3R6NA

Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin plakin domain
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
450
structure length
450
Chain Sequence
SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a rigid four-spectrin-repeat fragment of the human desmoplakin plakin domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Desmoplakin
total genus 171
structure length 450
sequence length 450
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17902 SH3_10 SH3 domain
A PF18373 Spectrin_like Spectrin like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1060 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA02
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3r6nA03
2KRNA 1OPLA 2KGTA 2GGRA 2C0TA 1PKTA 1XOVA 2AKKA 2FPEA 2PZ1A 1MUZA 1Y57A 1CSKA 1UECA 5FWCA 2DBKA 1TG0A 3EG1A 1OPKA 2O31A 5ECAA 3VS4A 2LX7A 2HDAA 4DEXA 1J3TA 5J1GA 1ARKA 2C0IA 1JQQA 2DL7A 4RTUA 3VS6A 4F16A 2K9GA 2FPDA 1MV3A 1K0SA 4Z89A 2L3QA 2DL8A 2KNBB 3M0RA 1UGVA 1S1NA 1VYUA 2K79A 2GNCA 2IIMA 4CC4B 2NUZA 1WX6A 1JU5C 2RNAA 2AZVA 2DRMA 1W6XA 1FMKA 3FJ5A 2EGCA 1WLPB 2HEQA 5EC7A 2FPFA 2MIOA 4OMPA 2J6KA 2RF0A 2ED0A 4Y92A 1ABQA 2K6DA 2W0ZA 3JV3A 2ECZA 2I0NA 1QLYA 2HSPA 4HXJA 4RTWA 1GFCA 1ZLMA 1WI7A 2A36A 2JW4A 1UHCA 3KBTA 1K0XA 3NPFA 4KRTA 2CT4A 4J9GA 1JEGA 2SRCA 1ZUUA 1SSHA 2YUNA 2HBWA 2FO0A 2ESWA 1V1CA 2EW3A 4RTVA 1OV3A 1K1ZA 1E6HA 1UUEA 2X3XD 2DYBA 2A28A 2CH4A 2X3WD 4OMOA 1QKXA 2VVKA 2RQUA 2O2OA 5IXBA 1ZBJA 5HCKA 3R6NA 2CT3A 1Y0MA 3EG0A 3M0SA 4LN2A 4K11A 2BZXA 2O88A 1X69A 4RTZA 3VRZA 3RBBB 2O9VA 1NYFA 1M30A 2GBQA 2FG0A 1X2QA 1UE9A 1AEYA 2KXCA 1WA7A 4GLMA 3H0FA 2GTJA 4JJDA 2EPDA 1CKBA 4HVVA 4X1VA 4J9IA 2O9SA 4JJBA 5IH2A 2D1XA 1H8KA 2CUDA 2B86A 2QDLA 3RNJA 4F17A 2CREA 2ROTA 2DNUA 2OAWA 2RQTA 5IHKA 3C0CA 3EGUA 3EHQA 4IIOA 1SEMA 1WYXA 1SHGA 3O5ZA 1BU1A 2LMJA 1VYVA 1T0JA 3I9QA 3UF4A 2F2VA 4RTTA 5IXFA 1MV0B 1M3AA 2FEIA 2J05A 3M0QA 2DX1A 1AWXA 2F2WA 2ENMA 2YUOA 1AWWA 2KT1A 2OJ2A 2AKLA 2DBMA 1H3HA 2KR3A 2BTTA 1QWEA 1PNJA 1QWFA 1UG1A 5I11A 4QT7A 1B3QA 1WFWA 1PKSA 1U3OA 1X43A 2LZ6B 4AFSC 3UA6A 1UTIA 3TSZA 2YUPA 4OMQA 1AWJA 2K7AA 2RMOA 2D0NA 1QCFA 2CH4W 1RI9A 2KRSA 1G2BA 1B07A 1NEBA 3ZL7C 5I22A 1NYGA 1AZEA 1UDLA 2DVJA 2LP5A 1OOTA 3QWYA 2KBTA 1M3CA 2DA9A 2KRMA 1JO8A 3H41A 2KEAA 1QKWA 1JXMA 4J9CA 1ZSGA 4J9EA 2G6FX 1A0NB 1GCQA 3THKA 3VS1A 1I0CA 3F57A 1G8XA 1SRLA 2JXBA 2BZ8A 3QWXX 2RPNA 2JMCA 1NM7A 1RLQC 1AOJA 4HCKA 2L2PA 3NGPA 3M0TA 4OMLA 4HVWA 1SHFA 2EYXA 2MOXA 2LNHB 3H0HA 4HVUA 2KE9A 2V1QA 3EG3A 1PRMC 2JM8A 3TVTA 4RTYA 3NHNA 1K76A 1YNZA 1T3LA 1G83A 3EDVA 3GBQA 3TSWA 1T0HA 3A98A 2A08A 2RQRA 2C0OA 3M0UA 1N5ZA 1K9AA 1TUDA 1BBZA 1OEBA 2KXDA 2DRKA 3REBB 1AZGB 4OMMA 2CSQA 1LCKA 3LH5A 1WDXA 4RTXA 2GQIA 2KYMA 2ABLA 1HSQA 4ESRA 3ULRB 2DL5A 4CC3A 4EIKA 1Z9QA 2L0AA 2LJ1A 2L3SA 2CSIA 4M4ZA 2JM9A 4CC7A 1NLPC 2EYYA 1M3BA 2A37A 1W70A 3M0PA 3EG2A 2YUQA 1FYNA 3KBUA 4AG2C 1ZUYA 1IO6A 2DMOA 2W10A 3VS0A 1KIKA 1PWTA 3EDUA 1UJYA 2EGEA 2JMAA 1GBQA 4DEYA 1KSWA 1ZX6A 4GBQA 2LCSA 1PRLC 1HD3A 4J9DA 2L3PA 2H8HA 4AFQC 1WXUA 1GFDA 3PE0A 4F14A 2EYWA 5FW9A 2DLPA 2J7IA 1E6GA 4IIMA 4A63B 1X6GA 2RN8A 1GCPA 1VA7A 2M0YA 2PNIA 1YN8A 2CDTA 1T3SA 3I5SA 4AFZC 2AZSA 1NEGA 1WXTA 1E7OA 2F2XA 4LUEA 4AG1C 1AD5A 2KT8A 1HJDA 3CQTA 2YT6A 2EBPA 2DL4A 3NMZC 4D8DA 1VYTA 2OI3A 2KROA 2XMFA 1TUCA 4WCIA 1SPKA 1I1JA 1YWOA 2EGAA 2LJ3A 1K4US 2EYZA 1H92A 1KFZA 4JZ4A 3PVLA 4E6RA 2JS0A 3PDYA 2IAKA 1X2KA 4ORZA 2J06A 1U06A 1RUWA 3UATA 3VS2A 2D8HA 5L23A 1NLOC 2JS2A 3UA7A 2FRYA 2BZYA 4Z88A 1BK2A 1UJ0A 1UFFA 4JJCA 3PVQA 2DL3A 2FRWA 2GTOA 4J9FA 4LNPA 3KFVA 1AWOA 3I5RA 2ED1A 4JPBW 3H0IA 4JZ3A 1PHTA 2CUBA 1EFNA 3EHRA 2YSQA 1X27A 4AFUC 4FSSA 2YDLA 2RQWA 1Z9ZA 3REAB 3IQLA 5GJVB 4J9BA 4D8KA 2SEMA 2DILA 5IHNA 2EKHA 1M8MA 2RQVA 2J6FA 4R0KA 4LE9A 1RLPC 1ABOA 2M51A 2DJQA 2E5KA 4LUDA 4CC2A 2PTKA 1W1FA 3U23A 1YP5A 1SRMA 2LQWA 4J9HA 1ZUKA 3I35A 2HCKA 3SHWA 2P4RA 2V1RA 2EQIA 1WXBA 1U5SA 2AK5A 2ROLA 4ZNXA 1WIEA 2VKNA 1GBRA 2DE0X 4OMNA 5GJWB 3VS7A 2EVRA 3VS3A 2JT4A 2DM1A 2D8JA 1UHFA 1I07A 1M27C 2J6OA 3SEMA 1KJWA 2MCNA 2K3BA 5IHIA 1NG2A 1JXOA 2VWFA 1GCQC 2KYBA 1YWPA 1GRIA 1X6BA 2DF6A 2K2MA 2LQNA 1GL5A 5FWBA 4Z8AA 3VS5A 2JTEA 1AVZC 2LJ0A 4RUGA 2NWMA 1BB9A 1YCSB 1CKAA 3VRYA
chains in the Genus database with same CATH superfamily
4IL4A 4YXDA 2KGTA 3AE5A 5J39A 3A8MB 3Q5DA 2X66A 1T98A 2NUTA 3EGDA 3HRUA 3CD6Q 2FPEA 2V7JA 4X5TA 2PZ1A 1YIJT 1UK5A 1MUZA 2QA4A 1UECA 4P1NA 4OGCA 3C4WA 4EAHA 1Y64B 1WHJA 1VQKA 2VWAA 5LJNA 2UUBT 1J3TA 3AAAB 1JQQA 3VS6A 2I59A 2A3DA 2E64A 1KC8C 1MV3A 1K0SA 3X26B 2L3QA 2K79A 2GNCA 2BKNA 2R5AA 2IIMA 5KDMC 4PW8A 2ATCB 1OU8A 1N27A 1W09A 2EJFA 1VQKT 1IREB 2MPKA 1UB4A 1QQJA 1WQ7A 2X9YA 2DRMA 2W66A 1I4K1 2FL7A 4N4GA 3AE8A 1BR4A 2KMFA 5J2UE 3CX7B 2EGCA 5EC7A 3VYGA 2V5DA 3DJBA 2LVMA 3RF1A 2X4JA 4M75B 2BG9C 3JB9D 5GANg 4QH5A 1O9SA 3CC7T 4JRIA 2J6KA 3GN5A 4OK0A 1WQWA 2QA4Q 3HSBA 4PJOC 4JDSA 5CKEA 1WR0A 4F7UB 3CMAA 2FHDA 2C5IT 1OZ2A 4BUGA 1QLYA 1KFYA 2XQAA 2QQSA 2D9TA 1SHZC 3CPWS 1VRBA 3AEFA 2DD4A 1VQ9T 1UHCA 3C94A 2XICA 3EFOB 3JB9I 4IL9A 1KC8R 4YTPA 4EXTA 1M5Q1 1ZUUA 4FJOA 4FSXA 3UQ7A 1SSHA 5A0DA 1V1CA 4ZOLE 4RTVA 2LHNA 3CVRA 5CJ5A 4DBRA 3G7ZA 2RQUA 4JRKA 2HQHA 5HCKA 3R6NA 3FZFB 1Y0MA 1IAPA 3ZSTA 3M0SA 4ZI2C 4K11A 1VQ8T 2EHOB 3N9OA 4QW2A 5L4EA 3VRZA 4C91A 3QXEB 2E4HA 4JI5T 2FG0A 2KXCA 2MK5A 3CC4Q 2K5LA 4KH1B 3OYCA 2CXDA 4GLMA 2RHZA 5LBMA 3T1YT 1QMCA 3H0FA 2NW7A 2JQHA 2A0FB 1UX4A 3UU4A 4J9IA 2XSBA 4C8QF 2D1XA 4B9XA 5ABHA 1ZA1B 1U1SA 2OAWA 3OVUA 3OYBA 1G73A 5IHKA 4IIOA 1ZSZA 2WDQA 5JRCA 1SEMA 4RMOA 1PM3A 2V5CA 3C4XA 3O5ZA 2QG9B 1BU1A 4IE5A 4EOZB 2K2VA 1MV0B 1M3AA 2D9DA 2DX1A 3RKYA 1TUGB 2CRBA 4A97A 4MBQA 5DABA 1VQOA 1YITA 5JDQA 1QLBA 2ENMA 2KT1A 3EGDB 1H3HA 2DIQA 4PL6A 4H9NC 4HWFA 3GIBA 2BTTA 3ER0A 2LSIA 4LD9K 4CN4A 3HP9A 3TLUA 1X43A 1WFWA 1U3OA 1VQPA 2LZ6B 4B3TT 3UWNA 2BZBA 4JI2T 1YJNA 4YLHA 2RH2A 1WPYA 1KF6A 3ZJ1A 3E19A 1N33T 1N9RA 3EHZA 2RMOA 2D0NA 3CXCP 4B3RT 5AQNB 5HAXA 1XWMA 2W2UA 3PUYF 4FYWB 1YQ3A 2KDSA 5GAOq 4XAXB 5GAOm 3ZL7C 1T7SA 3Q1JA 2XD0A 4M78B 4HWCA 4QVCA 4KMCA 1F1BB 1E2AA 1UGRB 3KFWX 4ZS3A 3R84B 2CBJA 2XM1A 2YRCA 4EZ4A 3JCMW 5FYMA 4WBNE 5KYWB 4OB0B 3B5MA 3ZN1B 4GKKT 3W15B 4CI0C 4V2SA 2HPJA 2KLQA 1SUMB 4MMKA 5IN1A 4J9CA 4IT4A 1NPPA 2WWUA 4J9EA 2ZPBB 2K3XA 4NS5A 4EYUA 3THKA 2MMPA 3OS1A 2JIWA 3EH1A 4JBWF 1G8XA 2XDPA 3L3PA 3S3MA 4OFZA 3QWXX 2ES0A 3CQXC 1YI2Q 1JNRA 2A72A 1U1TA 3CCQQ 3M0TA 4UC4A 5H6RB 5LHIB 2QTVA 3MEUA 2V1DB 4N4HA 4OMLA 5EK3A 5HWXA 2LNHB 3N2KE 2G3RA 1OX8A 2NYSA 3FZMB 4J5YA 3K3NA 1K73U 3G6EQ 2CHOA 1FIOA 3EG3A 2KNDA 4FI5A 2JM8A 2X4WA 2DZCA 4RTYA 4XBFB 3NHNA 1K76A 5GANf 3L8RA 4P5NA 4C92G 1MNEA 3GBQA 5D6XA 5IAYA 2A9UA 3TSWA 4C92F 3CX6B 1NJIR 4QKNA 1JJ2S 1BCMA 1KD1R 4AKIA 1N5ZA 5CKHA 1BBZA 3OMGA 3OYFA 3REBB 2KXDA 2DRKA 2YXYA 1PSFA 5FNVE 1FXXA 3L2ZA 2CXLA 1M1GA 3OYGA 3PJAJ 1US7B 3X20B 3SRZA 4JI8T 2ABLA 4QX8B 1HSQA 5GMKe 5HEOA 1XDOA 2DHRA 2LLYA 5DM7R 3A8YC 4DVDA 4CC3A 5KH6A 2FZCB 1Y01A 5HXRA 4ATOA 4DOWA 2L3SA 1WGSA 2JM9A 2EYYA 1KQ1A 3PMTA 2HZYA 2B1EA 2Q9QB 2XAJB 3KDSE 2DETA 1YJ9Q 3KBUA 3J9X1 2QQBA 2LE8A 2RHUA 3CMEA 3P8DA 1ZSZB 5GAN8 2DYIA 2E6NA 3V8JA 5DJQC 4WW0A 4M7DA 2ZPGB 2CCQA 2EGEA 2DTHA 5GANd 4EEDA 1MMDA 1VQ6T 3V7RA 2HKQB 2YRDA 4BI3A 1N8RR 1ZX6A 2LCSA 2X0YA 1HF8A 2CMRA 3M58A 1KQSA 2WWVA 1HD3A 2DK3A 1K73C 2XQ9A 3CCVT 2H8HA 4AFQC 2KMTA 2C5KT 4I0UA 5JQGE 2YWWA 5LJ5f 3PE0A 5AYFA 3I56A 1I5LA 1BI3A 1E7PA 1X01A 1E6GA 2KQWA 5AQRB 4A4EA 2MTQA 4U7IA 2HBPA 1IHVA 3WXMB 1SSFA 2HD0A 1KNZA 3PNWC 4C0ZA 4LFAT 4AFZC 3VU7H 2AZSA 3ETUA 2UU9T 4KGZB 2WBLA 2D0QB 1W2BS 4IGUA 1NJIU 4OP0A 3DTOA 3O4XE 2PG8A 3WAKA 4M7AD 3I55T 2LOSA 3RMQA 3SD4A 4AXPA 2OI3A 1NPRA 5KXJA 4QVDA 4TWHA 3ZPOA 3EFRA 5FXXA 2MPXC 2XMFA 4HA8A 4ZTJA 3GWHA 5CQXA 4C0DB 1SPKA 2CP3A 2RP4A 2K3YA 3N9NA 4AKRB 1I1JA 2LJ3A 3ZBDA 1VQMT 4E7ZA 4QXBB 4QHOA 5AQLB 3PVLA 1VQLA 4YSZA 5LJ5g 3OYKA 2RHXA 4HN9A 1X2KA 2E5VA 3AVSA 4B3ST 4HFDA 3RIAA 1NLOC 1YW0A 1B34A 4ISTA 4BE1A 5KYUB 3SDZA 2V7KA 2FJDA 3ZMZB 4JI6T 4YTMA 4C92A 1TOVA 2GTOA 5AQTB 3BK9A 2M02A 5GAMg 4U7YA 1G3YA 3I5RA 4EGWA 4BJMA 1I6ZA 2IIUA 2NW8A 3UFGA 4I55E 4YJ3E 3DLLA 4JZ3A 2MAMA 1PHTA 3E08A 2EJGA 1VQ9Q 3DKMA 5LJ5j 3GMIA 3ABVA 5GAN2 2FYKA 5GAOn 3GPLA 4JYAT 2RQWA 2BS3A 2RJFA 1Z9ZA 1KD1U 5GJVB 5GAMd 1D1BA 3P50A 2DILA 2OTJT 2F5KA 4LF9T 5IHNA 5GAMh 5L3GB 3CC7Q 1M8MA 2RQVA 2J6FA 4R0KA 2X0LB 2LSJA 2HN2A 3EUHA 4ILAA 2M51A 1HR0T 5CKBA 4JV5T 3JC6C 4M75C 1GXIE 3LG7A 1YCYA 4DV0T 3CCJA 1VQ7T 2F4VT 4MZMA 4C92E 5LJ5d 1BIAA 4LF8T 4J9HA 3PGGA 2XI9A 1IBKT 1ZUKA 1Q86U 3FHNA 4LFBT 2CZ1B 5LB7B 1OU9A 3SHWA 1M1KU 1HXDA 2IC6A 5IHYA 4RG2A 3VKIA 1JB0E 2MWOA 2RB6A 1XNQT 2AK5A 2ROLA 3FZHB 5HEJA 2ZM0A 2HKNA 3SS1A 1IB8A 3OMCA 1ZV4X 2YKSA 4J6XA 4OB1B 5FXWA 3ZMVB 4PJNA 4DR2T 2EHOA 1OEDA 2DE0X 4OVAA 1Q82R 1YJ9A 3L39A 3WI3A 1UGQB 2K4YA 4HE8A 1XTDA 5I21A 2XK0A 2W0GA 3O1HA 4WNKA 4KHZF 3NTIA 1N8RU 3MXZA 1I07A 3SEMA 2FBWA 2NUPB 4JRPA 2JZ2A 4JLGA 2MCNA 1Z0PA 2K3BA 5IHIA 2LX9A 1HX8A 3LJCA 1JXOA 4ZZBA 4AKLA 1WFDA 5AQUB 1GCQC 4KI0F 3ZKRA 1W4SA 2JTMA 2VV5A 3JCMd 1GRIA 2DF6A 5J3BA 2OTLQ 3CCJT 3GNGA 4OX9T 3O1IA 1OULA 1Z8UA 3MO8A 1OYXA 4I43B 4LDUA 1ZBXA 1GQEA 2FVUA 4DIDB 4C92D 3EGXA 2KRNA 2YLCA 1YJNQ 2QAZA 1Q95G 5LHGB 3PTRB 2R58A 4MMLA 3OW2S 2XU8A 4LMLA 2KT9A 1D1CA 1CSKA 2DBKA 1QVGP 5FU7C 4U72A 2LC4A 2PUKB 4ZEYA 2XKOC 3VS4A 3H3AA 2BG9A 2LX7A 1FWZA 1YHQT 4NOYA 4UIGA 3NTKA 4BY6B 4PFOA 1ARKA 2CA5A 4UELA 4X64T 2L89A 2QYZA 1SA0E 2WP9A 3E0ZA 5FY1A 4WZXA 3UU3A 2BIVA 2WDRA 3A8OB 5FU6C 2F1LA 4KUDK 2NUZA 5F3JA 3F70A 4ILBA 3G4SA 5JVDE 1WX6A 2QXFA 1CUNA 2H7OA 3PJAA 1JU5C 5ABFA 2DD5A 5KYYB 5LBQB 1W6XA 1FMKA 4FYXB 3Q2MA 1N8RC 3G71Q 3MK7C 1WLPB 1WNLA 2H7VC 3CCMA 1VQ5Q 3OYJA 2CZ0B 1MIYA 5LJ3f 4II1A 4Y92A 3AA7B 1ABQA 3OYXA 3CEYA 2EHOD 4CXXA 4TUYE 5GANe 1VUBA 3CCJQ 2ECZA 2I0NA 3N2OA 3CC2Q 2L9QA 4QQ6A 1WI7A 2A36A 3HTRA 3RX6A 2VKJA 2RM4A 1VQPQ 2QDYB 3V7CA 3PUXF 3ZLIA 2KI7A 3ME9A 5GAMj 4PFPA 1UEBA 3L2UA 2RD1A 1I81A 2RK1A 4KRTA 4J9GA 2SRCA 4U2YA 4NIQA 2J62A 3CK6A 2HBWA 2ESWA 1M1FA 1RL2A 1Y96A 2E1HA 2X3XD 1HNXT 4OMOA 3AHUA 1QKXA 4BACA 2VVKA 4FYYB 1S35A 2O2OA 1KNRA 2BBJA 2CP6A 3EG0A 4TNWA 4LN2A 1OQKA 1TH7A 3VJPA 2BZXA 2O88A 2W00A 4RTZA 3ZYLA 4XU2A 2D0UA 3ONJA 4Y91A 2NWBA 1D1AA 