3R6NA

Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin plakin domain
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
450
structure length
450
Chain Sequence
SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a rigid four-spectrin-repeat fragment of the human desmoplakin plakin domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Desmoplakin
total genus 171
structure length 450
sequence length 450
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17902 SH3_10 SH3 domain
A PF18373 Spectrin_like Spectrin like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1060 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA02
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3r6nA03
2EGEA 1OV3A 4RTYA 5HCKA 2GQIA 4RTTA 1BB9A 1UJ0A 1GCQC 1K0XA 4D8DA 2KRSA 3UA7A 1JU5C 1GCPA 2ENMA 1FMKA 2F2VA 2LJ3A 2NWMA 2DBMA 1MV0B 1Z9ZA 4Z88A 2FRWA 3PE0A 2GTJA 3UF4A 1TUDA 4AG2C 2YUQA 2KRMA 3M0RA 1FYNA 1WIEA 1VYUA 4AFZC 1KIKA 4ESRA 1JXOA 2RMOA 1EFNA 2V1QA 1E6HA 3IQLA 2EYXA 1ZUKA 2L2PA 3H0IA 4RTWA 4OMLA 4IIOA 3KFVA 2LZ6B 2DILA 4JPBW 2JM8A 3VS7A 1PWTA 1W1FA 1TUCA 4HVUA 3TVTA 2DYBA 2JXBA 2F2WA 2CT4A 1KJWA 1B07A 4LN2A 2BZ8A 2KROA 2FG0A 3O5ZA 2LMJA 2RQRA 1U3OA 2VWFA 1WFWA 1CSKA 2C0IA 1ABOA 2O2OA 2GBQA 1KFZA 3FJ5A 2PTKA 1NEBA 2EW3A 2YT6A 5L23A 3EG2A 2FEIA 1T0HA 2DM1A 3RNJA 3PDYA 4JJBA 2P4RA 2JS2A 4JJDA 3REAB 2JMAA 2LNHB 2RQWA 3VS3A 1AWXA 4RUGA 2HDAA 1YWPA 2O31A 4IIMA 4F17A 3EG3A 1X6GA 1ZX6A 1SSHA 1ZUUA 5IH2A 1YN8A 2CREA 1M30A 2ROTA 4F14A 4OMPA 2CDTA 4HCKA 2EYWA 1H3HA 3EDVA 2CT3A 2EVRA 3I9QA 2K3BA 2AZVA 1HD3A 4JZ4A 3RBBB 4E6RA 1UHCA 2AKKA 3A98A 1K9AA 3ULRB 1VA7A 1B3QA 3F57A 2L0AA 1NM7A 2L3PA 2CUBA 1WA7A 1CKBA 1NYFA 2BZXA 2JW4A 4HVVA 1SPKA 1U5SA 1GCQA 1JEGA 1WI7A 1RI9A 3EG0A 1OOTA 1Y0MA 4J9FA 4AFSC 4HXJA 3NHNA 2DL5A 