA 1M3BA 3EDVA 1M3AA 3KFVA 1AD5A 2AKKA 3EHRA 1AWXA 4JJDA 5IXBA 2L2PA 1AWWA 1VYUA 4CC2A 4DEYA 3VS3A 1OPLA 3ZL7C 3VS7A 5GJWB 3REAB 1AZGB 1Z9ZA 2SRCA 4X1VA 3SHWA 1MUZA 2ABLA 4HCKA 2J06A 2LQNA 3LH5A 2GNCA 3RNJA 1UGVA 2YT6A 1SHFA 4J9EA 2ROLA 2C0IA 3EG3A 4LN2A 2FPEA 3F57A 2QDLA 2PTKA 2DL8A 2PNIA 2HEQA 2RN8A 1UG1A 2E5KA 1M27C 1FMKA 1NLOC 5L23A 1SRMA 1Z9QA 2YDLA 5I11A 1UE9A 2LJ3A 2YUPA 3M0RA 2KT1A 3PVQA 2G6FX 3EG0A 4Z89A 1T3SA 1GRIA 1WXBA 2D8JA 5FWCA 2FO0A 2D0NA 2EYYA 2RF0A 2CSIA 2L0AA 1WI7A 1ZSGA 1WXUA 5EC7A 2RQUA 2LCSA 2LP5A 3PE0A 2RQRA 3JV3A 2VVKA 2M51A 3H0FA 1W1FA 1W70A 1CSKA 2FG0A 2DJQA 2GGRA 4Z88A 3VRYA 3M0SA 1QWEA 2GBQA 4IIMA 1K0SA 1ABQA 2KRSA 3I5RA 1JEGA 1GL5A 4CC7A 1TG0A 1QWFA 5J1GA 3PVLA 2F2WA 4IIOA 2YSQA 4J9CA 2DA9A 2A08A 3A98A 4HXJA 2LNHB 1GCPA 4QT7A 2C0OA 1NYFA 2EQIA 2HBWA 4D8KA 2YUOA 5IHNA 1BK2A 1NG2A 2DLPA 2DL5A 2DF6A 2J7IA 3UATA 1HSQA 2OJ2A 3KBTA 4AFSC
chains in the Genus database with same CATH superfamily
4U2ZA 4BI4A 4F17A 4HKAA 5GJVB 1PWTA 1OEDA 4MALA 1IRXA 2O9SA 1YIJA 2KLQA 2FJEA 1VQNA 3BY7A 1KD1R 5IAYA 2DNXA 3PUAA 5CJ5A 2EWNA 3LX7A 4G63A 1NEBA 3AE8A 4M75F 4AQGA 4JLIA 4Q25A 3RYFE 4XBFB 4ZEYA 4FYWB 4PJOF 3CCEA 4KX6A 2JOYA 2M0YA 3MEAA 3EFOA 1KFYA 4Z90A 2DYBA 3MHXA 2F2VA 5KYWA 2A0FB 2MAWA 5FU7C 1YJ9Q 3DJBA 3ZYKA 3A7MA 4OMLA 3CMAT 3ANWA 3KDSE 4PK6A 4YTMA 4A63B 1K9MC 1RUWA 2VVNA 3NTIA 4AT1B 3W15B 2DXUA 4OMMA 3OBWA 1ZLMA 1VQ4Q 1VQ9Q 2QDYB 5JRCB 4M75B 2XQ6A 5A1LA 4X1IE 4KRTA 2XPKA 2YU2A 5AQKB 4M77A 1WHHA 4E7JA 1OOTA 1UJYA 2ZM2A 4HKEA 1VQ6T 4HFVA 4AQFA 3C94A 1S35A 2EQMA 4GYRA 2Z6EA 3AAIA 3RX6A 3M65A 5GAN7 3VU3C 1UTIA 2XQ7A 5F5WA 4A4EA 2O4XA 3QUIA 4TV9E 5CA0E 3F70A 1US7B 1OULA 4LFCT 1UGRB 3OYLA 4RG2A 3JB9D 3LWIA 5JTGA 1T72A 1R77A 2CHNA 3GMIA 3IEEA 3TLVA 1NLPC 2JIWA 5FXZA 1Y57A 1M1KR 3RRWA 1ZA2B 4IDNA 3UU8A 2K3BA 1N8RU 4F6RC 2XQYA 1VQOQ 3OYKA 4JDSA 1XOVA 1HD3A 2J1DG 1BI3A 3SRZA 2FHDA 4AKGA 2E4HA 4ORZA 1I5LA 4UXNB 4IE4A 4YT0A 2DXBA 2R5MA 3L09A 4X34A 3LLRA 4ZS2A 3UU6A 2FEIA 5LBMA 1K8AR 1VYTA 2YRVA 4K0UA 3MP1A 1SRLA 4TNVA 1HS7A 3CMEQ 3RDVA 2NYSA 2ODVA 3FBLA 2BDEA 3VS0A 1Y01A 2K2MA 2AXDS 4HA8A 3A8HB 3C51A 3I5SA 3RKYA 4JI7T 3QSUA 4ILCA 2VL8A 4U3CA 2XQAA 1PKTA 3M5AA 1I4K1 2RI2A 2WACA 3CIRA 2PG8A 4DUYT 4M7DC 5KDMC 1AEYA 4DV4T 5LJ3d 2KMTA 1Y96A 2X35A 4F04B 3E1SA 1W2BS 4O4IE 3L42A 4OB0B 4DV5T 1NWMX 5H6RB 4M7AC 3M59A 2K5LA 3CCJT 4CN6A 1KG1A 5IN1A 3TKLB 4LFBT 2M6IA 4HE8A 1OZ3A 3M56A 4LUDA 2RK1A 3SFDA 5ABFA 2VGMA 1M4ZA 1D1CA 5DQWA 3GPLA 2X68A 3LSVA 4QX7B 1LCKA 2EKHA 5CB4E 5A0DA 4UVAB 2IC6A 5AQLB 2KI7A 3G7ZA 4YTPA 5GANd 1PG5B 2XQ8A 2AZSA 3CQGB 4IREA 4QKUA 2EW3A 2AT1B 3TEEA 2WBLA 3GN5B 3BW1A 1WYXA 4C0DC 1GFDA 2WWVA 1OYXA 3V7CA 5JR9B 3ZYMA 1JRIA 1YI2Q 1OI1A 3KV4A 1M8MA 1UURA 5FRNA 3EHQA 1NAFA 4A56A 4BJMA 3FXDB 8AT1B 2AKLA 1ZKEA 2QRXA 2YDSA 2L3QA 4DUZT 3EUHA 5L47A 3QO3A 4PJNA 4B6MA 4BJNA 2DRKA 3ETUA 4I55E 2HKQB 2W0ZA 3ZSTA 1YHQT 2B76A 3CD6T 2KINB 3U78A 1SHGA 2FJDA 4AG1C 2OTLT 3VR8A 1XNRT 2L8DA 2VK9A 1QLYA 2X9YA 1OEDE 2W66A 3CPZA 1Q82C 3JCMJ 2Y48B 3ZMSB 1GBRA 5LJ3g 5L3BB 3H6ZA 5CAIA 4MZTA 3D0TA 2DZ9A 3CCJA 3RH3A 2RJFA 4M4ZA 2XU8A 1QVFP 4AKLA 5LJ5f 3RKXA 1U5PA 5HEOA 1KQSA 3LFMA 1OV3A 2VL0A 3X1DA 2ATCB 4FM4B 1H7CA 3A5ZB 2K57A 3TVTA 3FXEB 3I1AA 3WVDB 2LOSA 4JRKA 4C8QG 1BR1A 2X4WA 4X66T 2F5TX 4ZGEB 4M78C 3RKWA 5GMKe 5GANg 1UEBA 4J9HA 4IGUA 5LGTB 5IHYA 1R0BG 3CCUA 2V7JA 1G5VA 2CE7A 2EHOB 1M3CA 1MHNA 1PSEA 4LNPA 3VRZA 1UB4A 2V1DB 4ZZCA 5LJ3h 1YITQ 1UK5A 2N1GA 2NP9A 3X26B 1QVPA 3P4QA 5CQXA 4OFZA 5KYYB 1I0CA 1QP2A 1BBZA 4NPPA 2IDOB 4ADZA 1U8RA 1GBQA 1YHQA 3CKDA 4GKKT 1TXQA 3CD6A 1U1SA 2E3HA 1H3ZA 2X0YA 4YLHA 1JNZA 4JI4T 2W10A 2K9GA 2LE8A 2QTVA 3LG7A 3HFNA 4PFOA 1RI9A 2OTLA 2WWUA 2M16A 2XMFA 5GANh 1N6AA 1ZUYA 1K0XA 3I9QA 2RA2A 3V8KA 2I0NA 2ZCFB 4D8DA 4UR9A 4COFA 4KI0F 4L59A 3QWXX 2CDTA 3AXJB 3UU5A 2WQYA 4U33A 5HXEA 1YKEB 3JCMQ 3LK42 2HBPA 3M0PA 3LBXB 4A98A 4Z8AA 2QEXQ 4O2BE 1ZUKA 4MDXA 2Q9QD 1XMQT 4DR2T 2VVSA 4RTTA 2JQKA 1YFNA 2XD0A 3INZA 3C0CA 2SEMA 2RA1A 3WAJA 1MV0B 2E5LT 2CGHA 4JZ3A 3P50A 5LXTE 1WZOA 3PMIA 3OMCA 3AE4A 1JO8A 2L8KA 1VQLQ 2EGCA 3C12A 3ESLA 2ZPIB 3QDRB 3A8MB 3FLGA 1K76A 2QK0A 4EZHA 2W67A 4NS5A 4TWHA 3JCMX 1X69A 4ILUA 4R0KA 4E47A 1SG5A 2M9UA 2LMJA 3L2RA 3ME9A 1UX5A 4ELZC 4FT2A 5A2QE 3GOXA 2IW5B 1FWZA 2OLTA 4BACA 3VKIA 1W2BA 1XDOA 5HEGA 5FY7A 4KBMB 3JB9I 3CCRQ 4EMGA 2QYWA 4DBFA 1VQ7Q 4Z8XA 3QBYA 3CBOA 3N2GE 3N9LA 4TX5A 4BY6C 3OKQA 4PJOA 4LDYA 3EH2A 2XI9A 2YHTA 4QVZA 3SB2A 2A36A 2VURA 2GTOA 4MMKA 1WR6A 5KCHA 2XQ3A 5FMNA 4KP3C 4QXCB 3MP6A 3AEAA 3EH1A 4J6WA 2LT3A 2M6BA 3G06A 3QOFA 3R84B 4M75D 2K48A 3CEYA 2QGFB 3NMZC 3HKBE 4U7IA 3QPHA 3LYIA 3R6OA 2WZIA 3VV0A 2WMNA 3RESA 2WM9A 4DA4A 2DRMA 2DI4A 1M90R 2LX9A 1Q86R 1YP5A 3F2EA 2LSJA 1YNZA 4AFQC 2A7YA 1BKBA 1UHCA 3OVUA 4DV3T 4JUYA 2CXDA 5AQPB 1JJ2S 4J8OA 2M1HA 1Q7YC 4NOYA 3N9NA 3VU7H 3KFVA 2KXPB 3KVAA 1YJWQ 1ACMB 1W9RA 3TLSA 1WLXA 2BG9A 2G0UA 2GFAA 4N0AA 2VGNA 3DLLA 2L2PA 1AWWA 4IE5A 1W2BP 1VYUA 2CLYC 3VS3A 4BA9A 1D3BA 1OPLA 3ZL7C 3HRUA 2WMOA 1SF9A 3REAB 1WJQA 4B9WA 5CFBA 4F8HA 1Z9ZA 3SOLA 3OBYA 3OYDA 1MUZA 2ABLA 3AE1A 4HCKA 2J06A 1NPPA 4IT4A 2K5IA 4E7IA 3RI5A 2DCFA 5EG2A 2NLUA 4FIBA 2HPJA 4UIGA 5HWXA 1SHFA 1OEDB 2C0SA 2FYKA 2PVGB 1NJIR 3OW2A 5IWAT 2LEHA 3EFRA 4ZI3D 2E70A 3F57A 4PAGA 4O4LE 2LCLA 2HL3A 3MPUB 2PTKA 2ZMAA 4HFIA 2Y4XA 5BR8T 2IC9A 4QVDA 3RQUA 1D09B 1NEKA 3HR0A 5LL6S 3OPCA 4HFEA 2H7VC 5TAOA 2E5KA 1M27C 3EFOB 5EZYE 5CA1E 2CZ0B 2DPPB 2XQ9A 4R55A 4H9OC 1NLOC 5AQJB 3CX8B 3G1JA 5LMUT 2QA4Q 4QXBB 1Z9QA 2JUFA 4LF5T 4JI1T 2AIRB 1UE9A 2EKOA 2YDLA 2YUPA 3PUQA 3M0RA 5GAMe 3ANWB 3FHNA 2Y8DA 3PVQA 3CCLQ 3JAEA 1ZSZC 4LDUA 5LHHB 3P8CD 3EG0A 3CMLA 4DR3T 4KT0E 4M7AG 2L3RA 1WXBA 2FO0A 4A4HA 1FMWA 3OS1A 2EYYA 1OX9A 2RF0A 2L0AA 4M77B 4HT9A 1WI7A 4PNIA 5HEUA 2LCSA 4M7DA 2J62A 1PSFA 4BI8B 1W1FA 3SFEA 2E3IA 3RLFF 4X64T 3CX7B 2O4XB 3P7IA 4JI2T 4F7UA 5L3FB 1YXRA 5AT1B 3C4SA 2V7MA 3M0SA 5KX5E 2XY8B 2E2AA 5FXVA 1N8RC 4MZMA 2HAXA 1ABQA 4UC4A 4YY3T 4KH0B 3FZFB 3AE9A 3I5RA 1VIEA 3URGA 1GL5A 1WYCA 3RYIE 4UELA 3HPWA 3VKHA 1EX4A 2DAQA 3PVLA 4EMKC 4ZN1A 2Y4YA 1IXDA 3E2UA 5JDHA 3META 1UGOA 1SUMB 3Q5DA 1X6OA 1BI1A 2DA9A 2UXDT 1KQ1A 2QYZA 3ONXA 1GCPA 4QT7A 3MO8A 3RIUC 1M62A 2FJAA 4V1Av 2R6GF 4DIDB 1WCRA 2HH7A 2CXLA 2DL5A 4G2AA 2DXTA 4MDWA 4XTWA 5CVIA 4J2CA 4GLMA 3PFSA 2RHYA 1WQ7A 2EQKA 3RIFA 1ZQ1A 3RC8A 5GMKl 4PJOE 3N9PA 4HWIB 1ZA1B 4N4HA 2EHOD 4JBWF 4JYAT 2DK3A 4X65T 2IMLA 3LK3B 3EG1A 3N5BB 1HJDA 2CP0A 2LX7A 1IGQA 4HWDA 4CRIA 2RQWA 3BQIA 2DIQA 1Y96B 3AAEB 3C64A 1E6GA 4M78G 4EMHA 3MJXA 1X2QA 4E7LA 1O3XA 4C92A 1WFWA 4WBNE 5EK3A 1I94T 5FYMA 2JPFA 1M1GA 4IL9A 4L5GA 1SPKA 5ABFB 1VQKT 1RLPC 3ZCIA 4GKJT 1VRBA 4PK4A 3JB9J 2FRWA 5JH7E 3Q5WA 2KZ7B 2ROTA 2HN2A 1J3TA 2XAGB 3ZBDA 5IT9E 4YSXA 2D2SA 2K7AA 2BG9E 4HN9A 1EIFA 1I5OB 5FU6C 1PRLC 2UUBT 4C5HA 5CQYA 1JU5C 2OTJT 1F1BB 4OMOA 5I2SA 2CBIA 2MTQA 3GF5A 4TN7B 2DERA 5HXCA 3U23A 2E9XD 2CP5A 3M9QA 1K1ZA 4O6JA 2MIOA 4LDVA 2WU2A 3I55T 2EYWA 2EIFA 2W63A 3CCEQ 4N4IA 2DD4A 2ACZA 2VUBA 2ZM8A 2FJBA 2RJEA 2BKDN 3VUBA 4L0RA 2JVVA 3RRCA 3LGLA 2VWFA 2KWIB 1M9SA 2K3XA 2IPOB 1VYVA 3H3MA 2DZCA 3L2VA 4DO0A 2BTTA 1OXZA 4P0BA 2JW4A 2KYBA 1WJRA 1M7KA 4J9FA 1KK7A 2PU9B 3SWHA 3O9XA 1JB0E 4KGVB 4IUUA 1VQKA 2LQKA 3EHZA 4QQDA 1JJ2P 4JS5A 4FSSA 1Y64B 3HA4A 3X24B 2Q9QC 2LSYA 2K9AA 1B3QA 1FYNA 2XG8D 1WLPB 1O75A 3A8LB 5CKHA 1K4US 5FL1A 3I56T 2V1RA 2BE7D 3E08A 3EGDA 1EZZB 2HSEB 1KJWA 1R8OB 2FVUA 1KF6A 2OTJA 2HN1A 1J1JA 4IDPA 2PZ1A 5GAMd 3C50A 3O1JA 1RI0A 1IZNB 1Q81C 5HCJA 3JC6D 1FX7A 5ETWA 1MV3A 2I6HA 5JDFA 1XQHA 3OBVE 3FIFA 3FRNA 4BE1A 3B13A 4J9BA 2XSAA 2MPXC 4HEAA 2OI3A 4F16A 2H7OA 3BQKA 4FCYA 2H3EB 2OV9A 4JEUB 1MIWA 1MMGA 3CWZB 4XAXB 1TUGB 2A37A 4K11A 4EPCA 1IBKT 2JS0A 4B6XA 4JI3T 4BAYB 4FW1A 3EGXA 2BE9B 4M7DE 2ECZA 2LKHA 4A4KA 1LPLA 5KE3A 2WB5A 2VB6A 3PJAJ 1K73U 3QK6A 4F7UE 3RKOA 3TREA 4OYKA 3CXCA 3VRBA 4H9SE 2JTEA 2M67A 5C6SA 3O8VA 2PQWA 5FWBA 2V6XA 3P8HA 5EK4A 1BIBA 2KBTA 1KIKA 3PT9A 4OK0A 1YCSB 3UPUA 4J9IA 2DBMA 1BCMA 1Y0MA 2JQQA 3OYHA 3PUYF 1IGUA 2W0GA 2CKKA 2NUZA 5L8RE 2ZM0A 4M75C 2D0TA 2K24A 2DNUA 3CCVA 1KC8R 3I56A 2ODUA 5LJ3j 4A4GA 4AKHA 1SHZC 3UQ4A 1RAFB 1VQ8T 1WIEA 2GF7A 5KYXA 3EG9A 3M0UA 3PIPA 3VYGA 4XTZA 4RKUE 1UUEA 1BCOA 1KQSS 3G4ST 3PGGA 1ZBJA 3OYJA 1H92A 5GAMg 1ZOYA 1E6HA 2YKSA 1PKSA 2RK2A 4CC3A 3AHUA 4A54A 5LG3A 5GANj 2CP7A 3IBPA 3ONLC 3RKGA 2YINA 3G6EA 4QH5A 1KD1U 5AFUL 5GAOp 3LDQB 3AE6A 3KV5A 4OB2B 1HG2A 3UUMA 4FYVB 5LJ5e 3RHWA 3JCMc 4L9IA 4C92E 3ZCJA 2XIDA 4PJOB 1IAPA 5EK2A 4IUVA 2KT9A 4RCBA 1S72T 2DEUA 1IJ6A 1SA0E 5HK3A 3O4XE 4RTUA 3JB9G 5KCOA 3ZPOA 3M54A 5GAMh 1VQ5T 1DU2A 1ZUUA 1UX4A 1D0YA 3PU3A 2CM0A 4NUVA 3PTAA 4M77D 4QQ6A 2XDDA 4DR6T 2PUOB 3SS1A 2LM9A 1YN8A 2V8SV 4HWCA 1X2KA 1Y07A 3QB5A 2X3XD 4X20E 3OYIA 1TSFA 4ZI3C 4AKIA 2KXCA 3H0IA 1G83A 4UV9B 2CPTA 1QCFA 5HEJA 2JNGA 2LNVA 2KSRA 4XTYA 2CMRA 3CCJQ 3KINB 2WSCE 2LRKA 3NRYA 2CWOA 4JRIA 2JQ9A 2DIGA 2P4TA 3L2UA 4YTNA 5LYJE 2HZYA 1FEWA 1AT1B 2CP6A 2KRMA 4BDZA 5AQVB 1G3WA 2A3LA 2BG9B 2XAHB 2FRYA 2RI3A 4J6YA 2LQ8A 3CMAA 3C4WA 3BDUA 4X62T 5CCAA 5GAN2 2DX1A 2X0LB 1D3BB 4EIKA 5FLXE 3RMQA 4E7ZA 2X9HA 1YJ9T 2C5KT 1MGQA 1M1KU 5FXWA 1PD0A 2CH4W 3AE7A 5AQFB 2YLCA 3V8LA 3VJPA 2V8IA 3UA6A 3CCUQ 1HX1B 5IYZE 4ILBA 2P0KA 4JJBA 5JR9C 5AQGB 1VQ4T 2KWHA 3L2WA 1VQ9T 2N9DA 2AK5A 3OYGA 1N27A 4TZ4C 4B3ST 1VQ6A 1VIFA 2COWA 4OGCA 5ABGA 1YCYA 4XTVA 2DBKA 3P8DA 3S3MA 4CXXA 1UFFA 1VQ5A 3UULA 3RYHE 2VXEA 1IHWA 2H8HA 1K8AU 4QWNB 3M55A 1YHQQ 3I9YA 1SEMA 1TOVA 3H0HA 4DEXA 1OX8A 3ZMZB 2EGEA 4EEDA 2I2LA 3CCSQ 2ZPHB 5FW9A 3OQ5A 4DOVA 2E12A 2E6ZA 3UFGA 2CH4A 1RAEB 3UU3A 2E41A 1XWMA 3FZLB 1P92A 4M7DF 3OYEA 3OYNA 4OHFA 2C5JA 3BDLA 4DV7T 1VQOT 5HXSA 4KHPT 2RQVA 4F7UF 2RNAA 3RBBB 2BBJA 1GCQA 1UECA 1YD8G 4JJNK 1YJ9A 3OYXA 4ZI2C 1ZBXA 1EFNA 3CMET 2K5FA 2L9QA 1VQ4A 4JI5T 1VQ9A 3RIAA 5KYUA 