1M30A 3MEAA 1K73R 2CLYC 4PNIA 4M78A 1QVGS 1MIWA 3N9QA 4M7AB 5L47A 4YY3T 1NJIC 3ZMTB 2HNIA 4C8QC 3U3IA 4HFBA 4FW1A 2JMHA 4YTNA 3UU5A 3OQ5A 2NUPA 3FJPA 5CFBA 2JN0A 1VQLQ 3QK6A 2CP2A 4JJDA 1U8RA 3LBXA 2E12A 2O01E 4HVVA 4X1VA 2XAGB 5BMVE 1M4ZA 2Q9QA 3H6ZA 1ZOYA 2B86A 3TEEA 4FW2A 2ROTA 1QP3A 3PURA 2DNUA 2RQTA 3LW5E 4CI1B 3PT9A 1IZ6A 4L59A 2WSSV 4E47A 5LJ3h 4FT4A 1YJ9T 3I9QA 5JR9C 3FZLB 3IBPA 1H7CA 1T0JA 2VC8A 3HL8A 3PV0F 2ZGWA 5JDHA 2BE9B 4ZGEB 2J05A 4EMGA 4C0DC 4TZ4C 1IJ5A 3I9YA 3ZFJA 3CQGB 2DBMA 2LRKA 5GAN5 4BE2A 5HCJA 5FY0A 1PNJA 1YKHB 1UG1A 1YBYA 5L4HA 2JJ9A 4J8OA 5I11A 2YINA 1B3QA 2CP0A 1PKSA 1HNZT 4AFSC 1PCXA 2D2SA 1Q81C 5L3CB 3G4SQ 4OMQA 2DLRA 3OBVE 1KD1C 1V29B 2K7AA 4ELYC 2CH4W 4X20E 4ZXLA 3RUXA 5FP3A 3TLSA 3VRBA 1G2BA 3G71T 3GOXA 4JI7T 3G6EA 2RO0A 3BDLA 2EIFA 4PK6A 1S72T 2LNVA 5AT1B 2IHR1 1MIVA 1HYOA 4ZI2D 1G3SA 3AXJA 3QWYA 2KBTA 4Z91A 1N32T 4ILCA 5F5WA 2EYQA 2PVDB 2KRMA 1OI1A 4TVRA 1KC8U 3JCMV 4HWDA 2QEXA 2WZHA 5AQJB 1M9SA 3ZYKA 4I4TE 4WTOB 2KAFA 3JCMc 2WMNA 3OYAA 1M1KC 3CC4A 2WSCE 1GCQA 4MFRA 3RH3A 4N4IA 2LOPA 1YHQQ 3F57A 3VHLA 4OYJA 2E9XA 2BZ8A 5CCAA 1KEYA 2V8SV 2K24A 1RLQC 3OYZA 2M0OA 3NGPA 3X28B 2EYXA 5D6WA 1D0YA 4M7DB 3MHXA 3RKWA 2X68A 2KSSA 3RRWA 3ASKA 1B34B 2J1DG 3AA0B 4HWIB 2F5TX 1RAEB 4JLEA 1VQLT 1WYBA 2XY8B 1C0MA 2KK4A 3QBYA 3EI0A 1VQMA 2M1HA 4FYVB 3K8PC 4KX6A 2V6YB 2AIRB 3TVTA 1JJ2A 1VQ5A 4N0AC 1CHUA 4OF1A 4AMCA 2EQMA 1T3LA 4IE4A 1Y96B 3JCMe 3CCRA 2OTJQ 3EDVA 4ZI7E 2K57A 2Q9QC 1VQ8Q 1IJ6A 2V8IA 1T0HA 3QUIA 2DVEA 5AQOB 2XM2A 4Q25A 3T8OA 3QB5A 2NLUA 3HKBE 1I94T 5C3JA 1LPLA 3RMSA 5GAN6 4BD3A 4QH4A 4OMMA 4J7FA 3U78A 4OMFB 3V8LA 2CWOA 2E5QA 4EEBA 3SWNB 2LEHA 1VQ7A 1LCKA 3AAIA 3HRSA 2GQIA 2KYMA 4XTZA 5GAMe 4KT0E 1K9MC 4ESRA 3T1HT 5HCMA 4M7AC 3IA3A 2K9AA 2I0MA 2LJ1A 3S3NA 2CSIA 2QEXT 2A2FX 4A54A 4M77G 3IF8B 5C6SA 5HY6A 3LBXB 1YITQ 3EAMA 3L2RA 3AE3A 3TLVA 3WVEB 2I6HA 3QNUA 2W67A 1X9BA 1M2VA 1ZUYA 3FB2A 3N9PA 4PFZA 3VS0A 3M3ZB 5A0GA 2IMLA 2QQAA 3AEGA 3EDUA 2Y4XA 4ZHQE 3E22E 2DERA 1YJNT 3JB9J 4M78C 1GBQA 2VUBA 4UV8B 4M77F 3T9NA 4DEYA 1VQKQ 1LOJA 5FXZA 4EV6A 3C4SA 4TWFA 3OYIA 4ISSA 1O3XA 3QPHA 4DR6T 3GA8A 4ME7A 4J9DA 4AI6A 3QHSA 4PJOF 3EH2A 4YHHT 1WXUA 2DTIA 4JS5A 3B57A 5L2LA 4F14A 2EYWA 4O6JA 5H6QB 4IIMA 2QQ9A 5HKCA 2BUDA 5CR2A 4HFIA 4A63B 2X9XA 1X6GA 1TSFA 3I1AA 3MA9A 4HTEA 3RESA 4U33A 3M5AA 4C92C 3LGLA 4A4HA 2CDTA 2WMOA 2QRXA 1NENA 2V26A 5AQFB 1Q86R 1T3SA 5LJMA 4M75E 1QP2A 2W62A 2WB5A 3KVAA 2EKOA 4JUVA 1WXTA 2QASA 5LMUT 2ACZA 2OV9A 2KZ7B 2UUCT 3AXJB 1AD5A 4IREA 2KT8A 5L3FB 5FU6B 4U74A 2YT6A 2COZA 2DNXA 1EIFA 3A1PA 4HGAA 4KUIA 2WSEE 3NMZC 5HXHA 1MMGA 3CC2T 4YSXA 3EAEA 3HKSA 4O5VA 1TUCA 2IPOB 3KV5A 4JI4T 1W2BP 3K3OA 3BQLA 3MPUB 1X79A 2EYZA 3JRZA 1H92A 5GAOl 4E2FB 2E9XB 1JBMA 2DL1A 4E6RA 3UULA 5CIUA 4UVCB 1VQMQ 1KHIA 3C12A 5D6YA 2RA1A 3C50A 1RUWA 1HG5A 4LFCT 5L23A 4LMJA 3UA7A 3NTHA 2BZYA 3PFSA 3ZT7A 1RAFB 1EZ3A 1WLXA 4J9FA 2FRWA 3UFEA 3NRXA 3HHTB 5KYXB 4LF6T 4NL2A 1QVFP 2NW9A 3CC2A 4DQ2A 1AJ3A 4JPBW 3H0IA 5AQMB 2YSQA 5FVKA 5FVLA 4CZZB 4WBOA 4F7UE 4H9PC 5LA6E 2SEMA 3CD6A 3WAJA 1VCSA 3FXEB 3OSVA 5A2QE 1QSDA 2XJ7A 1KHCA 4FU6A 2FUPA 2VXFA 1LKXA 2VB6A 3O1JA 1H3ZA 1ABOA 1JNZA 3NFCA 2E5KA 2XTLA 1YFNA 2GFUA 2XQ6A 2X35A 3FEOA 1VQ4A 2R6GF 2PTKA 3CCSA 1W1FA 1YP5A 2LQWA 2HN1A 4IUQA 1VQPT 5LJ3j 3C95A 3I35A 3G4ST 2HCKA 3PMIA 2V1RA 4M77C 2EQIA 2E2AA 2H89A 4XU0A 5HXCA 1C6VX 4CI3B 1VCTA 3UT5E 1WJSA 4A98A 4ZNXA 4M7AG 1VQOT 2VL0A 3RKGA 2HQXA 1VQ5T 2VKNA 1GBRA 1BYMA 2ZPHB 1T72A 4ERRA 1RADB 5LMNT 4C8QD 3PUQA 2JPFA 4OB3B 4M7AA 5GMKj 2WU2A 4M77E 2JT4A 1BR0A 2DM1A 9ATCB 4AKHA 4PLLA 4FM4B 4O2BE 1EX4A 1M27C 4MALA 5ABFB 1KJWA 5KYYA 1NG2A 5JH7E 4LF7T 3FC3A 5L3EB 2KYBA 4M75A 3V7SA 3RGLA 1VQ6A 3AE4A 4TV9E 1RAHB 1X6BA 3GN5B 2D6FA 1V9DA 2LCCA 1PD0A 3META 5JR9B 5FWBA 3QZ9B 3S6WA 3CKDA 2CLYB 2CE7A 1AVZC 1QCNA 3RYFE 2JTEA 3QYGB 4D6WA 5FLXE 2ODUA 1BB9A 1YCSB 1CKAA 2E5LT 2DCFA 1VQ6Q 3X1DA 1VIEA 1K8AR 1HX1B 2GGRA 3EFOA 1ZSZC 4CRIA 4V1Av 3JAFA 3ETVA 2LM2A 2C0TA 4JJNK 5AFUL 2W4XA 1PKTA 1UURA 2AKKA 1ZEEA 3EG9A 3A8GB 4PJOG 2NTYA 3TLWA 3CPWA 3EG1A 3DB3A 3OPCA 3RHWA 4DNDA 2XQ4A 2F69A 1D0ZA 2HDAA 4HKEA 3RDVA 2YU1A 3QUJA 4M75G 5J1GA 3OYEA 3JADA 2DL7A 4RTUA 2LQKA 4A4GA 2JVVA 4M77D 1D09B 2PTFA 1YITT 4XK8E 3RR6A 2ZPIB 2D0TA 1VYUA 3M57A 3ANWB 2UXXB 1XNRT 3SFMA 3CC4T 4DV7T 4EMKC 4X34A 4J6WA 4VUBA 2AZVA 1NEKA 4A53A 3FJ5A 4K0KT 2XDDA 4MLKA 3MP8A 1Q81R 4G63A 1Y71A 2HEQA 4ADZA 5KE2A 1WHHA 3CCSQ 2NP9A 2UXDT 2FPFA 1DU2A 3UPUA 2NR4A 4EB6E 4M7DG 1I8FA 2ED0A 4U31A 2KINB 4UF0A 2VGNA 4XTYA 3P4QA 2W0ZA 4C5IA 2OX7A 2HSPA 3G06A 3VU3C 4AT1B 2DFUA 5LYJE 5EZYE 4WYVA 1VOMA 2W63A 3ONLC 5DLQE 5EG2A 3UU8A 3WVDB 4PJMA 4X1IE 1K0XA 3PU3A 2E3IA 1YJWA 1VQ7Q 1IGQA 3NPFA 3CCQT 2PQWA 4AQFA 3RKXA 2CT4A 3CCLA 2LKHA 1OEDE 2IVWA 2P0QA 4PJJA 2YUNA 1U4QA 2J47A 2YK0A 3RYHE 1K1ZA 1E6HA 4GY5A 4O2AE 2DYBA 2A28A 4DR1T 2CH4A 3EVYA 1Q82C 3QDRB 3CQCB 4F7UG 4CXYA 5LG4A 2FZGB 5DY9A 2CT3A 2UXCT 4NUVA 2B8AA 1QVGA 4HFHA 5J0ZA 5HEGA 1Y7XA 2DEUA 1X69A 2K3WA 3LWHA 3RBBB 4M7DC 1NYFA 4ZZCA 4TV8E 1NZ9A 1RAGB 5M9OA 1M90R 2GBQA 2YHTA 2DO3A 3E1SA 1X2QA 1QUUA 2IUBA 1AEYA 3RYCE 2DWKA 4PKCC 1FMWA 5LNKA 3E9FA 1D0XA 3C98B 4IIJE 5FL0A 3C64A 2GTJA 1SF9A 4B9WA 2XQ8A 4HWHA 1PD1A 1CKBA 3CC7A 5IH2A 5CGMA 5JDGA 1UUSA 3KV9A 3M4GA 4QQDA 3KXTA 2CUDA 3QSUA 4M7AE 3RNJA 4YJ2E 2CREA 3CCST 5FU7B 2V8KA 3TREA 4HT8A 4AIUA 2QVAA 3CBMA 3H37A 4F7UA 3EHQA 1YI2T 5EK2A 1VQNT 5HK0A 4PK4A 1VYVA 3UF4A 2F2VA 4RTTA 1PG5B 3X24B 5IXFA 1XQHA 2FEIA 4RKUE 3ZT5A 3M0QA 4PNOA 3CD6T 3UU6A 1MMAA 2XASB 5L3BB 4DBQA 3GNFB 2CWYA 1WCRA 4IDZA 1AWXA 5AQGB 2PFVA 4CI2B 4XTWA 1Q81U 3LFMA 3MP1A 2OJ2A 5GAN3 5LGTB 4TNVA 2AKLA 3M59A 3CCVA 4YTLA 3RI5A 2KR3A 3EG9B 4RCBA 2V6YA 4O8SA 2RK2A 2BBHA 1QWFA 1QW1A 3BFMA 3L2WA 2XZEA 2FJAA 3CCLT 3FXDB 4XTXA 4MDXA 3LSVA 3MJXA 2JQ9A 4QT7A 2L3LA 5HK3A 1EZZB 2FJBA 3RC8A 1UTIA 2YUPA 2Y8DA 4O4JE 2E65A 4C90A 4DUZT 1ZHCA 3JAEA 1B7TA 1AWJA 3VR9A 5J2TE 2BVMA 4GK0E 1RI9A 2KRSA 4GOUA 4DV6T 2R57A 3G1JA 5I22A 3OA6A 3OW2A 1XJWB 4LMKA 2N9DA 1UDLA 3G71A 5DQVA 4YT0A 3JCMg 3CCMT 1FMVA 3QO3A 3TU4K 1KG1A 2AXDS 2J4GA 4IDNA 5HEHA 1N9SA 2VK9A 2BS2A 3PUAA 1M62A 4XZCA 1RACB 2OTLA 2RJCA 4RG8A 2KXPB 3I0OA 3H41A 4PJOE 5GMKi 3O9XA 4J2CA 1Q82U 3JCMX 5C8YE 3SFDA 3PUVF 3AA1B 3FIFA 1JXMA 3CXCA 3H8ZA 3RC3A 4IE7A 2CYZB 2G6FX 1A0NB 2RHIA 4C0GA 3TCJA 1OZ3A 3VS1A 2QI2A 2ODVA 3L09A 5LJ3g 3MP6A 1YJWQ 1MMNA 2RPNA 1NM7A 1AOJA 1M1KR 3ZJ2A 1JRIA 4HCKA 4M78D 3SWNC 2WACA 2IC9A 5GANh 1OEDC 3AEEA 3N5LA 3KVBA 1SHFA 3VR8A 3ZMUB 2MOXA 3ZN0B 2KWHA 3R6OA 3H0HA 4HVUA 3RIRA 5LL6S 8ATCB 4DBHA 2V7MA 4H9RC 4DV2T 2CHNA 4JI3T 2V1QA 4IE0A 5KYXA 2PU9B 4IURA 2M6BA 1YNZA 1OWAA 2HAXA 1U5PA 3UQ4A 3M65A 2BE7D 1K9MU 4M7DE 1MGQA 3ZEFB 2C0OA 3M0UA 2PBIA 3AB3B 3O8VA 3RQUA 5IWAT 1OEBA 4IDPA 4IE6A 2UXBT 3URGA 2DIGA 2XQ5A 2CSQA 2VKOA 2HHHT 3LH5A 1HS7A 2RJEA 1WDXA 2COYA 4RTXA 4YSYA 5AQKB 3H3MA 1HK9A 2DL5A 4EIKA 1Z9QA 3CX8B 5ETWA 4M78F 2UXNB 4K0UA 1NE8A 4M4ZA 5KYWA 2YU2A 4KH0B 3AEBA 2KVQG 4M75D 1M3BA 2Z0WA 4CXWA 3M0PA 2C5JA 3EG2A 2FZKB 4J6YA 5DQWA 1FYNA 1LJOA 1FEWA 3AAEB 2BVLA 2DMOA 2W10A 2WDVA 5LP6E 3PUZF 2JRKA 5HXEA 4L6V5 3JCMP 2WCAA 4DO0A 1N36T 1Q7YU 1VQ9A 4LF4T 3FLGA 1TU0B 1KIKA 1UJYA 4XU1A 2JMAA 1XMOT 1QVFA 3C51A 3QOFA 5GONE 4LF5T 4NL3A 5KYUA 5KMGP 3CMAT 1KSWA 3HA4A 4F8HA 4NUUA 4OHFA 1WHKA 1ZQ1A 2EAYA 4JEHB 1PRLC 5L3DB 4IDOA 2L3PA 4M78G 2CBIA 3JCMQ 3QJYA 2DTOA 1WHLA 2DLPA 1AHJB 3LGFA 5CQYA 2WSFE 1GCPA 2LTOA 1UCUA 3ZCIA 4ANJA 3RYIE 2PNIA 2IDOB 3DP7A 5TAOA 1VQNQ 4JI0T 1NEGA 3OBWA 4GYRA 3HKCE 4IUUA 4LDWA 1IZNB 5A1LA 1KQ2A 3AT1B 5FRMA 4PJOA 3LK42 3AEDA 2EBPA 3LX7A 2BDEA 4B6MA 2JQKA 2Y4YA 3F2EA 2CXFA 2XG8D 3VUZA 4D8DA 4FT2A 4ZI3D 3QDFA 2KROA 3HPWA 2L8DA 2CP5A 5AQHB 2QGFB 1BIBA 3E2UA 2GF7A 3OBYA 3P8BB 2JS0A 3BW1A 4AQFC 3N2GE 2LSKA 2JOYA 4ZTFA 2IAKA 4GK5E 4EYYR 1VQ8A 1WRDA 2EQUA 2J06A 3G6ET 4QXHB 3HKDE 3VS2A 3I56Q 3ZC0A 4KUMB 1OEDB 3KBGA 4X1YE 1UGPB 2XHCA 5FKYA 2FRYA 4EDUA 4AQGA 2R5MA 2CS7A 1UFFA 5LJ3e 3RRCA 3PVQA 2AE9A 4LNPA 5EK4A 3PUWF 3KFVA 5KYNA 1AWOA 1LVKA 5GAOp 2LHRA 1WZOA 4QH1A 2QGGA 2QK0A 2EQJA 4X9CA 2ED1A 2DPPB 2CUBA 3BQIA 5ABEA 3PTAA 2DEQA 3EFSA 2VURA 2K5FA 4AFUC 1Q7YC 5BR8T 1W0AA 4C8QB 5CO7A 2ACXA 3Q5XA 2E41A 3IQLA 3DLMA 1M8VA 4J9BA 4KGVB 2LT1A 5FROA 5GMKm 3OW2P 1J1JA 4UXNB 1WHMA 3AEAA 5JR9A 2QEXQ 4RCCA 4X1KE 3ZSSA 3VV0A 2EKHA 3CCVQ 3M55A 5IYZE 1RLPC 2LRLA 1RABB 4CC2A 3EGXB 2COWA 3M54A 2K5IA 3JCMb 3OYNA 3N9MA 2DXUA 1VIFA 2QGSA 5FMNA 1SRMA 3ZC1A 1ZP0A 3MACA 2DI4A 2K48A 3OKQA 3RPUA 1PC0A 3H9NA 3IEEA 2LQ8A 2P4RA 3JCMh 2RA2A 1VQ4Q 4O4IE 2VKHA 1U5SA 3INZA 1NBEB 2VYTA 4B6XA 5CA1E 1UX5A 1WIEA 3GP8A 2JMKA 2C06A 3JSCA 3HL6A 4E7LA 5KCOA 4KP3C 2DXCA 2VVSA 4XU3A 5GJWB 1XZYA 1ZKEA 4IHJE 5KCHA 2BS4A 3PU8A 4C92B 2DKGA 4QWNB 4DUYT 2GK9A 4XTUA 2SPCA 4JS4A 4KULA 3LYIA 2D8JA 1XMQT 3J7Yq 5JDLA 4QX7B 2H3JA 1W9RA 2J6OA 2MOZA 3A5XA 1FJGT 3KV4A 3QC9A 2BKDN 1LVFA 2VWFA 4M77B 2PVGB 1M7KA 1Q86C 3PIOA 4BA9A 4GLKA 2M9UA 1M90U 4N78D 1YWPA 2XAHB 3CCET 5LOVE 4EMKA 2LQNA 5ADXL 2Y90A 2WU5A 2XPKA 1HG2A 1MNDA 2GCXA 5LJ5h 3CBPA 3FB9A 2CPTA 3HFOA 3CCEA 1GL5A 3E9GA 4E7KA 3VS5A 4EZHA 2LJ0A 2V8JA 4RUGA 4ASKA 2G0UA 3VRYA 1S72Q 2ZPEB 1OPLA 4M78E 1AT1B 1SE7A 3OS5A 3JCFA 3OJAA 2LCLA 1XOVA 2GFAA 3A5ZB 3QJ6A 3J81E 1WYCA 2HL5C 1HFAA 1Y57A 2E9XD 3TQ7P 2EJ9A 5FWCA 1TG0A 2Z6EA 3MKDA 1H641 1XDPA 5AQQB 4ZI3C 5LGUB 1OPKA 2O31A 4JLIA 5ECAA 2WAUA 2MWPA 4LDVA 4AISA 1G5VA 4DEXA 2JNGA 5JREA 1BI1A 7AT1B 1IHWA 2C0IA 3LK3B 2HMAA 4F16A 4NXMT 2K9GA 3AE2A 1VQOQ 2FPDA 4EIWA 1ZHIA 2FJEA 3HFNA 4Z89A 4P0AA 4XTVA 2DL8A 2KNBB 3M0RA 2WY2A 1S1NA 1UGVA 4UEMA 4CC4B 4E7IA 1D3BB 2YN6A 4J83A 3I0QA 1I5OB 3UUNA 1RAIB 2KY9A 3RQWA 4PLIA 2XAQB 2LM9A 5JDMA 2RNAA 4JRQA 2CKKA 2E6ZA 2QTXA 6AT1B 5AQPB 2QA4T 4C8QG 3CPWP 2MYSA 3L1AA 3I56T 3ZT6A 2MIOA 1IGUA 4F6RC 1QCOA 2XDBA 1R77A 3P7IA 2ZZDA 4OMPA 4L9IA 1S72A 2RF0A 4UVAB 4E7JA 4O4LE 4J7IA 2K6DA 3JV3A 2YDQA 4HXJA 4RTWA 1P92A 1GFCA 1TWBA 3FDRA 1ZLMA 3SFEA 2JW4A 2QYWA 2P4TA 1MHNA 2VKDA 2V6XA 3KBTA 1RAAB 4L0RA 1IXDA 2E70A 2PVOB 2P0PA 3CWZB 4TN7B 4LD6A 4H9SE 2JUFA 4MDWA 4ZN3A 1JEGA 4GIWA 2LSGA 2VVNA 3P4WA 2FO0A 2D5UA 2EW3A 4KHPT 5GAMf 1OV3A 3QKJA 1UUEA 4QKUA 4Q5WA 2X3WD 2BG9B 4MHCA 2LRQA 2XQYA 2OA5A 1YKEB 2M16A 2ZCFB 3K1SA 4JUYA 5IXBA 1ZBJA 2CGHA 