4OMMA 3GBQA 1AOJA 1UG1A 1M3CA 2CH4A 4OMQA 2VKNA 2D8JA 1Y57A 2CSQA 4J9GA 1SRMA 1AWOA 2DVJA 1QWEA 2RPNA 4CC2A 3VS0A 1X43A 1AZEA 5IHNA 3VS2A 2J05A 2HBWA 1UJYA 4QT7A 1E6GA 4D8KA 2ED1A 3M0QA 1ZSGA 4WCIA 1GFDA 2AZSA 5FWCA 3VS1A 2RQUA 2OAWA 1M3BA 3PVLA 3TSWA 2DL3A 4X1VA 2J6FA 2L3SA 2A28A 3LH5A 4DEYA 4JZ3A 5GJVB 3M0SA 2NUZA 4A63B 4K11A 1U06A 4J9EA 2K9GA 3EG1A 1H92A 1GRIA 3EHRA 1ABQA 1PHTA 3VS5A 4J9IA 1AEYA 1I1JA 2SRCA 1T3LA 2FPDA 2DBKA 5IXFA 1X2KA 4Z89A 1PNJA 2M0YA 1WYXA 2GTOA 4M4ZA 3VRZA 2K79A 4LUEA 1GL5A 1RLPC 2XMFA 4RTVA 3H0FA 2K7AA 4AFUC 2LCSA 3VRYA 3QWYA 1HJDA 2D8HA 4LE9A 5I11A 2CH4W 1X2QA 2DNUA 1NYGA 1A0NB 1N5ZA 2JMCA 3UA6A 4Y92A 2K6DA 3KBUA 1QCFA 3REBB 2M51A 2B86A 2FRYA 1NEGA 2HEQA 2KRNA 4HVWA 2QDLA 1UDLA 2DL8A 3C0CA 1UE9A 1I0CA 1SRLA 1X27A 1WLPB 2O88A 1QWFA 2RF0A 2AK5A 1T3SA 2JS0A 1VYTA 2ABLA 3M0PA 4J9HA 2BTTA 2ESWA 2YUNA 2KT8A 2OI3A 4JJCA 1UHFA 2DX1A 2MOXA 2GGRA 2RN8A 2EPDA 4CC7A 2GNCA 2J6OA 1AZGB 3QWXX 2DE0X 1T0JA 4GBQA 2JM9A 1WXUA 4J9DA 1UGVA 3SHWA 2MIOA 5IXBA 1W70A 1X6BA 2O9SA 2A08A 5I22A 2KYMA 3THKA 1RLQC 1LCKA 2H8HA 3H41A 4OMOA 3ZL7C 4ZNXA 4CC4B 1OPKA 2C0TA 2C0OA 2KNBB 2LJ1A 2LQNA 2EGCA 2KR3A 2F2XA 2DA9A 3EHQA 4AFQC 1TG0A 2X3WD 1WDXA 2KBTA 1RUWA 2X3XD 2DF6A 2LJ0A 2J06A 1WXBA 2ECZA 2KT1A 1GBQA 4ORZA 2IIMA 4EIKA 1K0SA 4FSSA 1MUZA 1JXMA 4OMNA 2DMOA 1M3AA 1M27C 3M0UA 1YCSB 1ZUYA 2YDLA 2FPFA 1WX6A 1AWJA 2D1XA 3TSZA 1K76A 4F16A 1IO6A 1VYVA 1AVZC 2VVKA 1S1NA 2DJQA 2FO0A 2EQIA 1G2BA 3NGPA 2KEAA 3U23A 2J6KA 1CKAA 3I35A 2KYBA 4CC3A 3SEMA 2DLPA 2EBPA 2LX7A 4GLMA 5IHKA 2J7IA 1UFFA 5FW9A 3NPFA 1MV3A 2EYYA 4J9CA 2LP5A 2RNAA 2K2MA 2L3QA 2EGAA 5ECAA 1WXTA 1PRLC 2KGTA 3KBTA 4AG1C 2W0ZA 2KXDA 1SEMA 1PKSA 5GJWB 3R6NA 1AWWA 4RTUA 2EKHA 4KRTA 2DL4A 1NLPC 1SHGA 2CUDA 4R0KA 2DRMA 1BU1A 2ED0A 5J1GA 2RQTA 4RTXA 2HSPA 2YUPA 