5IH2A 3I35A 2EHOC 4CXYA 2CS7A 3LK2B 3M58A 4M7DB 1XDPA 2KY9A 1LNXA 2E6NA 2BZYA 2LTOA 2BZ8A 4LD6A 1E7OA 2RHXA 3OSVA 2XAQB 2D1XA 2DWKA 3ZMVB 3NFCA 2ES0A 3ZKRA 3PJAA 2DHRA 2M0OA 1AVZC 4F7UB 2BKPA 1LJOA 4J83A 1G73A 3NBXX 1HK9A 2RI5A 2BS3A 1EZ3A 4CI1B 1AJ3A 1AWXA 5C0MA 5HYAA 5IXBA 2PFVA 5CIUA 2XAJB 2F69A 4ISSA 4CI2B 4DEYA 4DV0T 4CI0C 3CC7Q 5GAN6 4TUYE 1ZHCA 3DB4A 2XQ5A 4GLKA 4JUVA 2XKOC 2A3DA 3CBPA 3U3IA 5KH6A 4B3TT 4OX9T 1AZGB 1VQOA 2H88A 2DKGA 2CZ6B 5A0LA 3ZLIA 3OW2S 3B57A 1RL2A 4X1VA 5JDQA 4C92F 4H9PC 2OX7A 5GAOl 3L8RA 3BE3A 4H63H 1W0AA 1FIOA 4II1A 3UT1A 4N78D 1Q81R 3CC2Q 3LH5A 2CZ7B 1UGVA 2YT6A 4GY5A 3KUFA 4C8QA 4HFHA 3CMEA 1HG5A 2XHEB 3RPUA 4ZGJB 5LJ5d 4XU0A 1S94A 1U1TA 2MOZA 4NXNT 5ADXL 4C0GA 3V5UA 4RMOA 2FPEA 3OSSC 3NWIA 4EZ4A 2Y90A 3CVRA 2RH2A 2QG9B 2DJZA 3EABA 3QJYA 5KMGP 2DL8A 2CEAA 2WP9A 2C5IT 4C92B 4DR5T 3FJPA 5FXXA 3OS2A 5GONE 1SRMA 2VKOA 3PNWC 5LP6E 1KQSP 1WRDA 4ANJA 5I11A 1B7TA 3H9NA 1UGPB 3RF1A 2B8AA 4RG8A 2SPCA 3ZN0B 1NZ9A 5FRMA 2G6FX 2K5BB 2QGSA 4P1NA 3AVSA 3JCMb 2QQ9A 2E9XB 4FYXB 2WCAA 4Z89A 2YWWA 1GRIA 1HYOA 2FB7A 3I9WA 3MK7C 4B3RT 1T98A 2D8JA 2L5QA 5KYWB 5L4EA 3LGFA 2BBHA 1WXUA 1QVGA 1D1BA 1VCSA 2LP5A 4EYYR 3JV3A 2M51A 2NUPA 5AYFA 1UCUA 3T1HT 4DMVA 5GMKj 3JC6C 3N2KE 5HWYA 1W70A 3QIIA 2BKOA 4LFAT 2K4YA 2ZZDA 2W2UA 2DJQA 2XTLA 4BUGA 1YITT 1WR0A 2GGRA 4Z88A 5C3JA 4DR1T 1K9MR 5JREA 2X9XA 5LJ5g 2GBQA 3GNGA 2DYIA 1K0SA 4DNDA 2KRSA 3OS5A 1JEGA 2HKNA 2RHZA 3PIOA 4M75G 3N9OA 2W4XA 3X25B 4ZI7E 3QUJA 1IHVA 1QWFA 2HHHT 3E9GA 3AEBA 4MMLA 1WQWA 2F2WA 3K3NA 4IIOA 4J7IA 2YSQA 4J9CA 1XMOT 5LCYA 5JDNA 3AB3B 4TVRA 2EQIA 4JI0T 4PJMA 5HXRA 3SWNC 4C0ZA 4PJOD 1PCXA 4IIJE 3QNUA 2QEXT 5JDMA 3UATA 1HSQA 5LJ5h 3EGDB 2XJ7A 4A5XA 2ED0A 3T9NA 2EYQA 2CRBA 3HKEE 2F2XA 3QC9A 5GAN8 2DILA 2HQXA 2FPDA 2X51A 4HFDA 1OEDC 1VQLT 2NTYA 5I22A 1N5ZA 3UT5E 3VHLA 1X9BA 3QYGB 2JT4A 5FVLA 3JCMW 2RPNA 3CCQQ 4I4TE 1YITA 2P84A 1HX8A 1B34A 3OYBA 2K79A 3REBB 2L3SA 3QXEB 5I21A 3EGXB 3QB5K 2V5DA 1D0ZA 1M90U 4EEBA 4J9GA 1Q86U 2CUDA 1K73C 1QKXA 4EIWA 1VCTA 1IZ6A 1IBMT 5FROA 4Y92A 2KK4A 4QH1A 1U3OA 2LHNA 1NEGA 3EG2A 5AQSB 3UQ7A 1KSWA 1RAIB 3JCMf 3CCRT 2JM8A 2NTXA 1VQ7T 3J7AF 1CKAA 2BIVA 4BE0A 2JZ2A 2YOEA 1HXDA 3N9MA 4O5VA 1W4SA 2DL3A 1KFZA 4O2AE 4IE6A 2QEXA 2LOPA 1QMCA 1XZYA 1A0NB 2X0HA 4DBQA 1QCNA 3AEFA 4LMLA 4M77C 3E9FA 1Z8UA 4Y91A 2DTHA 3HFOA 5KYXB 1V76A 3EG9B 2RJDA 2A28A 3KV9A 3AEGA 5FL0A 4AQFC 1PM3A 3L3PA 4O8SA 3J80E 4PLLA 1VQLA 5FY0A 4OYJA 3F31A 3WVEB 4OF1A 3OYFA 3K8PC 1YWPA 4AG2C 4C8QE 3Q9DA 1O9SA 1VQPQ 2WS3A 4KMCA 3KBGA 2HDAA 1WHMA 1NJIU 4CQIA 3VUZA 1ZX6A 2VKHA 4DV2T 3AAAB 4JRQA 1WX6A 4UVCB 1YJWT 4JEHB 4DR4T 2EJGA 2MMPA 3OTOT 2PUKB 4LD9K 2JTMA 5IHKA 3UUNA 1T7SA 2H3RA 4KULA 5D7UA 1PNJA 3AE3A 1YQ3A 2HNIA 4TV8E 4E6RA 2E8IA 4YTLA 3MZKB 4JLGA 2CSQA 3MACA 3DB3A 3TCJA 3ZJ2A 3FZMB 5BMVE 3CCMQ 4HT8A 3CCRA 3ZEFB 3EGUA 1G2BA 1S1NA 2YN6A 1KNRA 1NPRA 4HTEA 4EV6A 1HF8A 4IDZA 4U31A 1G3SA 2ZGWA 2V7KA 2EYXA 4OMQA 2CWYA 2PJQA 1XNQT 3RC3A 2F5KA 4XTXA 5CKBA 3L1AA 1T0HA 3OW2P 3D7SB 4EGWA 5C2TA 2XDBA 4M7AA 3V8JA 1U4QA 2GQVA 4M7DD 4H9NC 2BKNA 4KGXB 1GFCA 4NXMT 2V6YA 2K6DA 1HNWT 3CXCS 3PUWF 2KSSA 5ABEA 2FZKB 2QGGA 3MEWA 3SFMA 3NZPA 3ZSSA 4HVUA 5LB7B 5L3DB 2IHR1 3RGLA 2PTFA 4AFUC 3GNFB 3CPWA 4HFBA 3RYCE 2LQWA 2R58A 3CQTA 4ME7A 2QA4T 1M1KC 1NBEB 1KQ2A 2YUQA 1WXTA 4OP0A 2QXFA 3AA0B 3ZMUB 1JBMA 4Q5WA 2BVLA 1M5Q1 1K9AA 5CKDA 2WY2A 1TUCA 1W09A 2QI2A 3CCLT 1I1JA 5GAMj 4C5GA 1DJ7B 2P0QA 4AXPA 2VASA 2I0MA 3UTKA 4WYVA 1K8AC 2EJFA 2W61A 2X4YA 3G71Q 4PJJA 2CYZB 5L3GB 4R56A 3CQXC 3P4RA 3M0QA 4HGAA 4NUUA 4QKNA 2L89A 1M1FA 3PMTA 3NTHA 1SKUB 4FT4A 2D0QB 2EJ9A 4PNOA 2LJ0A 2LJLA 2DXCA 3QZ9B 4C92D 5GMKm 4B9XA 1Y71A 3OYMA 4Z91A 3M57A 4M78A 3NVOA 2RO0A 4IE7A 2W62A 2UUCT 3QG1A 1C0MA 2P9BA 3AA6B 3CBMA 4DVDA 4WNKA 4YJ2E 2X4JA 2ED1A 1YIJQ 1VQNQ 2GCXA 3PU8A 1QQJA 2CT3A 3CCVQ 4EDUA 2J05A 4YHJA 4AFZC 3O5ZA 1UHFA 4GIWA 2IIUA 2CP3A 4FU6A 3MCAB 1LOJA 4XU2A 3QZ5B 1NM7A 4C0FA 2KR3A 3NTKA 2I59A 2LC4A 4ZXLA 5KYUB 5HAXA 2EPDA 2JMAA 2KVQG 4LMKA 1QP3A 1D0XA 1VOMA 2IUBA 1TWBA 2CP2A 1JQQA 3CC4T 2KXDA 4PJLA 2VQFT 2VYTA 1H641 3G6EQ 2WSFE 4IURA 4O4HE 2LLYA 3V7SA 1JXMA 4C8QF 3KFWX 3ZMTB 2B1EA 2X4XA 2K2VA 2AHJB 3OA6A 4A4FA 4V2SA 2MPKA 1AWJA 4HVVA 3ZEHA 5M9OA 3TSWA 1BI0A 1KHIA 1XJWB 2WSSV 2FUPA 2ACXA 2A2FX 3AE5A 2LJ1A 2O01E 4QVCA 4K0KT 2CBJA 1N36T 1Y7XA 2XM2A 2MCNA 2GTJA 1UGQB 4P0AA 4KHZF 4ESRA 5AQNB 4A53A 2H89A 3R6NA 5E0OA 3H37A 4ERRA 3H8ZA 4ZHQE 4LDWA 3GP8A 2EAYA 4C8QB 3I55A 2HL5C 1RABB 3NKZA 1Q7YR 3QYHB 4U74A 2PBIA 5GAN4 4DQ2A 2DVJA 2JJ9A 1W6XA 1QKWA 3LH0A 1X01A 3M4GA 2WDRA 4GOUA 3J9X1 2ESWA 3HKSA 5AQMB 3BK9A 3CCET 3H3AA 2KROA 1C1AA 3CC4A 4RUGA 2Y6XA 2JS2A 2LT4A 2XQ4A 1HNZT 1WGSA 2FL7A 3CMAQ 4M7AE 4ELYC 1BR0A 2MBGA 4GK5E 5J26A 4JZ4A 1WA7A 2RQTA 4IUTA 2IAKA 1TUDA 5DM7R 4PFZA 1Q7YU 3HHTB 3C4ZA 4CXWA 2YLBA 2AE9A 1IJ5A 3TQ7P 2JQHA 1BU1A 5J2TE 4KUDK 2NW7A 2VWAA 2F4VT 3SWNA 2CZ1B 1X27A 2V8JA 5DY9A 6AT1B 1YJNT 2FPFA 3PUZF 1MMAA 2KGTA 4PJOC 3TLTA 4OB1B 2OA5A 2WDQA 1VQ6Q 3MEVA 2E5VA 2WSEE 2P0PA 2QASA 4IKFA 2DE0X 2COYA 2EFIA 3S6WA 2V26A 4LE9A 1QSDA 2DL7A 1U06A 2MK5A 3WXMB 3Q5EA 2MF2A 4E2FB 2NUPB 3SEMA 3OYCA 4ZNXA 2LRLA 2OAUA 2L3PA 3UWNA 1KNZA 1MMDA 5D6XA 1VQMT 2YK0A 2RD1A 4ZGDB 1I07A 3VS2A 5LNKA 4A97A 1KC8U 2J6OA 1M3BA 3EDVA 4P5NA 4JI6T 3DKMA 2VC8A 4DR7T 3PUVF 1AD5A 3EHRA 2NW8A 3PUGA 1L0VA 5AQRB 4TWDA 1BIAA 3L2ZA 2FBWA 3S3OA 4M77G 4C5IA 2ZPFB 4WW0A 3CXCP 2BG9C 4N0AC 3VS7A 5GJWB 3HKDE 5J2UE 1IB8A 2SRCA 4LF6T 2XICA 3SHWA 4KGZB 4D6WA 3T8OA 5F3JA 2X66A 3FB2A 4DBHA 5HK0A 2LQNA 4X1YE 4M78E 4LXCA 1FJGT 1YJNA 3MP8A 2GNCA 1GQEA 3AVRA 1AHJB 1M2VA 1VQ8A 1IBLT 2WAUA 4PLIA 1QUUA 1N8RR 2ROLA 2XM1A 3EG3A 5CK9A 4LN2A 3IA3A 1WHGA 4XQ3A 2J4GA 1N9SA 4EXTA 3G4SA 3ZJ1A 2BS4A 2WDVA 2QDLA 3HRTA 4MHCA 2HEQA 4IHJE 4X9CA 1VQMA 2A72A 5FU7B 2MYSA 2QAZA 1M90C 1B34B 5AQIB 3I0QA 4YXDA 2RB6A 3HSBA 2D9DA 1Q86C 2KNDA 2X9WA 3AA1B 4UVBB 4PFPA 1PC0A 2VXFA 2E1HA 3HRSA 4UF0A 1ZSZA 2LJ3A 4ILAA 2ZLYA 2JMHA 1BI2A 3OJAA 5LJ3f 2MWPA 2E10A 1QVGS 3TLWA 1S72A 2VQET 3WAKA 2HD0A 1G3YA 4E7SA 3ZN1B 4JI8T 3EFSA 4CI3B 5CKFA 3S3NA 4XTUA 2PVOB 5LJ5j 2D0NA 3PTRB 5JQGE 4QX8B 2CSIA 2NUTA 1ZSGA 3EAEA 3LW5E 2RQUA 4DBRA 1MIYA 3CD6Q 5GANf 2RQRA 4OMFB 3ZFJA 1YKHB 2OTLQ 2KQWA 5AQTB 1WHKA 2HQEA 1I81A 3VRYA 3A1PA 3DLMA 5DLQE 1E1HB 2VKDA 2KDSA 5LGUB 4IIMA 3E22E 5KYNA 4EMKA 1NJIC 4DMWA 4CC7A 3C95A 4ZN3A 3FDRA 1TG0A 4MBQA 2BZBA 2QVAA 1FMVA 4NIQA 5J1GA 4X1KE 5D6WA 1QVFA 3RIUA 3FZKB 4AIUA 4M7AF 4B3MT 4H63V 5L2LA 4HWHA 2LM2A 4HXJA 2M02A 3ASKA 2DL1A 2CHOA 5D6YA 4XZCA 2XZEA 1HTJF 2QTXA 2XDPA 2YUOA 4FYYB 5IHNA 3VYHB 1BK2A 4QXHB 3Q1JA 4ZTFA 3ZC1A 1R0CB 2OJ2A 3KBTA 1BR4A 3P4WA 4GBQA 1KEYA 2ZAEA 3CCUT 5FVKA 4NL2A 1NYGA 1LKXA 2YDRA 2HMAA 3CK6A 3ETVA 2V5CA 1AWOA 4PL6A 4Z02A 3AECA 4OGEA 1RADB 4YSZA 4M7AB 3THKA 4OMPA 3JB9H 3DP7A 2P4RA 4C91A 3ONJA 3N9QA 3KBUA 2KE9A 1OU9A 2BS2A 3JRZA 1D1AA 4LMJA 2GK9A 2V6YB 4HWFA 4U2YA 4LF7T 1M30A 4O4JE 3JADA 3CCST 3OYZA 3UU4A 5J0ZA 3H41A 3ZC0A 3HKCE 3K3OA 4DV1T 2VV5A 4J7FA 3PUSA 4C0DB 4C92C 5H6QB 2RJCA 3GBQA 1RACB 4E7KA 5KE2A 1N9RA 4TWFA 1TTHB 2CXFA 5GAN3 2W00A 4L6V5 2JMKA 1YI2T 4XU3A 1E7PA 3JCMe 5AQOB 1ABOA 3M3ZB 1RLQC 3M4YA 3TLUA 3NGPA 3GA8A 2E9XC 5LG4A 1V9DA 2FZCB 2V1QA 2D6FA 2YEVC 4M78F 3QWYA 1WFDA 4IDOA 2NWBA 3IHRA 3EAMA 3P4SA 4I50E 4C8QD 3C98B 1OEBA 3OYYA 1RAGB 4BE2A 3S4UA 1PRMC 2CUBA 3LJCA 3PDYA 3AA7B 3WI3A 1Q81U 2LHRA 3GLXA 1VUBA 1ARKA 3MKDA 1OPKA 2EYZA 2G3RA 3IQLA 4M77E 4WCIA 5GAOm 4ATOA 3UF4A 1HCIA 4TNWA 4ZZBA 5J3BA 4YJ3E 2HQHA 3NZQA 2RHIA 1U5SA 3QHSA 3E0ZA 3CCSA 5AQUB 3JAFA 1JNRA 2Q9QA 1YBYA 2ZPEB 1IREB 3E19A 1H3HA 3O1IA 4M78B 4ASKA 1YQ4A 4H9RC 1JXOA 3VKGA 2A9UA 2LSIA 5LHGB 3OS0A 4VUBA 4FL6A 1CHUA 4WF2A 3SD4A 3CC7T 5JDGA 2MWOA 5HCMA 2GQIA 3AEDA 1YI2A 2KNBB 4FI5A 2K3YA 3FBZA 3TSZA 2YRDA 4C5EA 5FP3A 1TU0B 3TU4K 2BUDA 4WTOB 1SSHA 3CC2T 3FEOA 1IO6A 2XUEA 2B86A 2WZHA 3RMSA 5LOVE 2O2OA 3KVBA 2LSKA 5JVDE 2LZ6B 1AOJA 3JSCA 3CPWS 5A0GA 3PV0F 1ZP0A 3FC3A 3QKJA 2KYMA 2LT1A 4EOZB 1MNDA 4N4GA 2ZPBB 4PJOG 4XU1A 2UXBT 1M2OA 2HSPA 3M53A 4OMNA 2XHCA 4HCCA 2DWGA 1QCOA 1G8XA 1X43A 2KT8A 4QW2A 3RQWA 2KAFA 4BB7A 3FB9A 1K9MU 3EI0A 4WZXA 3EDUA 5GAN5 2DLRA 3ZT6A 5JRCA 3ZT7A 5GAOq 2UUAT 4M75A 2KMFA 4AI6A 1XTDA 7AT1B 3CC7A 4C90A 2EGAA 5DABA 1G3TA 2QQAA 1X79A 1QVGP 4EYUA 3ZYLA 3UDCA 3PUXF 4CC4B 2WU5A 3UA7A 2MOXA 1UGSB 1UJ0A 5LA6E 3UUBA 2J6KA 2EBPA 4LF9T 2RMOA 2DEQA 4IUPA 4YHHT 3CC2A 2BVMA 3KXTA 3M0TA 1WNLA 3HL6A 3MXZA 4LF4T 3A8YC 1WDXA 4FJOA 3RUXA 4HVWA 1PHTA 2YUNA 1WYBA 1ZV4X 1SSFA 2DFUA 5LMNT 1X6BA 2RHUA 1TS9A 1B07A 2VKNA 2CREA 4AQYT 2D5UA 5ECAA 4BY6B 3L2QA 4JLEA 2JM9A 5FNVE 1WJSA 1MNEA 4YSYA 5CO7A 1CUNA 3K3QC 2O88A 5HXHA 2XAFB 2HCKA 4I0UA 2CT4A 5DJQC 2X3WD 5I2MA 3A8OB 4U72A 4U7YA 4UEMA 2V7IA 3SWNB 4GK0E 4GYSA 2KRNA 1N34T 5IHIA 3HI2A 5HCKA 1X6GA 2J6FA 2JXBA 1BYMA 2O31A 4IDQA 4PW8A 2IIMA 4RTWA 1NE8A 4PK5A 3I0OA 2QQBA 4ZTJA 3CPFA 2C06A 2DM1A 1OQKA 1BB9A 1V1CA 1T0JA 3SDZA 3A8GB 4F14A 1V29B 2IG0A 5HEHA 4RTXA 3GWHA 2O9VA 2YDQA 3BQLA 5HKCA 2L3LA 3JCMd 4P09A 1TH7A 1KD1C 1KC8C 3O1HA 1I6ZA 1Q82R 4EAHA 2D8HA 2YRCA 4BI3A 5F8PA 2ENMA 2JTFA 3NRXA 3MEUA 5CKEA 2CLYB 1J5WA 3CCQT 1HR0T 4AMCA 5AQQB 2ZPGB 4M77F 3JCFA 5DLOA 4AKRB 2BZXA 5JDLA 1AZEA 1WHJA 4I43B 2DL4A 4LUEA 3JB9F 3GN5A 2GFUA 4MFRA 4JJCA 3JCMV 2D0UA 2DMOA 3VS1A 5JR9A 2QQSA 3OB9A 3NPFA 3OYAA 2C0TA 1VQ7A 3ABVA 3VS6A 3P4PA 4M7DG 2QQRA 1WPYA 2LSGA 2OAWA 3JCMP 2RM4A 1C6VX 4CN4A 3Q2MA 2IVWA 3B5MA 4ZS3A 2CA5A 3K1SA 2Z0WA 3HP9A 2NWMA 4F7UG 1QLBA 5C8YE 4J5YA 4BDYA 2FZGB 4YFSA 3BFMA 3NHNA 8ATCB 5LJNA 1M2VB 4XK8E 3OY9A 3DTOA 3MA9A 1ZHIA 2EQJA 3VS5A 1LRZA 2DO3A 5AQHB 3J81E 2KEAA 4M7AD 4WBOA 4DV6T 4RTYA 3VS4A 1CKBA 4J6XA 4J9DA 1N33T 1VQKQ 1RAAB 1UDLA 1N32T 5FY1A 1OWAA 1Q82U 1UUSA 4RTVA 4IE0A 2MAMA 4RTZA 4M1PA 1QW1A 3JCMg 3JAME 2DTOA 5IXFA 1YJWA 1VQPT 3ULRB 3CCQA 5LHIB 