3AE1A 8AT1B 3GLXA 4G2AA 5GMKh 2O9VA 3OYDA 2X0HA 3CPZA 3J80E 3MEVA 1FX7A 4OB2B 4HCCA 4C0FA 1UE9A 1W0BA 2WM9A 5CKDA 5LCYA 3SWHA 4H9QC 1WA7A 4LDYA 4DBFA 1ZA2B 3NWIA 5HWYA 3S3OA 4KGXB 1OXZA 3QIIA 2RJDA 1N34T 1G3WA 4N0AA 3KINB 2EPDA 2P0KA 3LK2B 3P8HA 2O9SA 4JJBA 3HI2A 1H8KA 2QQRA 1ACMB 5GAN7 1DJ7B 2XQ3A 1SG5A 3FBZA 2QDLA 3AE7A 1R8OB 4F17A 2O4XA 2NOXA 5FRNA 3CCUT 4PAGA 4EMKB 4GYSA 3C0CA 2MI6A 3EGUA 2EQKA 3VUBA 4F7UF 2XQ7A 5GMKl 3LH0A 1WYXA 4HKAA 1SHGA 2LMJA 4DA4A 4PJOD 4IUTA 5LJ3d 4Y28E 3P4SA 3PIPA 1PSEA 3OS2A 3N9LA 4M75F 3KUFA 3FBLA 1YXRA 4IUVA 2F2WA 2NUTB 2YUOA 4BE0A 3UTKA 3Q9DA 3CCMQ 1AWWA 2LT3A 3ZCJA 4R56A 1QWEA 3AE9A 4MZTA 1N6AA 1W2BA 5FXVA 2MBGA 2PUOB 3RIFA 2EWNA 3FRNA 4GKJT 3SB2A 3UA6A 3VKGA 3TSZA 4QVZA 2I2LA 3BY7A 2OAUA 2UUAT 2VQET 2CM0A 2HH7A 2YEVC 2ZMAA 1QCFA 5LXTE 3OYYA 5JDFA 1UGOA 2LDMA 5KE3A 3UUBA 2ZM6T 4X66T 3SWNA 1B07A 1IRXA 3JAME 2YOEA 4CQIA 1NEBA 1NYGA 2JTFA 1BI2A 1AZEA 1Y07A 2DVJA 1L0VA 2LP5A 1OOTA 1HTJF 4U2ZA 3ZMSB 5LJ5e 4M7DD 4DOVA 4A5XA 1M3CA 1TTHB 3I9WA 4X65T 3AA6B 2DA9A 4Z8XA 3VRAA 3CXCS 2CP7A 1JO8A 5A0LA 2WQYA 4FL6A 3AVRA 2MF2A 2KEAA 2LJLA 2HQEA 1S94A 1QKWA 1ZSGA 3D7SB 5M4YA 4U3CA 4QQGA 2IG0A 3VYHB 3LLRA 1I0CA 1M2VB 4PJLA 5CA0E 3UUXB 3OY9A 3CIRA 5JRCB 2E8IA 1SRLA 2JXBA 2X9WA 5GAN4 2VL8A 2JMCA 3OSSC 1M2OA 2L2PA 1YIJQ 1WJRA 4HVWA 2XIDA 1KQSP 3RIUC 2HPLA 3ZYMA 2L5QA 1BR2A 5LG3A 3L42A 2X4YA 2KE9A 4COFA 2E9XC 3P4PA 3CCUA 1PRMC 4C8QE 5GAOr 1YIJA 1OX9A 3V5SA 2VGMA 4JEUB 4DMWA 4M1PA 1G83A 4NXNT 2RI2A 3MEWA 3F31A 3A98A 5LHHB 2A08A 2RQRA 2L3RA 3AE6A 2XSAA 4UVBB 5IUXA 5JDNA 1K9AA 1M90C 1TUDA 4BDZA 4Z90A 4DR7T 2ZLYA 4C8QA 3NZPA 3GF5A 1AZGB 2WZIA 3A7MA 4DR5T 3BE3A 2VASA 3QG1A 4IUPA 3JC6D 2QA7A 4OYKA 3RLFF 1JJ2P 2LSYA 4I50E 4LXCA 3ULRB 4UV9B 2XHEB 3JCMf 2LKGA 2L0AA 4PK5A 5CKFA 4DV4T 1YI2A 4CC7A 1Q7YR 1NLPC 4PJOB 2AHJB 3OB9A 4HT9A 1K8AU 1BCOA 4HFCA 3M56A 2A37A 1W70A 4BAYB 5KX5E 2YUQA 1T8BA 3OYLA 2O4XB 4C5GA 4AG2C 5C2TA 5CB4E 1IO6A 3A8LB 4AKGA 1BR1A 4DMVA 1G3TA 5E0OA 2V7LA 3AECA 1K9MR 1PWTA 2M67A 4C5EA 3QYHB 3BDUA 1WJQA 3HRTA 1E1HB 3NKZA 3Q5EA 4DV5T 3JB9F 2A3LA 3P8CD 5L8RE 4ZGDB 2FB7A 5AQVB 4P09A 4FCYA 4GBQA 2K5BB 2YDRA 4HFVA 5F8PA 4ELZC 1X6OA 4H9OC 1BKBA 2H88A 3CCEQ 4P0BA 2RI3A 2X51A 1GFDA 4TX5A 3CPFA 4BJNA 1KQSS 1BI0A 1NAFA 1O75A 2GQVA 5FW9A 2J7IA 1HNWT 4M77A 1V76A 4H63H 2RN8A 4ZS2A 1VA7A 2NTXA 1YQ4A 2M0YA 3FZKB 1YN8A 3NVOA 3HKEE 3I55Q 2OTJA 1YJWT 2Q9QD 2ZM2A 4NPPA 2CZ6B 1TXQA 3DB4A 3I5SA 3OYHA 2ZAEA 1XNIA 1E7OA 4BDYA 1NWMX 3C4ZA 2LT4A 2F2XA 4LUEA 2BG9E 3TLTA 4AG1C 3NZQA 2JQQA 2PJQA 5FL1A 4B3MT 3VKHA 1HJDA 3CQTA 3PUSA 1WR6A 2IW5B 4DR3T 2E3HA 4ZGJB 2DXTA 2XUEA 3OTOT 5CAIA 5HEUA 3TKLB 3LDQB 3NBXX 2DL4A 4QXCB 1VYTA 3CCRT 3HR0A 1K8AC 4ZN1A 4WCIA 4A4FA 3JCMJ 2CEAA 4X9DA 1VQ4T 4A4KA 1YWOA 2EGAA 4DR4T 3RIUA 4M7DF 2RHYA 1K4US 4AQYT 1KFZA 4JZ4A 2W61A 2H3EB 3CCUQ 4TWDA 5GANj 3MZKB 2RI5A 4E7SA 3PDYA 4FIBA 4ORZA 4LDXA 4DV3T 5AQSB 1QVPA 2YRVA 2VQFT 3MCAB 1U06A 3UATA 2D8HA 4KBMB 3ONXA 4BI8B 2MAWA 3UUMA 2JS2A 3N5BB 4MZPA 2V7IA 1R0BG 4Z88A 1BK2A 1UJ0A 4JJCA 4WF2A 2DL3A 4C5HA 1KNPA 1UGSB 5JTGA 3S4UA 2KWIB 3SOLA 2DXBA 4YFSA 4CN1A 3CMLA 1YHQA 4HCZA 5HXSA 3CCQA 2KSRA 3I55A 3IHRA 1EFNA 5I2MA 4HCBA 2P9BA 3EHRA 3P4RA 2RPAA 2HSEB 3ZEHA 4F04B 2B76A 3UDCA 1X27A 4FSSA 1J5ET 2DWGA 3B13A 4CN6A 2YDLA 4IDQA 4E7HA 3REAB 4R55A 5C0MA 3RERA 4OGEA 4D8KA 2A7YA 4BI4A 2VXEA 5CVIA 3NRYA 2M6IA 2EHOC 2N2NA 2X9HA 2X67A 4ILUA 5DLOA 2C0SA 4LE9A 3CMEQ 2DJQA 2BKOA 4LUDA 3M53A 4BB7A 3K3QC 4DV1T 3CMAQ 3ESLA 2Y6XA 4BY6C 1KK7A 3U23A 1YD8G 3V8KA 2X4XA 3BQKA 1LNXA 2L8KA 4L5GA 2P84A 5ABGA 3A8HB 3M4YA 2XAFB 3PUGA 2HL3A 3QZ5B 1WXBA 2YLBA 3QB5K 3D0TA 2Y48B 1HCIA 4H63V 4YHJA 3M9QA 3LWIA 3V5UA 4XQ3A 4EPCA 5I2SA 2ZM8A 2EFIA 2ZPFB 3OYMA 4JI1T 3JB9H 3RKOA 5FY7A 2OLTA 5AQIB 1TS9A 2AT1B 3CCRQ 3CBOA 1IBLT 4OMNA 2DJZA 3VS7A 5HYAA 4UR9A 5LGNB 1IBMT 3OS0A 3CMET 1VQNA 2EVRA 2DZ9A 3ANWA 3VS3A 3JB9G 1D3BA 1LRZA 1WHGA 1UHFA 1C1AA 4X62T 2YDSA 5J26A 1RI0A 3UT1A 4IKFA 2DAQA 5IT9E 3KV6A 1R8IA 4Z02A 2BKPA 4O4HE 4M7AF 3L2VA 5D7UA 4HFEA 1R0CB 5CK9A 2WS3A 1QVFS 2E10A 3J7AF 3Q5WA 4HEAA 4A56A 2K2MA 4UF0B 3L2QA 1X75C 2H3RA 2OTLT 3CCLQ 3X25B 4Z8AA 1J5WA 2CZ7B 4EMHA 3EABA 2NWMA 2N1GA 1SKUB
chains in the Genus database with same CATH topology
2KRNA 1OPLA 2KGTA 2GGRA 2X66A 1T98A 5LHGB 4V1Av 3PTRB 3ETVA 3OJAA 2C0TA 5AFUL 1PKTA 1XOVA 2AKKA 1ZEEA 2V7JA 2FPEA 2PZ1A 1WYCA 2KT9A 1HFAA 2NTYA 2E9XD 1MUZA 1D1CA 1CSKA 1UECA 1Y57A 5FWCA 2DBKA 1TG0A 2Z6EA 3C4WA 3MKDA 4EAHA 5LGUB 3EG1A 4ZI3C 1OPKA 4U72A 2O31A 5ECAA 1Y64B 4DNDA 3VS4A 2WAUA 3H3AA 2VWAA 2LX7A 1D0ZA 5LJNA 2HDAA 2YU1A 2JXBA 4UIGA 4DEXA 4RUGA 5JREA 1J3TA 3QUJA 5J1GA 4PFOA 1ARKA 2C0IA 3AAAB 2CA5A 1JQQA 4UELA 3LK3B 2DL7A 4RTUA 3VS6A 4F16A 2K9GA 2I59A 2A3DA 4EIWA 2FPDA 1MV3A 2RMOA 1K0SA 1SA0E 3E0ZA 5FY1A 4Z89A 4P0AA 2L3QA 2DL8A 2KNBB 3M0RA 2D0TA 1S1NA 1UGVA 1VYUA 4UEMA 2K79A 2GNCA 3ANWB 2IIMA 5KDMC 2UXXB 4CC4B 4PW8A 5F3JA 2NUZA 3I0QA 5JVDE 3UUNA 1WX6A 3QWXX 2XAQB 2LM9A 5JDMA 1CUNA 2H7OA 1JU5C 2X9YA 2RNAA 2AZVA 2DRMA 5LBQB 1W6XA 1FMKA 3Q2MA 3FJ5A 4MLKA 2MYSA 1BR4A 2KMFA 3MK7C 3CX7B 4G63A 4ADZA 5J2UE 2NP9A 1WLPB 2EGCA 2HEQA 5EC7A 2H7VC 3DJBA 2FPFA 2MIOA 4EB6E 4F6RC 3P7IA 1MIYA 4OMPA 4L9IA 2J6KA 3GN5A 4OK0A 2ED0A 2RF0A 4Y92A 4UVAB 3AA7B 1ABQA 3OYXA 2EHOD 4CXXA 2KINB 4O4LE 4TUYE 4UF0A 2K6DA 2W0ZA 3JV3A 2C5IT 2ECZA 2I0NA 1QLYA 3N2OA 2HSPA 4HXJA 4RTWA 1SHZC 2L9QA 1GFCA 1ZLMA 1WI7A 1VRBA 5LYJE 2A36A 5EZYE 3RX6A 2VKJA 2JW4A 2VKDA 1VOMA 2W63A 1UHCA 3ZLIA 4PJMA 3KBTA 4X1IE 4PFPA 3PU3A 1K0XA 4L0RA 3NPFA 3CWZB 4KRTA 4TN7B 4AQFA 2CT4A 4H9SE 4EXTA 4J9GA 1JEGA 2SRCA 1ZUUA 4GIWA 4FJOA 2LSGA 4PJJA 1SSHA 2YUNA 2HBWA 1U4QA 2YK0A 2FO0A 2ESWA 2D5UA 1V1CA 4ZOLE 2EW3A 3RYHE 1K1ZA 2LHNA 1E6HA 1OV3A 1UUEA 2X3XD 4O2AE 4RTVA 3CVRA 2A28A 2CH4A 2DYBA 2X3WD 4OMOA 3EVYA 4MHCA 1QKXA 3CQCB 2VVKA 2XQYA 4DBRA 4CXYA 5LG4A 2OA5A 1S35A 1YKEB 2RQUA 2O2OA 4JUYA 5IXBA 1ZBJA 5HCKA 3R6NA 2CT3A 3VRYA 1Y0MA 1IAPA 3EG0A 3M0SA 4ZI2C 4LN2A 4NUVA 4K11A 2EHOB 2BZXA 3N9OA 2W00A 1X69A 4RTZA 3ZYLA 2O88A 4G2AA 2D0UA 2O9VA 1NYFA 4C91A 4TV8E 3RBBB 3VRZA 3CPZA 2NWBA 1D1AA 1M30A 3PVQA 2GBQA 2CLYC 4PNIA 2FG0A 1MIWA 3N9QA 1UE9A 1QUUA 1X2QA 2WM9A 3ZMTB 1AEYA 2KXCA 5LCYA 3SWHA 3RYCE 2CXDA 4H9QC 1WA7A 2DWKA 3U3IA 4GLMA 5LBMA 1FMWA 5LNKA 2JMHA 1D0XA 3C98B 4IIJE 5HWYA 3C64A 2GTJA 3H0FA 1OXZA 2NW7A 3QK6A 3KINB 4JJDA 2EPDA 3LBXA 1CKBA 1UX4A 4HVVA 4X1VA 3LK2B 4J9IA 2O9SA 4JJBA 2XAGB 5BMVE 2D1XA 5IH2A 3HI2A 5JDGA 1H8KA 3KV9A 2Q9QA 3FBZA 2CUDA 2B86A 2QDLA 3RNJA 4YJ2E 2CREA 4F17A 2NOXA 2ROTA 3PURA 2DNUA 2OAWA 4PAGA 4CI1B 2RQTA 1G73A 4GYSA 3H37A 5IHKA 3C0CA 3EGUA 3EHQA 4IIOA 5EK2A 5JRCA 1SEMA 2WSSV 1WYXA 4HKAA 3C4XA 1SHGA 4PK4A 3O5ZA 1BU1A 5JR9C 1VYVA 1T0JA 3IBPA 1H7CA 2F2VA 4IE5A 4EOZB 2LMJA 4RTTA 1MV0B 5IXFA 1M3AA 5JDHA 2FEIA 2J05A 3M0QA 2DX1A 1MMAA 2XASB 1IJ5A 4TZ4C 4DBQA 5L3BB 3N9LA 2CWYA 4MBQA 3FBLA 4IDZA 5DABA 3I9YA 2PFVA 4CI2B 5JDQA 1AWXA 3CQGB 3LFMA 2F2WA 2ENMA 2YUOA 1AWWA 3UTKA 3Q9DA 2KT1A 2OJ2A 2LT3A 5LGTB 3ZCJA 2AKLA 2DBMA 1H3HA 4H9NC 5FY0A 2KR3A 2BTTA 1QWEA 2LSIA 4O8SA 1PNJA 1YKHB 1QWFA 1UG1A 5FXVA 2JJ9A 3FXDB 2MBGA 3MJXA 2YINA 4QT7A 1B3QA 2L3LA 1PKSA 1U3OA 1WFWA 1X43A 5I11A 2LZ6B 4AFSC 3UA6A 2BZBA 2D2SA 4YLHA 3VKGA 3RC8A 1UTIA 5L3CB 2YUPA 2Y8DA 3TSZA 4O4JE 3ZJ1A 4OMQA 2DLRA 4C90A 1ZHCA 3OBVE 1B7TA 1AWJA 2CM0A 2HH7A 2YEVC 5J2TE 2ZMAA 1QCFA 4X20E 2CH4W 5LXTE 2D0NA 2BVMA 4GK0E 5HAXA 5JDFA 1RI9A 2KRSA 4GOUA 5FP3A 1G2BA 1B07A 4XAXB 1NEBA 4CQIA 3ZL7C 5I22A 1NYGA 1AZEA 4PK6A 2N9DA 1UDLA 2DVJA 4KMCA 2LP5A 1MIVA 1HTJF 5DQVA 3ZMSB 1OOTA 3KFWX 4ZI2D 1FMVA 4ZS3A 3R84B 1M3CA 2KBTA 3QWYA 3I9WA 4EZ4A 2VK9A 3PUAA 3AA6B 4XZCA 2DA9A 4Z8XA 5FYMA 4WBNE 2KRMA 2KXPB 3I0OA 3ZN1B 1JO8A 3H41A 3O9XA 4J2CA 3AVRA 2KEAA 2LJLA 3W15B 2HPJA 5C8YE 2KLQA 3ZYKA 4I4TE 1S94A 3AA1B 1QKWA 2WMNA 1JXMA 4J9CA 1ZSGA 5M4YA 3RC3A 4IE7A 2WWUA 2G6FX 4J9EA 1A0NB 4EYUA 1GCQA 3THKA 4MFRA 3VS1A 3RH3A 1I0CA 2LOPA 4PJLA 2ODVA 5CA0E 3UUXB 3F57A 3VHLA 1G8XA 3L09A 2E8IA 2E9XA 4OYJA 5JRCB 1SRLA 2BZ8A 2X9WA 3L3PA 1MMNA 2VL8A 4OFZA 2ES0A 3CQXC 2K24A 1NM7A 1RLQC 2JMCA 3OYZA 1AOJA 3ZJ2A 2A72A 2RPNA 4HCKA 2L2PA 3NGPA 2IC9A 3M0TA 5H6RB 5LHIB 4HVWA 4OMLA 2V1DB 3N5LA 3KVBA 1SHFA 2EYXA 1D0YA 5EK3A 3ZMUB 5HWXA 2LNHB 2MOXA 3N2KE 2HPLA 3ZN0B 3ZYMA 2KWHA 2X68A 3RRWA 3H0HA 1BR2A 4HVUA 2J1DG 3AA0B 2V7MA 4H9RC 4JLEA 3K3NA 1WYBA 2KE9A 2V1QA 2E9XC 1FIOA 3EG3A 4IE0A 2KNDA 3K8PC 4FI5A 1PRMC 2JM8A 3TVTA 3V5SA 4RTYA 4XBFB 1HJDA 4JEUB 3NHNA 1K76A 4DMWA 1OWAA 1YNZA 1U5PA 4M1PA 1T3LA 4IE4A 1G83A 1MNEA 3EDVA 4ZI7E 3GBQA 2Q9QC 3M65A 3TSWA 3CX6B 3F31A 1IJ6A 4QKNA 1T0HA 3A98A 5LHHB 2A08A 2RQRA 3ZEFB 3T8OA 4UVBB 2C0OA 2PBIA 5JDNA 4AKIA 1K9AA 1N5ZA 3AB3B 3HKBE 1BBZA 1TUDA 1OEBA 2KXDA 2DRKA 3REBB 2ZLYA 3NZPA 4IE6A 1AZGB 5FNVE 4OMMA 2CXLA 3U78A 2CWOA 2CSQA 3I9QA 2LEHA 2VKOA 3AAIA 1LCKA 2VASA 3LH5A 1US7B 1HS7A 1WDXA 3JC6D 2QA7A 4OYKA 3SRZA 4RTXA 3UF4A 2GQIA 2KYMA 2ABLA 2LSYA 4QX8B 1HSQA 4I50E 4ESRA 3ULRB 4UV9B 2DHRA 2XHEB 2DL5A 4DVDA 2K9AA 4CC3A 4EIKA 1Z9QA 3CX8B 5ETWA 5HXRA 2L0AA 2UXNB 4K0UA 2CSIA 4PK5A 2A2FX 2L3SA 2JM9A 2LJ1A 4M4ZA 1NLPC 4CC7A 2YU2A 3IF8B 2EYYA 1M3BA 3LBXB 2B1EA 4CXWA 2A37A 1W70A 2C5JA 3EG2A 3M0PA 1NG2A 2Q9QB 2XAJB 3KDSE 4BAYB 5KX5E 2YUQA 5DQWA 1FYNA 3KBUA 3J9X1 1FEWA 4AG2C 1ZUYA 5CB4E 2LE8A 3AAEB 3FB2A 2BVLA 1IO6A 2DMOA 2W10A 4AKGA 1BR1A 3N9PA 5LP6E 3VS0A 4DMVA 5E0OA 2JRKA 2V7LA 5HXEA 4DO0A 1KIKA 1PWTA 5DJQC 3EDUA 2M67A 4WW0A 4ZHQE 3E22E 2CCQA 1UJYA 2EGEA 2JMAA 1E1HB 1GBQA 1MMDA 3C51A 5GONE 4UV8B 4DEYA 3P8CD 5KMGP 1KSWA 3HA4A 1ZX6A 4NUUA 4OHFA 4P09A 5FXZA 4GBQA 1HF8A 2CMRA 2K5BB 4JEHB 4HFVA 1O3XA 4ISSA 5F8PA 1PRLC 3GA8A 5L3DB 1HD3A 4J9DA 2L3PA 4H9OC 4AI6A 2H8HA 4AFQC 4P0BA 2C5KT 2X51A 5JQGE 4TX5A 1WXUA 1GFDA 4BJNA 3PE0A 3B57A 5L2LA 4F14A 1NAFA 2EYWA 5FW9A 2DLPA 2J7IA 5H6QB 1E6GA 4IIMA 4A63B 2X9XA 1X6GA 4H63H 2MTQA 3I1AA 3MA9A 4HTEA 4ZS2A 1UCUA 3ZCIA 4ANJA 1GCPA 2RN8A 1VA7A 2NTXA 2M0YA 3RYIE 2PNIA 1YN8A 2WMOA 2CDTA 3HKEE 1YCSB 1KNZA 2Q9QD 2V26A 3DP7A 5TAOA 1T3SA 5LJMA 2ZM2A 3I5SA 4AFZC 3VU7H 2AZSA 2W62A 3ETUA 3KVAA 1NEGA 1WXTA 2WBLA 4GYRA 1E7OA 3HKCE 2KZ7B 1NWMX 3C4ZA 2F2XA 1IZNB 4LUEA 4AG1C 1AD5A 4IGUA 3NZQA 2JQQA 2PJQA 5A1LA 2KT8A 5L3FB 3VKHA 3DTOA 4U74A 3PUSA 1WR6A 3LK42 3O4XE 