1AD5A 1J3TA 1K4US 2RQVA 3H0HA 1JO8A 1KSWA 3EDUA 2ROLA 4LUDA 2A36A 1W6XA 2O9VA 1ZLMA 4RTZA 1JQQA 2FPEA 2YSQA 1ARKA 1UTIA 3I5SA 4J9BA 1UECA 2KE9A 2CSIA 2PZ1A 2I0NA 1G8XA 1QKWA 1OEBA 1ZBJA 2EYZA 4Z8AA 2BZYA 1QLYA 3PVQA 2A37A 3UATA 1BBZA 1HSQA 2D0NA 1V1CA 2DL7A 1QKXA 2KXCA 1I07A 2MCNA 1OPLA 2IAKA 1X69A 3EGUA 1M8MA 3CQTA 1NLOC 1GBRA 1SHFA 1NG2A 1BK2A 1XOVA 3I5RA 2SEMA 3M0TA 1PRMC 2YUOA 4DEXA 1E7OA 3VS4A 2AKLA 1K1ZA 2HCKA 1G83A 3NMZC 2G6FX 3VS6A 2JT4A 2E5KA 1PKTA 1Z9QA 2LQWA 2W10A 5FWBA 2PNIA 3JV3A 4LNPA 2V1RA 5EC7A 2DRKA 1YNZA 1YWOA 2OJ2A 2JTEA 5IHIA 1GFCA 1H8KA 1YP5A 1UUEA
chains in the Genus database with same CATH superfamily
3SWNA 2HMAA 2EGEA 1KQSP 4RTYA 3G4SQ 1QQJA 1VQOQ 1K73R 1BB9A 3OB9A 2V7JA 2V6XA 5FY0A 1GCQC 4BE0A 3QZ9B 1IHWA 1ZHCA 1KF6A 3UA7A 4F7UG 1YI2A 4M78D 3FZLB 2DD4A 4LMKA 1GCPA 2KDSA 2D0QB 3G71Q 1TWBA 2K57A 3EFOB 3A8HB 4Z88A 4XTVA 3UF4A 2GTJA 2B1EA 1G3SA 1TUDA 3AVRA 1R77A 2FJEA 2KRMA 3CCMQ 2X51A 3M0RA 4U3CA 1U1TA 4XTWA 4AXPA 1W2BP 1JXOA 2E70A 2BDEA 1MNEA 1EFNA 2V1QA 1E6HA 3TLVA 2CCQA 3IQLA 1Q82C 3RQUA 4JJNK 4OMLA 1QCOA 3TU4K 4JI6T 2DILA 3PTAA 2VL8A 1VQ5A 3ZMUB 1BI0A 2VKOA 2JM8A 2YXYA 3VS7A 1K8AU 4C91A 2ATCB 4EEBA 3P7IA 3EGXA 5FXXA 5CR2A 3TVTA 2DYBA 4KHPT 4CI1B 2X67A 3OVUA 4CI3B 1NZ9A 4XU3A 5D6YA 1S72Q 4MZPA 2XDBA 4HKAA 2BZ8A 1IXDA 4L0RA 4X9CA 2FG0A 1VQ5T 2WU5A 2KY9A 2JNGA 2GFUA 2LMJA 4NXNT 1PM3A 1U3OA 1SUMB 1YXRA 2DHRA 1CSKA 2C0IA 2OX7A 4JRQA 1BR1A 3H3AA 1KFZA 4PFOA 3CCLT 2PTKA 1KNRA 5LJ5d 3TEEA 3GP8A 1Q7YU 1V29B 2FBWA 1YJNQ 2DXUA 2FEIA 2QI2A 2XKOC 5GMKe 4E7KA 4JI5T 1WR6A 4R55A 4RG2A 4MLKA 1X75C 2JS2A 4RKUE 2PVOB 4RUGA 1K8AR 1RAGB 1UGPB 3OBVE 3GLXA 5IN1A 5FU6B 5LBMA 2EQUA 3L2UA 4ERRA 1YWPA 2C06A 5ETWA 1IBLT 2E6ZA 4IIMA 3EG3A 3OYZA 3PU3A 4LFBT 1DU2A 2X68A 3OKQA 4TWDA 3VRAA 5L3BB 1ZUUA 3FEOA 1BCMA 