4UF0B 4EB6E 1KNPA 1ZSZB 4OB3B 1HNXT 1J5ET 2JN0A 2N2NA 2UXCT 2OTJQ 3PURA 2JMCA 5IUXA 2AZVA 2R5AA 1T3LA 4HFCA 5CGMA 1OZ2A 1VA7A 2RPAA 4JPBW 3OMGA 3EVYA 2EHOA 4AISA 4E7HA 1GCQC 4HCBA 1XNIA 3I55Q 3CCMT 2RP4A 4ZI2D 2NUTB 1YW0A 2V8KA 3UUXB 4BD3A 1H8KA 2UXXB 4C92G 1YWOA 3JCMh 3V7RA 4M75E 3X20B 5KYYA 2F1LA 2JRKA 2PVDB 2EVRA 3FJ5A 2VKJA 5LBQB 3CC4Q 5ABHA 4JS4A 2LRQA 5GMKh 3C4XA 2LKGA 2UU9T 1X75C 3UFEA 4CN1A 5DQVA 1M3AA 4MLKA 4EMKB 3V5SA 2EQUA 3L39A 2AKKA 5KXJA 4JJDA 3N2OA 2CCQA 2D9TA 2J47A 3QDFA 5FKYA 3CPWP 4CC2A 3AXJA 2COZA 4DOWA 2QA4A 3LBXA 2QA7A 1VQPA 3P8BB 1JJ2A 3T1YT 4M78D 3I56Q 3X28B 5L4HA 2V7LA 2XASB 1I8FA 5L3CB 3CCLA 1GXIE 3RERA 4KUIA 4KH1B 2E9XA 2LCCA 3VR9A 5LGNB 1MIVA 3RNJA 4MZPA 4NL3A 3A5XA 2MI6A 4LF8T 3RIRA 3HTRA 3Q5XA 2E64A 3CCMA 4J9EA 2C0IA 4JRPA 1KHCA 3KV6A 2X67A 3G71T 2R57A 4C8QC 4PKCC 1M8VA 2PNIA 1LVFA 2RN8A 5HY6A 1UG1A 5LJMA 1FMKA 1Q95G 1E2AA 3RR6A 3ZT5A 4LDXA 5L23A 5GAMf 4JV5T 1NENA 2XK0A 1SE7A 1Z0PA 3QJ6A 4RCCA 3LWHA 4CZZB 1R8IA 2KT1A 5FU6B 1BR2A 5LJ3e 2XSBA 4X9DA 4QQGA 4IUQA 2NR4A 4FW2A 1T3SA 2LDMA 1YJNQ 1HFAA 2YU1A 3CQCB 3IF8B 2YXYA 5FWCA 2DVEA 1W0BA 1VQ8Q 1YIJT 2DTIA 5GMKi 1VQNT 5EC7A 5M4YA 3CCVT 3PE0A 4X5TA 2VVKA 4HCZA 5GAOr 2ZM6T 3H0FA 4FSXA 5GANe 9ATCB 3G4SQ 3CX6B 1CSKA 2H3JA 2NOXA 1QVFS 2FG0A 4IL4A 1K73R 1ZEEA 4QH4A 1VQMQ 3G71A 2LVMA 1QWEA 3AT1B 2NW9A 2DD5A 3HL8A 3ER0A 4Y28E 1FXXA 3GIBA 3AEEA 3VRAA 1MMNA 2UXNB 4H9QC 3N5LA 5CR2A 3G6ET 4OVAA 5L3EB 1T8BA 2HPLA 1OU8A 4ZOLE 1S72Q 1WHLA 5GAOn 2DETA 2Q9QB 3J7Yq 1LVKA 2A08A 3A98A 4KUMB 1PD1A 2LNHB 2K3WA 3AE2A 4QHOA 2C0OA 1NYFA 2HBWA 4D8KA 1VQ5Q 2DLPA 4ISTA 1NG2A 5J39A 3FZHB 1RAHB 2E5QA 2J7IA 2DF6A 2E65A 4UV8B 4AFSC
chains in the Genus database with same CATH topology
4F17A 4HKAA 5GJVB 1PWTA 4MALA 2O9SA 2KLQA 2DNXA 3PUAA 4G63A 1NEBA 4AQGA 3RYFE 4XBFB 2M0YA 2DYBA 2F2VA 3DJBA 3ZYKA 4OMLA 3ANWA 3KDSE 4PK6A 4A63B 1RUWA 3W15B 4OMMA 1ZLMA 5JRCB 5A1LA 4X1IE 4KRTA 2YU2A 1OOTA 1UJYA 2ZM2A 4HFVA 4AQFA 1S35A 4GYRA 2Z6EA 3AAIA 3RX6A 3M65A 1UTIA 4TV9E 5CA0E 1US7B 3GMIA 3IEEA 1NLPC 5FXZA 1Y57A 3RRWA 2K3BA 4F6RC 2XQYA 1XOVA 1HD3A 2J1DG 4ORZA 3SRZA 4AKGA 4UXNB 4IE4A 3L09A 4ZS2A 2FEIA 5LBMA 1VYTA 4K0UA 1SRLA 1HS7A 2ODVA 3FBLA 2BDEA 3VS0A 2K2MA 3C51A 3I5SA 2VL8A 1PKTA 2PG8A 5KDMC 1AEYA 4O4IE 1NWMX 5H6RB 3TKLB 4HE8A 4LUDA 1D1CA 5DQWA 2X68A 4QX7B 1LCKA 2EKHA 5CB4E 4UVAB 2IC6A 2AZSA 3CQGB 2EW3A 2WBLA 3GN5B 1WYXA 1GFDA 5JR9B 3ZYMA 3KV4A 1M8MA 3EHQA 1NAFA 4A56A 4BJMA 3FXDB 2AKLA 1ZKEA 2L3QA 3EUHA 4PJNA 4BJNA 2DRKA 3ETUA 4I55E 2W0ZA 2KINB 3U78A 1SHGA 4AG1C 2VK9A 1QLYA 2X9YA 3CPZA 2Y48B 3ZMSB 1GBRA 5L3BB 3D0TA 3RH3A 4M4ZA 4AKLA 1U5PA 3LFMA 1OV3A 1H7CA 3TVTA 3FXEB 3I1AA 2LOSA 1BR1A 4J9HA 4IGUA 5LGTB 5IHYA 2V7JA 2CE7A 2EHOB 1M3CA 4LNPA 3VRZA 2V1DB 2N1GA 2NP9A 4OFZA 1I0CA 1BBZA 4ADZA 1GBQA 3CKDA 4YLHA 2W10A 2K9GA 2LE8A 3LG7A 4PFOA 1RI9A 2WWUA 2XMFA 1ZUYA 1K0XA 3I9QA 2I0NA 4D8DA 3QWXX 2CDTA 5HXEA 1YKEB 3LK42 3M0PA 4Z8AA 3LBXB 4O2BE 1ZUKA 2Q9QD 4RTTA 3C0CA 2SEMA 2RA1A 3WAJA 1MV0B 4JZ3A 5LXTE 1JO8A 2L8KA 2EGCA 3ESLA 1K76A 4EZHA 1X69A 4ILUA 4R0KA 2LMJA 1UX5A 2IW5B 5FY7A 4KBMB 4Z8XA 3N2GE 3N9LA 4TX5A 3OKQA 2A36A 2GTOA 1WR6A 5FMNA 4KP3C 4QXCB 2LT3A 3R84B 2K48A 3NMZC 3HKBE 2WMNA 2WM9A 2DRMA 2DI4A 1YP5A 3F2EA 2LSJA 1YNZA 4AFQC 1UHCA 4JUYA 2CXDA 3N9NA 3VU7H 3KFVA 2KXPB 3KVAA 1WLXA 2G0UA 2L2PA 1AWWA 4IE5A 1VYUA 2CLYC 3VS3A 4BA9A 1OPLA 3ZL7C 2WMOA 3REAB 1Z9ZA 3SOLA 1MUZA 2ABLA 4HCKA 2J06A 2DCFA 2HPJA 4UIGA 5HWXA 1SHFA 2C0SA 2LEHA 4ZI3D 3F57A 4PAGA 4O4LE 2PTKA 2ZMAA 2IC9A 3HR0A 2H7VC 5TAOA 2E5KA 1M27C 5EZYE 5CA1E 4H9OC 1NLOC 3CX8B 4QXBB 1Z9QA 2YDLA 1UE9A 2YUPA 3M0RA 3PUQA 3ANWB 3FHNA 2Y8DA 3PVQA 5LHHB 3P8CD 3EG0A 3CMLA 1WXBA 2FO0A 1FMWA 2EYYA 2RF0A 2L0AA 1WI7A 4PNIA 2LCSA 1W1FA 3CX7B 3P7IA 5L3FB 2V7MA 3M0SA 5KX5E 5FXVA 1ABQA 3I5RA 1GL5A 1WYCA 3RYIE 4UELA 3VKHA 3PVLA 5JDHA 2DA9A 3ONXA 1GCPA 4QT7A 4V1Av 2HH7A 2CXLA 2DL5A 4G2AA 4J2CA 4GLMA 3RC8A 3N9PA 2EHOD 3LK3B 3EG1A 1HJDA 2LX7A 2RQWA 3BQIA 3AAEB 3C64A 1E6GA 3MJXA 1X2QA 1O3XA 1WFWA 4WBNE 5EK3A 5FYMA 2JPFA 4L5GA 1SPKA 1RLPC 3ZCIA 1VRBA 4PK4A 2FRWA 5JH7E 3Q5WA 2KZ7B 2ROTA 1J3TA 2XAGB 2D2SA 2K7AA 4HN9A 1PRLC 1JU5C 4OMOA 2MTQA 4TN7B 5HXCA 3U23A 2E9XD 1K1ZA 2MIOA 2EYWA 2W63A 2ZM8A 4L0RA 3RRCA 2VWFA 2KWIB 1VYVA 4DO0A 2BTTA 1OXZA 4P0BA 2JW4A 2KYBA 4J9FA 1KK7A 3SWHA 3O9XA 4FSSA 1Y64B 3HA4A 2Q9QC 2LSYA 2K9AA 1B3QA 1FYNA 1WLPB 1K4US 2V1RA 3E08A 1KJWA 2PZ1A 3C50A 3O1JA 1IZNB 3JC6D 5ETWA 1MV3A 5JDFA 3OBVE 3B13A 4J9BA 4HEAA 2OI3A 4F16A 2H7OA 3BQKA 4XAXB 4JEUB 1MIWA 1MMGA 3CWZB 2A37A 4K11A 2JS0A 4B6XA 4BAYB 2ECZA 2VB6A 3QK6A 3RKOA 4OYKA 4H9SE 2JTEA 2M67A 5FWBA 5EK4A 2KBTA 1KIKA 4OK0A 1YCSB 4J9IA 2DBMA 1Y0MA 2JQQA 2NUZA 2W0GA 2ZM0A 2D0TA 2K24A 2DNUA 2ODUA 4AKHA 1SHZC 1WIEA 3M0UA 1UUEA 1ZBJA 1H92A 1E6HA 1PKSA 4CC3A 3IBPA 2YINA 5AFUL 3KV5A 1HG2A 3UUMA 4L9IA 3ZCJA 1IAPA 5EK2A 2KT9A 1IJ6A 1SA0E 3O4XE 4RTUA 3ZPOA 1ZUUA 1UX4A 1D0YA 3PU3A 2CM0A 4NUVA 3SS1A 2LM9A 1YN8A 1X2KA 2X3XD 4X20E 4ZI3C 4AKIA 2KXCA 3H0IA 1G83A 4UV9B 1QCFA 2CMRA 3KINB 3NRYA 2CWOA 5LYJE 1FEWA 2KRMA 2FRYA 2XAHB 3C4WA 2DX1A 2X0LB 4EIKA 4E7ZA 2X9HA 2C5KT 5FXWA 2CH4W 3UA6A 5IYZE 4JJBA 5JR9C 2KWHA 2N9DA 2AK5A 4TZ4C 2DBKA 4CXXA 1UFFA 3UULA 3RYHE 2H8HA 4QWNB 3I9YA 1SEMA 3H0HA 4DEXA 3ZMZB 2EGEA 5FW9A 2CH4A 4OHFA 2C5JA 5HXSA 2RQVA 2RNAA 3RBBB 1GCQA 1UECA 1YD8G 3OYXA 4ZI2C 1EFNA 2L9QA 5IH2A 3I35A 2EHOC 4CXYA 3LK2B 2BZYA 2BZ8A 1E7OA 2XAQB 2D1XA 2DWKA 3ZMVB 2ES0A 2DHRA 1AVZC 1G73A 3NBXX 1EZ3A 4CI1B 1AJ3A 1AWXA 5IXBA 5HYAA 2PFVA 2XAJB 4ISSA 4CI2B 4DEYA 4TUYE 1ZHCA 2A3DA 3U3IA 1AZGB 3ZLIA 3B57A 4X1VA 5JDQA 4H9PC 4H63H 1FIOA 4N78D 3LH5A 1UGVA 2YT6A 1HG5A 2XHEB 3RPUA 1S94A 2MOZA 5ADXL 3V5UA 2FPEA 4EZ4A 3CVRA 5KMGP 2DL8A 2CEAA 2C5IT 5FXXA 5GONE 1SRMA 2VKOA 5LP6E 1WRDA 4ANJA 5I11A 1B7TA 2SPCA 3ZN0B 2G6FX 2K5BB 2QGSA 3AVSA 2E9XB 4Z89A 1GRIA 3I9WA 3MK7C 2D8JA 1T98A 1WXUA 1D1BA 2LP5A 4EYYR 3JV3A 2M51A 1UCUA 4DMVA 3JC6C 3N2KE 5HWYA 1W70A 2DJQA 2XTLA 2GGRA 4Z88A 5JREA 2X9XA 2GBQA 1K0SA 4DNDA 2KRSA 1JEGA 3N9OA 4ZI7E 3QUJA 1QWFA 2F2WA 3K3NA 4IIOA 2YSQA 4J9CA 5LCYA 5JDNA 3AB3B 2EQIA 4PJMA 5HXRA 4IIJE 5JDMA 3UATA 1HSQA 2ED0A 3HKEE 2F2XA 3QC9A 2DILA 2FPDA 2X51A 2NTYA 5I22A 1N5ZA 3UT5E 3VHLA 2JT4A 2RPNA 4I4TE 1HX8A 2K79A 3REBB 2L3SA 1D0ZA 4J9GA 2CUDA 1QKXA 4EIWA 4Y92A 1U3OA 2LHNA 1NEGA 3EG2A 1KSWA 2JM8A 2NTXA 1CKAA 3N9MA 2DL3A 1KFZA 4O2AE 4IE6A 2LOPA 1A0NB 4DBQA 2A28A 3KV9A 4AQFC 3L3PA 4O8SA 5FY0A 4OYJA 3F31A 3K8PC 1YWPA 4AG2C 3Q9DA 4KMCA 2HDAA 4CQIA 1ZX6A 2VKHA 3AAAB 1WX6A 4UVCB 4JEHB 5IHKA 3UUNA 2H3RA 1PNJA 4TV8E 4E6RA 2E8IA 3MZKB 2CSQA 3MACA 3ZJ2A 5BMVE 3ZEFB 3EGUA 1G2BA 1S1NA 4HTEA 1HF8A 4IDZA 2V7KA 2EYXA 4OMQA 2CWYA 2PJQA 3RC3A 1T0HA 1U4QA 4H9NC 1GFCA 2K6DA 3NZPA 4HVUA 5L3DB 4AFUC 3RYCE 2LQWA 3CQTA 2YUQA 1WXTA 3AA0B 3ZMUB 2BVLA 1K9AA 1TUCA 1I1JA 4AXPA 2VASA 3UTKA 2W61A 4PJJA 5L3GB 3CQXC 3M0QA 4HGAA 4NUUA 4QKNA 2LJ0A 2LJLA 4IE7A 2W62A 2P9BA 3AA6B 4DVDA 4WNKA 4YJ2E 2ED1A 3PU8A 2CT3A 2J05A 4YHJA 4AFZC 3O5ZA 1UHFA 4GIWA 1NM7A 2KR3A 2I59A 5HAXA 2EPDA 2JMAA 1D0XA 1VOMA 1JQQA 2KXDA 4PJLA 4O4HE 1JXMA 3KFWX 3ZMTB 2B1EA 1AWJA 4HVVA 3TSWA 2WSSV 2ACXA 2A2FX 2LJ1A 2MCNA 2GTJA 4P0AA 4ESRA 3R6NA 5E0OA 3H37A 4ERRA 4ZHQE 4U74A 2PBIA 2DVJA 2JJ9A 1W6XA 1QKWA 4GOUA 3J9X1 2ESWA 3BK9A 3H3AA 2KROA 4RUGA 2Y6XA 2JS2A 1BR0A 2MBGA 4GK5E 4JZ4A 1WA7A 2RQTA 2IAKA 1TUDA 3C4ZA 4CXWA 1IJ5A 1BU1A 5J2TE 2NW7A 2VWAA 1X27A 2FPFA 1MMAA 2KGTA 2OA5A 2DE0X 2V26A 4LE9A 1QSDA 2DL7A 1U06A 3SEMA 4ZNXA 2L3PA 1KNZA 1MMDA 2YK0A 1I07A 3VS2A 5LNKA 2J6OA 1M3BA 3EDVA 1AD5A 3EHRA 2NW8A 3PUGA 4WW0A 3VS7A 5GJWB 3HKDE 5J2UE 2SRCA 3SHWA 3T8OA 5F3JA 2X66A 3FB2A 2LQNA 4X1YE 2GNCA 3AVRA 2WAUA 1QUUA 2ROLA 3EG3A 4LN2A 4EXTA 3ZJ1A 2QDLA 4MHCA 2HEQA 4IHJE 2A72A 2MYSA 3I0QA 2KNDA 2X9WA 3AA1B 4UVBB 4PFPA 4UF0A 2LJ3A 2ZLYA 2JMHA 3OJAA 3WAKA 4E7SA 3ZN1B 4CI3B 2D0NA 3PTRB 5JQGE 4QX8B 2CSIA 1ZSGA 2RQUA 4DBRA 1MIYA 2RQRA 1YKHB 3VRYA 1E1HB 2VKDA 5LGUB 4IIMA 3E22E 4DMWA 4CC7A 1TG0A 4MBQA 2BZBA 1FMVA 5J1GA 4X1KE 4H63V 5L2LA 4HXJA 4XZCA 1HTJF 2YUOA 5IHNA 1BK2A 4QXHB 3ZC1A 2OJ2A 3KBTA 1BR4A 4GBQA 1NYGA 1LKXA 3ETVA 1AWOA 3THKA 4OMPA 3DP7A 2P4RA 4C91A 3N9QA 3KBUA 2KE9A 1D1AA 2GK9A 1M30A 4O4JE 3OYZA 3H41A 3ZC0A 3HKCE 3K3OA 3PUSA 5H6QB 3GBQA 2CXFA 2W00A 2JMKA 1ABOA 1RLQC 3NGPA 3GA8A 2E9XC 5LG4A 1V9DA 2V1QA 2YEVC 3QWYA 2NWBA 3IHRA 4I50E 3C98B 1OEBA 3S4UA 1PRMC 2CUBA 3LJCA 3PDYA 3AA7B 3WI3A 2LHRA 1ARKA 3MKDA 1OPKA 2EYZA 3IQLA 4WCIA 3UF4A 1HCIA 4YJ3E 3NZQA 1U5SA 3E0ZA 2Q9QA 1H3HA 3O1IA 4ASKA 4H9RC 1JXOA 3VKGA 2LSIA 5LHGB 5JDGA 2GQIA 2KNBB 4FI5A 3FBZA 3TSZA 5FP3A 1SSHA 1IO6A 2XUEA 2B86A 5LOVE 2O2OA 3KVBA 2LSKA 5JVDE 2LZ6B 1AOJA 2KYMA 4EOZB 1MNDA 2HSPA 4OMNA 2DWGA 1G8XA 1X43A 2KT8A 3EDUA 2DLRA 5JRCA 2KMFA 4AI6A 4C90A 2EGAA 5DABA 1X79A 4EYUA 3ZYLA 4CC4B 3UA7A 2MOXA 1UJ0A 5LA6E 2J6KA 2EBPA 2RMOA 2BVMA 3M0TA 3HL6A 3MXZA 1WDXA 4FJOA 4HVWA 1PHTA 2YUNA 1WYBA 1ZV4X 1X6BA 1B07A 2VKNA 2CREA 2D5UA 5ECAA 4JLEA 2JM9A 5FNVE 1MNEA 1CUNA 3K3QC 2O88A 5HXHA 2XAFB 2HCKA 2CT4A 5DJQC 2X3WD 4U72A 4UEMA 2V7IA 4GK0E 4GYSA 2KRNA 5IHIA 3HI2A 5HCKA 1X6GA 2JXBA 2J6FA 2O31A 4PW8A 2IIMA 4RTWA 4PK5A 3I0OA 2DM1A 1V1CA 1BB9A 1T0JA 4F14A 4RTXA 3GWHA 2O9VA 3BQLA 2L3LA 4P09A 3O1HA 4EAHA 2D8HA 5F8PA 2ENMA 3NRXA 2CLYB 4AKRB 2BZXA 5JDLA 1AZEA 4I43B 2DL4A 4LUEA 3GN5A 4MFRA 4JJCA 2D0UA 2DMOA 3VS1A 5JR9A 3NPFA 2C0TA 3VS6A 2LSGA 2OAWA 3Q2MA 4ZS3A 2CA5A 2NWMA 5C8YE 4YFSA 3NHNA 5LJNA 3DTOA 3MA9A 3VS5A 1LRZA 2KEAA 4WBOA 4RTYA 3VS4A 1CKBA 4J9DA 1UDLA 5FY1A 1OWAA 4RTVA 4IE0A 4RTZA 4M1PA 5IXFA 3ULRB 5LHIB 4UF0B 4EB6E 2N2NA 3PURA 2JMCA 2AZVA 1T3LA 1VA7A 4JPBW 3EVYA 2EHOA 1GCQC 2RP4A 4ZI2D 1YW0A 3UUXB 1H8KA 2UXXB 1YWOA 2JRKA 2EVRA 3FJ5A 2VKJA 5LBQB 3C4XA 3UFEA 5DQVA 1M3AA 4MLKA 3V5SA 2AKKA 4JJDA 3N2OA 2CCQA 4CC2A 3LBXA 2QA7A 2V7LA 2XASB 5L3CB 2E9XA 5LGNB 1MIVA 3RNJA 