2IW5B 2YT6A 3CQTA 2EBPA 2PG8A 2BDEA 2XUEA 2DNXA 3F2EA 3WAKA 2CXFA 2LOSA 4HGAA 3TKLB 3NBXX 2DL4A 3NMZC 4D8DA 4QXCB 4AXPA 1VYTA 4ZI3D 5HXHA 2OI3A 1MMGA 3ZPOA 3HR0A 5FXXA 2KROA 2XMFA 3GWHA 1TUCA 4WCIA 3KV5A 2CEAA 2RP4A 3K3OA 1SPKA 3BQLA 3N9NA 4AKRB 1I1JA 1YWOA 2EGAA 1X79A 2EYZA 2LJ3A 1H92A 1K4US 4E7ZA 1KFZA 4QXBB 4QHOA 4JZ4A 2W61A 2E9XB 3PVLA 4E6RA 2JS0A 3UULA 4AQFC 3N2GE 2LSKA 3MZKB 4HN9A 4UVCB 4E7SA 3PDYA 2IAKA 4GK5E 4EYYR 1X2KA 4ORZA 1WRDA 3AVSA 2J06A 1U06A 2RA1A 3C50A 3HKDE 4QXHB 3ZC0A 1HG5A 1RUWA 2D8HA 4KBMB 3ONXA 3UATA 3VS2A 4KUMB 1NLOC 5L23A 3UUMA 4X1YE 2JS2A 1YW0A 4ISTA 3UA7A 2FRYA 2V7IA 2V7KA 4AQGA 2BZYA 4Z88A 1BK2A 1UJ0A 1UFFA 3ZMZB 4JJCA 1EZ3A 1WLXA 3RRCA 2DL3A 3UFEA 3NRXA 2FRWA 2GTOA 3BK9A 2KWIB 5EK4A 3S4UA 3SOLA 3KFVA 4YFSA 1LVKA 4LNPA 2NW9A 3I5RA 2LHRA 3CMLA 4BJMA 1AJ3A 2ED1A 2NW8A 5HXSA 4I55E 4YJ3E 4JPBW 3H0IA 4JZ3A 1PHTA 3IHRA 1EFNA 2CUBA 3E08A 2DCFA 3BQIA 2P9BA 3EHRA 3GMIA 2YSQA 1X27A 4AFUC 4FSSA 2DWGA 3B13A 4CZZB 2YDLA 2ACXA 2RQWA 3Q5XA 4WBOA 1Z9ZA 3REAB 3IQLA 5GJVB 4H9PC 5LA6E 4J9BA 4D8KA 2SEMA 1D1BA 4UXNB 3WAJA 5JR9A 2DILA 3NRYA 4X1KE 3FXEB 5IHNA 2EKHA 2EHOC 1QSDA 2N2NA 2X9HA 5L3GB 1M8MA 5IYZE 2X67A 4ILUA 2J6FA 2RQVA 3M0UA 4LE9A 1LKXA 2C0SA 2VB6A 2LSJA 2X0LB 3O1JA 3EUHA 1ABOA 1RLPC 2M51A 2DJQA 2E5KA 2XTLA 4LUDA 4CC2A 3JC6C 3K3QC 3LG7A 3N9MA 3ESLA 1W1FA 2Y6XA 2PTKA 1KK7A 2QGSA 5FMNA 1YP5A 1SRMA 2LQWA 1YD8G 3U23A 3ZC1A 4J9HA 3BQKA 3MACA 2DI4A 2K48A 1ZUKA 2L8KA 3FHNA 3OKQA 3RPUA 3I35A 4L5GA 2HCKA 3IEEA 3SHWA 1AWOA 2XAFB 3PUGA 2P4RA 2V1RA 2IC6A 2EQIA 5IHYA 1WXBA 4O4IE 2VKHA 2Y48B 1HCIA 3D0TA 4H63V 4YHJA 5HXCA 4CI3B 1U5SA 3UT5E 3V5UA 2AK5A 2ROLA 4ZNXA 2ZM8A 2LCSA 4B6XA 5CA1E 1UX5A 2ZM0A 3SS1A 1WIEA 1ZV4X 2VKNA 1GBRA 2JMKA 3RKOA 5FY7A 5FXWA 4ERRA 3ZMVB 4PJNA 3HL6A 2EHOA 2DE0X 4KP3C 4OMNA 5GJWB 1ZKEA 4IHJE 3PUQA 3WI3A 3VS7A 5HYAA 5LGNB 2JPFA 3VS5A 2EVRA 3PU8A 3ANWA 4QWNB 3VS3A 4HE8A 2GK9A 1BR0A 2JT4A 2SPCA 2W0GA 3O1HA 1LRZA 2DM1A 4AKHA 4WNKA 2D8JA 1UHFA 3J7Yq 4O2BE 3MXZA 5JDLA 1I07A 4QX7B 1M27C 4MALA 2J6OA 4J9FA 1KJWA 2MCNA 3SEMA 1Z0PA 2MOZA 2K3BA 5IHIA 3KV6A 1HX8A 3A5XA 3KV4A 3LJCA 3QC9A 5JH7E 1JXOA 4AKLA 1LVFA 2VWFA 4O4HE 5L3EB 4BA9A 1GCQC 2KYBA 4N78D 2K7AA 1YWPA 2XAHB 1GRIA 4TV9E 1X6BA 2DF6A 3GN5B 3Q5WA 1V9DA 4HEAA 5LOVE 4A56A 5ADXL 2K2MA 2LQNA 1HG2A 1MNDA 4UF0B 3O1IA 5JR9B 2H3RA 5FWBA 1GL5A 4Z8AA 3CKDA 4I43B 2CLYB 2CE7A 4EZHA 1AVZC 3RYFE 2JTEA 4ASKA 2LJ0A 4R0KA 2NWMA 2ODUA 1BB9A 2N1GA 1CKAA 2G0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRN A;  1OPL A;  2KGT A;  2GGR A;  2C0T A;  1PKT A;  1XOV A;  2AKK A;  2FPE A;  2PZ1 A;  1MUZ A;  1Y57 A;  1CSK A;  1UEC A;  5FWC A;  2DBK A;  1TG0 A;  3EG1 A;  1OPK A;  2O31 A;  5ECA A;  3VS4 A;  2LX7 A;  2HDA A;  4DEX A;  1J3T A;  5J1G A;  1ARK A;  2C0I A;  1JQQ A;  2DL7 A;  4RTU A;  3VS6 A;  4F16 A;  2K9G A;  2FPD A;  1MV3 A;  1K0S A;  4Z89 A;  2L3Q A;  2DL8 A;  2KNB B;  3M0R A;  1UGV A;  1S1N A;  1VYU A;  2K79 A;  2GNC A;  2IIM A;  4CC4 B;  2NUZ A;  1WX6 A;  1JU5 C;  2RNA A;  2AZV A;  2DRM A;  1W6X A;  1FMK A;  3FJ5 A;  2EGC A;  1WLP B;  2HEQ A;  5EC7 A;  2FPF A;  2MIO A;  4OMP A;  2J6K A;  2RF0 A;  2ED0 A;  4Y92 A;  1ABQ A;  2K6D A;  2W0Z A;  3JV3 A;  2ECZ A;  2I0N A;  1QLY A;  2HSP A;  4HXJ A;  4RTW A;  1GFC A;  1ZLM A;  1WI7 A;  2A36 A;  2JW4 A;  1UHC A;  3KBT A;  1K0X A;  3NPF A;  4KRT A;  2CT4 A;  4J9G A;  1JEG A;  2SRC A;  1ZUU A;  1SSH A;  2YUN A;  2HBW A;  2FO0 A;  2ESW A;  1V1C A;  2EW3 A;  4RTV A;  1OV3 A;  1K1Z A;  1E6H A;  1UUE A;  2X3X D;  2DYB A;  2A28 A;  2CH4 A;  2X3W D;  4OMO A;  1QKX A;  2VVK A;  2RQU A;  2O2O A;  5IXB A;  1ZBJ A;  5HCK A;  3R6N A;  2CT3 A;  1Y0M A;  3EG0 A;  3M0S A;  4LN2 A;  4K11 A;  2BZX A;  2O88 A;  1X69 A;  4RTZ A;  3VRZ A;  3RBB B;  2O9V A;  1NYF A;  1M30 A;  2GBQ A;  2FG0 A;  1X2Q A;  1UE9 A;  1AEY A;  2KXC A;  1WA7 A;  4GLM A;  3H0F A;  2GTJ A;  4JJD A;  2EPD A;  1CKB A;  4HVV A;  4X1V A;  4J9I A;  2O9S A;  4JJB A;  5IH2 A;  2D1X A;  1H8K A;  2CUD A;  2B86 A;  2QDL A;  3RNJ A;  4F17 A;  2CRE A;  2ROT A;  2DNU A;  2OAW A;  2RQT A;  5IHK A;  3C0C A;  3EGU A;  3EHQ A;  4IIO A;  1SEM A;  1WYX A;  1SHG A;  3O5Z A;  1BU1 A;  2LMJ A;  1VYV A;  1T0J A;  3I9Q A;  3UF4 A;  2F2V A;  4RTT A;  5IXF A;  1MV0 B;  1M3A A;  2FEI A;  2J05 A;  3M0Q A;  2DX1 A;  1AWX A;  2F2W A;  2ENM A;  2YUO A;  1AWW A;  2KT1 A;  2OJ2 A;  2AKL A;  2DBM A;  1H3H A;  2KR3 A;  2BTT A;  1QWE A;  1PNJ A;  1QWF A;  1UG1 A;  5I11 A;  4QT7 A;  1B3Q A;  1WFW A;  1PKS A;  1U3O A;  1X43 A;  2LZ6 B;  4AFS C;  3UA6 A;  1UTI A;  3TSZ A;  2YUP A;  4OMQ A;  1AWJ A;  2K7A A;  2RMO A;  2D0N A;  1QCF A;  2CH4 W;  1RI9 A;  2KRS A;  1G2B A;  1B07 A;  1NEB A;  3ZL7 C;  5I22 A;  1NYG A;  1AZE A;  1UDL A;  2DVJ A;  2LP5 A;  1OOT A;  3QWY A;  2KBT A;  1M3C A;  2DA9 A;  2KRM A;  1JO8 A;  3H41 A;  2KEA A;  1QKW A;  1JXM A;  4J9C A;  1ZSG A;  4J9E A;  2G6F X;  1A0N B;  1GCQ A;  3THK A;  3VS1 A;  1I0C A;  3F57 A;  1G8X A;  1SRL A;  2JXB A;  2BZ8 A;  3QWX X;  2RPN A;  2JMC A;  1NM7 A;  1RLQ C;  1AOJ A;  4HCK A;  2L2P A;  3NGP A;  3M0T A;  4OML A;  4HVW A;  1SHF A;  2EYX A;  2MOX A;  2LNH B;  3H0H A;  4HVU A;  2KE9 A;  2V1Q A;  3EG3 A;  1PRM C;  2JM8 A;  3TVT A;  4RTY A;  3NHN A;  1K76 A;  1YNZ A;  1T3L A;  1G83 A;  3EDV A;  3GBQ A;  3TSW A;  1T0H A;  3A98 A;  2A08 A;  2RQR A;  2C0O A;  3M0U A;  1N5Z A;  1K9A A;  1TUD A;  1BBZ A;  1OEB A;  2KXD A;  2DRK A;  3REB B;  1AZG B;  4OMM A;  2CSQ A;  1LCK A;  3LH5 A;  1WDX A;  4RTX A;  2GQI A;  2KYM A;  2ABL A;  1HSQ A;  4ESR A;  3ULR B;  2DL5 A;  4CC3 A;  4EIK A;  1Z9Q A;  2L0A A;  2LJ1 A;  2L3S A;  2CSI A;  4M4Z A;  2JM9 A;  4CC7 A;  1NLP C;  2EYY A;  1M3B A;  2A37 A;  1W70 A;  3M0P A;  3EG2 A;  2YUQ A;  1FYN A;  3KBU A;  4AG2 C;  1ZUY A;  1IO6 A;  2DMO A;  2W10 A;  3VS0 A;  1KIK A;  1PWT A;  3EDU A;  1UJY A;  2EGE A;  2JMA A;  1GBQ A;  4DEY A;  1KSW A;  1ZX6 A;  4GBQ A;  2LCS A;  1PRL C;  1HD3 A;  4J9D A;  2L3P A;  2H8H A;  4AFQ C;  1WXU A;  1GFD A;  3PE0 A;  4F14 A;  2EYW A;  5FW9 A;  2DLP A;  2J7I A;  1E6G A;  4IIM A;  4A63 B;  1X6G A;  2RN8 A;  1GCP A;  1VA7 A;  2M0Y A;  2PNI A;  1YN8 A;  2CDT A;  1T3S A;  3I5S A;  4AFZ C;  2AZS A;  1NEG A;  1WXT A;  1E7O A;  2F2X A;  4LUE A;  4AG1 C;  1AD5 A;  2KT8 A;  1HJD A;  3CQT A;  2YT6 A;  2EBP A;  2DL4 A;  3NMZ C;  4D8D A;  1VYT A;  2OI3 A;  2KRO A;  2XMF A;  1TUC A;  4WCI A;  1SPK A;  1I1J A;  1YWO A;  2EGA A;  2LJ3 A;  1K4U S;  2EYZ A;  1H92 A;  1KFZ A;  4JZ4 A;  3PVL A;  4E6R A;  2JS0 A;  3PDY A;  2IAK A;  1X2K A;  4ORZ A;  2J06 A;  1U06 A;  1RUW A;  3UAT A;  3VS2 A;  2D8H A;  5L23 A;  1NLO C;  2JS2 A;  3UA7 A;  2FRY A;  2BZY A;  4Z88 A;  1BK2 A;  1UJ0 A;  1UFF A;  4JJC A;  3PVQ A;  2DL3 A;  2FRW A;  2GTO A;  4J9F A;  4LNP A;  3KFV A;  1AWO A;  3I5R A;  2ED1 A;  4JPB W;  3H0I A;  4JZ3 A;  1PHT A;  2CUB A;  1EFN A;  3EHR A;  2YSQ A;  1X27 A;  4AFU C;  4FSS A;  2YDL A;  2RQW A;  1Z9Z A;  3REA B;  3IQL A;  5GJV B;  4J9B A;  4D8K A;  2SEM A;  2DIL A;  5IHN A;  2EKH A;  1M8M A;  2RQV A;  2J6F A;  4R0K A;  4LE9 A;  1RLP C;  1ABO A;  2M51 A;  2DJQ A;  2E5K A;  4LUD A;  4CC2 A;  2PTK A;  1W1F A;  3U23 A;  1YP5 A;  1SRM A;  2LQW A;  4J9H A;  1ZUK A;  3I35 A;  2HCK A;  3SHW A;  2P4R A;  2V1R A;  2EQI A;  1WXB A;  1U5S A;  2AK5 A;  2ROL A;  4ZNX A;  1WIE A;  2VKN A;  1GBR A;  2DE0 X;  4OMN A;  5GJW B;  3VS7 A;  2EVR A;  3VS3 A;  2JT4 A;  2DM1 A;  2D8J A;  1UHF A;  1I07 A;  1M27 C;  2J6O A;  3SEM A;  1KJW A;  2MCN A;  2K3B A;  5IHI A;  1NG2 A;  1JXO A;  2VWF A;  1GCQ C;  2KYB A;  1YWP A;  1GRI A;  1X6B A;  2DF6 A;  2K2M A;  2LQN A;  1GL5 A;  5FWB A;  4Z8A A;  3VS5 A;  2JTE A;  1AVZ C;  2LJ0 A;  4RUG A;  2NWM A;  1BB9 A;  1YCS B;  1CKA A;  3VRY A; 
#chains in the Genus database with same CATH topology
 4IL4 A;  4YXD A;  2KGT A;  3AE5 A;  5J39 A;  3A8M B;  3Q5D A;  2X66 A;  1T98 A;  2NUT A;  3EGD A;  3HRU A;  3CD6 Q;  2FPE A;  2V7J A;  4X5T A;  2PZ1 A;  1YIJ T;  1UK5 A;  1MUZ A;  2QA4 A;  1UEC A;  4P1N A;  4OGC A;  3C4W A;  4EAH A;  1Y64 B;  1WHJ A;  1VQK A;  2VWA A;  5LJN A;  2UUB T;  1J3T A;  3AAA B;  1JQQ A;  3VS6 A;  2I59 A;  2A3D A;  2E64 A;  1KC8 C;  1MV3 A;  1K0S A;  3X26 B;  2L3Q A;  2K79 A;  2GNC A;  2BKN A;  2R5A A;  2IIM A;  5KDM C;  4PW8 A;  2ATC B;  1OU8 A;  1N27 A;  1W09 A;  2EJF A;  1VQK T;  1IRE B;  2MPK A;  1UB4 A;  1QQJ A;  1WQ7 A;  2X9Y A;  2DRM A;  2W66 A;  1I4K 1;  2FL7 A;  4N4G A;  3AE8 A;  1BR4 A;  2KMF A;  5J2U E;  3CX7 B;  2EGC A;  5EC7 A;  3VYG A;  2V5D A;  3DJB A;  2LVM A;  3RF1 A;  2X4J A;  4M75 B;  2BG9 C;  3JB9 D;  5GAN g;  4QH5 A;  1O9S A;  3CC7 T;  4JRI A;  2J6K A;  3GN5 A;  4OK0 A;  1WQW A;  2QA4 Q;  3HSB A;  4PJO C;  4JDS A;  5CKE A;  1WR0 A;  4F7U B;  3CMA A;  2FHD A;  2C5I T;  1OZ2 A;  4BUG A;  1QLY A;  1KFY A;  2XQA A;  2QQS A;  2D9T A;  1SHZ C;  3CPW S;  1VRB A;  3AEF A;  2DD4 A;  1VQ9 T;  1UHC A;  3C94 A;  2XIC A;  3EFO B;  3JB9 I;  4IL9 A;  1KC8 R;  4YTP A;  4EXT A;  1M5Q 1;  1ZUU A;  4FJO A;  4FSX A;  3UQ7 A;  1SSH A;  5A0D A;  1V1C A;  4ZOL E;  4RTV A;  2LHN A;  3CVR A;  5CJ5 A;  4DBR A;  3G7Z A;  2RQU A;  4JRK A;  2HQH A;  5HCK A;  3R6N A;  3FZF B;  1Y0M A;  1IAP A;  3ZST A;  3M0S A;  4ZI2 C;  4K11 A;  1VQ8 T;  2EHO B;  3N9O A;  4QW2 A;  5L4E A;  3VRZ A;  4C91 A;  3QXE B;  2E4H A;  4JI5 T;  2FG0 A;  2KXC A;  2MK5 A;  3CC4 Q;  2K5L A;  4KH1 B;  3OYC A;  2CXD A;  4GLM A;  2RHZ A;  5LBM A;  3T1Y T;  1QMC A;  3H0F A;  2NW7 A;  2JQH A;  2A0F B;  1UX4 A;  3UU4 A;  4J9I A;  2XSB A;  4C8Q F;  2D1X A;  4B9X A;  5ABH A;  1ZA1 B;  1U1S A;  2OAW A;  3OVU A;  3OYB A;  1G73 A;  5IHK A;  4IIO A;  1ZSZ A;  2WDQ A;  5JRC A;  1SEM A;  4RMO A;  1PM3 A;  2V5C A;  3C4X A;  3O5Z A;  2QG9 B;  1BU1 A;  4IE5 A;  4EOZ B;  2K2V A;  1MV0 B;  1M3A A;  2D9D A;  2DX1 A;  3RKY A;  1TUG B;  2CRB A;  4A97 A;  4MBQ A;  5DAB A;  1VQO A;  1YIT A;  5JDQ A;  1QLB A;  2ENM A;  2KT1 A;  3EGD B;  1H3H A;  2DIQ A;  4PL6 A;  4H9N C;  4HWF A;  3GIB A;  2BTT A;  3ER0 A;  2LSI A;  4LD9 K;  4CN4 A;  3HP9 A;  3TLU A;  1X43 A;  1WFW A;  1U3O A;  1VQP A;  2LZ6 B;  4B3T T;  3UWN A;  2BZB A;  4JI2 T;  1YJN A;  4YLH