1M30A 2ROTA 2DLRA 4HCKA 3JAEA 5CA1E 3JB9G 2SPCA 3A8OB 1UB4A 2AZVA 4JZ4A 3RBBB 1ZSZB 2K3XA 4ZEYA 2OTJQ 2LM9A 4EYUA 1SF9A 3O8VA 3GNGA 2EHOC 4C92F 1WHKA 2YEVC 1TU0B 4KUMB 4UIGA 4IE0A 5EK3A 3ZT7A 3BQKA 1K9AA 3MCAB 2L3LA 2M02A 4E7IA 2VC8A 4M77C 1LRZA 4DBRA 2CP7A 1H641 4AI6A 4MDXA 5KYWB 2CUBA 5C0MA 1SG5A 4E7JA 1BI1A 2BBHA 2JW4A 5KYYB 4M77E 4PW8A 4PJJA 4WZXA 1TXQA 5GAOl 4C8QE 4NL3A 1WI7A 3QXEB 5L3CB 1M62A 3EG0A 5KYUA 4U33A 1Y0MA 4YTMA 3F2EA 1R0CB 3NHNA 2VGMA 2DL5A 5LMNT 2HZYA 4BI3A 3GBQA 2D9TA 3M4YA 3NKZA 4DR6T 3PMIA 2CH4A 5GAMe 2VKNA 3UT5E 2D8JA 4ZI2D 2CSQA 2E12A 4J9GA 1AWOA 2ODVA 1JNRA 3UTKA 2KI7A 2WBLA 4YTLA 2JN0A 4M78F 2RPNA 3M56A 8ATCB 4KI0F 2WSSV 5JQGE 3I56A 2A3LA 4UVCB 4WYVA 4I4TE 3E9GA 4QH5A 1SE7A 5FXVA 1VQ9A 1UJYA 3JB9J 4E47A 4GYRA 5GONE 4BB7A 2ED1A 4JRKA 3FC3A 4DR1T 3QDFA 4C5EA 3HFNA 1XDOA 4A97A 3VS1A 2BVLA 4IDZA 3RKXA 2JZ2A 2UU9T 3C64A 3AVSA 2VKHA 3LDQB 3UU5A 1I8FA 4IREA 2CMRA 2L3SA 3E19A 3E9FA 2PQWA 1US7B 2IMLA 1Q7YR 3ZMSB 4DEYA 2COYA 3JCMb 5GJVB 1YITQ 2E9XC 3GA8A 4DNDA 3FZFB 5JREA 1U06A 2EJ9A 2O4XA 2K9GA 2QA4A 3EG1A 2XUEA 4DBQA 1MMGA 4HTEA 4BY6B 4NUVA 1ABQA 5HXCA 3KDSE 4J9IA 4FYYB 3TLUA 2SRCA 3ME9A 3CC4T 3OW2P 1B34A 1VQMT 2LX9A 4AQYT 4HT8A 1PNJA 4UF0A 1KQSS 1WYXA 4RTVA 3H0FA 5DY9A 1HG2A 3A7MA 1GXIE 3JAFA 5LJ3h 5LHGB 5I11A 3ZYLA 1NYGA 2V6YA 2K4YA 5F3JA 3UA6A 2E4HA 4Y92A 2WSCE 4XTXA 1QCFA 2LHNA 2BS4A 4IIJE 3ER0A 4A4HA 2FRYA 3X20B 3GMIA 2X35A 3CPZA 3AB3B 4C5GA 3OYAA 3MA9A 1EIFA 2VASA 2QDLA 1BR4A 4M78C 4J8OA 3OYFA 3CXCA 1I0CA 2XIDA 2WMOA 3RIAA 1QSDA 3RI5A 2AK5A 3MZKB 1T3SA 3AEAA 3L8RA 4A4FA 2M9UA 4M75C 1VYTA 2ABLA 4J9HA 2UUBT 2BTTA 3ETUA 4EGWA 3QZ5B 2KT8A 2YU2A 3I55A 2DX1A 3M58A 5LG3A 2GGRA 2RN8A 4X1IE 2GFAA 4PLIA 5FY1A 3NZQA 4GBQA 2MIOA 1VQ6A 3G6EA 3GF5A 3M54A 4N4IA 3X26B 1X6BA 2O9SA 4JDSA 4CI2B 4J7FA 4ZI7E 