3A5XA 3Q5XA 4J9EA 2C0IA 3KV6A 2X67A 2PNIA 1LVFA 2RN8A 1UG1A 5LJMA 1FMKA 5L23A 1Z0PA 4CZZB 2KT1A 1BR2A 1T3SA 1HFAA 2YU1A 3CQCB 3IF8B 5FWCA 5EC7A 5M4YA 3PE0A 2VVKA 3H0FA 3CX6B 1CSKA 2NOXA 2FG0A 1ZEEA 1QWEA 2NW9A 1MMNA 2UXNB 4H9QC 3N5LA 5L3EB 2HPLA 4ZOLE 2Q9QB 3J7Yq 1LVKA 2A08A 3A98A 4KUMB 2LNHB 4QHOA 2C0OA 1NYFA 2HBWA 4D8KA 2DLPA 4ISTA 1NG2A 2J7IA 2DF6A 4UV8B 4AFSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBQ A;  4F17 A;  4GLM A;  5GJV B;  1PWT A;  1NYG A;  2ED0 A;  2O9S A;  2F2X A;  1AWO A;  3EG1 A;  1HJD A;  2DIL A;  2LX7 A;  2FPD A;  3THK A;  4OMP A;  1NEB A;  5I22 A;  2RQW A;  1N5Z A;  2P4R A;  2JT4 A;  1E6G A;  3KBU A;  2KE9 A;  2RPN A;  2M0Y A;  1X2Q A;  1WFW A;  2K79 A;  3REB B;  1M30 A;  2L3S A;  3H41 A;  2DYB A;  1SPK A;  2F2V A;  4J9G A;  2CUD A;  1RLP C;  1QKX A;  3GBQ A;  4OML A;  4Y92 A;  2FRW A;  4A63 B;  1RUW A;  1U3O A;  2ROT A;  1NEG A;  3EG2 A;  1J3T A;  1KSW A;  2JM8 A;  4OMM A;  1ZLM A;  1ABO A;  2K7A A;  1CKA A;  1RLQ C;  1PRL C;  3NGP A;  1JU5 C;  4KRT A;  4OMO A;  2DL3 A;  1KFZ A;  1OOT A;  1UJY A;  3U23 A;  2V1Q A;  1A0N B;  3QWY A;  1K1Z A;  2MIO A;  2EYW A;  1UTI A;  1OEB A;  2A28 A;  1PRM C;  2CUB A;  3PDY A;  1YWP A;  2VWF A;  1NLP C;  4AG2 C;  1ARK A;  1OPK A;  2EYZ A;  3IQL A;  1Y57 A;  4WCI A;  1VYV A;  3UF4 A;  2K3B A;  2BTT A;  2HDA A;  1XOV A;  2JW4 A;  1HD3 A;  1ZX6 A;  1U5S A;  2KYB A;  4ORZ A;  1WX6 A;  4J9F A;  5IHK A;  1H3H A;  1JXO A;  1PNJ A;  2FEI A;  4FSS A;  4E6R A;  1VYT A;  1SRL A;  2CSQ A;  1B3Q A;  3VS0 A;  1FYN A;  2K2M A;  1WLP B;  2GQI A;  3EGU A;  2KNB B;  3I5S A;  1K4U S;  2V1R A;  1G2B A;  1S1N A;  1KJW A;  3TSZ A;  1PKT A;  2EYX A;  2PZ1 A;  4OMQ A;  1SSH A;  1T0H A;  1IO6 A;  1MV3 A;  2B86 A;  1AEY A;  2O2O A;  4J9B A;  2LZ6 B;  4F16 A;  1AOJ A;  2OI3 A;  1GFC A;  2A37 A;  2KYM A;  2K6D A;  4K11 A;  2JS0 A;  4LUD A;  2HSP A;  4HVU A;  2ECZ A;  4OMN A;  1LCK A;  2EKH A;  1G8X A;  1X43 A;  2KT8 A;  4AFU C;  2AZS A;  2EW3 A;  2LQW A;  3CQT A;  1WYX A;  1GFD A;  2JTE A;  3EDU A;  2YUQ A;  1WXT A;  5FWB A;  1M8M A;  2KBT A;  1KIK A;  1YCS B;  1K9A A;  3EHQ A;  4J9I A;  1TUC A;  2DBM A;  1Y0M A;  1I1J A;  2AKL A;  2L3Q A;  2NUZ A;  2EGA A;  2DNU A;  4CC4 B;  3UA7 A;  2MOX A;  1UJ0 A;  2DRK A;  2W0Z A;  1WIE A;  2J6K A;  3M0U A;  2EBP A;  2RMO A;  3M0Q A;  1UUE A;  1SHG A;  4AG1 C;  3M0T A;  1ZBJ A;  1H92 A;  1WDX A;  1QLY A;  4HVW A;  1PHT A;  2YUN A;  1E6H A;  1PKS A;  1X6B A;  4CC3 A;  1GBR A;  2LJ0 A;  1B07 A;  2VKN A;  2CRE A;  4M4Z A;  5ECA A;  2JM9 A;  1OV3 A;  2O88 A;  3TVT A;  2HCK A;  2CT4 A;  2X3W D;  2ED1 A;  4J9H A;  4RTU A;  2CT3 A;  2KRN A;  2J05 A;  4AFZ C;  5IHI A;  1ZUU A;  3O5Z A;  1UHF A;  1X6G A;  2J6F A;  2JXB A;  5HCK A;  1M3C A;  4LNP A;  3VRZ A;  2O31 A;  2IIM A;  4RTW A;  1NM7 A;  2KR3 A;  2DM1 A;  1V1C A;  1BB9 A;  1YN8 A;  1T0J A;  4F14 A;  2EPD A;  2JMA A;  1X2K A;  2X3X D;  4RTX A;  1I0C A;  1BBZ A;  2O9V A;  2KXC A;  1GBQ A;  1G83 A;  1JQQ A;  3H0I A;  1QCF A;  2KXD A;  2W10 A;  2K9G A;  2D8H A;  1RI9 A;  2ENM A;  2XMF A;  1JXM A;  1ZUY A;  2KRM A;  3I9Q A;  1K0X A;  2I0N A;  2FRY A;  2BZX A;  4D8D A;  1AZE A;  1AWJ A;  4HVV A;  2DL4 A;  4LUE A;  3TSW A;  3QWX X;  2CDT A;  2DX1 A;  4JJC A;  4EIK A;  2DMO A;  3M0P A;  4Z8A A;  3VS1 A;  1ZUK A;  3NPF A;  2C0T A;  2LJ1 A;  3VS6 A;  4RTT A;  2CH4 W;  2MCN A;  3UA6 A;  2GTJ A;  3C0C A;  2SEM A;  2OAW A;  1MV0 B;  4JJB A;  4ESR A;  4JZ3 A;  2AK5 A;  3R6N A;  1JO8 A;  2DBK A;  2NWM A;  1UFF A;  2EGC A;  3NHN A;  2H8H A;  1K76 A;  1SEM A;  3H0H A;  4DEX A;  2DVJ A;  3VS5 A;  1W6X A;  1QKW A;  1X69 A;  2EGE A;  2KEA A;  4R0K A;  2ESW A;  2LMJ A;  4RTY A;  3VS4 A;  1CKB A;  4J9D A;  5FW9 A;  2KRO A;  1UDL A;  4RUG A;  2JS2 A;  2CH4 A;  4RTV A;  4RTZ A;  5IXF A;  4JZ4 A;  1WA7 A;  2RQT A;  2IAK A;  3ULR B;  1TUD A;  2RQV A;  1BU1 A;  2JMC A;  2AZV A;  2A36 A;  1GCQ A;  2RNA A;  1UEC A;  2GTO A;  3RBB B;  1X27 A;  1T3L A;  2FPF A;  1VA7 A;  4JPB W;  2KGT A;  1EFN A;  1GCQ C;  2DE0 X;  3NMZ C;  4LE9 A;  2DL7 A;  1H8K A;  1U06 A;  5IH2 A;  1YWO A;  2DRM A;  3I35 A;  2EVR A;  3SEM A;  3FJ5 A;  1YP5 A;  4ZNX A;  2BZY A;  4AFQ C;  1YNZ A;  2BZ8 A;  2L3P A;  1E7O A;  1UHC A;  2D1X A;  1I07 A;  3VS2 A;  1AVZ C;  2J6O A;  1M3B A;  3EDV A;  1M3A A;  3KFV A;  1AD5 A;  2AKK A;  3EHR A;  1AWX A;  4JJD A;  5IXB A;  2L2P A;  1AWW A;  1VYU A;  4CC2 A;  4DEY A;  3VS3 A;  1OPL A;  3ZL7 C;  3VS7 A;  5GJW B;  3REA B;  1AZG B;  1Z9Z A;  2SRC A;  4X1V A;  3SHW A;  1MUZ A;  2ABL A;  4HCK A;  2J06 A;  2LQN A;  3LH5 A;  2GNC A;  3RNJ A;  1UGV A;  2YT6 A;  1SHF A;  4J9E A;  2ROL A;  2C0I A;  3EG3 A;  4LN2 A;  2FPE A;  3F57 A;  2QDL A;  2PTK A;  2DL8 A;  2PNI A;  2HEQ A;  2RN8 A;  1UG1 A;  2E5K A;  1M27 C;  1FMK A;  1NLO C;  5L23 A;  1SRM A;  1Z9Q A;  2YDL A;  5I11 A;  1UE9 A;  2LJ3 A;  2YUP A;  3M0R A;  2KT1 A;  3PVQ A;  2G6F X;  3EG0 A;  4Z89 A;  1T3S A;  1GRI A;  1WXB A;  2D8J A;  5FWC A;  2FO0 A;  2D0N A;  2EYY A;  2RF0 A;  2CSI A;  2L0A A;  1WI7 A;  1ZSG A;  1WXU A;  5EC7 A;  2RQU A;  2LCS A;  2LP5 A;  3PE0 A;  2RQR A;  3JV3 A;  2VVK A;  2M51 A;  3H0F A;  1W1F A;  1W70 A;  1CSK A;  2FG0 A;  2DJQ A;  2GGR A;  4Z88 A;  3VRY A;  3M0S A;  1QWE A;  2GBQ A;  4IIM A;  1K0S A;  1ABQ A;  2KRS A;  3I5R A;  1JEG A;  1GL5 A;  4CC7 A;  1TG0 A;  1QWF A;  5J1G A;  3PVL A;  2F2W A;  4IIO A;  2YSQ A;  4J9C A;  2DA9 A;  2A08 A;  3A98 A;  4HXJ A;  2LNH B;  1GCP A;  4QT7 A;  2C0O A;  1NYF A;  2EQI A;  2HBW A;  4D8K A;  2YUO A;  5IHN A;  1BK2 A;  1NG2 A;  2DLP A;  2DL5 A;  2DF6 A;  2J7I A;  3UAT A;  1HSQ A;  2OJ2 A;  3KBT A;  4AFS C; 
#chains in the Genus database with same CATH topology
 4U2Z A;  4BI4 A;  4F17 A;  4HKA A;  5GJV B;  1PWT A;  1OED A;  4MAL A;  1IRX A;  2O9S A;  1YIJ A;  2KLQ A;  2FJE A;  1VQN A;  3BY7 A;  1KD1 R;  5IAY A;  2DNX A;  3PUA A;  5CJ5 A;  2EWN A;  3LX7 A;  4G63 A;  1NEB A;  3AE8 A;  4M75 F;  4AQG A;  4JLI A;  4Q25 A;  3RYF E;  4XBF B;  4ZEY A;  4FYW B;  4PJO F;  3CCE A;  4KX6 A;  2JOY A;  2M0Y A;  3MEA A;  3EFO A;  1KFY A;  4Z90 A;  2DYB A;  3MHX A;  2F2V A;  5KYW A;  2A0F B;  2MAW A;  5FU7 C;  1YJ9 Q;  3DJB A;  3ZYK A;  3A7M A;  4OML A;  3CMA T;  3ANW A;  3KDS E;  4PK6 A;  4YTM A;  4A63 B;  1K9M C;  1RUW A;  2VVN A;  3NTI A;  4AT1 B;  3W15 B;  2DXU A;  4OMM A;  3OBW A;  1ZLM A;  1VQ4 Q;  1VQ9 Q;  2QDY B;  5JRC B;  4M75 B;  2XQ6 A;  5A1L A;  4X1I E;  4KRT A;  2XPK A;  2YU2 A;  5AQK B;  4M77 A;  1WHH A;  4E7J A;  1OOT A;  1UJY A;  2ZM2 A;  4HKE A;  1VQ6 T;  4HFV A;  4AQF A;  3C94 A;  1S35 A;  2EQM A;  4GYR A;  2Z6E A;  3AAI A;  3RX6 A;  3M65 A;  5GAN 7;  3VU3 C;  1UTI A;  2XQ7 A;  5F5W A;  4A4E A;  2O4X A;  3QUI A;  4TV9 E;  5CA0 E;  3F70 A;  1US7 B;  1OUL A;  4LFC T;  1UGR B;  3OYL A;  4RG2 A;  3JB9 D;  3LWI A;  5JTG A;  1T72 A;  1R77 A;  2CHN A;  3GMI A;  3IEE A;  3TLV A;  1NLP C;  2JIW A;  5FXZ A;  1Y57 A;  1M1K R;  3RRW A;  1ZA2 B;  4IDN A;  3UU8 A;  2K3B A;  1N8R U;  4F6R C;  2XQY A;  1VQO Q;  3OYK A;  4JDS A;  1XOV A;  1HD3 A;  2J1D G;  1BI3 A;  3SRZ A;  2FHD A;  4AKG A;  2E4H A;  4ORZ A;  1I5L A;  4UXN B;  4IE4 A;  4YT0 A;  2DXB A;  2R5M A;  3L09 A;  4X34 A;  3LLR A;  4ZS2 A;  3UU6 A;  2FEI A;  5LBM A;  1K8A R;  1VYT A;  2YRV A;  4K0U A;  3MP1 A;  1SRL A;  4TNV A;  1HS7 A;  3CME Q;  3RDV A;  2NYS A;  2ODV A;  3FBL A;  2BDE A;  3VS0 A;  1Y01 A;  2K2M A;  2AXD S;  4HA8 A;  3A8H B;  3C51 A;  3I5S A;  3RKY A;  4JI7 T;  3QSU A;  4ILC A;  2VL8 A;  4U3C A;  2XQA A;  1PKT A;  3M5A A;  1I4K 1;  2RI2 A;  2WAC A;  3CIR A;  2PG8 A;  4DUY T;  4M7D C;  5KDM C;  1AEY A;  4DV4 T;  5LJ3 d;  2KMT A;  1Y96 A;  2X35 A;  4F04 B;  3E1S A;  1W2B S;  4O4I E;  3L42 A;  4OB0 B;  4DV5 T;  1NWM X;  5H6R B;  4M7A C;  3M59 A;  2K5L A;  3CCJ T;  4CN6 A;  1KG1 A;  5IN1 A;  3TKL B;  4LFB T;  2M6I A;  4HE8 A;  1OZ3 A;  3M56 A;  4LUD A;  2RK1 A;  3SFD A;  5ABF A;  2VGM A;  1M4Z A;  1D1C A;  5DQW A;  3GPL A;  2X68 A;  3LSV A;  4QX7 B;  1LCK A;  2EKH A;  5CB4 E;  5A0D A;  4UVA B;  2IC6 A;  5AQL B;  2KI7 A;  3G7Z A;  4YTP A;  5GAN d;  1PG5 B;  2XQ8 A;  2AZS A;  3CQG B;  4IRE A;  4QKU A;  2EW3 A;  2AT1 B;  3TEE A;  2WBL A;  3GN5 B;  3BW1 A;  1WYX A;  4C0D C;  1GFD A;  2WWV A;  1OYX A;  3V7C A;  5JR9 B;  3ZYM A;  1JRI A;  1YI2 Q;  1OI1 A;  3KV4 A;  1M8M A;  1UUR A;  5FRN A;  3EHQ A;  1NAF A;  4A56 A;  4BJM A;  3FXD B;  8AT1 B;  2AKL A;  1ZKE A;  2QRX A;  2YDS A;  2L3Q A;  4DUZ T;  3EUH A;  5L47 A;  3QO3 A;  4PJN A;  4B6M A;  4BJN A;  2DRK A;  3ETU A;  4I55 E;  2HKQ B;  2W0Z A;  3ZST A;  1YHQ T;  2B76 A;  3CD6 T;  2KIN B;  3U78 A;  1SHG A;  2FJD A;  4AG1 C;  2OTL T;  3VR8 A;  1XNR T;  2L8D A;  2VK9 A;  1QLY A;  2X9Y A;  1OED E;  2W66 A;  3CPZ A;  1Q82 C;  3JCM J;  2Y48 B;  3ZMS B;  1GBR A;  5LJ3 g;  5L3B B;  3H6Z A;  5CAI A;  4MZT A;  3D0T A;  2DZ9 A;  3CCJ A;  3RH3 A;  2RJF A;  4M4Z A;  2XU8 A;  1QVF P;  4AKL A;  5LJ5 f;  3RKX A;  1U5P A;  5HEO A;  1KQS A;  3LFM A;  1OV3 A;  2VL0 A;  3X1D A;  2ATC B;  4FM4 B;  1H7C A;  3A5Z B;  2K57 A;  3TVT A;  3FXE B;  3I1A A;  3WVD B;  2LOS A;  4JRK A;  4C8Q G;  1BR1 A;  2X4W A;  4X66 T;  2F5T X;  4ZGE B;  4M78 C;  3RKW A;  5GMK e;  5GAN g;  1UEB A;  4J9H A;  4IGU A;  5LGT B;  5IHY A;  1R0B G;  3CCU A;  2V7J A;  1G5V A;  2CE7 A;  2EHO B;  1M3C A;  1MHN A;  1PSE A;  4LNP A;  3VRZ A;  1UB4 A;  2V1D B;  4ZZC A;  5LJ3 h;  1YIT Q;  1UK5 A;  2N1G A;  2NP9 A;  3X26 B;  1QVP A;  3P4Q A;  5CQX A;  4OFZ A;  5KYY B;  1I0C A;  1QP2 A;  1BBZ A;  4NPP A;  2IDO B;  4ADZ A;  1U8R A;  1GBQ A;  1YHQ A;  3CKD A;  4GKK T;  1TXQ A;  3CD6 A;  1U1S A;  2E3H A;  1H3Z A;  2X0Y A;  4YLH A;  1JNZ A;  4JI4 T;  2W10 A;  2K9G A;  2LE8 A;  2QTV A;  