A;  2RH2 A;  1WPY A;  1KF6 A;  3ZJ1 A;  3E19 A;  1N33 T;  1N9R A;  3EHZ A;  2RMO A;  2D0N A;  3CXC P;  4B3R T;  5AQN B;  5HAX A;  1XWM A;  2W2U A;  3PUY F;  4FYW B;  1YQ3 A;  2KDS A;  5GAO q;  4XAX B;  5GAO m;  3ZL7 C;  1T7S A;  3Q1J A;  2XD0 A;  4M78 B;  4HWC A;  4QVC A;  4KMC A;  1F1B B;  1E2A A;  1UGR B;  3KFW X;  4ZS3 A;  3R84 B;  2CBJ A;  2XM1 A;  2YRC A;  4EZ4 A;  3JCM W;  5FYM A;  4WBN E;  5KYW B;  4OB0 B;  3B5M A;  3ZN1 B;  4GKK T;  3W15 B;  4CI0 C;  4V2S A;  2HPJ A;  2KLQ A;  1SUM B;  4MMK A;  5IN1 A;  4J9C A;  4IT4 A;  1NPP A;  2WWU A;  4J9E A;  2ZPB B;  2K3X A;  4NS5 A;  4EYU A;  3THK A;  2MMP A;  3OS1 A;  2JIW A;  3EH1 A;  4JBW F;  1G8X A;  2XDP A;  3L3P A;  3S3M A;  4OFZ A;  3QWX X;  2ES0 A;  3CQX C;  1YI2 Q;  1JNR A;  2A72 A;  1U1T A;  3CCQ Q;  3M0T A;  4UC4 A;  5H6R B;  5LHI B;  2QTV A;  3MEU A;  2V1D B;  4N4H A;  4OML A;  5EK3 A;  5HWX A;  2LNH B;  3N2K E;  2G3R A;  1OX8 A;  2NYS A;  3FZM B;  4J5Y A;  3K3N A;  1K73 U;  3G6E Q;  2CHO A;  1FIO A;  3EG3 A;  2KND A;  4FI5 A;  2JM8 A;  2X4W A;  2DZC A;  4RTY A;  4XBF B;  3NHN A;  1K76 A;  5GAN f;  3L8R A;  4P5N A;  4C92 G;  1MNE A;  3GBQ A;  5D6X A;  5IAY A;  2A9U A;  3TSW A;  4C92 F;  3CX6 B;  1NJI R;  4QKN A;  1JJ2 S;  1BCM A;  1KD1 R;  4AKI A;  1N5Z A;  5CKH A;  1BBZ A;  3OMG A;  3OYF A;  3REB B;  2KXD A;  2DRK A;  2YXY A;  1PSF A;  5FNV E;  1FXX A;  3L2Z A;  2CXL A;  1M1G A;  3OYG A;  3PJA J;  1US7 B;  3X20 B;  3SRZ A;  4JI8 T;  2ABL A;  4QX8 B;  1HSQ A;  5GMK e;  5HEO A;  1XDO A;  2DHR A;  2LLY A;  5DM7 R;  3A8Y C;  4DVD A;  4CC3 A;  5KH6 A;  2FZC B;  1Y01 A;  5HXR A;  4ATO A;  4DOW A;  2L3S A;  1WGS A;  2JM9 A;  2EYY A;  1KQ1 A;  3PMT A;  2HZY A;  2B1E A;  2Q9Q B;  2XAJ B;  3KDS E;  2DET A;  1YJ9 Q;  3KBU A;  3J9X 1;  2QQB A;  2LE8 A;  2RHU A;  3CME A;  3P8D A;  1ZSZ B;  5GAN 8;  2DYI A;  2E6N A;  3V8J A;  5DJQ C;  4WW0 A;  4M7D A;  2ZPG B;  2CCQ A;  2EGE A;  2DTH A;  5GAN d;  4EED A;  1MMD A;  1VQ6 T;  3V7R A;  2HKQ B;  2YRD A;  4BI3 A;  1N8R R;  1ZX6 A;  2LCS A;  2X0Y A;  1HF8 A;  2CMR A;  3M58 A;  1KQS A;  2WWV A;  1HD3 A;  2DK3 A;  1K73 C;  2XQ9 A;  3CCV T;  2H8H A;  4AFQ C;  2KMT A;  2C5K T;  4I0U A;  5JQG E;  2YWW A;  5LJ5 f;  3PE0 A;  5AYF A;  3I56 A;  1I5L A;  1BI3 A;  1E7P A;  1X01 A;  1E6G A;  2KQW A;  5AQR B;  4A4E A;  2MTQ A;  4U7I A;  2HBP A;  1IHV A;  3WXM B;  1SSF A;  2HD0 A;  1KNZ A;  3PNW C;  4C0Z A;  4LFA T;  4AFZ C;  3VU7 H;  2AZS A;  3ETU A;  2UU9 T;  4KGZ B;  2WBL A;  2D0Q B;  1W2B S;  4IGU A;  1NJI U;  4OP0 A;  3DTO A;  3O4X E;  2PG8 A;  3WAK A;  4M7A D;  3I55 T;  2LOS A;  3RMQ A;  3SD4 A;  4AXP A;  2OI3 A;  1NPR A;  5KXJ A;  4QVD A;  4TWH A;  3ZPO A;  3EFR A;  5FXX A;  2MPX C;  2XMF A;  4HA8 A;  4ZTJ A;  3GWH A;  5CQX A;  4C0D B;  1SPK A;  2CP3 A;  2RP4 A;  2K3Y A;  3N9N A;  4AKR B;  1I1J A;  2LJ3 A;  3ZBD A;  1VQM T;  4E7Z A;  4QXB B;  4QHO A;  5AQL B;  3PVL A;  1VQL A;  4YSZ A;  5LJ5 g;  3OYK A;  2RHX A;  4HN9 A;  1X2K A;  2E5V A;  3AVS A;  4B3S T;  4HFD A;  3RIA A;  1NLO C;  1YW0 A;  1B34 A;  4IST A;  4BE1 A;  5KYU B;  3SDZ A;  2V7K A;  2FJD A;  3ZMZ B;  4JI6 T;  4YTM A;  4C92 A;  1TOV A;  2GTO A;  5AQT B;  3BK9 A;  2M02 A;  5GAM g;  4U7Y A;  1G3Y A;  3I5R A;  4EGW A;  4BJM A;  1I6Z A;  2IIU A;  2NW8 A;  3UFG A;  4I55 E;  4YJ3 E;  3DLL A;  4JZ3 A;  2MAM A;  1PHT A;  3E08 A;  2EJG A;  1VQ9 Q;  3DKM A;  5LJ5 j;  3GMI A;  3ABV A;  5GAN 2;  2FYK A;  5GAO n;  3GPL A;  4JYA T;  2RQW A;  2BS3 A;  2RJF A;  1Z9Z A;  1KD1 U;  5GJV B;  5GAM d;  1D1B A;  3P50 A;  2DIL A;  2OTJ T;  2F5K A;  4LF9 T;  5IHN A;  5GAM h;  5L3G B;  3CC7 Q;  1M8M A;  2RQV A;  2J6F A;  4R0K A;  2X0L B;  2LSJ A;  2HN2 A;  3EUH A;  4ILA A;  2M51 A;  1HR0 T;  5CKB A;  4JV5 T;  3JC6 C;  4M75 C;  1GXI E;  3LG7 A;  1YCY A;  4DV0 T;  3CCJ A;  1VQ7 T;  2F4V T;  4MZM A;  4C92 E;  5LJ5 d;  1BIA A;  4LF8 T;  4J9H A;  3PGG A;  2XI9 A;  1IBK T;  1ZUK A;  1Q86 U;  3FHN A;  4LFB T;  2CZ1 B;  5LB7 B;  1OU9 A;  3SHW A;  1M1K U;  1HXD A;  2IC6 A;  5IHY A;  4RG2 A;  3VKI A;  1JB0 E;  2MWO A;  2RB6 A;  1XNQ T;  2AK5 A;  2ROL A;  3FZH B;  5HEJ A;  2ZM0 A;  2HKN A;  3SS1 A;  1IB8 A;  3OMC A;  1ZV4 X;  2YKS A;  4J6X A;  4OB1 B;  5FXW A;  3ZMV B;  4PJN A;  4DR2 T;  2EHO A;  1OED A;  2DE0 X;  4OVA A;  1Q82 R;  1YJ9 A;  3L39 A;  3WI3 A;  1UGQ B;  2K4Y A;  4HE8 A;  1XTD A;  5I21 A;  2XK0 A;  2W0G A;  3O1H A;  4WNK A;  4KHZ F;  3NTI A;  1N8R U;  3MXZ A;  1I07 A;  3SEM A;  2FBW A;  2NUP B;  4JRP A;  2JZ2 A;  4JLG A;  2MCN A;  1Z0P A;  2K3B A;  5IHI A;  2LX9 A;  1HX8 A;  3LJC A;  1JXO A;  4ZZB A;  4AKL A;  1WFD A;  5AQU B;  1GCQ C;  4KI0 F;  3ZKR A;  1W4S A;  2JTM A;  2VV5 A;  3JCM d;  1GRI A;  2DF6 A;  5J3B A;  2OTL Q;  3CCJ T;  3GNG A;  4OX9 T;  3O1I A;  1OUL A;  1Z8U A;  3MO8 A;  1OYX A;  4I43 B;  4LDU A;  1ZBX A;  1GQE A;  2FVU A;  4DID B;  4C92 D;  3EGX A;  2KRN A;  2YLC A;  1YJN Q;  2QAZ A;  1Q95 G;  5LHG B;  3PTR B;  2R58 A;  4MML A;  3OW2 S;  2XU8 A;  4LML A;  2KT9 A;  1D1C A;  1CSK A;  2DBK A;  1QVG P;  5FU7 C;  4U72 A;  2LC4 A;  2PUK B;  4ZEY A;  2XKO C;  3VS4 A;  3H3A A;  2BG9 A;  2LX7 A;  1FWZ A;  1YHQ T;  4NOY A;  4UIG A;  3NTK A;  4BY6 B;  4PFO A;  1ARK A;  2CA5 A;  4UEL A;  4X64 T;  2L89 A;  2QYZ A;  1SA0 E;  2WP9 A;  3E0Z A;  5FY1 A;  4WZX A;  3UU3 A;  2BIV A;  2WDR A;  3A8O B;  5FU6 C;  2F1L A;  4KUD K;  2NUZ A;  5F3J A;  3F70 A;  4ILB A;  3G4S A;  5JVD E;  1WX6 A;  2QXF A;  1CUN A;  2H7O A;  3PJA A;  1JU5 C;  5ABF A;  2DD5 A;  5KYY B;  5LBQ B;  1W6X A;  1FMK A;  4FYX B;  3Q2M A;  1N8R C;  3G71 Q;  3MK7 C;  1WLP B;  1WNL A;  2H7V C;  3CCM A;  1VQ5 Q;  3OYJ A;  2CZ0 B;  1MIY A;  5LJ3 f;  4II1 A;  4Y92 A;  3AA7 B;  1ABQ A;  3OYX A;  3CEY A;  2EHO D;  4CXX A;  4TUY E;  5GAN e;  1VUB A;  3CCJ Q;  2ECZ A;  2I0N A;  3N2O A;  3CC2 Q;  2L9Q A;  4QQ6 A;  1WI7 A;  2A36 A;  3HTR A;  3RX6 A;  2VKJ A;  2RM4 A;  1VQP Q;  2QDY B;  3V7C A;  3PUX F;  3ZLI A;  2KI7 A;  3ME9 A;  5GAM j;  4PFP A;  1UEB A;  3L2U A;  2RD1 A;  1I81 A;  2RK1 A;  4KRT A;  4J9G A;  2SRC A;  4U2Y A;  4NIQ A;  2J62 A;  3CK6 A;  2HBW A;  2ESW A;  1M1F A;  1RL2 A;  1Y96 A;  2E1H A;  2X3X D;  1HNX T;  4OMO A;  3AHU A;  1QKX A;  4BAC A;  2VVK A;  4FYY B;  1S35 A;  2O2O A;  1KNR A;  2BBJ A;  2CP6 A;  3EG0 A;  4TNW A;  4LN2 A;  1OQK A;  1TH7 A;  3VJP A;  2BZX A;  2O88 A;  2W00 A;  4RTZ A;  3ZYL A;  4XU2 A;  2D0U A;  3ONJ A;  4Y91 A;  2NWB A;  1D1A A;  1M30 A;  3MEA A;  1K73 R;  2CLY C;  4PNI A;  4M78 A;  1QVG S;  1MIW A;  3N9Q A;  4M7A B;  5L47 A;  4YY3 T;  1NJI C;  3ZMT B;  2HNI A;  4C8Q C;  3U3I A;  4HFB A;  4FW1 A;  2JMH A;  4YTN A;  3UU5 A;  3OQ5 A;  2NUP A;  3FJP A;  5CFB A;  2JN0 A;  1VQL Q;  3QK6 A;  2CP2 A;  4JJD A;  1U8R A;  3LBX A;  2E12 A;  2O01 E;  4HVV A;  4X1V A;  2XAG B;  5BMV E;  1M4Z A;  2Q9Q A;  3H6Z A;  1ZOY A;  2B86 A;  3TEE A;  4FW2 A;  2ROT A;  1QP3 A;  3PUR A;  2DNU A;  2RQT A;  3LW5 E;  4CI1 B;  3PT9 A;  1IZ6 A;  4L59 A;  2WSS V;  4E47 A;  5LJ3 h;  4FT4 A;  1YJ9 T;  3I9Q A;  5JR9 C;  3FZL B;  3IBP A;  1H7C A;  1T0J A;  2VC8 A;  3HL8 A;  3PV0 F;  2ZGW A;  5JDH A;  2BE9 B;  4ZGE B;  2J05 A;  4EMG A;  4C0D C;  4TZ4 C;  1IJ5 A;  3I9Y A;  3ZFJ A;  3CQG B;  2DBM A;  2LRK A;  5GAN 5;  4BE2 A;  5HCJ A;  5FY0 A;  1PNJ A;  1YKH B;  1UG1 A;  1YBY A;  5L4H A;  2JJ9 A;  4J8O A;  5I11 A;  2YIN A;  1B3Q A;  2CP0 A;  1PKS A;  1HNZ T;  4AFS C;  1PCX A;  2D2S A;  1Q81 C;  5L3C B;  3G4S Q;  4OMQ A;  2DLR A;  3OBV E;  1KD1 C;  1V29 B;  2K7A A;  4ELY C;  2CH4 W;  4X20 E;  4ZXL A;  3RUX A;  5FP3 A;  3TLS A;  3VRB A;  1G2B A;  3G71 T;  3GOX A;  4JI7 T;  3G6E A;  2RO0 A;  3BDL A;  2EIF A;  4PK6 A;  1S72 T;  2LNV A;  5AT1 B;  2IHR 1;  1MIV A;  1HYO A;  4ZI2 D;  1G3S A;  3AXJ A;  3QWY A;  2KBT A;  4Z91 A;  1N32 T;  4ILC A;  5F5W A;  2EYQ A;  2PVD B;  2KRM A;  1OI1 A;  4TVR A;  1KC8 U;  3JCM V;  4HWD A;  2QEX A;  2WZH A;  5AQJ B;  1M9S A;  3ZYK A;  4I4T E;  4WTO B;  2KAF A;  3JCM c;  2WMN A;  3OYA A;  1M1K C;  3CC4 A;  2WSC E;  1GCQ A;  4MFR A;  3RH3 A;  4N4I A;  2LOP A;  1YHQ Q;  3F57 A;  3VHL A;  4OYJ A;  2E9X A;  2BZ8 A;  5CCA A;  1KEY A;  2V8S V;  2K24 A;  1RLQ C;  3OYZ A;  2M0O A;  3NGP A;  3X28 B;  2EYX A;  5D6W A;  1D0Y A;  4M7D B;  3MHX A;  3RKW A;  2X68 A;  2KSS A;  3RRW A;  3ASK A;  1B34 B;  2J1D G;  3AA0 B;  4HWI B;  2F5T X;  1RAE B;  4JLE A;  1VQL T;  1WYB A;  2XY8 B;  1C0M A;  2KK4 A;  3QBY A;  3EI0 A;  1VQM A;  2M1H A;  4FYV B;  3K8P C;  4KX6 A;  2V6Y B;  2AIR B;  3TVT A;  1JJ2 A;  1VQ5 A;  4N0A C;  1CHU A;  4OF1 A;  4AMC A;  2EQM A;  1T3L A;  4IE4 A;  1Y96 B;  3JCM e;  3CCR A;  2OTJ Q;  3EDV A;  4ZI7 E;  2K57 A;  2Q9Q C;  1VQ8 Q;  1IJ6 A;  2V8I A;  1T0H A;  3QUI A;  2DVE A;  5AQO B;  2XM2 A;  4Q25 A;  3T8O A;  3QB5 A;  2NLU A;  3HKB E;  1I94 T;  5C3J A;  1LPL A;  3RMS A;  5GAN 6;  4BD3 A;  4QH4 A;  4OMM A;  4J7F A;  3U78 A;  4OMF B;  3V8L A;  2CWO A;  2E5Q A;  4EEB A;  3SWN B;  2LEH A;  1VQ7 A;  1LCK A;  3AAI A;  3HRS A;  2GQI A;  2KYM A;  4XTZ A;  5GAM e;  4KT0 E;  1K9M C;  4ESR A;  3T1H T;  5HCM A;  4M7A C;  3IA3 A;  2K9A A;  2I0M A;  2LJ1 A;  3S3N A;  2CSI A;  2QEX T;  2A2F X;  4A54 A;  4M77 G;  3IF8 B;  5C6S A;  5HY6 A;  3LBX B;  1YIT Q;  3EAM A;  3L2R A;  3AE3 A;  3TLV A;  3WVE B;  2I6H A;  3QNU A;  2W67 A;  1X9B A;  1M2V A;  1ZUY A;  3FB2 A;  3N9P A;  4PFZ A;  3VS0 A;  3M3Z B;  5A0G A;  2IML A;  2QQA A;  3AEG A;  3EDU A;  2Y4X A;  4ZHQ E;  3E22 E;  2DER A;  1YJN T;  3JB9 J;  4M78 C;  1GBQ A;  2VUB A;  4UV8 B;  4M77 F;  3T9N A;  4DEY A;  1VQK Q;  1LOJ A;  5FXZ A;  4EV6 A;  3C4S A;  4TWF A;  3OYI A;  4ISS A;  1O3X A;  3QPH A;  4DR6 T;  3GA8 A;  4ME7 A;  4J9D A;  4AI6 A;  3QHS A;  4PJO F;  3EH2 A;  4YHH T;  1WXU A;  2DTI A;  4JS5 A;  3B57 A;  5L2L A;  4F14 A;  2EYW A;  4O6J A;  5H6Q B;  4IIM A;  2QQ9 A;  5HKC A;  2BUD A;  5CR2 A;  4HFI A;  4A63 B;  2X9X A;  1X6G A;  1TSF A;  3I1A A;  3MA9 A;  4HTE A;  3RES A;  4U33 A;  3M5A A;  4C92 C;  3LGL A;  4A4H A;  2CDT A;  2WMO A;  2QRX A;  1NEN A;  2V26 A;  5AQF B;  1Q86 R;  1T3S A;  5LJM A;  4M75 E;  1QP2 A;  2W62 A;  2WB5 A;  3KVA A;  2EKO A;  4JUV A;  1WXT A;  2QAS A;  