3LG7 A;  3HFN A;  4PFO A;  1RI9 A;  2OTL A;  2WWU A;  2M16 A;  2XMF A;  5GAN h;  1N6A A;  1ZUY A;  1K0X A;  3I9Q A;  2RA2 A;  3V8K A;  2I0N A;  2ZCF B;  4D8D A;  4UR9 A;  4COF A;  4KI0 F;  4L59 A;  3QWX X;  2CDT A;  3AXJ B;  3UU5 A;  2WQY A;  4U33 A;  5HXE A;  1YKE B;  3JCM Q;  3LK4 2;  2HBP A;  3M0P A;  3LBX B;  4A98 A;  4Z8A A;  2QEX Q;  4O2B E;  1ZUK A;  4MDX A;  2Q9Q D;  1XMQ T;  4DR2 T;  2VVS A;  4RTT A;  2JQK A;  1YFN A;  2XD0 A;  3INZ A;  3C0C A;  2SEM A;  2RA1 A;  3WAJ A;  1MV0 B;  2E5L T;  2CGH A;  4JZ3 A;  3P50 A;  5LXT E;  1WZO A;  3PMI A;  3OMC A;  3AE4 A;  1JO8 A;  2L8K A;  1VQL Q;  2EGC A;  3C12 A;  3ESL A;  2ZPI B;  3QDR B;  3A8M B;  3FLG A;  1K76 A;  2QK0 A;  4EZH A;  2W67 A;  4NS5 A;  4TWH A;  3JCM X;  1X69 A;  4ILU A;  4R0K A;  4E47 A;  1SG5 A;  2M9U A;  2LMJ A;  3L2R A;  3ME9 A;  1UX5 A;  4ELZ C;  4FT2 A;  5A2Q E;  3GOX A;  2IW5 B;  1FWZ A;  2OLT A;  4BAC A;  3VKI A;  1W2B A;  1XDO A;  5HEG A;  5FY7 A;  4KBM B;  3JB9 I;  3CCR Q;  4EMG A;  2QYW A;  4DBF A;  1VQ7 Q;  4Z8X A;  3QBY A;  3CBO A;  3N2G E;  3N9L A;  4TX5 A;  4BY6 C;  3OKQ A;  4PJO A;  4LDY A;  3EH2 A;  2XI9 A;  2YHT A;  4QVZ A;  3SB2 A;  2A36 A;  2VUR A;  2GTO A;  4MMK A;  1WR6 A;  5KCH A;  2XQ3 A;  5FMN A;  4KP3 C;  4QXC B;  3MP6 A;  3AEA A;  3EH1 A;  4J6W A;  2LT3 A;  2M6B A;  3G06 A;  3QOF A;  3R84 B;  4M75 D;  2K48 A;  3CEY A;  2QGF B;  3NMZ C;  3HKB E;  4U7I A;  3QPH A;  3LYI A;  3R6O A;  2WZI A;  3VV0 A;  2WMN A;  3RES A;  2WM9 A;  4DA4 A;  2DRM A;  2DI4 A;  1M90 R;  2LX9 A;  1Q86 R;  1YP5 A;  3F2E A;  2LSJ A;  1YNZ A;  4AFQ C;  2A7Y A;  1BKB A;  1UHC A;  3OVU A;  4DV3 T;  4JUY A;  2CXD A;  5AQP B;  1JJ2 S;  4J8O A;  2M1H A;  1Q7Y C;  4NOY A;  3N9N A;  3VU7 H;  3KFV A;  2KXP B;  3KVA A;  1YJW Q;  1ACM B;  1W9R A;  3TLS A;  1WLX A;  2BG9 A;  2G0U A;  2GFA A;  4N0A A;  2VGN A;  3DLL A;  2L2P A;  1AWW A;  4IE5 A;  1W2B P;  1VYU A;  2CLY C;  3VS3 A;  4BA9 A;  1D3B A;  1OPL A;  3ZL7 C;  3HRU A;  2WMO A;  1SF9 A;  3REA B;  1WJQ A;  4B9W A;  5CFB A;  4F8H A;  1Z9Z A;  3SOL A;  3OBY A;  3OYD A;  1MUZ A;  2ABL A;  3AE1 A;  4HCK A;  2J06 A;  1NPP A;  4IT4 A;  2K5I A;  4E7I A;  3RI5 A;  2DCF A;  5EG2 A;  2NLU A;  4FIB A;  2HPJ A;  4UIG A;  5HWX A;  1SHF A;  1OED B;  2C0S A;  2FYK A;  2PVG B;  1NJI R;  3OW2 A;  5IWA T;  2LEH A;  3EFR A;  4ZI3 D;  2E70 A;  3F57 A;  4PAG A;  4O4L E;  2LCL A;  2HL3 A;  3MPU B;  2PTK A;  2ZMA A;  4HFI A;  2Y4X A;  5BR8 T;  2IC9 A;  4QVD A;  3RQU A;  1D09 B;  1NEK A;  3HR0 A;  5LL6 S;  3OPC A;  4HFE A;  2H7V C;  5TAO A;  2E5K A;  1M27 C;  3EFO B;  5EZY E;  5CA1 E;  2CZ0 B;  2DPP B;  2XQ9 A;  4R55 A;  4H9O C;  1NLO C;  5AQJ B;  3CX8 B;  3G1J A;  5LMU T;  2QA4 Q;  4QXB B;  1Z9Q A;  2JUF A;  4LF5 T;  4JI1 T;  2AIR B;  1UE9 A;  2EKO A;  2YDL A;  2YUP A;  3PUQ A;  3M0R A;  5GAM e;  3ANW B;  3FHN A;  2Y8D A;  3PVQ A;  3CCL Q;  3JAE A;  1ZSZ C;  4LDU A;  5LHH B;  3P8C D;  3EG0 A;  3CML A;  4DR3 T;  4KT0 E;  4M7A G;  2L3R A;  1WXB A;  2FO0 A;  4A4H A;  1FMW A;  3OS1 A;  2EYY A;  1OX9 A;  2RF0 A;  2L0A A;  4M77 B;  4HT9 A;  1WI7 A;  4PNI A;  5HEU A;  2LCS A;  4M7D A;  2J62 A;  1PSF A;  4BI8 B;  1W1F A;  3SFE A;  2E3I A;  3RLF F;  4X64 T;  3CX7 B;  2O4X B;  3P7I A;  4JI2 T;  4F7U A;  5L3F B;  1YXR A;  5AT1 B;  3C4S A;  2V7M A;  3M0S A;  5KX5 E;  2XY8 B;  2E2A A;  5FXV A;  1N8R C;  4MZM A;  2HAX A;  1ABQ A;  4UC4 A;  4YY3 T;  4KH0 B;  3FZF B;  3AE9 A;  3I5R A;  1VIE A;  3URG A;  1GL5 A;  1WYC A;  3RYI E;  4UEL A;  3HPW A;  3VKH A;  1EX4 A;  2DAQ A;  3PVL A;  4EMK C;  4ZN1 A;  2Y4Y A;  1IXD A;  3E2U A;  5JDH A;  3MET A;  1UGO A;  1SUM B;  3Q5D A;  1X6O A;  1BI1 A;  2DA9 A;  2UXD T;  1KQ1 A;  2QYZ A;  3ONX A;  1GCP A;  4QT7 A;  3MO8 A;  3RIU C;  1M62 A;  2FJA A;  4V1A v;  2R6G F;  4DID B;  1WCR A;  2HH7 A;  2CXL A;  2DL5 A;  4G2A A;  2DXT A;  4MDW A;  4XTW A;  5CVI A;  4J2C A;  4GLM A;  3PFS A;  2RHY A;  1WQ7 A;  2EQK A;  3RIF A;  1ZQ1 A;  3RC8 A;  5GMK l;  4PJO E;  3N9P A;  4HWI B;  1ZA1 B;  4N4H A;  2EHO D;  4JBW F;  4JYA T;  2DK3 A;  4X65 T;  2IML A;  3LK3 B;  3EG1 A;  3N5B B;  1HJD A;  2CP0 A;  2LX7 A;  1IGQ A;  4HWD A;  4CRI A;  2RQW A;  3BQI A;  2DIQ A;  1Y96 B;  3AAE B;  3C64 A;  1E6G A;  4M78 G;  4EMH A;  3MJX A;  1X2Q A;  4E7L A;  1O3X A;  4C92 A;  1WFW A;  4WBN E;  5EK3 A;  1I94 T;  5FYM A;  2JPF A;  1M1G A;  4IL9 A;  4L5G A;  1SPK A;  5ABF B;  1VQK T;  1RLP C;  3ZCI A;  4GKJ T;  1VRB A;  4PK4 A;  3JB9 J;  2FRW A;  5JH7 E;  3Q5W A;  2KZ7 B;  2ROT A;  2HN2 A;  1J3T A;  2XAG B;  3ZBD A;  5IT9 E;  4YSX A;  2D2S A;  2K7A A;  2BG9 E;  4HN9 A;  1EIF A;  1I5O B;  5FU6 C;  1PRL C;  2UUB T;  4C5H A;  5CQY A;  1JU5 C;  2OTJ T;  1F1B B;  4OMO A;  5I2S A;  2CBI A;  2MTQ A;  3GF5 A;  4TN7 B;  2DER A;  5HXC A;  3U23 A;  2E9X D;  2CP5 A;  3M9Q A;  1K1Z A;  4O6J A;  2MIO A;  4LDV A;  2WU2 A;  3I55 T;  2EYW A;  2EIF A;  2W63 A;  3CCE Q;  4N4I A;  2DD4 A;  2ACZ A;  2VUB A;  2ZM8 A;  2FJB A;  2RJE A;  2BKD N;  3VUB A;  4L0R A;  2JVV A;  3RRC A;  3LGL A;  2VWF A;  2KWI B;  1M9S A;  2K3X A;  2IPO B;  1VYV A;  3H3M A;  2DZC A;  3L2V A;  4DO0 A;  2BTT A;  1OXZ A;  4P0B A;  2JW4 A;  2KYB A;  1WJR A;  1M7K A;  4J9F A;  1KK7 A;  2PU9 B;  3SWH A;  3O9X A;  1JB0 E;  4KGV B;  4IUU A;  1VQK A;  2LQK A;  3EHZ A;  4QQD A;  1JJ2 P;  4JS5 A;  4FSS A;  1Y64 B;  3HA4 A;  3X24 B;  2Q9Q C;  2LSY A;  2K9A A;  1B3Q A;  1FYN A;  2XG8 D;  1WLP B;  1O75 A;  3A8L B;  5CKH A;  1K4U S;  5FL1 A;  3I56 T;  2V1R A;  2BE7 D;  3E08 A;  3EGD A;  1EZZ B;  2HSE B;  1KJW A;  1R8O B;  2FVU A;  1KF6 A;  2OTJ A;  2HN1 A;  1J1J A;  4IDP A;  2PZ1 A;  5GAM d;  3C50 A;  3O1J A;  1RI0 A;  1IZN B;  1Q81 C;  5HCJ A;  3JC6 D;  1FX7 A;  5ETW A;  1MV3 A;  2I6H A;  5JDF A;  1XQH A;  3OBV E;  3FIF A;  3FRN A;  4BE1 A;  3B13 A;  4J9B A;  2XSA A;  2MPX C;  4HEA A;  2OI3 A;  4F16 A;  2H7O A;  3BQK A;  4FCY A;  2H3E B;  2OV9 A;  4JEU B;  1MIW A;  1MMG A;  3CWZ B;  4XAX B;  1TUG B;  2A37 A;  4K11 A;  4EPC A;  1IBK T;  2JS0 A;  4B6X A;  4JI3 T;  4BAY B;  4FW1 A;  3EGX A;  2BE9 B;  4M7D E;  2ECZ A;  2LKH A;  4A4K A;  1LPL A;  5KE3 A;  2WB5 A;  2VB6 A;  3PJA J;  1K73 U;  3QK6 A;  4F7U E;  3RKO A;  3TRE A;  4OYK A;  3CXC A;  3VRB A;  4H9S E;  2JTE A;  2M67 A;  5C6S A;  3O8V A;  2PQW A;  5FWB A;  2V6X A;  3P8H A;  5EK4 A;  1BIB A;  2KBT A;  1KIK A;  3PT9 A;  4OK0 A;  1YCS B;  3UPU A;  4J9I A;  2DBM A;  1BCM A;  1Y0M A;  2JQQ A;  3OYH A;  3PUY F;  1IGU A;  2W0G A;  2CKK A;  2NUZ A;  5L8R E;  2ZM0 A;  4M75 C;  2D0T A;  2K24 A;  2DNU A;  3CCV A;  1KC8 R;  3I56 A;  2ODU A;  5LJ3 j;  4A4G A;  4AKH A;  1SHZ C;  3UQ4 A;  1RAF B;  1VQ8 T;  1WIE A;  2GF7 A;  5KYX A;  3EG9 A;  3M0U A;  3PIP A;  3VYG A;  4XTZ A;  4RKU E;  1UUE A;  1BCO A;  1KQS S;  3G4S T;  3PGG A;  1ZBJ A;  3OYJ A;  1H92 A;  5GAM g;  1ZOY A;  1E6H A;  2YKS A;  1PKS A;  2RK2 A;  4CC3 A;  3AHU A;  4A54 A;  5LG3 A;  5GAN j;  2CP7 A;  3IBP A;  3ONL C;  3RKG A;  2YIN A;  3G6E A;  4QH5 A;  1KD1 U;  5AFU L;  5GAO p;  3LDQ B;  3AE6 A;  3KV5 A;  4OB2 B;  1HG2 A;  3UUM A;  4FYV B;  5LJ5 e;  3RHW A;  3JCM c;  4L9I A;  4C92 E;  3ZCJ A;  2XID A;  4PJO B;  1IAP A;  5EK2 A;  4IUV A;  2KT9 A;  4RCB A;  1S72 T;  2DEU A;  1IJ6 A;  1SA0 E;  5HK3 A;  3O4X E;  4RTU A;  3JB9 G;  5KCO A;  3ZPO A;  3M54 A;  5GAM h;  1VQ5 T;  1DU2 A;  1ZUU A;  1UX4 A;  1D0Y A;  3PU3 A;  2CM0 A;  4NUV A;  3PTA A;  4M77 D;  4QQ6 A;  2XDD A;  4DR6 T;  2PUO B;  3SS1 A;  2LM9 A;  1YN8 A;  2V8S V;  4HWC A;  1X2K A;  1Y07 A;  3QB5 A;  2X3X D;  4X20 E;  3OYI A;  1TSF A;  4ZI3 C;  4AKI A;  2KXC A;  3H0I A;  1G83 A;  4UV9 B;  2CPT A;  1QCF A;  5HEJ A;  2JNG A;  2LNV A;  2KSR A;  4XTY A;  2CMR A;  3CCJ Q;  3KIN B;  2WSC E;  2LRK A;  3NRY A;  2CWO A;  4JRI A;  2JQ9 A;  2DIG A;  2P4T A;  3L2U A;  4YTN A;  5LYJ E;  2HZY A;  1FEW A;  1AT1 B;  2CP6 A;  2KRM A;  4BDZ A;  5AQV B;  1G3W A;  2A3L A;  2BG9 B;  2XAH B;  2FRY A;  2RI3 A;  4J6Y A;  2LQ8 A;  3CMA A;  3C4W A;  3BDU A;  4X62 T;  5CCA A;  5GAN 2;  2DX1 A;  2X0L B;  1D3B B;  4EIK A;  5FLX E;  3RMQ A;  4E7Z A;  2X9H A;  1YJ9 T;  2C5K T;  1MGQ A;  1M1K U;  5FXW A;  1PD0 A;  2CH4 W;  3AE7 A;  5AQF B;  2YLC A;  3V8L A;  3VJP A;  2V8I A;  3UA6 A;  3CCU Q;  1HX1 B;  5IYZ E;  4ILB A;  2P0K A;  4JJB A;  5JR9 C;  5AQG B;  1VQ4 T;  2KWH A;  3L2W A;  1VQ9 T;  2N9D A;  2AK5 A;  3OYG A;  1N27 A;  4TZ4 C;  4B3S T;  1VQ6 A;  1VIF A;  2COW A;  4OGC A;  5ABG A;  1YCY A;  4XTV A;  2DBK A;  3P8D A;  3S3M A;  4CXX A;  1UFF A;  1VQ5 A;  3UUL A;  3RYH E;  2VXE A;  1IHW A;  2H8H A;  1K8A U;  4QWN B;  3M55 A;  1YHQ Q;  3I9Y A;  1SEM A;  1TOV A;  3H0H A;  4DEX A;  1OX8 A;  3ZMZ B;  2EGE A;  4EED A;  2I2L A;  3CCS Q;  2ZPH B;  5FW9 A;  3OQ5 A;  4DOV A;  2E12 A;  2E6Z A;  3UFG A;  2CH4 A;  1RAE B;  3UU3 A;  2E41 A;  1XWM A;  3FZL B;  1P92 A;  4M7D F;  3OYE A;  3OYN A;  4OHF A;  2C5J A;  3BDL A;  4DV7 T;  1VQO T;  5HXS A;  4KHP T;  2RQV A;  4F7U F;  2RNA A;  3RBB B;  2BBJ A;  1GCQ A;  1UEC A;  1YD8 G;  4JJN K;  1YJ9 A;  3OYX A;  4ZI2 C;  1ZBX A;  1EFN A;  3CME T;  2K5F A;  2L9Q A;  1VQ4 A;  4JI5 T;  1VQ9 A;  3RIA A;  5KYU A;  5IH2 A;  3I35 A;  2EHO C;  4CXY A;  2CS7 A;  3LK2 B;  3M58 A;  4M7D B;  1XDP A;  2KY9 A;  1LNX A;  2E6N A;  2BZY A;  2LTO A;  2BZ8 A;  4LD6 A;  1E7O A;  2RHX A;  3OSV A;  2XAQ B;  2D1X A;  2DWK A;  3ZMV B;  3NFC A;  2ES0 A;  3ZKR A;  3PJA A;  2DHR A;  2M0O A;  1AVZ C;  4F7U B;  2BKP A;  1LJO A;  4J83 A;  1G73 A;  3NBX X;  1HK9 A;  2RI5 A;  2BS3 A;  1EZ3 A;  4CI1 B;  1AJ3 A;  1AWX A;  5C0M A;  5HYA A;  5IXB A;  2PFV A;  5CIU A;  2XAJ B;  2F69 A;  4ISS A;  4CI2 B;  4DEY A;  4DV0 T;  4CI0 C;  3CC7 Q;  5GAN 6;  4TUY E;  1ZHC A;  3DB4 A;  2XQ5 A;  4GLK A;  4JUV A;  