5LMU T;  2ACZ A;  2OV9 A;  2KZ7 B;  2UUC T;  3AXJ B;  1AD5 A;  4IRE A;  2KT8 A;  5L3F B;  5FU6 B;  4U74 A;  2YT6 A;  2COZ A;  2DNX A;  1EIF A;  3A1P A;  4HGA A;  4KUI A;  2WSE E;  3NMZ C;  5HXH A;  1MMG A;  3CC2 T;  4YSX A;  3EAE A;  3HKS A;  4O5V A;  1TUC A;  2IPO B;  3KV5 A;  4JI4 T;  1W2B P;  3K3O A;  3BQL A;  3MPU B;  1X79 A;  2EYZ A;  3JRZ A;  1H92 A;  5GAO l;  4E2F B;  2E9X B;  1JBM A;  2DL1 A;  4E6R A;  3UUL A;  5CIU A;  4UVC B;  1VQM Q;  1KHI A;  3C12 A;  5D6Y A;  2RA1 A;  3C50 A;  1RUW A;  1HG5 A;  4LFC T;  5L23 A;  4LMJ A;  3UA7 A;  3NTH A;  2BZY A;  3PFS A;  3ZT7 A;  1RAF B;  1EZ3 A;  1WLX A;  4J9F A;  2FRW A;  3UFE A;  3NRX A;  3HHT B;  5KYX B;  4LF6 T;  4NL2 A;  1QVF P;  2NW9 A;  3CC2 A;  4DQ2 A;  1AJ3 A;  4JPB W;  3H0I A;  5AQM B;  2YSQ A;  5FVK A;  5FVL A;  4CZZ B;  4WBO A;  4F7U E;  4H9P C;  5LA6 E;  2SEM A;  3CD6 A;  3WAJ A;  1VCS A;  3FXE B;  3OSV A;  5A2Q E;  1QSD A;  2XJ7 A;  1KHC A;  4FU6 A;  2FUP A;  2VXF A;  1LKX A;  2VB6 A;  3O1J A;  1H3Z A;  1ABO A;  1JNZ A;  3NFC A;  2E5K A;  2XTL A;  1YFN A;  2GFU A;  2XQ6 A;  2X35 A;  3FEO A;  1VQ4 A;  2R6G F;  2PTK A;  3CCS A;  1W1F A;  1YP5 A;  2LQW A;  2HN1 A;  4IUQ A;  1VQP T;  5LJ3 j;  3C95 A;  3I35 A;  3G4S T;  2HCK A;  3PMI A;  2V1R A;  4M77 C;  2EQI A;  2E2A A;  2H89 A;  4XU0 A;  5HXC A;  1C6V X;  4CI3 B;  1VCT A;  3UT5 E;  1WJS A;  4A98 A;  4ZNX A;  4M7A G;  1VQO T;  2VL0 A;  3RKG A;  2HQX A;  1VQ5 T;  2VKN A;  1GBR A;  1BYM A;  2ZPH B;  1T72 A;  4ERR A;  1RAD B;  5LMN T;  4C8Q D;  3PUQ A;  2JPF A;  4OB3 B;  4M7A A;  5GMK j;  2WU2 A;  4M77 E;  2JT4 A;  1BR0 A;  2DM1 A;  9ATC B;  4AKH A;  4PLL A;  4FM4 B;  4O2B E;  1EX4 A;  1M27 C;  4MAL A;  5ABF B;  1KJW A;  5KYY A;  1NG2 A;  5JH7 E;  4LF7 T;  3FC3 A;  5L3E B;  2KYB A;  4M75 A;  3V7S A;  3RGL A;  1VQ6 A;  3AE4 A;  4TV9 E;  1RAH B;  1X6B A;  3GN5 B;  2D6F A;  1V9D A;  2LCC A;  1PD0 A;  3MET A;  5JR9 B;  5FWB A;  3QZ9 B;  3S6W A;  3CKD A;  2CLY B;  2CE7 A;  1AVZ C;  1QCN A;  3RYF E;  2JTE A;  3QYG B;  4D6W A;  5FLX E;  2ODU A;  1BB9 A;  1YCS B;  1CKA A;  2E5L T;  2DCF A;  1VQ6 Q;  3X1D A;  1VIE A;  1K8A R;  1HX1 B;  2GGR A;  3EFO A;  1ZSZ C;  4CRI A;  4V1A v;  3JAF A;  3ETV A;  2LM2 A;  2C0T A;  4JJN K;  5AFU L;  2W4X A;  1PKT A;  1UUR A;  2AKK A;  1ZEE A;  3EG9 A;  3A8G B;  4PJO G;  2NTY A;  3TLW A;  3CPW A;  3EG1 A;  3DB3 A;  3OPC A;  3RHW A;  4DND A;  2XQ4 A;  2F69 A;  1D0Z A;  2HDA A;  4HKE A;  3RDV A;  2YU1 A;  3QUJ A;  4M75 G;  5J1G A;  3OYE A;  3JAD A;  2DL7 A;  4RTU A;  2LQK A;  4A4G A;  2JVV A;  4M77 D;  1D09 B;  2PTF A;  1YIT T;  4XK8 E;  3RR6 A;  2ZPI B;  2D0T A;  1VYU A;  3M57 A;  3ANW B;  2UXX B;  1XNR T;  3SFM A;  3CC4 T;  4DV7 T;  4EMK C;  4X34 A;  4J6W A;  4VUB A;  2AZV A;  1NEK A;  4A53 A;  3FJ5 A;  4K0K T;  2XDD A;  4MLK A;  3MP8 A;  1Q81 R;  4G63 A;  1Y71 A;  2HEQ A;  4ADZ A;  5KE2 A;  1WHH A;  3CCS Q;  2NP9 A;  2UXD T;  2FPF A;  1DU2 A;  3UPU A;  2NR4 A;  4EB6 E;  4M7D G;  1I8F A;  2ED0 A;  4U31 A;  2KIN B;  4UF0 A;  2VGN A;  4XTY A;  3P4Q A;  2W0Z A;  4C5I A;  2OX7 A;  2HSP A;  3G06 A;  3VU3 C;  4AT1 B;  2DFU A;  5LYJ E;  5EZY E;  4WYV A;  1VOM A;  2W63 A;  3ONL C;  5DLQ E;  5EG2 A;  3UU8 A;  3WVD B;  4PJM A;  4X1I E;  1K0X A;  3PU3 A;  2E3I A;  1YJW A;  1VQ7 Q;  1IGQ A;  3NPF A;  3CCQ T;  2PQW A;  4AQF A;  3RKX A;  2CT4 A;  3CCL A;  2LKH A;  1OED E;  2IVW A;  2P0Q A;  4PJJ A;  2YUN A;  1U4Q A;  2J47 A;  2YK0 A;  3RYH E;  1K1Z A;  1E6H A;  4GY5 A;  4O2A E;  2DYB A;  2A28 A;  4DR1 T;  2CH4 A;  3EVY A;  1Q82 C;  3QDR B;  3CQC B;  4F7U G;  4CXY A;  5LG4 A;  2FZG B;  5DY9 A;  2CT3 A;  2UXC T;  4NUV A;  2B8A A;  1QVG A;  4HFH A;  5J0Z A;  5HEG A;  1Y7X A;  2DEU A;  1X69 A;  2K3W A;  3LWH A;  3RBB B;  4M7D C;  1NYF A;  4ZZC A;  4TV8 E;  1NZ9 A;  1RAG B;  5M9O A;  1M90 R;  2GBQ A;  2YHT A;  2DO3 A;  3E1S A;  1X2Q A;  1QUU A;  2IUB A;  1AEY A;  3RYC E;  2DWK A;  4PKC C;  1FMW A;  5LNK A;  3E9F A;  1D0X A;  3C98 B;  4IIJ E;  5FL0 A;  3C64 A;  2GTJ A;  1SF9 A;  4B9W A;  2XQ8 A;  4HWH A;  1PD1 A;  1CKB A;  3CC7 A;  5IH2 A;  5CGM A;  5JDG A;  1UUS A;  3KV9 A;  3M4G A;  4QQD A;  3KXT A;  2CUD A;  3QSU A;  4M7A E;  3RNJ A;  4YJ2 E;  2CRE A;  3CCS T;  5FU7 B;  2V8K A;  3TRE A;  4HT8 A;  4AIU A;  2QVA A;  3CBM A;  3H37 A;  4F7U A;  3EHQ A;  1YI2 T;  5EK2 A;  1VQN T;  5HK0 A;  4PK4 A;  1VYV A;  3UF4 A;  2F2V A;  4RTT A;  1PG5 B;  3X24 B;  5IXF A;  1XQH A;  2FEI A;  4RKU E;  3ZT5 A;  3M0Q A;  4PNO A;  3CD6 T;  3UU6 A;  1MMA A;  2XAS B;  5L3B B;  4DBQ A;  3GNF B;  2CWY A;  1WCR A;  4IDZ A;  1AWX A;  5AQG B;  2PFV A;  4CI2 B;  4XTW A;  1Q81 U;  3LFM A;  3MP1 A;  2OJ2 A;  5GAN 3;  5LGT B;  4TNV A;  2AKL A;  3M59 A;  3CCV A;  4YTL A;  3RI5 A;  2KR3 A;  3EG9 B;  4RCB A;  2V6Y A;  4O8S A;  2RK2 A;  2BBH A;  1QWF A;  1QW1 A;  3BFM A;  3L2W A;  2XZE A;  2FJA A;  3CCL T;  3FXD B;  4XTX A;  4MDX A;  3LSV A;  3MJX A;  2JQ9 A;  4QT7 A;  2L3L A;  5HK3 A;  1EZZ B;  2FJB A;  3RC8 A;  1UTI A;  2YUP A;  2Y8D A;  4O4J E;  2E65 A;  4C90 A;  4DUZ T;  1ZHC A;  3JAE A;  1B7T A;  1AWJ A;  3VR9 A;  5J2T E;  2BVM A;  4GK0 E;  1RI9 A;  2KRS A;  4GOU A;  4DV6 T;  2R57 A;  3G1J A;  5I22 A;  3OA6 A;  3OW2 A;  1XJW B;  4LMK A;  2N9D A;  1UDL A;  3G71 A;  5DQV A;  4YT0 A;  3JCM g;  3CCM T;  1FMV A;  3QO3 A;  3TU4 K;  1KG1 A;  2AXD S;  2J4G A;  4IDN A;  5HEH A;  1N9S A;  2VK9 A;  2BS2 A;  3PUA A;  1M62 A;  4XZC A;  1RAC B;  2OTL A;  2RJC A;  4RG8 A;  2KXP B;  3I0O A;  3H41 A;  4PJO E;  5GMK i;  3O9X A;  4J2C A;  1Q82 U;  3JCM X;  5C8Y E;  3SFD A;  3PUV F;  3AA1 B;  3FIF A;  1JXM A;  3CXC A;  3H8Z A;  3RC3 A;  4IE7 A;  2CYZ B;  2G6F X;  1A0N B;  2RHI A;  4C0G A;  3TCJ A;  1OZ3 A;  3VS1 A;  2QI2 A;  2ODV A;  3L09 A;  5LJ3 g;  3MP6 A;  1YJW Q;  1MMN A;  2RPN A;  1NM7 A;  1AOJ A;  1M1K R;  3ZJ2 A;  1JRI A;  4HCK A;  4M78 D;  3SWN C;  2WAC A;  2IC9 A;  5GAN h;  1OED C;  3AEE A;  3N5L A;  3KVB A;  1SHF A;  3VR8 A;  3ZMU B;  2MOX A;  3ZN0 B;  2KWH A;  3R6O A;  3H0H A;  4HVU A;  3RIR A;  5LL6 S;  8ATC B;  4DBH A;  2V7M A;  4H9R C;  4DV2 T;  2CHN A;  4JI3 T;  2V1Q A;  4IE0 A;  5KYX A;  2PU9 B;  4IUR A;  2M6B A;  1YNZ A;  1OWA A;  2HAX A;  1U5P A;  3UQ4 A;  3M65 A;  2BE7 D;  1K9M U;  4M7D E;  1MGQ A;  3ZEF B;  2C0O A;  3M0U A;  2PBI A;  3AB3 B;  3O8V A;  3RQU A;  5IWA T;  1OEB A;  4IDP A;  4IE6 A;  2UXB T;  3URG A;  2DIG A;  2XQ5 A;  2CSQ A;  2VKO A;  2HHH T;  3LH5 A;  1HS7 A;  2RJE A;  1WDX A;  2COY A;  4RTX A;  4YSY A;  5AQK B;  3H3M A;  1HK9 A;  2DL5 A;  4EIK A;  1Z9Q A;  3CX8 B;  5ETW A;  4M78 F;  2UXN B;  4K0U A;  1NE8 A;  4M4Z A;  5KYW A;  2YU2 A;  4KH0 B;  3AEB A;  2KVQ G;  4M75 D;  1M3B A;  2Z0W A;  4CXW A;  3M0P A;  2C5J A;  3EG2 A;  2FZK B;  4J6Y A;  5DQW A;  1FYN A;  1LJO A;  1FEW A;  3AAE B;  2BVL A;  2DMO A;  2W10 A;  2WDV A;  5LP6 E;  3PUZ F;  2JRK A;  5HXE A;  4L6V 5;  3JCM P;  2WCA A;  4DO0 A;  1N36 T;  1Q7Y U;  1VQ9 A;  4LF4 T;  3FLG A;  1TU0 B;  1KIK A;  1UJY A;  4XU1 A;  2JMA A;  1XMO T;  1QVF A;  3C51 A;  3QOF A;  5GON E;  4LF5 T;  4NL3 A;  5KYU A;  5KMG P;  3CMA T;  1KSW A;  3HA4 A;  4F8H A;  4NUU A;  4OHF A;  1WHK A;  1ZQ1 A;  2EAY A;  4JEH B;  1PRL C;  5L3D B;  4IDO A;  2L3P A;  4M78 G;  2CBI A;  3JCM Q;  3QJY A;  2DTO A;  1WHL A;  2DLP A;  1AHJ B;  3LGF A;  5CQY A;  2WSF E;  1GCP A;  2LTO A;  1UCU A;  3ZCI A;  4ANJ A;  3RYI E;  2PNI A;  2IDO B;  3DP7 A;  5TAO A;  1VQN Q;  4JI0 T;  1NEG A;  3OBW A;  4GYR A;  3HKC E;  4IUU A;  4LDW A;  1IZN B;  5A1L A;  1KQ2 A;  3AT1 B;  5FRM A;  4PJO A;  3LK4 2;  3AED A;  2EBP A;  3LX7 A;  2BDE A;  4B6M A;  2JQK A;  2Y4Y A;  3F2E A;  2CXF A;  2XG8 D;  3VUZ A;  4D8D A;  4FT2 A;  4ZI3 D;  3QDF A;  2KRO A;  3HPW A;  2L8D A;  2CP5 A;  5AQH B;  2QGF B;  1BIB A;  3E2U A;  2GF7 A;  3OBY A;  3P8B B;  2JS0 A;  3BW1 A;  4AQF C;  3N2G E;  2LSK A;  2JOY A;  4ZTF A;  2IAK A;  4GK5 E;  4EYY R;  1VQ8 A;  1WRD A;  2EQU A;  2J06 A;  3G6E T;  4QXH B;  3HKD E;  3VS2 A;  3I56 Q;  3ZC0 A;  4KUM B;  1OED B;  3KBG A;  4X1Y E;  1UGP B;  2XHC A;  5FKY A;  2FRY A;  4EDU A;  4AQG A;  2R5M A;  2CS7 A;  1UFF A;  5LJ3 e;  3RRC A;  3PVQ A;  2AE9 A;  4LNP A;  5EK4 A;  3PUW F;  3KFV A;  5KYN A;  1AWO A;  1LVK A;  5GAO p;  2LHR A;  1WZO A;  4QH1 A;  2QGG A;  2QK0 A;  2EQJ A;  4X9C A;  2ED1 A;  2DPP B;  2CUB A;  3BQI A;  5ABE A;  3PTA A;  2DEQ A;  3EFS A;  2VUR A;  2K5F A;  4AFU C;  1Q7Y C;  5BR8 T;  1W0A A;  4C8Q B;  5CO7 A;  2ACX A;  3Q5X A;  2E41 A;  3IQL A;  3DLM A;  1M8V A;  4J9B A;  4KGV B;  2LT1 A;  5FRO A;  5GMK m;  3OW2 P;  1J1J A;  4UXN B;  1WHM A;  3AEA A;  5JR9 A;  2QEX Q;  4RCC A;  4X1K E;  3ZSS A;  3VV0 A;  2EKH A;  3CCV Q;  3M55 A;  5IYZ E;  1RLP C;  2LRL A;  1RAB B;  4CC2 A;  3EGX B;  2COW A;  3M54 A;  2K5I A;  3JCM b;  3OYN A;  3N9M A;  2DXU A;  1VIF A;  2QGS A;  5FMN A;  1SRM A;  3ZC1 A;  1ZP0 A;  3MAC A;  2DI4 A;  2K48 A;  3OKQ A;  3RPU A;  1PC0 A;  3H9N A;  3IEE A;  2LQ8 A;  2P4R A;  3JCM h;  2RA2 A;  1VQ4 Q;  4O4I E;  2VKH A;  1U5S A;  3INZ A;  1NBE B;  2VYT A;  4B6X A;  5CA1 E;  1UX5 A;  1WIE A;  3GP8 A;  2JMK A;  2C06 A;  3JSC A;  3HL6 A;  4E7L A;  5KCO A;  4KP3 C;  2DXC A;  2VVS A;  4XU3 A;  5GJW B;  1XZY A;  1ZKE A;  4IHJ E;  5KCH A;  2BS4 A;  3PU8 A;  4C92 B;  2DKG A;  4QWN B;  4DUY T;  2GK9 A;  4XTU A;  2SPC A;  4JS4 A;  4KUL A;  3LYI A;  2D8J A;  1XMQ T;  3J7Y q;  5JDL A;  4QX7 B;  2H3J A;  1W9R A;  2J6O A;  2MOZ A;  3A5X A;  1FJG T;  3KV4 A;  3QC9 A;  2BKD N;  1LVF A;  2VWF A;  4M77 B;  2PVG B;  1M7K A;  1Q86 C;  3PIO A;  4BA9 A;  4GLK A;  2M9U A;  1M90 U;  4N78 D;  1YWP A;  2XAH B;  3CCE T;  5LOV E;  4EMK A;  2LQN A;  5ADX L;  2Y90 A;  2WU5 A;  2XPK A;  1HG2 A;  1MND A;  2GCX A;  5LJ5 h;  3CBP A;  3FB9 A;  2CPT A;  3HFO A;  3CCE A;  1GL5 A;  3E9G A;  4E7K A;  3VS5 A;  4EZH A;  2LJ0 A;  2V8J A;  4RUG A;  4ASK A;  2G0U A;  3VRY A;  1S72 Q;  2ZPE B;  1OPL A;  4M78 E;  1AT1 B;  1SE7 A;  3OS5 A;  3JCF A;  3OJA A;  2LCL A;  1XOV A;  2GFA A;  3A5Z B;  3QJ6 A;  3J81 E;  1WYC A;  2HL5 C;  1HFA A;  1Y57 A;  2E9X D;  3TQ7 P;  2EJ9 A;  5FWC A;  1TG0 A;  2Z6E A;  3MKD A;  1H64 1;  1XDP A;  5AQQ B;  4ZI3 C;  5LGU B;  1OPK A;  2O31 A;  4JLI A;  5ECA A;  2WAU A;  2MWP A;  4LDV A;  4AIS A;  1G5V A;  4DEX A;  2JNG A;  5JRE A;  1BI1 A;  7AT1 B;  1IHW A;  2C0I A;  3LK3 B;  2HMA A;  4F16 A;  4NXM T;  2K9G A;  3AE2 A;  1VQO Q;  2FPD A;  4EIW A;  1ZHI A;  2FJE A;  3HFN A;  4Z89 A;  4P0A A;  4XTV A;  2DL8 A;  2KNB B;  3M0R A;  2WY2 A;  1S1N A;  1UGV A;  4UEM A;  4CC4 B;  4E7I A;  1D3B B;  2YN6 A;  4J83 A;  3I0Q A;  1I5O B;  3UUN A;  1RAI B;  2KY9 A;  3RQW A;  4PLI A;  2XAQ B;  2LM9 A;  5JDM A;  2RNA A;  4JRQ A;  2CKK A;  2E6Z A;  2QTX A;  6AT1 B;  5AQP B;  2QA4 T;  4C8Q G;  3CPW P;  2MYS A;  3L1A A;  3I56 T;  3ZT6 A;  2MIO A;  1IGU A;  4F6R C;  1QCO A;  2XDB A;  1R77 A;  3P7I A;  2ZZD A;  4OMP A;  4L9I A;  1S72 A;  2RF0 A;  4UVA B;  4E7J A;  4O4L E;  4J7I A;  2K6D A;  3JV3 A;  2YDQ A;  4HXJ A;  4RTW A;  1P92 A;  1GFC A;  1TWB A;  3FDR A;  1ZLM A;  3SFE A;  2JW4 A;  2QYW A;  2P4T A;  1MHN A;  2VKD A;  2V6X A;  3KBT A;  1RAA B;  4L0R A;  1IXD A;  2E70 A;  2PVO B;  2P0P A;  3CWZ B;  4TN7 B;  4LD6 A;  4H9S E;  2JUF A;  4MDW A;  4ZN3 A;  1JEG A;  4GIW A;  2LSG A;  2VVN A;  3P4W A;  2FO0 A;  2D5U A;  2EW3 A;  4KHP T;  5GAM f;  1OV3 A;  3QKJ A;  1UUE A;  4QKU A;  4Q5W A;  2X3W D;  2BG9 B;  4MHC A;  2LRQ A;  2XQY A;  2OA5 A;  1YKE B;  2M16 A;  2ZCF B;  3K1S A;  4JUY A;  5IXB A;  1ZBJ A;  2CGH A;  3AE1 A;  8AT1 B;  3GLX A;  4G2A A;  5GMK h;  2O9V A;  3OYD A;  2X0H A;  3CPZ A;  3J80 E;  3MEV A;  1FX7 A;  4OB2 B;  4HCC A;  4C0F A;  1UE9 A;  1W0B A;  2WM9 A;  5CKD A;  5LCY A;  3SWH A;  4H9Q C;  1WA7 A;  4LDY A;  4DBF A;  1ZA2 B;  3NWI A;  5HWY A;  3S3O A;  4KGX B;  1OXZ A;  3QII A;  2RJD A;  1N34 T;  1G3W A;  4N0A A;  3KIN B;  2EPD A;  2P0K A;  3LK2 B;  3P8H A;  2O9S A;  4JJB A;  3HI2 A;  1H8K A;  2QQR A;  1ACM B;  5GAN 7;  1DJ7 B;  2XQ3 A;  1SG5 A;  3FBZ A;  2QDL A;  3AE7 A;  1R8O B;  4F17 A;  2O4X A;  2NOX A;  5FRN A;  3CCU T;  4PAG A;  4EMK B;  4GYS A;  3C0C A;  2MI6 A;  3EGU A;  2EQK A;  3VUB A;  4F7U F;  2XQ7 A;  5GMK l;  3LH0 A;  1WYX A;  4HKA A;  1SHG A;  2LMJ A;  4DA4 A;  4PJO D;  4IUT A;  5LJ3 d;  4Y28 E;  3P4S A;  3PIP A;  1PSE A;  3OS2 A;  3N9L A;  4M75 F;  3KUF A;  3FBL A;  1YXR A;  4IUV A;  2F2W A;  2NUT B;  2YUO A;  4BE0 A;  3UTK A;  3Q9D A;  3CCM Q;  1AWW A;  2LT3 A;  3ZCJ A;  4R56 A;  1QWE A;  3AE9 A;  4MZT A;  1N6A A;  1W2B A;  5FXV A;  2MBG A;  2PUO B;  3RIF A;  2EWN A;  3FRN A;  4GKJ T;  3SB2 A;  3UA6 A;  3VKG A;  3TSZ A;  4QVZ A;  2I2L A;  3BY7 A;  2OAU A;  2UUA T;  2VQE T;  2CM0 A;  2HH7 A;  2YEV C;  2ZMA A;  1QCF A;  5LXT E;  3OYY A;  5JDF A;  1UGO A;  2LDM A;  5KE3 A;  3UUB A;  2ZM6 T;  4X66 T;  3SWN A;  1B07 A;  1IRX A;  3JAM E;  2YOE A;  4CQI A;  1NEB A;  1NYG A;  2JTF A;  1BI2 A;  1AZE A;  1Y07 A;  2DVJ A;  1L0V A;  2LP5 A;  1OOT A;  1HTJ F;  4U2Z A;  3ZMS B;  5LJ5 e;  4M7D D;  4DOV A;  4A5X A;  1M3C A;  1TTH B;  3I9W A;  4X65 T;  3AA6 B;  2DA9 A;  4Z8X A;  3VRA A;  3CXC S;  2CP7 A;  1JO8 A;  5A0L A;  2WQY A;  4FL6 A;  3AVR A;  2MF2 A;  2KEA A;  2LJL A;  2HQE A;  1S94 A;  1QKW A;  1ZSG A;  3D7S B;  5M4Y A;  4U3C A;  4QQG A;  2IG0 A;  3VYH B;  3LLR A;  1I0C A;  1M2V B;  4PJL A;  5CA0 E;  3UUX B;  3OY9 A;  3CIR A;  5JRC B;  2E8I A;  1SRL A;  2JXB A;  2X9W A;  5GAN 4;  2VL8 A;  2JMC A;  3OSS C;  1M2O A;  2L2P A;  1YIJ Q;  1WJR A;  4HVW A;  2XID A;  1KQS P;  3RIU C;  2HPL A;  3ZYM A;  2L5Q A;  1BR2 A;  5LG3 A;  3L42 A;  2X4Y A;  2KE9 A;  4COF A;  2E9X C;  3P4P A;  3CCU A;  1PRM C;  4C8Q E;  5GAO r;  1YIJ A;  1OX9 A;  3V5S A;  2VGM A;  4JEU B;  4DMW A;  4M1P A;  1G83 A;  4NXN T;  2RI2 A;  3MEW A;  3F31 A;  3A98 A;  5LHH B;  2A08 A;  2RQR A;  2L3R A;  3AE6 A;  2XSA A;  4UVB B;  5IUX A;  5JDN A;  1K9A A;  1M90 C;  1TUD A;  4BDZ A;  4Z90 A;  4DR7 T;  2ZLY A;  4C8Q A;  3NZP A;  3GF5 A;  1AZG B;  2WZI A;  3A7M A;  4DR5 T;  3BE3 A;  2VAS A;  3QG1 A;  4IUP A;  3JC6 D;  2QA7 A;  4OYK A;  3RLF F;  1JJ2 P;  2LSY A;  4I50 E;  4LXC A;  3ULR B;  4UV9 B;  2XHE B;  3JCM f;  2LKG A;  2L0A A;  4PK5 A;  5CKF A;  4DV4 T;  1YI2 A;  4CC7 A;  1Q7Y R;  1NLP C;  4PJO B;  2AHJ B;  3OB9 A;  4HT9 A;  1K8A U;  1BCO A;  4HFC A;  3M56 A;  2A37 A;  1W70 A;  4BAY B;  5KX5 E;  2YUQ A;  1T8B A;  3OYL A;  2O4X B;  4C5G A;  4AG2 C;  5C2T A;  5CB4 E;  1IO6 A;  3A8L B;  4AKG A;  1BR1 A;  4DMV A;  1G3T A;  5E0O A;  2V7L A;  3AEC A;  1K9M R;  1PWT A;  2M67 A;  4C5E A;  3QYH B;  3BDU A;  1WJQ A;  3HRT A;  1E1H B;  3NKZ A;  3Q5E A;  4DV5 T;  3JB9 F;  2A3L A;  3P8C D;  5L8R E;  4ZGD B;  2FB7 A;  5AQV B;  4P09 A;  4FCY A;  4GBQ A;  2K5B B;  2YDR A;  4HFV A;  5F8P A;  4ELZ C;  1X6O A;  4H9O C;  1BKB A;  2H88 A;  3CCE Q;  4P0B A;  2RI3 A;  2X51 A;  1GFD A;  4TX5 A;  3CPF A;  4BJN A;  1KQS S;  1BI0 A;  1NAF A;  1O75 A;  2GQV A;  5FW9 A;  2J7I A;  1HNW T;  4M77 A;  1V76 A;  4H63 H;  2RN8 A;  4ZS2 A;  1VA7 A;  2NTX A;  1YQ4 A;  2M0Y A;  3FZK B;  1YN8 A;  3NVO A;  3HKE E;  3I55 Q;  2OTJ A;  1YJW T;  2Q9Q D;  2ZM2 A;  4NPP A;  2CZ6 B;  1TXQ A;  3DB4 A;  3I5S A;  3OYH A;  2ZAE A;  1XNI A;  1E7O A;  4BDY A;  1NWM X;  3C4Z A;  2LT4 A;  2F2X A;  4LUE A;  2BG9 E;  3TLT A;  4AG1 C;  3NZQ A;  2JQQ A;  2PJQ A;  5FL1 A;  4B3M T;  3VKH A;  1HJD A;  3CQT A;  3PUS A;  1WR6 A;  2IW5 B;  4DR3 T;  2E3H A;  4ZGJ B;  2DXT A;  2XUE A;  3OTO T;  5CAI A;  5HEU A;  3TKL B;  3LDQ B;  3NBX X;  2DL4 A;  4QXC B;  1VYT A;  3CCR T;  3HR0 A;  1K8A C;  4ZN1 A;  4WCI A;  4A4F A;  3JCM J;  2CEA A;  4X9D A;  1VQ4 T;  4A4K A;  1YWO A;  2EGA A;  4DR4 T;  3RIU A;  4M7D F;  2RHY A;  1K4U S;  4AQY T;  1KFZ A;  4JZ4 A;  2W61 A;  2H3E B;  3CCU Q;  4TWD A;  5GAN j;  3MZK B;  2RI5 A;  4E7S A;  3PDY A;  4FIB A;  4ORZ A;  4LDX A;  4DV3 T;  5AQS B;  1QVP A;  2YRV A;  2VQF T;  3MCA B;  1U06 A;  3UAT A;  2D8H A;  4KBM B;  3ONX A;  4BI8 B;  2MAW A;  3UUM A;  2JS2 A;  3N5B B;  4MZP A;  2V7I A;  1R0B G;  4Z88 A;  1BK2 A;  1UJ0 A;  4JJC A;  4WF2 A;  2DL3 A;  4C5H A;  1KNP A;  1UGS B;  5JTG A;  3S4U A;  2KWI B;  3SOL A;  2DXB A;  4YFS A;  4CN1 A;  3CML A;  1YHQ A;  4HCZ A;  5HXS A;  3CCQ A;  2KSR A;  3I55 A;  3IHR A;  1EFN A;  5I2M A;  4HCB A;  2P9B A;  3EHR A;  3P4R A;  2RPA A;  2HSE B;  3ZEH A;  4F04 B;  2B76 A;  3UDC A;  1X27 A;  4FSS A;  1J5E T;  2DWG A;  3B13 A;  4CN6 A;  2YDL A;  4IDQ A;  4E7H A;  3REA B;  4R55 A;  5C0M A;  3RER A;  4OGE A;  4D8K A;  2A7Y A;  4BI4 A;  2VXE A;  5CVI A;  3NRY A;  2M6I A;  2EHO C;  2N2N A;  2X9H A;  2X67 A;  4ILU A;  5DLO A;  2C0S A;  4LE9 A;  3CME Q;  2DJQ A;  2BKO A;  4LUD A;  3M53 A;  4BB7 A;  3K3Q C;  4DV1 T;  3CMA Q;  3ESL A;  2Y6X A;  4BY6 C;  1KK7 A;  3U23 A;  1YD8 G;  3V8K A;  2X4X A;  3BQK A;  1LNX A;  2L8K A;  4L5G A;  2P84 A;  5ABG A;  3A8H B;  3M4Y A;  2XAF B;  3PUG A;  2HL3 A;  3QZ5 B;  1WXB A;  2YLB A;  3QB5 K;  3D0T A;  2Y48 B;  1HCI A;  4H63 V;  4YHJ A;  3M9Q A;  3LWI A;  3V5U A;  4XQ3 A;  4EPC A;  5I2S A;  2ZM8 A;  2EFI A;  2ZPF B;  3OYM A;  4JI1 T;  3JB9 H;  3RKO A;  5FY7 A;  2OLT A;  5AQI B;  1TS9 A;  2AT1 B;  3CCR Q;  3CBO A;  1IBL T;  4OMN A;  2DJZ A;  3VS7 A;  5HYA A;  4UR9 A;  5LGN B;  1IBM T;  3OS0 A;  3CME T;  1VQN A;  2EVR A;  2DZ9 A;  3ANW A;  3VS3 A;  3JB9 G;  1D3B A;  1LRZ A;  1WHG A;  1UHF A;  1C1A A;  4X62 T;  2YDS A;  5J26 A;  1RI0 A;  3UT1 A;  4IKF A;  2DAQ A;  5IT9 E;  3KV6 A;  1R8I A;  4Z02 A;  2BKP A;  4O4H E;  4M7A F;  3L2V A;  5D7U A;  4HFE A;  1R0C B;  5CK9 A;  2WS3 A;  1QVF S;  2E10 A;  3J7A F;  3Q5W A;  4HEA A;  4A56 A;  2K2M A;  4UF0 B;  3L2Q A;  1X75 C;  2H3R A;  2OTL T;  3CCL Q;  3X25 B;  4Z8A A;  1J5W A;  2CZ7 B;  4EMH A;  3EAB A;  2NWM A;  2N1G A;  1SKU B; 
#chains in the Genus database with same CATH homology
 2KRN A;  1OPL A;  2KGT A;  2GGR A;  2X66 A;  1T98 A;  5LHG B;  4V1A v;  3PTR B;  3ETV A;  3OJA A;  2C0T A;  5AFU L;  1PKT A;  1XOV A;  2AKK A;  1ZEE A;  2V7J A;  2FPE A;  2PZ1 A;  1WYC A;  2KT9 A;  1HFA A;  2NTY A;  2E9X D;  1MUZ A;  1D1C A;  1CSK A;  1UEC A;  1Y57 A;  5FWC A;  2DBK A;  1TG0 A;  2Z6E A;  3C4W A;  3MKD A;  4EAH A;  5LGU B;  3EG1 A;  4ZI3 C;  1OPK A;  4U72 A;  2O31 A;  5ECA A;  1Y64 B;  4DND A;  3VS4 A;  2WAU A;  3H3A A;  2VWA A;  2LX7 A;  1D0Z A;  5LJN A;  2HDA A;  2YU1 A;  2JXB A;  4UIG A;  4DEX A;  4RUG A;  5JRE A;  1J3T A;  3QUJ A;  5J1G A;  4PFO A;  1ARK A;  2C0I A;  3AAA B;  2CA5 A;  1JQQ A;  4UEL A;  3LK3 B;  2DL7 A;  4RTU A;  3VS6 A;  4F16 A;  2K9G A;  2I59 A;  2A3D A;  4EIW A;  2FPD A;  1MV3 A;  2RMO A;  1K0S A;  1SA0 E;  3E0Z A;  5FY1 A;  4Z89 A;  4P0A A;  2L3Q A;  2DL8 A;  2KNB B;  3M0R A;  2D0T A;  1S1N A;  1UGV A;  1VYU A;  4UEM A;  2K79 A;  2GNC A;  3ANW B;  2IIM A;  5KDM C;  2UXX B;  4CC4 B;  4PW8 A;  5F3J A;  2NUZ A;  3I0Q A;  5JVD E;  3UUN A;  1WX6 A;  3QWX X;  2XAQ B;  2LM9 A;  5JDM A;  1CUN A;  2H7O A;  1JU5 C;  2X9Y A;  2RNA A;  2AZV A;  2DRM A;  5LBQ B;  1W6X A;  1FMK A;  3Q2M A;  3FJ5 A;  4MLK A;  2MYS A;  1BR4 A;  2KMF A;  3MK7 C;  3CX7 B;  4G63 A;  4ADZ A;  5J2U E;  2NP9 A;  1WLP B;  2EGC A;  2HEQ A;  5EC7 A;  2H7V C;  3DJB A;  2FPF A;  2MIO A;  4EB6 E;  4F6R C;  3P7I A;  1MIY A;  4OMP A;  4L9I A;  2J6K A;  3GN5 A;  4OK0 A;  2ED0 A;  2RF0 A;  4Y92 A;  4UVA B;  3AA7 B;  1ABQ A;  3OYX A;  2EHO D;  4CXX A;  2KIN B;  4O4L E;  4TUY E;  4UF0 A;  2K6D A;  2W0Z A;  3JV3 A;  2C5I T;  2ECZ A;  2I0N A;  1QLY A;  3N2O A;  2HSP A;  4HXJ A;  4RTW A;  1SHZ C;  2L9Q A;  1GFC A;  1ZLM A;  1WI7 A;  1VRB A;  5LYJ E;  2A36 A;  5EZY E;  3RX6 A;  2VKJ A;  2JW4 A;  2VKD A;  1VOM A;  2W63 A;  1UHC A;  3ZLI A;  4PJM A;  3KBT A;  4X1I E;  4PFP A;  3PU3 A;  1K0X A;  4L0R A;  3NPF A;  3CWZ B;  4KRT A;  4TN7 B;  4AQF A;  2CT4 A;  4H9S E;  4EXT A;  4J9G A;  1JEG A;  2SRC A;  1ZUU A;  4GIW A;  4FJO A;  2LSG A;  4PJJ A;  1SSH A;  2YUN A;  2HBW A;  1U4Q A;  2YK0 A;  2FO0 A;  2ESW A;  2D5U A;  1V1C A;  4ZOL E;  2EW3 A;  3RYH E;  1K1Z A;  2LHN A;  1E6H A;  1OV3 A;  1UUE A;  2X3X D;  4O2A E;  4RTV A;  3CVR A;  2A28 A;  2CH4 A;  2DYB A;  2X3W D;  4OMO A;  3EVY A;  4MHC A;  1QKX A;  3CQC B;  2VVK A;  2XQY A;  4DBR A;  4CXY A;  5LG4 A;  2OA5 A;  1S35 A;  1YKE B;  2RQU A;  2O2O A;  4JUY A;  5IXB A;  1ZBJ A;  5HCK A;  3R6N A;  2CT3 A;  3VRY A;  1Y0M A;  1IAP A;  3EG0 A;  3M0S A;  4ZI2 C;  4LN2 A;  4NUV A;  4K11 A;  2EHO B;  2BZX A;  3N9O A;  2W00 A;  1X69 A;  4RTZ A;  3ZYL A;  2O88 A;  4G2A A;  2D0U A;  2O9V A;  1NYF A;  4C91 A;  4TV8 E;  3RBB B;  3VRZ A;  3CPZ A;  2NWB A;  1D1A A;  1M30 A;  3PVQ A;  2GBQ A;  2CLY C;  4PNI A;  2FG0 A;  1MIW A;  3N9Q A;  1UE9 A;  1QUU A;  1X2Q A;  2WM9 A;  3ZMT B;  1AEY A;  2KXC A;  5LCY A;  3SWH A;  3RYC E;  2CXD A;  4H9Q C;  1WA7 A;  2DWK A;  3U3I A;  4GLM A;  5LBM A;  1FMW A;  5LNK A;  2JMH A;  1D0X A;  3C98 B;  4IIJ E;  5HWY A;  3C64 A;  2GTJ A;  3H0F A;  1OXZ A;  2NW7 A;  3QK6 A;  3KIN B;  4JJD A;  2EPD A;  3LBX A;  1CKB A;  1UX4 A;  4HVV A;  4X1V A;  3LK2 B;  4J9I A;  2O9S A;  4JJB A;  2XAG B;  5BMV E;  2D1X A;  5IH2 A;  3HI2 A;  5JDG A;  1H8K A;  3KV9 A;  2Q9Q A;  3FBZ A;  2CUD A;  2B86 A;  2QDL A;  3RNJ A;  4YJ2 E;  2CRE A;  4F17 A;  2NOX A;  2ROT A;  3PUR A;  2DNU A;  2OAW A;  4PAG A;  4CI1 B;  2RQT A;  1G73 A;  4GYS A;  3H37 A;  5IHK A;  3C0C A;  3EGU A;  3EHQ A;  4IIO A;  5EK2 A;  5JRC A;  1SEM A;  2WSS V;  1WYX A;  4HKA A;  3C4X A;  1SHG A;  4PK4 A;  3O5Z A;  1BU1 A;  5JR9 C;  1VYV A;  1T0J A;  3IBP A;  1H7C A;  2F2V A;  4IE5 A;  4EOZ B;  2LMJ A;  4RTT A;  1MV0 B;  5IXF A;  1M3A A;  5JDH A;  2FEI A;  2J05 A;  3M0Q A;  2DX1 A;  1MMA A;  2XAS B;  1IJ5 A;  4TZ4 C;  4DBQ A;  5L3B B;  3N9L A;  2CWY A;  4MBQ A;  3FBL A;  4IDZ A;  5DAB A;  3I9Y A;  2PFV A;  4CI2 B;  5JDQ A;  1AWX A;  3CQG B;  3LFM A;  2F2W A;  2ENM A;  2YUO A;  1AWW A;  3UTK A;  3Q9D A;  2KT1 A;  2OJ2 A;  2LT3 A;  5LGT B;  3ZCJ A;  2AKL A;  2DBM A;  1H3H A;  4H9N C;  5FY0 A;  2KR3 A;  2BTT A;  1QWE A;  2LSI A;  4O8S A;  1PNJ A;  1YKH B;  1QWF A;  1UG1 A;  5FXV A;  2JJ9 A;  3FXD B;  2MBG A;  3MJX A;  2YIN A;  4QT7 A;  1B3Q A;  2L3L A;  1PKS A;  1U3O A;  1WFW A;  1X43 A;  5I11 A;  2LZ6 B;  4AFS C;  3UA6 A;  2BZB A;  2D2S A;  4YLH A;  3VKG A;  3RC8 A;  1UTI A;  5L3C B;  2YUP A;  2Y8D A;  3TSZ A;  4O4J E;  3ZJ1 A;  4OMQ A;  2DLR A;  4C90 A;  1ZHC A;  3OBV E;  1B7T A;  1AWJ A;  2CM0 A;  2HH7 A;  2YEV C;  5J2T E;  2ZMA A;  1QCF A;  4X20 E;  2CH4 W;  5LXT E;  2D0N A;  2BVM A;  4GK0 E;  5HAX A;  5JDF A;  1RI9 A;  2KRS A;  4GOU A;  5FP3 A;  1G2B A;  1B07 A;  4XAX B;  1NEB A;  4CQI A;  3ZL7 C;  5I22 A;  1NYG A;  1AZE A;  4PK6 A;  2N9D A;  1UDL A;  2DVJ A;  4KMC A;  2LP5 A;  1MIV A;  1HTJ F;  5DQV A;  3ZMS B;  1OOT A;  3KFW X;  4ZI2 D;  1FMV A;  4ZS3 A;  3R84 B;  1M3C A;  2KBT A;  3QWY A;  3I9W A;  4EZ4 A;  2VK9 A;  3PUA A;  3AA6 B;  4XZC A;  2DA9 A;  4Z8X A;  5FYM A;  4WBN E;  2KRM A;  2KXP B;  3I0O A;  3ZN1 B;  1JO8 A;  3H41 A;  3O9X A;  4J2C A;  3AVR A;  2KEA A;  2LJL A;  3W15 B;  2HPJ A;  5C8Y E;  2KLQ A;  3ZYK A;  4I4T E;  1S94 A;  3AA1 B;  1QKW A;  2WMN A;  1JXM A;  4J9C A;  1ZSG A;  5M4Y A;  3RC3 A;  4IE7 A;  2WWU A;  2G6F X;  4J9E A;  1A0N B;  4EYU A;  1GCQ A;  3THK A;  4MFR A;  3VS1 A;  3RH3 A;  1I0C A;  2LOP A;  4PJL A;  2ODV A;  5CA0 E;  3UUX B;  3F57 A;  3VHL A;  1G8X A;  3L09 A;  2E8I A;  2E9X A;  4OYJ A;  5JRC B;  1SRL A;  2BZ8 A;  2X9W A;  3L3P A;  1MMN A;  2VL8 A;  4OFZ A;  2ES0 A;  3CQX C;  2K24 A;  1NM7 A;  1RLQ C;  2JMC A;  3OYZ A;  1AOJ A;  3ZJ2 A;  2A72 A;  2RPN A;  4HCK A;  2L2P A;  3NGP A;  2IC9 A;  3M0T A;  5H6R B;  5LHI B;  4HVW A;  4OML A;  2V1D B;  3N5L A;  3KVB A;  1SHF A;  2EYX A;  1D0Y A;  5EK3 A;  3ZMU B;  5HWX A;  2LNH B;  2MOX A;  3N2K E;  2HPL A;  3ZN0 B;  3ZYM A;  2KWH A;  2X68 A;  3RRW A;  3H0H A;  1BR2 A;  4HVU A;  2J1D G;  3AA0 B;  2V7M A;  4H9R C;  4JLE A;  3K3N A;  1WYB A;  2KE9 A;  2V1Q A;  2E9X C;  1FIO A;  3EG3 A;  4IE0 A;  2KND A;  3K8P C;  4FI5 A;  1PRM C;  2JM8 A;  3TVT A;  3V5S A;  4RTY A;  4XBF B;  1HJD A;  4JEU B;  3NHN A;  1K76 A;  4DMW A;  1OWA A;  1YNZ A;  1U5P A;  4M1P A;  1T3L A;  4IE4 A;  1G83 A;  1MNE A;  3EDV A;  4ZI7 E;  3GBQ A;  2Q9Q C;  3M65 A;  3TSW A;  3CX6 B;  3F31 A;  1IJ6 A;  4QKN A;  1T0H A;  3A98 A;  5LHH B;  2A08 A;  2RQR A;  3ZEF B;  3T8O A;  4UVB B;  2C0O A;  2PBI A;  5JDN A;  4AKI A;  1K9A A;  1N5Z A;  3AB3 B;  3HKB E;  1BBZ A;  1TUD A;  1OEB A;  2KXD A;  2DRK A;  3REB B;  2ZLY A;  3NZP A;  4IE6 A;  1AZG B;  5FNV E;  4OMM A;  2CXL A;  3U78 A;  2CWO A;  2CSQ A;  3I9Q A;  2LEH A;  2VKO A;  3AAI A;  1LCK A;  2VAS A;  3LH5 A;  1US7 B;  1HS7 A;  1WDX A;  3JC6 D;  2QA7 A;  4OYK A;  3SRZ A;  4RTX A;  3UF4 A;  2GQI A;  2KYM A;  2ABL A;  2LSY A;  4QX8 B;  1HSQ A;  4I50 E;  4ESR A;  3ULR B;  4UV9 B;  2DHR A;  2XHE B;  2DL5 A;  4DVD A;  2K9A A;  4CC3 A;  4EIK A;  1Z9Q A;  3CX8 B;  5ETW A;  5HXR A;  2L0A A;  2UXN B;  4K0U A;  2CSI A;  4PK5 A;  2A2F X;  2L3S A;  2JM9 A;  2LJ1 A;  4M4Z A;  1NLP C;  4CC7 A;  2YU2 A;  3IF8 B;  2EYY A;  1M3B A;  3LBX B;  2B1E A;  4CXW A;  2A37 A;  1W70 A;  2C5J A;  3EG2 A;  3M0P A;  1NG2 A;  2Q9Q B;  2XAJ B;  3KDS E;  4BAY B;  5KX5 E;  2YUQ A;  5DQW A;  1FYN A;  3KBU A;  3J9X 1;  1FEW A;  4AG2 C;  1ZUY A;  5CB4 E;  2LE8 A;  3AAE B;  3FB2 A;  2BVL A;  1IO6 A;  2DMO A;  2W10 A;  4AKG A;  1BR1 A;  3N9P A;  5LP6 E;  3VS0 A;  4DMV A;  5E0O A;  2JRK A;  2V7L A;  5HXE A;  4DO0 A;  1KIK A;  1PWT A;  5DJQ C;  3EDU A;  2M67 A;  4WW0 A;  4ZHQ E;  3E22 E;  2CCQ A;  1UJY A;  2EGE A;  2JMA A;  1E1H B;  1GBQ A;  1MMD A;  3C51 A;  5GON E;  4UV8 B;  4DEY A;  3P8C D;  5KMG P;  1KSW A;  3HA4 A;  1ZX6 A;  4NUU A;  4OHF A;  4P09 A;  5FXZ A;  4GBQ A;  1HF8 A;  2CMR A;  2K5B B;  4JEH B;  4HFV A;  1O3X A;  4ISS A;  5F8P A;  1PRL C;  3GA8 A;  5L3D B;  1HD3 A;  4J9D A;  2L3P A;  4H9O C;  4AI6 A;  2H8H A;  4AFQ C;  4P0B A;  2C5K T;  2X51 A;  5JQG E;  4TX5 A;  1WXU A;  1GFD A;  4BJN A;  3PE0 A;  3B57 A;  5L2L A;  4F14 A;  1NAF A;  2EYW A;  5FW9 A;  2DLP A;  2J7I A;  5H6Q B;  1E6G A;  4IIM A;  4A63 B;  2X9X A;  1X6G A;  4H63 H;  2MTQ A;  3I1A A;  3MA9 A;  4HTE A;  4ZS2 A;  1UCU A;  3ZCI A;  4ANJ A;  1GCP A;  2RN8 A;  1VA7 A;  2NTX A;  2M0Y A;  3RYI E;  2PNI A;  1YN8 A;  2WMO A;  2CDT A;  3HKE E;  1YCS B;  1KNZ A;  2Q9Q D;  2V26 A;  3DP7 A;  5TAO A;  1T3S A;  5LJM A;  2ZM2 A;  3I5S A;  4AFZ C;  3VU7 H;  2AZS A;  2W62 A;  3ETU A;  3KVA A;  1NEG A;  1WXT A;  2WBL A;  4GYR A;  1E7O A;  3HKC E;  2KZ7 B;  1NWM X;  3C4Z A;  2F2X A;  1IZN B;  4LUE A;  4AG1 C;  1AD5 A;  4IGU A;  3NZQ A;  2JQQ A;  2PJQ A;  5A1L A;  2KT8 A;  5L3F B;  3VKH A;  3DTO A;  4U74 A;  3PUS A;  1WR6 A;  3LK4 2;  3O4X E;  2IW5 B;  2YT6 A;  3CQT A;  2EBP A;  2PG8 A;  2BDE A;  2XUE A;  2DNX A;  3F2E A;  3WAK A;  2CXF A;  2LOS A;  4HGA A;  3TKL B;  3NBX X;  2DL4 A;  3NMZ C;  4D8D A;  4QXC B;  4AXP A;  1VYT A;  4ZI3 D;  5HXH A;  2OI3 A;  1MMG A;  3ZPO A;  3HR0 A;  5FXX A;  2KRO A;  2XMF A;  3GWH A;  1TUC A;  4WCI A;  3KV5 A;  2CEA A;  2RP4 A;  3K3O A;  1SPK A;  3BQL A;  3N9N A;  4AKR B;  1I1J A;  1YWO A;  2EGA A;  1X79 A;  2EYZ A;  2LJ3 A;  1H92 A;  1K4U S;  4E7Z A;  1KFZ A;  4QXB B;  4QHO A;  4JZ4 A;  2W61 A;  2E9X B;  3PVL A;  4E6R A;  2JS0 A;  3UUL A;  4AQF C;  3N2G E;  2LSK A;  3MZK B;  4HN9 A;  4UVC B;  4E7S A;  3PDY A;  2IAK A;  4GK5 E;  4EYY R;  1X2K A;  4ORZ A;  1WRD A;  3AVS A;  2J06 A;  1U06 A;  2RA1 A;  3C50 A;  3HKD E;  4QXH B;  3ZC0 A;  1HG5 A;  1RUW A;  2D8H A;  4KBM B;  3ONX A;  3UAT A;  3VS2 A;  4KUM B;  1NLO C;  5L23 A;  3UUM A;  4X1Y E;  2JS2 A;  1YW0 A;  4IST A;  3UA7 A;  2FRY A;  2V7I A;  2V7K A;  4AQG A;  2BZY A;  4Z88 A;  1BK2 A;  1UJ0 A;  1UFF A;  3ZMZ B;  4JJC A;  1EZ3 A;  1WLX A;  3RRC A;  2DL3 A;  3UFE A;  3NRX A;  2FRW A;  2GTO A;  3BK9 A;  2KWI B;  5EK4 A;  3S4U A;  3SOL A;  3KFV A;  4YFS A;  1LVK A;  4LNP A;  2NW9 A;  3I5R A;  2LHR A;  3CML A;  4BJM A;  1AJ3 A;  2ED1 A;  2NW8 A;  5HXS A;  4I55 E;  4YJ3 E;  4JPB W;  3H0I A;  4JZ3 A;  1PHT A;  3IHR A;  1EFN A;  2CUB A;  3E08 A;  2DCF A;  3BQI A;  2P9B A;  3EHR A;  3GMI A;  2YSQ A;  1X27 A;  4AFU C;  4FSS A;  2DWG A;  3B13 A;  4CZZ B;  2YDL A;  2ACX A;  2RQW A;  3Q5X A;  4WBO A;  1Z9Z A;  3REA B;  3IQL A;  5GJV B;  4H9P C;  5LA6 E;  4J9B A;  4D8K A;  2SEM A;  1D1B A;  4UXN B;  3WAJ A;  5JR9 A;  2DIL A;  3NRY A;  4X1K E;  3FXE B;  5IHN A;  2EKH A;  2EHO C;  1QSD A;  2N2N A;  2X9H A;  5L3G B;  1M8M A;  5IYZ E;  2X67 A;  4ILU A;  2J6F A;  2RQV A;  3M0U A;  4LE9 A;  1LKX A;  2C0S A;  2VB6 A;  2LSJ A;  2X0L B;  3O1J A;  3EUH A;  1ABO A;  1RLP C;  2M51 A;  2DJQ A;  2E5K A;  2XTL A;  4LUD A;  4CC2 A;  3JC6 C;  3K3Q C;  3LG7 A;  3N9M A;  3ESL A;  1W1F A;  2Y6X A;  2PTK A;  1KK7 A;  2QGS A;  5FMN A;  1YP5 A;  1SRM A;  2LQW A;  1YD8 G;  3U23 A;  3ZC1 A;  4J9H A;  3BQK A;  3MAC A;  2DI4 A;  2K48 A;  1ZUK A;  2L8K A;  3FHN A;  3OKQ A;  3RPU A;  3I35 A;  4L5G A;  2HCK A;  3IEE A;  3SHW A;  1AWO A;  2XAF B;  3PUG A;  2P4R A;  2V1R A;  2IC6 A;  2EQI A;  5IHY A;  1WXB A;  4O4I E;  2VKH A;  2Y48 B;  1HCI A;  3D0T A;  4H63 V;  4YHJ A;  5HXC A;  4CI3 B;  1U5S A;  3UT5 E;  3V5U A;  2AK5 A;  2ROL A;  4ZNX A;  2ZM8 A;  2LCS A;  4B6X A;  5CA1 E;  1UX5 A;  2ZM0 A;  3SS1 A;  1WIE A;  1ZV4 X;  2VKN A;  1GBR A;  2JMK A;  3RKO A;  5FY7 A;  5FXW A;  4ERR A;  3ZMV B;  4PJN A;  3HL6 A;  2EHO A;  2DE0 X;  4KP3 C;  4OMN A;  5GJW B;  1ZKE A;  4IHJ E;  3PUQ A;  3WI3 A;  3VS7 A;  5HYA A;  5LGN B;  2JPF A;  3VS5 A;  2EVR A;  3PU8 A;  3ANW A;  4QWN B;  3VS3 A;  4HE8 A;  2GK9 A;  1BR0 A;  2JT4 A;  2SPC A;  2W0G A;  3O1H A;  1LRZ A;  2DM1 A;  4AKH A;  4WNK A;  2D8J A;  1UHF A;  3J7Y q;  4O2B E;  3MXZ A;  5JDL A;  1I07 A;  4QX7 B;  1M27 C;  4MAL A;  2J6O A;  4J9F A;  1KJW A;  2MCN A;  3SEM A;  1Z0P A;  2MOZ A;  2K3B A;  5IHI A;  3KV6 A;  1HX8 A;  3A5X A;  3KV4 A;  3LJC A;  3QC9 A;  5JH7 E;  1JXO A;  4AKL A;  1LVF A;  2VWF A;  4O4H E;  5L3E B;  4BA9 A;  1GCQ C;  2KYB A;  4N78 D;  2K7A A;  1YWP A;  2XAH B;  1GRI A;  4TV9 E;  1X6B A;  2DF6 A;  3GN5 B;  3Q5W A;  1V9D A;  4HEA A;  5LOV E;  4A56 A;  5ADX L;  2K2M A;  2LQN A;  1HG2 A;  1MND A;  4UF0 B;  3O1I A;  5JR9 B;  2H3R A;  5FWB A;  1GL5 A;  4Z8A A;  3CKD A;  4I43 B;  2CLY B;  2CE7 A;  4EZH A;  1AVZ C;  3RYF E;  2JTE A;  4ASK A;  2LJ0 A;  4R0K A;  2NWM A;  2ODU A;  1BB9 A;  2N1G A;  1CKA A;  2G0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...