2XKO C;  2A3D A;  3CBP A;  3U3I A;  5KH6 A;  4B3T T;  4OX9 T;  1AZG B;  1VQO A;  2H88 A;  2DKG A;  2CZ6 B;  5A0L A;  3ZLI A;  3OW2 S;  3B57 A;  1RL2 A;  4X1V A;  5JDQ A;  4C92 F;  4H9P C;  2OX7 A;  5GAO l;  3L8R A;  3BE3 A;  4H63 H;  1W0A A;  1FIO A;  4II1 A;  3UT1 A;  4N78 D;  1Q81 R;  3CC2 Q;  3LH5 A;  2CZ7 B;  1UGV A;  2YT6 A;  4GY5 A;  3KUF A;  4C8Q A;  4HFH A;  3CME A;  1HG5 A;  2XHE B;  3RPU A;  4ZGJ B;  5LJ5 d;  4XU0 A;  1S94 A;  1U1T A;  2MOZ A;  4NXN T;  5ADX L;  4C0G A;  3V5U A;  4RMO A;  2FPE A;  3OSS C;  3NWI A;  4EZ4 A;  2Y90 A;  3CVR A;  2RH2 A;  2QG9 B;  2DJZ A;  3EAB A;  3QJY A;  5KMG P;  2DL8 A;  2CEA A;  2WP9 A;  2C5I T;  4C92 B;  4DR5 T;  3FJP A;  5FXX A;  3OS2 A;  5GON E;  1SRM A;  2VKO A;  3PNW C;  5LP6 E;  1KQS P;  1WRD A;  4ANJ A;  5I11 A;  1B7T A;  3H9N A;  1UGP B;  3RF1 A;  2B8A A;  4RG8 A;  2SPC A;  3ZN0 B;  1NZ9 A;  5FRM A;  2G6F X;  2K5B B;  2QGS A;  4P1N A;  3AVS A;  3JCM b;  2QQ9 A;  2E9X B;  4FYX B;  2WCA A;  4Z89 A;  2YWW A;  1GRI A;  1HYO A;  2FB7 A;  3I9W A;  3MK7 C;  4B3R T;  1T98 A;  2D8J A;  2L5Q A;  5KYW B;  5L4E A;  3LGF A;  2BBH A;  1WXU A;  1QVG A;  1D1B A;  1VCS A;  2LP5 A;  4EYY R;  3JV3 A;  2M51 A;  2NUP A;  5AYF A;  1UCU A;  3T1H T;  4DMV A;  5GMK j;  3JC6 C;  3N2K E;  5HWY A;  1W70 A;  3QII A;  2BKO A;  4LFA T;  2K4Y A;  2ZZD A;  2W2U A;  2DJQ A;  2XTL A;  4BUG A;  1YIT T;  1WR0 A;  2GGR A;  4Z88 A;  5C3J A;  4DR1 T;  1K9M R;  5JRE A;  2X9X A;  5LJ5 g;  2GBQ A;  3GNG A;  2DYI A;  1K0S A;  4DND A;  2KRS A;  3OS5 A;  1JEG A;  2HKN A;  2RHZ A;  3PIO A;  4M75 G;  3N9O A;  2W4X A;  3X25 B;  4ZI7 E;  3QUJ A;  1IHV A;  1QWF A;  2HHH T;  3E9G A;  3AEB A;  4MML A;  1WQW A;  2F2W A;  3K3N A;  4IIO A;  4J7I A;  2YSQ A;  4J9C A;  1XMO T;  5LCY A;  5JDN A;  3AB3 B;  4TVR A;  2EQI A;  4JI0 T;  4PJM A;  5HXR A;  3SWN C;  4C0Z A;  4PJO D;  1PCX A;  4IIJ E;  3QNU A;  2QEX T;  5JDM A;  3UAT A;  1HSQ A;  5LJ5 h;  3EGD B;  2XJ7 A;  4A5X A;  2ED0 A;  3T9N A;  2EYQ A;  2CRB A;  3HKE E;  2F2X A;  3QC9 A;  5GAN 8;  2DIL A;  2HQX A;  2FPD A;  2X51 A;  4HFD A;  1OED C;  1VQL T;  2NTY A;  5I22 A;  1N5Z A;  3UT5 E;  3VHL A;  1X9B A;  3QYG B;  2JT4 A;  5FVL A;  3JCM W;  2RPN A;  3CCQ Q;  4I4T E;  1YIT A;  2P84 A;  1HX8 A;  1B34 A;  3OYB A;  2K79 A;  3REB B;  2L3S A;  3QXE B;  5I21 A;  3EGX B;  3QB5 K;  2V5D A;  1D0Z A;  1M90 U;  4EEB A;  4J9G A;  1Q86 U;  2CUD A;  1K73 C;  1QKX A;  4EIW A;  1VCT A;  1IZ6 A;  1IBM T;  5FRO A;  4Y92 A;  2KK4 A;  4QH1 A;  1U3O A;  2LHN A;  1NEG A;  3EG2 A;  5AQS B;  3UQ7 A;  1KSW A;  1RAI B;  3JCM f;  3CCR T;  2JM8 A;  2NTX A;  1VQ7 T;  3J7A F;  1CKA A;  2BIV A;  4BE0 A;  2JZ2 A;  2YOE A;  1HXD A;  3N9M A;  4O5V A;  1W4S A;  2DL3 A;  1KFZ A;  4O2A E;  4IE6 A;  2QEX A;  2LOP A;  1QMC A;  1XZY A;  1A0N B;  2X0H A;  4DBQ A;  1QCN A;  3AEF A;  4LML A;  4M77 C;  3E9F A;  1Z8U A;  4Y91 A;  2DTH A;  3HFO A;  5KYX B;  1V76 A;  3EG9 B;  2RJD A;  2A28 A;  3KV9 A;  3AEG A;  5FL0 A;  4AQF C;  1PM3 A;  3L3P A;  4O8S A;  3J80 E;  4PLL A;  1VQL A;  5FY0 A;  4OYJ A;  3F31 A;  3WVE B;  4OF1 A;  3OYF A;  3K8P C;  1YWP A;  4AG2 C;  4C8Q E;  3Q9D A;  1O9S A;  1VQP Q;  2WS3 A;  4KMC A;  3KBG A;  2HDA A;  1WHM A;  1NJI U;  4CQI A;  3VUZ A;  1ZX6 A;  2VKH A;  4DV2 T;  3AAA B;  4JRQ A;  1WX6 A;  4UVC B;  1YJW T;  4JEH B;  4DR4 T;  2EJG A;  2MMP A;  3OTO T;  2PUK B;  4LD9 K;  2JTM A;  5IHK A;  3UUN A;  1T7S A;  2H3R A;  4KUL A;  5D7U A;  1PNJ A;  3AE3 A;  1YQ3 A;  2HNI A;  4TV8 E;  4E6R A;  2E8I A;  4YTL A;  3MZK B;  4JLG A;  2CSQ A;  3MAC A;  3DB3 A;  3TCJ A;  3ZJ2 A;  3FZM B;  5BMV E;  3CCM Q;  4HT8 A;  3CCR A;  3ZEF B;  3EGU A;  1G2B A;  1S1N A;  2YN6 A;  1KNR A;  1NPR A;  4HTE A;  4EV6 A;  1HF8 A;  4IDZ A;  4U31 A;  1G3S A;  2ZGW A;  2V7K A;  2EYX A;  4OMQ A;  2CWY A;  2PJQ A;  1XNQ T;  3RC3 A;  2F5K A;  4XTX A;  5CKB A;  3L1A A;  1T0H A;  3OW2 P;  3D7S B;  4EGW A;  5C2T A;  2XDB A;  4M7A A;  3V8J A;  1U4Q A;  2GQV A;  4M7D D;  4H9N C;  2BKN A;  4KGX B;  1GFC A;  4NXM T;  2V6Y A;  2K6D A;  1HNW T;  3CXC S;  3PUW F;  2KSS A;  5ABE A;  2FZK B;  2QGG A;  3MEW A;  3SFM A;  3NZP A;  3ZSS A;  4HVU A;  5LB7 B;  5L3D B;  2IHR 1;  3RGL A;  2PTF A;  4AFU C;  3GNF B;  3CPW A;  4HFB A;  3RYC E;  2LQW A;  2R58 A;  3CQT A;  4ME7 A;  2QA4 T;  1M1K C;  1NBE B;  1KQ2 A;  2YUQ A;  1WXT A;  4OP0 A;  2QXF A;  3AA0 B;  3ZMU B;  1JBM A;  4Q5W A;  2BVL A;  1M5Q 1;  1K9A A;  5CKD A;  2WY2 A;  1TUC A;  1W09 A;  2QI2 A;  3CCL T;  1I1J A;  5GAM j;  4C5G A;  1DJ7 B;  2P0Q A;  4AXP A;  2VAS A;  2I0M A;  3UTK A;  4WYV A;  1K8A C;  2EJF A;  2W61 A;  2X4Y A;  3G71 Q;  4PJJ A;  2CYZ B;  5L3G B;  4R56 A;  3CQX C;  3P4R A;  3M0Q A;  4HGA A;  4NUU A;  4QKN A;  2L89 A;  1M1F A;  3PMT A;  3NTH A;  1SKU B;  4FT4 A;  2D0Q B;  2EJ9 A;  4PNO A;  2LJ0 A;  2LJL A;  2DXC A;  3QZ9 B;  4C92 D;  5GMK m;  4B9X A;  1Y71 A;  3OYM A;  4Z91 A;  3M57 A;  4M78 A;  3NVO A;  2RO0 A;  4IE7 A;  2W62 A;  2UUC T;  3QG1 A;  1C0M A;  2P9B A;  3AA6 B;  3CBM A;  4DVD A;  4WNK A;  4YJ2 E;  2X4J A;  2ED1 A;  1YIJ Q;  1VQN Q;  2GCX A;  3PU8 A;  1QQJ A;  2CT3 A;  3CCV Q;  4EDU A;  2J05 A;  4YHJ A;  4AFZ C;  3O5Z A;  1UHF A;  4GIW A;  2IIU A;  2CP3 A;  4FU6 A;  3MCA B;  1LOJ A;  4XU2 A;  3QZ5 B;  1NM7 A;  4C0F A;  2KR3 A;  3NTK A;  2I59 A;  2LC4 A;  4ZXL A;  5KYU B;  5HAX A;  2EPD A;  2JMA A;  2KVQ G;  4LMK A;  1QP3 A;  1D0X A;  1VOM A;  2IUB A;  1TWB A;  2CP2 A;  1JQQ A;  3CC4 T;  2KXD A;  4PJL A;  2VQF T;  2VYT A;  1H64 1;  3G6E Q;  2WSF E;  4IUR A;  4O4H E;  2LLY A;  3V7S A;  1JXM A;  4C8Q F;  3KFW X;  3ZMT B;  2B1E A;  2X4X A;  2K2V A;  2AHJ B;  3OA6 A;  4A4F A;  4V2S A;  2MPK A;  1AWJ A;  4HVV A;  3ZEH A;  5M9O A;  3TSW A;  1BI0 A;  1KHI A;  1XJW B;  2WSS V;  2FUP A;  2ACX A;  2A2F X;  3AE5 A;  2LJ1 A;  2O01 E;  4QVC A;  4K0K T;  2CBJ A;  1N36 T;  1Y7X A;  2XM2 A;  2MCN A;  2GTJ A;  1UGQ B;  4P0A A;  4KHZ F;  4ESR A;  5AQN B;  4A53 A;  2H89 A;  3R6N A;  5E0O A;  3H37 A;  4ERR A;  3H8Z A;  4ZHQ E;  4LDW A;  3GP8 A;  2EAY A;  4C8Q B;  3I55 A;  2HL5 C;  1RAB B;  3NKZ A;  1Q7Y R;  3QYH B;  4U74 A;  2PBI A;  5GAN 4;  4DQ2 A;  2DVJ A;  2JJ9 A;  1W6X A;  1QKW A;  3LH0 A;  1X01 A;  3M4G A;  2WDR A;  4GOU A;  3J9X 1;  2ESW A;  3HKS A;  5AQM B;  3BK9 A;  3CCE T;  3H3A A;  2KRO A;  1C1A A;  3CC4 A;  4RUG A;  2Y6X A;  2JS2 A;  2LT4 A;  2XQ4 A;  1HNZ T;  1WGS A;  2FL7 A;  3CMA Q;  4M7A E;  4ELY C;  1BR0 A;  2MBG A;  4GK5 E;  5J26 A;  4JZ4 A;  1WA7 A;  2RQT A;  4IUT A;  2IAK A;  1TUD A;  5DM7 R;  4PFZ A;  1Q7Y U;  3HHT B;  3C4Z A;  4CXW A;  2YLB A;  2AE9 A;  1IJ5 A;  3TQ7 P;  2JQH A;  1BU1 A;  5J2T E;  4KUD K;  2NW7 A;  2VWA A;  2F4V T;  3SWN A;  2CZ1 B;  1X27 A;  2V8J A;  5DY9 A;  6AT1 B;  1YJN T;  2FPF A;  3PUZ F;  1MMA A;  2KGT A;  4PJO C;  3TLT A;  4OB1 B;  2OA5 A;  2WDQ A;  1VQ6 Q;  3MEV A;  2E5V A;  2WSE E;  2P0P A;  2QAS A;  4IKF A;  2DE0 X;  2COY A;  2EFI A;  3S6W A;  2V26 A;  4LE9 A;  1QSD A;  2DL7 A;  1U06 A;  2MK5 A;  3WXM B;  3Q5E A;  2MF2 A;  4E2F B;  2NUP B;  3SEM A;  3OYC A;  4ZNX A;  2LRL A;  2OAU A;  2L3P A;  3UWN A;  1KNZ A;  1MMD A;  5D6X A;  1VQM T;  2YK0 A;  2RD1 A;  4ZGD B;  1I07 A;  3VS2 A;  5LNK A;  4A97 A;  1KC8 U;  2J6O A;  1M3B A;  3EDV A;  4P5N A;  4JI6 T;  3DKM A;  2VC8 A;  4DR7 T;  3PUV F;  1AD5 A;  3EHR A;  2NW8 A;  3PUG A;  1L0V A;  5AQR B;  4TWD A;  1BIA A;  3L2Z A;  2FBW A;  3S3O A;  4M77 G;  4C5I A;  2ZPF B;  4WW0 A;  3CXC P;  2BG9 C;  4N0A C;  3VS7 A;  5GJW B;  3HKD E;  5J2U E;  1IB8 A;  2SRC A;  4LF6 T;  2XIC A;  3SHW A;  4KGZ B;  4D6W A;  3T8O A;  5F3J A;  2X66 A;  3FB2 A;  4DBH A;  5HK0 A;  2LQN A;  4X1Y E;  4M78 E;  4LXC A;  1FJG T;  1YJN A;  3MP8 A;  2GNC A;  1GQE A;  3AVR A;  1AHJ B;  1M2V A;  1VQ8 A;  1IBL T;  2WAU A;  4PLI A;  1QUU A;  1N8R R;  2ROL A;  2XM1 A;  3EG3 A;  5CK9 A;  4LN2 A;  3IA3 A;  1WHG A;  4XQ3 A;  2J4G A;  1N9S A;  4EXT A;  3G4S A;  3ZJ1 A;  2BS4 A;  2WDV A;  2QDL A;  3HRT A;  4MHC A;  2HEQ A;  4IHJ E;  4X9C A;  1VQM A;  2A72 A;  5FU7 B;  2MYS A;  2QAZ A;  1M90 C;  1B34 B;  5AQI B;  3I0Q A;  4YXD A;  2RB6 A;  3HSB A;  2D9D A;  1Q86 C;  2KND A;  2X9W A;  3AA1 B;  4UVB B;  4PFP A;  1PC0 A;  2VXF A;  2E1H A;  3HRS A;  4UF0 A;  1ZSZ A;  2LJ3 A;  4ILA A;  2ZLY A;  2JMH A;  1BI2 A;  3OJA A;  5LJ3 f;  2MWP A;  2E10 A;  1QVG S;  3TLW A;  1S72 A;  2VQE T;  3WAK A;  2HD0 A;  1G3Y A;  4E7S A;  3ZN1 B;  4JI8 T;  3EFS A;  4CI3 B;  5CKF A;  3S3N A;  4XTU A;  2PVO B;  5LJ5 j;  2D0N A;  3PTR B;  5JQG E;  4QX8 B;  2CSI A;  2NUT A;  1ZSG A;  3EAE A;  3LW5 E;  2RQU A;  4DBR A;  1MIY A;  3CD6 Q;  5GAN f;  2RQR A;  4OMF B;  3ZFJ A;  1YKH B;  2OTL Q;  2KQW A;  5AQT B;  1WHK A;  2HQE A;  1I81 A;  3VRY A;  3A1P A;  3DLM A;  5DLQ E;  1E1H B;  2VKD A;  2KDS A;  5LGU B;  4IIM A;  3E22 E;  5KYN A;  4EMK A;  1NJI C;  4DMW A;  4CC7 A;  3C95 A;  4ZN3 A;  3FDR A;  1TG0 A;  4MBQ A;  2BZB A;  2QVA A;  1FMV A;  4NIQ A;  5J1G A;  4X1K E;  5D6W A;  1QVF A;  3RIU A;  3FZK B;  4AIU A;  4M7A F;  4B3M T;  4H63 V;  5L2L A;  4HWH A;  2LM2 A;  4HXJ A;  2M02 A;  3ASK A;  2DL1 A;  2CHO A;  5D6Y A;  4XZC A;  2XZE A;  1HTJ F;  2QTX A;  2XDP A;  2YUO A;  4FYY B;  5IHN A;  3VYH B;  1BK2 A;  4QXH B;  3Q1J A;  4ZTF A;  3ZC1 A;  1R0C B;  2OJ2 A;  3KBT A;  1BR4 A;  3P4W A;  4GBQ A;  1KEY A;  2ZAE A;  3CCU T;  5FVK A;  4NL2 A;  1NYG A;  1LKX A;  2YDR A;  2HMA A;  3CK6 A;  3ETV A;  2V5C A;  1AWO A;  4PL6 A;  4Z02 A;  3AEC A;  4OGE A;  1RAD B;  4YSZ A;  4M7A B;  3THK A;  4OMP A;  3JB9 H;  3DP7 A;  2P4R A;  4C91 A;  3ONJ A;  3N9Q A;  3KBU A;  2KE9 A;  1OU9 A;  2BS2 A;  3JRZ A;  1D1A A;  4LMJ A;  2GK9 A;  2V6Y B;  4HWF A;  4U2Y A;  4LF7 T;  1M30 A;  4O4J E;  3JAD A;  3CCS T;  3OYZ A;  3UU4 A;  5J0Z A;  3H41 A;  3ZC0 A;  3HKC E;  3K3O A;  4DV1 T;  2VV5 A;  4J7F A;  3PUS A;  4C0D B;  4C92 C;  5H6Q B;  2RJC A;  3GBQ A;  1RAC B;  4E7K A;  5KE2 A;  1N9R A;  4TWF A;  1TTH B;  2CXF A;  5GAN 3;  2W00 A;  4L6V 5;  2JMK A;  1YI2 T;  4XU3 A;  1E7P A;  3JCM e;  5AQO B;  1ABO A;  3M3Z B;  1RLQ C;  3M4Y A;  3TLU A;  3NGP A;  3GA8 A;  2E9X C;  5LG4 A;  1V9D A;  2FZC B;  2V1Q A;  2D6F A;  2YEV C;  4M78 F;  3QWY A;  1WFD A;  4IDO A;  2NWB A;  3IHR A;  3EAM A;  3P4S A;  4I50 E;  4C8Q D;  3C98 B;  1OEB A;  3OYY A;  1RAG B;  4BE2 A;  3S4U A;  1PRM C;  2CUB A;  3LJC A;  3PDY A;  3AA7 B;  3WI3 A;  1Q81 U;  2LHR A;  3GLX A;  1VUB A;  1ARK A;  3MKD A;  1OPK A;  2EYZ A;  2G3R A;  3IQL A;  4M77 E;  4WCI A;  5GAO m;  4ATO A;  3UF4 A;  1HCI A;  4TNW A;  4ZZB A;  5J3B A;  4YJ3 E;  2HQH A;  3NZQ A;  2RHI A;  1U5S A;  3QHS A;  3E0Z A;  3CCS A;  5AQU B;  3JAF A;  1JNR A;  2Q9Q A;  1YBY A;  2ZPE B;  1IRE B;  3E19 A;  1H3H A;  3O1I A;  4M78 B;  4ASK A;  1YQ4 A;  4H9R C;  1JXO A;  3VKG A;  2A9U A;  2LSI A;  5LHG B;  3OS0 A;  4VUB A;  4FL6 A;  1CHU A;  4WF2 A;  3SD4 A;  3CC7 T;  5JDG A;  2MWO A;  5HCM A;  2GQI A;  3AED A;  1YI2 A;  2KNB B;  4FI5 A;  2K3Y A;  3FBZ A;  3TSZ A;  2YRD A;  4C5E A;  5FP3 A;  1TU0 B;  3TU4 K;  2BUD A;  4WTO B;  1SSH A;  3CC2 T;  3FEO A;  1IO6 A;  2XUE A;  2B86 A;  2WZH A;  3RMS A;  5LOV E;  2O2O A;  3KVB A;  2LSK A;  5JVD E;  2LZ6 B;  1AOJ A;  3JSC A;  3CPW S;  5A0G A;  3PV0 F;  1ZP0 A;  3FC3 A;  3QKJ A;  2KYM A;  2LT1 A;  4EOZ B;  1MND A;  4N4G A;  2ZPB B;  4PJO G;  4XU1 A;  2UXB T;  1M2O A;  2HSP A;  3M53 A;  4OMN A;  2XHC A;  4HCC A;  2DWG A;  1QCO A;  1G8X A;  1X43 A;  2KT8 A;  4QW2 A;  3RQW A;  2KAF A;  4BB7 A;  3FB9 A;  1K9M U;  3EI0 A;  4WZX A;  3EDU A;  5GAN 5;  2DLR A;  3ZT6 A;  5JRC A;  3ZT7 A;  5GAO q;  2UUA T;  4M75 A;  2KMF A;  4AI6 A;  1XTD A;  7AT1 B;  3CC7 A;  4C90 A;  2EGA A;  5DAB A;  1G3T A;  2QQA A;  1X79 A;  1QVG P;  4EYU A;  3ZYL A;  3UDC A;  3PUX F;  4CC4 B;  2WU5 A;  3UA7 A;  2MOX A;  1UGS B;  1UJ0 A;  5LA6 E;  3UUB A;  2J6K A;  2EBP A;  4LF9 T;  2RMO A;  2DEQ A;  4IUP A;  4YHH T;  3CC2 A;  2BVM A;  3KXT A;  3M0T A;  1WNL A;  3HL6 A;  3MXZ A;  4LF4 T;  3A8Y C;  1WDX A;  4FJO A;  3RUX A;  4HVW A;  1PHT A;  2YUN A;  1WYB A;  1ZV4 X;  1SSF A;  2DFU A;  5LMN T;  1X6B A;  2RHU A;  1TS9 A;  1B07 A;  2VKN A;  2CRE A;  4AQY T;  2D5U A;  5ECA A;  4BY6 B;  3L2Q A;  4JLE A;  2JM9 A;  5FNV E;  1WJS A;  1MNE A;  4YSY A;  5CO7 A;  1CUN A;  3K3Q C;  2O88 A;  5HXH A;  2XAF B;  2HCK A;  4I0U A;  2CT4 A;  5DJQ C;  2X3W D;  5I2M A;  3A8O B;  4U72 A;  4U7Y A;  4UEM A;  2V7I A;  3SWN B;  4GK0 E;  4GYS A;  2KRN A;  1N34 T;  5IHI A;  3HI2 A;  5HCK A;  1X6G A;  2J6F A;  2JXB A;  1BYM A;  2O31 A;  4IDQ A;  4PW8 A;  2IIM A;  4RTW A;  1NE8 A;  4PK5 A;  3I0O A;  2QQB A;  4ZTJ A;  3CPF A;  2C06 A;  2DM1 A;  1OQK A;  1BB9 A;  1V1C A;  1T0J A;  3SDZ A;  3A8G B;  4F14 A;  1V29 B;  2IG0 A;  5HEH A;  4RTX A;  3GWH A;  2O9V A;  2YDQ A;  3BQL A;  5HKC A;  2L3L A;  3JCM d;  4P09 A;  1TH7 A;  1KD1 C;  1KC8 C;  3O1H A;  1I6Z A;  1Q82 R;  4EAH A;  2D8H A;  2YRC A;  4BI3 A;  5F8P A;  2ENM A;  2JTF A;  3NRX A;  3MEU A;  5CKE A;  2CLY B;  1J5W A;  3CCQ T;  1HR0 T;  4AMC A;  5AQQ B;  2ZPG B;  4M77 F;  3JCF A;  5DLO A;  4AKR B;  2BZX A;  5JDL A;  1AZE A;  1WHJ A;  4I43 B;  2DL4 A;  4LUE A;  3JB9 F;  3GN5 A;  2GFU A;  4MFR A;  4JJC A;  3JCM V;  2D0U A;  2DMO A;  3VS1 A;  5JR9 A;  2QQS A;  3OB9 A;  3NPF A;  3OYA A;  2C0T A;  1VQ7 A;  3ABV A;  3VS6 A;  3P4P A;  4M7D G;  2QQR A;  1WPY A;  2LSG A;  2OAW A;  3JCM P;  2RM4 A;  1C6V X;  4CN4 A;  3Q2M A;  2IVW A;  3B5M A;  4ZS3 A;  2CA5 A;  3K1S A;  2Z0W A;  3HP9 A;  2NWM A;  4F7U G;  1QLB A;  5C8Y E;  4J5Y A;  4BDY A;  2FZG B;  4YFS A;  3BFM A;  3NHN A;  8ATC B;  5LJN A;  1M2V B;  4XK8 E;  3OY9 A;  3DTO A;  3MA9 A;  1ZHI A;  2EQJ A;  3VS5 A;  1LRZ A;  2DO3 A;  5AQH B;  3J81 E;  2KEA A;  4M7A D;  4WBO A;  4DV6 T;  4RTY A;  3VS4 A;  1CKB A;  4J6X A;  4J9D A;  1N33 T;  1VQK Q;  1RAA B;  1UDL A;  1N32 T;  5FY1 A;  1OWA A;  1Q82 U;  1UUS A;  4RTV A;  4IE0 A;  2MAM A;  4RTZ A;  4M1P A;  1QW1 A;  3JCM g;  3JAM E;  2DTO A;  5IXF A;  1YJW A;  1VQP T;  3ULR B;  3CCQ A;  5LHI B;  4UF0 B;  4EB6 E;  1KNP A;  1ZSZ B;  4OB3 B;  1HNX T;  1J5E T;  2JN0 A;  2N2N A;  2UXC T;  2OTJ Q;  3PUR A;  2JMC A;  5IUX A;  2AZV A;  2R5A A;  1T3L A;  4HFC A;  5CGM A;  1OZ2 A;  1VA7 A;  2RPA A;  4JPB W;  3OMG A;  3EVY A;  2EHO A;  4AIS A;  4E7H A;  1GCQ C;  4HCB A;  1XNI A;  3I55 Q;  3CCM T;  2RP4 A;  4ZI2 D;  2NUT B;  1YW0 A;  2V8K A;  3UUX B;  4BD3 A;  1H8K A;  2UXX B;  4C92 G;  1YWO A;  3JCM h;  3V7R A;  4M75 E;  3X20 B;  5KYY A;  2F1L A;  2JRK A;  2PVD B;  2EVR A;  3FJ5 A;  2VKJ A;  5LBQ B;  3CC4 Q;  5ABH A;  4JS4 A;  2LRQ A;  5GMK h;  3C4X A;  2LKG A;  2UU9 T;  1X75 C;  3UFE A;  4CN1 A;  5DQV A;  1M3A A;  4MLK A;  4EMK B;  3V5S A;  2EQU A;  3L39 A;  2AKK A;  5KXJ A;  4JJD A;  3N2O A;  2CCQ A;  2D9T A;  2J47 A;  3QDF A;  5FKY A;  3CPW P;  4CC2 A;  3AXJ A;  2COZ A;  4DOW A;  2QA4 A;  3LBX A;  2QA7 A;  1VQP A;  3P8B B;  1JJ2 A;  3T1Y T;  4M78 D;  3I56 Q;  3X28 B;  5L4H A;  2V7L A;  2XAS B;  1I8F A;  5L3C B;  3CCL A;  1GXI E;  3RER A;  4KUI A;  4KH1 B;  2E9X A;  2LCC A;  3VR9 A;  5LGN B;  1MIV A;  3RNJ A;  4MZP A;  4NL3 A;  3A5X A;  2MI6 A;  4LF8 T;  3RIR A;  3HTR A;  3Q5X A;  2E64 A;  3CCM A;  4J9E A;  2C0I A;  4JRP A;  1KHC A;  3KV6 A;  2X67 A;  3G71 T;  2R57 A;  4C8Q C;  4PKC C;  1M8V A;  2PNI A;  1LVF A;  2RN8 A;  5HY6 A;  1UG1 A;  5LJM A;  1FMK A;  1Q95 G;  1E2A A;  3RR6 A;  3ZT5 A;  4LDX A;  5L23 A;  5GAM f;  4JV5 T;  1NEN A;  2XK0 A;  1SE7 A;  1Z0P A;  3QJ6 A;  4RCC A;  3LWH A;  4CZZ B;  1R8I A;  2KT1 A;  5FU6 B;  1BR2 A;  5LJ3 e;  2XSB A;  4X9D A;  4QQG A;  4IUQ A;  2NR4 A;  4FW2 A;  1T3S A;  2LDM A;  1YJN Q;  1HFA A;  2YU1 A;  3CQC B;  3IF8 B;  2YXY A;  5FWC A;  2DVE A;  1W0B A;  1VQ8 Q;  1YIJ T;  2DTI A;  5GMK i;  1VQN T;  5EC7 A;  5M4Y A;  3CCV T;  3PE0 A;  4X5T A;  2VVK A;  4HCZ A;  5GAO r;  2ZM6 T;  3H0F A;  4FSX A;  5GAN e;  9ATC B;  3G4S Q;  3CX6 B;  1CSK A;  2H3J A;  2NOX A;  1QVF S;  2FG0 A;  4IL4 A;  1K73 R;  1ZEE A;  4QH4 A;  1VQM Q;  3G71 A;  2LVM A;  1QWE A;  3AT1 B;  2NW9 A;  2DD5 A;  3HL8 A;  3ER0 A;  4Y28 E;  1FXX A;  3GIB A;  3AEE A;  3VRA A;  1MMN A;  2UXN B;  4H9Q C;  3N5L A;  5CR2 A;  3G6E T;  4OVA A;  5L3E B;  1T8B A;  2HPL A;  1OU8 A;  4ZOL E;  1S72 Q;  1WHL A;  5GAO n;  2DET A;  2Q9Q B;  3J7Y q;  1LVK A;  2A08 A;  3A98 A;  4KUM B;  1PD1 A;  2LNH B;  2K3W A;  3AE2 A;  4QHO A;  2C0O A;  1NYF A;  2HBW A;  4D8K A;  1VQ5 Q;  2DLP A;  4IST A;  1NG2 A;  5J39 A;  3FZH B;  1RAH B;  2E5Q A;  2J7I A;  2DF6 A;  2E65 A;  4UV8 B;  4AFS C; 
#chains in the Genus database with same CATH homology
 4F17 A;  4HKA A;  5GJV B;  1PWT A;  4MAL A;  2O9S A;  2KLQ A;  2DNX A;  3PUA A;  4G63 A;  1NEB A;  4AQG A;  3RYF E;  4XBF B;  2M0Y A;  2DYB A;  2F2V A;  3DJB A;  3ZYK A;  4OML A;  3ANW A;  3KDS E;  4PK6 A;  4A63 B;  1RUW A;  3W15 B;  4OMM A;  1ZLM A;  5JRC B;  5A1L A;  4X1I E;  4KRT A;  2YU2 A;  1OOT A;  1UJY A;  2ZM2 A;  4HFV A;  4AQF A;  1S35 A;  4GYR A;  2Z6E A;  3AAI A;  3RX6 A;  3M65 A;  1UTI A;  4TV9 E;  5CA0 E;  1US7 B;  3GMI A;  3IEE A;  1NLP C;  5FXZ A;  1Y57 A;  3RRW A;  2K3B A;  4F6R C;  2XQY A;  1XOV A;  1HD3 A;  2J1D G;  4ORZ A;  3SRZ A;  4AKG A;  4UXN B;  4IE4 A;  3L09 A;  4ZS2 A;  2FEI A;  5LBM A;  1VYT A;  4K0U A;  1SRL A;  1HS7 A;  2ODV A;  3FBL A;  2BDE A;  3VS0 A;  2K2M A;  3C51 A;  3I5S A;  2VL8 A;  1PKT A;  2PG8 A;  5KDM C;  1AEY A;  4O4I E;  1NWM X;  5H6R B;  3TKL B;  4HE8 A;  4LUD A;  1D1C A;  5DQW A;  2X68 A;  4QX7 B;  1LCK A;  2EKH A;  5CB4 E;  4UVA B;  2IC6 A;  2AZS A;  3CQG B;  2EW3 A;  2WBL A;  3GN5 B;  1WYX A;  1GFD A;  5JR9 B;  3ZYM A;  3KV4 A;  1M8M A;  3EHQ A;  1NAF A;  4A56 A;  4BJM A;  3FXD B;  2AKL A;  1ZKE A;  2L3Q A;  3EUH A;  4PJN A;  4BJN A;  2DRK A;  3ETU A;  4I55 E;  2W0Z A;  2KIN B;  3U78 A;  1SHG A;  4AG1 C;  2VK9 A;  1QLY A;  2X9Y A;  3CPZ A;  2Y48 B;  3ZMS B;  1GBR A;  5L3B B;  3D0T A;  3RH3 A;  4M4Z A;  4AKL A;  1U5P A;  3LFM A;  1OV3 A;  1H7C A;  3TVT A;  3FXE B;  3I1A A;  2LOS A;  1BR1 A;  4J9H A;  4IGU A;  5LGT B;  5IHY A;  2V7J A;  2CE7 A;  2EHO B;  1M3C A;  4LNP A;  3VRZ A;  2V1D B;  2N1G A;  2NP9 A;  4OFZ A;  1I0C A;  1BBZ A;  4ADZ A;  1GBQ A;  3CKD A;  4YLH A;  2W10 A;  2K9G A;  2LE8 A;  3LG7 A;  4PFO A;  1RI9 A;  2WWU A;  2XMF A;  1ZUY A;  1K0X A;  3I9Q A;  2I0N A;  4D8D A;  3QWX X;  2CDT A;  5HXE A;  1YKE B;  3LK4 2;  3M0P A;  4Z8A A;  3LBX B;  4O2B E;  1ZUK A;  2Q9Q D;  4RTT A;  3C0C A;  2SEM A;  2RA1 A;  3WAJ A;  1MV0 B;  4JZ3 A;  5LXT E;  1JO8 A;  2L8K A;  2EGC A;  3ESL A;  1K76 A;  4EZH A;  1X69 A;  4ILU A;  4R0K A;  2LMJ A;  1UX5 A;  2IW5 B;  5FY7 A;  4KBM B;  4Z8X A;  3N2G E;  3N9L A;  4TX5 A;  3OKQ A;  2A36 A;  2GTO A;  1WR6 A;  5FMN A;  4KP3 C;  4QXC B;  2LT3 A;  3R84 B;  2K48 A;  3NMZ C;  3HKB E;  2WMN A;  2WM9 A;  2DRM A;  2DI4 A;  1YP5 A;  3F2E A;  2LSJ A;  1YNZ A;  4AFQ C;  1UHC A;  4JUY A;  2CXD A;  3N9N A;  3VU7 H;  3KFV A;  2KXP B;  3KVA A;  1WLX A;  2G0U A;  2L2P A;  1AWW A;  4IE5 A;  1VYU A;  2CLY C;  3VS3 A;  4BA9 A;  1OPL A;  3ZL7 C;  2WMO A;  3REA B;  1Z9Z A;  3SOL A;  1MUZ A;  2ABL A;  4HCK A;  2J06 A;  2DCF A;  2HPJ A;  4UIG A;  5HWX A;  1SHF A;  2C0S A;  2LEH A;  4ZI3 D;  3F57 A;  4PAG A;  4O4L E;  2PTK A;  2ZMA A;  2IC9 A;  3HR0 A;  2H7V C;  5TAO A;  2E5K A;  1M27 C;  5EZY E;  5CA1 E;  4H9O C;  1NLO C;  3CX8 B;  4QXB B;  1Z9Q A;  2YDL A;  1UE9 A;  2YUP A;  3M0R A;  3PUQ A;  3ANW B;  3FHN A;  2Y8D A;  3PVQ A;  5LHH B;  3P8C D;  3EG0 A;  3CML A;  1WXB A;  2FO0 A;  1FMW A;  2EYY A;  2RF0 A;  2L0A A;  1WI7 A;  4PNI A;  2LCS A;  1W1F A;  3CX7 B;  3P7I A;  5L3F B;  2V7M A;  3M0S A;  5KX5 E;  5FXV A;  1ABQ A;  3I5R A;  1GL5 A;  1WYC A;  3RYI E;  4UEL A;  3VKH A;  3PVL A;  5JDH A;  2DA9 A;  3ONX A;  1GCP A;  4QT7 A;  4V1A v;  2HH7 A;  2CXL A;  2DL5 A;  4G2A A;  4J2C A;  4GLM A;  3RC8 A;  3N9P A;  2EHO D;  3LK3 B;  3EG1 A;  1HJD A;  2LX7 A;  2RQW A;  3BQI A;  3AAE B;  3C64 A;  1E6G A;  3MJX A;  1X2Q A;  1O3X A;  1WFW A;  4WBN E;  5EK3 A;  5FYM A;  2JPF A;  4L5G A;  1SPK A;  1RLP C;  3ZCI A;  1VRB A;  4PK4 A;  2FRW A;  5JH7 E;  3Q5W A;  2KZ7 B;  2ROT A;  1J3T A;  2XAG B;  2D2S A;  2K7A A;  4HN9 A;  1PRL C;  1JU5 C;  4OMO A;  2MTQ A;  4TN7 B;  5HXC A;  3U23 A;  2E9X D;  1K1Z A;  2MIO A;  2EYW A;  2W63 A;  2ZM8 A;  4L0R A;  3RRC A;  2VWF A;  2KWI B;  1VYV A;  4DO0 A;  2BTT A;  1OXZ A;  4P0B A;  2JW4 A;  2KYB A;  4J9F A;  1KK7 A;  3SWH A;  3O9X A;  4FSS A;  1Y64 B;  3HA4 A;  2Q9Q C;  2LSY A;  2K9A A;  1B3Q A;  1FYN A;  1WLP B;  1K4U S;  2V1R A;  3E08 A;  1KJW A;  2PZ1 A;  3C50 A;  3O1J A;  1IZN B;  3JC6 D;  5ETW A;  1MV3 A;  5JDF A;  3OBV E;  3B13 A;  4J9B A;  4HEA A;  2OI3 A;  4F16 A;  2H7O A;  3BQK A;  4XAX B;  4JEU B;  1MIW A;  1MMG A;  3CWZ B;  2A37 A;  4K11 A;  2JS0 A;  4B6X A;  4BAY B;  2ECZ A;  2VB6 A;  3QK6 A;  3RKO A;  4OYK A;  4H9S E;  2JTE A;  2M67 A;  5FWB A;  5EK4 A;  2KBT A;  1KIK A;  4OK0 A;  1YCS B;  4J9I A;  2DBM A;  1Y0M A;  2JQQ A;  2NUZ A;  2W0G A;  2ZM0 A;  2D0T A;  2K24 A;  2DNU A;  2ODU A;  4AKH A;  1SHZ C;  1WIE A;  3M0U A;  1UUE A;  1ZBJ A;  1H92 A;  1E6H A;  1PKS A;  4CC3 A;  3IBP A;  2YIN A;  5AFU L;  3KV5 A;  1HG2 A;  3UUM A;  4L9I A;  3ZCJ A;  1IAP A;  5EK2 A;  2KT9 A;  1IJ6 A;  1SA0 E;  3O4X E;  4RTU A;  3ZPO A;  1ZUU A;  1UX4 A;  1D0Y A;  3PU3 A;  2CM0 A;  4NUV A;  3SS1 A;  2LM9 A;  1YN8 A;  1X2K A;  2X3X D;  4X20 E;  4ZI3 C;  4AKI A;  2KXC A;  3H0I A;  1G83 A;  4UV9 B;  1QCF A;  2CMR A;  3KIN B;  3NRY A;  2CWO A;  5LYJ E;  1FEW A;  2KRM A;  2FRY A;  2XAH B;  3C4W A;  2DX1 A;  2X0L B;  4EIK A;  4E7Z A;  2X9H A;  2C5K T;  5FXW A;  2CH4 W;  3UA6 A;  5IYZ E;  4JJB A;  5JR9 C;  2KWH A;  2N9D A;  2AK5 A;  4TZ4 C;  2DBK A;  4CXX A;  1UFF A;  3UUL A;  3RYH E;  2H8H A;  4QWN B;  3I9Y A;  1SEM A;  3H0H A;  4DEX A;  3ZMZ B;  2EGE A;  5FW9 A;  2CH4 A;  4OHF A;  2C5J A;  5HXS A;  2RQV A;  2RNA A;  3RBB B;  1GCQ A;  1UEC A;  1YD8 G;  3OYX A;  4ZI2 C;  1EFN A;  2L9Q A;  5IH2 A;  3I35 A;  2EHO C;  4CXY A;  3LK2 B;  2BZY A;  2BZ8 A;  1E7O A;  2XAQ B;  2D1X A;  2DWK A;  3ZMV B;  2ES0 A;  2DHR A;  1AVZ C;  1G73 A;  3NBX X;  1EZ3 A;  4CI1 B;  1AJ3 A;  1AWX A;  5IXB A;  5HYA A;  2PFV A;  2XAJ B;  4ISS A;  4CI2 B;  4DEY A;  4TUY E;  1ZHC A;  2A3D A;  3U3I A;  1AZG B;  3ZLI A;  3B57 A;  4X1V A;  5JDQ A;  4H9P C;  4H63 H;  1FIO A;  4N78 D;  3LH5 A;  1UGV A;  2YT6 A;  1HG5 A;  2XHE B;  3RPU A;  1S94 A;  2MOZ A;  5ADX L;  3V5U A;  2FPE A;  4EZ4 A;  3CVR A;  5KMG P;  2DL8 A;  2CEA A;  2C5I T;  5FXX A;  5GON E;  1SRM A;  2VKO A;  5LP6 E;  1WRD A;  4ANJ A;  5I11 A;  1B7T A;  2SPC A;  3ZN0 B;  2G6F X;  2K5B B;  2QGS A;  3AVS A;  2E9X B;  4Z89 A;  1GRI A;  3I9W A;  3MK7 C;  2D8J A;  1T98 A;  1WXU A;  1D1B A;  2LP5 A;  4EYY R;  3JV3 A;  2M51 A;  1UCU A;  4DMV A;  3JC6 C;  3N2K E;  5HWY A;  1W70 A;  2DJQ A;  2XTL A;  2GGR A;  4Z88 A;  5JRE A;  2X9X A;  2GBQ A;  1K0S A;  4DND A;  2KRS A;  1JEG A;  3N9O A;  4ZI7 E;  3QUJ A;  1QWF A;  2F2W A;  3K3N A;  4IIO A;  2YSQ A;  4J9C A;  5LCY A;  5JDN A;  3AB3 B;  2EQI A;  4PJM A;  5HXR A;  4IIJ E;  5JDM A;  3UAT A;  1HSQ A;  2ED0 A;  3HKE E;  2F2X A;  3QC9 A;  2DIL A;  2FPD A;  2X51 A;  2NTY A;  5I22 A;  1N5Z A;  3UT5 E;  3VHL A;  2JT4 A;  2RPN A;  4I4T E;  1HX8 A;  2K79 A;  3REB B;  2L3S A;  1D0Z A;  4J9G A;  2CUD A;  1QKX A;  4EIW A;  4Y92 A;  1U3O A;  2LHN A;  1NEG A;  3EG2 A;  1KSW A;  2JM8 A;  2NTX A;  1CKA A;  3N9M A;  2DL3 A;  1KFZ A;  4O2A E;  4IE6 A;  2LOP A;  1A0N B;  4DBQ A;  2A28 A;  3KV9 A;  4AQF C;  3L3P A;  4O8S A;  5FY0 A;  4OYJ A;  3F31 A;  3K8P C;  1YWP A;  4AG2 C;  3Q9D A;  4KMC A;  2HDA A;  4CQI A;  1ZX6 A;  2VKH A;  3AAA B;  1WX6 A;  4UVC B;  4JEH B;  5IHK A;  3UUN A;  2H3R A;  1PNJ A;  4TV8 E;  4E6R A;  2E8I A;  3MZK B;  2CSQ A;  3MAC A;  3ZJ2 A;  5BMV E;  3ZEF B;  3EGU A;  1G2B A;  1S1N A;  4HTE A;  1HF8 A;  4IDZ A;  2V7K A;  2EYX A;  4OMQ A;  2CWY A;  2PJQ A;  3RC3 A;  1T0H A;  1U4Q A;  4H9N C;  1GFC A;  2K6D A;  3NZP A;  4HVU A;  5L3D B;  4AFU C;  3RYC E;  2LQW A;  3CQT A;  2YUQ A;  1WXT A;  3AA0 B;  3ZMU B;  2BVL A;  1K9A A;  1TUC A;  1I1J A;  4AXP A;  2VAS A;  3UTK A;  2W61 A;  4PJJ A;  5L3G B;  3CQX C;  3M0Q A;  4HGA A;  4NUU A;  4QKN A;  2LJ0 A;  2LJL A;  4IE7 A;  2W62 A;  2P9B A;  3AA6 B;  4DVD A;  4WNK A;  4YJ2 E;  2ED1 A;  3PU8 A;  2CT3 A;  2J05 A;  4YHJ A;  4AFZ C;  3O5Z A;  1UHF A;  4GIW A;  1NM7 A;  2KR3 A;  2I59 A;  5HAX A;  2EPD A;  2JMA A;  1D0X A;  1VOM A;  1JQQ A;  2KXD A;  4PJL A;  4O4H E;  1JXM A;  3KFW X;  3ZMT B;  2B1E A;  1AWJ A;  4HVV A;  3TSW A;  2WSS V;  2ACX A;  2A2F X;  2LJ1 A;  2MCN A;  2GTJ A;  4P0A A;  4ESR A;  3R6N A;  5E0O A;  3H37 A;  4ERR A;  4ZHQ E;  4U74 A;  2PBI A;  2DVJ A;  2JJ9 A;  1W6X A;  1QKW A;  4GOU A;  3J9X 1;  2ESW A;  3BK9 A;  3H3A A;  2KRO A;  4RUG A;  2Y6X A;  2JS2 A;  1BR0 A;  2MBG A;  4GK5 E;  4JZ4 A;  1WA7 A;  2RQT A;  2IAK A;  1TUD A;  3C4Z A;  4CXW A;  1IJ5 A;  1BU1 A;  5J2T E;  2NW7 A;  2VWA A;  1X27 A;  2FPF A;  1MMA A;  2KGT A;  2OA5 A;  2DE0 X;  2V26 A;  4LE9 A;  1QSD A;  2DL7 A;  1U06 A;  3SEM A;  4ZNX A;  2L3P A;  1KNZ A;  1MMD A;  2YK0 A;  1I07 A;  3VS2 A;  5LNK A;  2J6O A;  1M3B A;  3EDV A;  1AD5 A;  3EHR A;  2NW8 A;  3PUG A;  4WW0 A;  3VS7 A;  5GJW B;  3HKD E;  5J2U E;  2SRC A;  3SHW A;  3T8O A;  5F3J A;  2X66 A;  3FB2 A;  2LQN A;  4X1Y E;  2GNC A;  3AVR A;  2WAU A;  1QUU A;  2ROL A;  3EG3 A;  4LN2 A;  4EXT A;  3ZJ1 A;  2QDL A;  4MHC A;  2HEQ A;  4IHJ E;  2A72 A;  2MYS A;  3I0Q A;  2KND A;  2X9W A;  3AA1 B;  4UVB B;  4PFP A;  4UF0 A;  2LJ3 A;  2ZLY A;  2JMH A;  3OJA A;  3WAK A;  4E7S A;  3ZN1 B;  4CI3 B;  2D0N A;  3PTR B;  5JQG E;  4QX8 B;  2CSI A;  1ZSG A;  2RQU A;  4DBR A;  1MIY A;  2RQR A;  1YKH B;  3VRY A;  1E1H B;  2VKD A;  5LGU B;  4IIM A;  3E22 E;  4DMW A;  4CC7 A;  1TG0 A;  4MBQ A;  2BZB A;  1FMV A;  5J1G A;  4X1K E;  4H63 V;  5L2L A;  4HXJ A;  4XZC A;  1HTJ F;  2YUO A;  5IHN A;  1BK2 A;  4QXH B;  3ZC1 A;  2OJ2 A;  3KBT A;  1BR4 A;  4GBQ A;  1NYG A;  1LKX A;  3ETV A;  1AWO A;  3THK A;  4OMP A;  3DP7 A;  2P4R A;  4C91 A;  3N9Q A;  3KBU A;  2KE9 A;  1D1A A;  2GK9 A;  1M30 A;  4O4J E;  3OYZ A;  3H41 A;  3ZC0 A;  3HKC E;  3K3O A;  3PUS A;  5H6Q B;  3GBQ A;  2CXF A;  2W00 A;  2JMK A;  1ABO A;  1RLQ C;  3NGP A;  3GA8 A;  2E9X C;  5LG4 A;  1V9D A;  2V1Q A;  2YEV C;  3QWY A;  2NWB A;  3IHR A;  4I50 E;  3C98 B;  1OEB A;  3S4U A;  1PRM C;  2CUB A;  3LJC A;  3PDY A;  3AA7 B;  3WI3 A;  2LHR A;  1ARK A;  3MKD A;  1OPK A;  2EYZ A;  3IQL A;  4WCI A;  3UF4 A;  1HCI A;  4YJ3 E;  3NZQ A;  1U5S A;  3E0Z A;  2Q9Q A;  1H3H A;  3O1I A;  4ASK A;  4H9R C;  1JXO A;  3VKG A;  2LSI A;  5LHG B;  5JDG A;  2GQI A;  2KNB B;  4FI5 A;  3FBZ A;  3TSZ A;  5FP3 A;  1SSH A;  1IO6 A;  2XUE A;  2B86 A;  5LOV E;  2O2O A;  3KVB A;  2LSK A;  5JVD E;  2LZ6 B;  1AOJ A;  2KYM A;  4EOZ B;  1MND A;  2HSP A;  4OMN A;  2DWG A;  1G8X A;  1X43 A;  2KT8 A;  3EDU A;  2DLR A;  5JRC A;  2KMF A;  4AI6 A;  4C90 A;  2EGA A;  5DAB A;  1X79 A;  4EYU A;  3ZYL A;  4CC4 B;  3UA7 A;  2MOX A;  1UJ0 A;  5LA6 E;  2J6K A;  2EBP A;  2RMO A;  2BVM A;  3M0T A;  3HL6 A;  3MXZ A;  1WDX A;  4FJO A;  4HVW A;  1PHT A;  2YUN A;  1WYB A;  1ZV4 X;  1X6B A;  1B07 A;  2VKN A;  2CRE A;  2D5U A;  5ECA A;  4JLE A;  2JM9 A;  5FNV E;  1MNE A;  1CUN A;  3K3Q C;  2O88 A;  5HXH A;  2XAF B;  2HCK A;  2CT4 A;  5DJQ C;  2X3W D;  4U72 A;  4UEM A;  2V7I A;  4GK0 E;  4GYS A;  2KRN A;  5IHI A;  3HI2 A;  5HCK A;  1X6G A;  2JXB A;  2J6F A;  2O31 A;  4PW8 A;  2IIM A;  4RTW A;  4PK5 A;  3I0O A;  2DM1 A;  1V1C A;  1BB9 A;  1T0J A;  4F14 A;  4RTX A;  3GWH A;  2O9V A;  3BQL A;  2L3L A;  4P09 A;  3O1H A;  4EAH A;  2D8H A;  5F8P A;  2ENM A;  3NRX A;  2CLY B;  4AKR B;  2BZX A;  5JDL A;  1AZE A;  4I43 B;  2DL4 A;  4LUE A;  3GN5 A;  4MFR A;  4JJC A;  2D0U A;  2DMO A;  3VS1 A;  5JR9 A;  3NPF A;  2C0T A;  3VS6 A;  2LSG A;  2OAW A;  3Q2M A;  4ZS3 A;  2CA5 A;  2NWM A;  5C8Y E;  4YFS A;  3NHN A;  5LJN A;  3DTO A;  3MA9 A;  3VS5 A;  1LRZ A;  2KEA A;  4WBO A;  4RTY A;  3VS4 A;  1CKB A;  4J9D A;  1UDL A;  5FY1 A;  1OWA A;  4RTV A;  4IE0 A;  4RTZ A;  4M1P A;  5IXF A;  3ULR B;  5LHI B;  4UF0 B;  4EB6 E;  2N2N A;  3PUR A;  2JMC A;  2AZV A;  1T3L A;  1VA7 A;  4JPB W;  3EVY A;  2EHO A;  1GCQ C;  2RP4 A;  4ZI2 D;  1YW0 A;  3UUX B;  1H8K A;  2UXX B;  1YWO A;  2JRK A;  2EVR A;  3FJ5 A;  2VKJ A;  5LBQ B;  3C4X A;  3UFE A;  5DQV A;  1M3A A;  4MLK A;  3V5S A;  2AKK A;  4JJD A;  3N2O A;  2CCQ A;  4CC2 A;  3LBX A;  2QA7 A;  2V7L A;  2XAS B;  5L3C B;  2E9X A;  5LGN B;  1MIV A;  3RNJ A;  3A5X A;  3Q5X A;  4J9E A;  2C0I A;  3KV6 A;  2X67 A;  2PNI A;  1LVF A;  2RN8 A;  1UG1 A;  5LJM A;  1FMK A;  5L23 A;  1Z0P A;  4CZZ B;  2KT1 A;  1BR2 A;  1T3S A;  1HFA A;  2YU1 A;  3CQC B;  3IF8 B;  5FWC A;  5EC7 A;  5M4Y A;  3PE0 A;  2VVK A;  3H0F A;  3CX6 B;  1CSK A;  2NOX A;  2FG0 A;  1ZEE A;  1QWE A;  2NW9 A;  1MMN A;  2UXN B;  4H9Q C;  3N5L A;  5L3E B;  2HPL A;  4ZOL E;  2Q9Q B;  3J7Y q;  1LVK A;  2A08 A;  3A98 A;  4KUM B;  2LNH B;  4QHO A;  2C0O A;  1NYF A;  2HBW A;  4D8K A;  2DLP A;  4IST A;  1NG2 A;  2J7I A;  2DF6 A;  4UV8 B;  4AFS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...