1VQPT 2A08A 1YHQT 3FBLA 3MXZA 1Q82U 2KYMA 2NTXA 2HNIA 2E5QA 2KXPB 4K0KT 3ZL7C 2WDQA 1Y07A 4AMCA 2KNBB 5KMGP 3N2GE 3AE8A 2LQNA 1RAEB 2DWGA 2EGCA 2KR3A 1HNWT 2YRDA 4CXYA 2X3WD 1BR0A 4AFQC 1WDXA 2LEHA 3QSUA 3AA0B 4BI8B 3CBOA 1Y71A 1BR2A 4ORZA 4EIKA 1GBQA 2DCFA 2F5TX 3GPLA 1W4SA 5AQMB 2YKSA 2BE7D 1S72T 4ZN1A 4M7DC 3ZC0A 5LJMA 2DMOA 2G0UA 1C6VX 4M7AE 4H63V 4PK4A 2YDLA 1IAPA 5TAOA 1WX6A 1D0XA 2D1XA 3TSZA 1K76A 2LT3A 1M1FA 1AVZC 1KEYA 1S1NA 3BDUA 2FO0A 2EQIA 1ZSZC 2LT1A 2KEAA 1KC8R 2WWVA 2JIWA 3RYCE 1TSFA 5L2LA 4EMKA 2BG9E 1Y64B 4B3RT 2GK9A 4DA4A 2B76A 2EBPA 2LX7A 2L3RA 4C92D 3NPFA 1MV3A 1OEDC 2YHTA 2YN6A 2QXFA 1KFYA 3OBYA 2CP2A 2WZHA 1VQMA 4WNKA 1WXTA 1W0BA 4L5GA 3KBTA 5C3JA 2W0ZA 4BDZA 4EB6E 5GAOr 2XDDA 2EKHA 3C4XA 5FLXE 1SHGA 2Y4XA 2XU8A 1Z8UA 4E7HA 3S6WA 2L8KA 5IT9E 4E2FB 3MP6A 5GANe 5HK0A 2QA4T 4ZTFA 1AD5A 4N4GA 2HPJA 5JDMA 1Y96A 2A3DA 1JO8A 5AQLB 2HKNA 1VUBA 2A36A 3CC7A 3RDVA 5L4HA 1W6XA 3DB3A 2MTQA 4CRIA 3RYHE 3CCMA 2DETA 3CC7Q 3ZYMA 3I5SA 5LXTE 5ABFA 5JDNA 2KVQG 2XZEA 1VQ8Q 3OBWA 5A0GA 2QTXA 2KSRA 3RKWA 1G8XA 2CLYC 2ZPFB 3HI2A 2DPPB 3RGLA 1OYXA 2DL1A 2XJ7A 5AQHB 5LGNB 1EZZB 3B57A 2P9BA 1Y96B 4GLKA 3PJAJ 1WJSA 3MJXA 3LSVA 4IUUA 3KXTA 1HS7A 1OI1A 5DJQC 2D0NA 5AQUB 4NS5A 5GAOp 3PNWC 2DO3A 3M3ZB 2KXCA 3CCRT 1XQHA 5FYMA 3JCMf 3QNUA 1YFNA 4XZCA 3EGUA 2VK9A 3UUMA 4F7UB 2K3WA 1VQ7T 4DV6T 4NXMT 2XQ5A 5CO7A 5L8RE 1GBRA 2AT1B 5LMUT 2F4VT 1YJ9T 3CD6T 3NBXX 2SEMA 1RACB 4KULA 4IHJE 4GK0E 4X1YE 2L5QA 2YUOA 4OB2B 2I2LA 2W62A 4DV2T 4UVAB 4ISSA 2DTHA 5C6SA 3E22E 2JMKA 3QYHB 3LLRA 2XDPA 2WMNA 2UUCT 4A98A 1G83A 4B3ST 3OYEA 1VIFA 4GYSA 1N9SA 3QDRB 3VS6A 2CGHA 5KE3A 3P8DA 2E5KA 3LBXB 4ZGEB 3IBPA 2J62A 5LA6E 1WHJA 3ZMTB 4B6XA 1Y7XA 2RH2A 4ZTJA 2P0QA 2LRQA 2ZPBB 3JV3A 4JI7T 2IDOB 5CAIA 5FRMA 3UUBA 1WYCA 2WP9A 1YITT 2XK0A 5IHIA 2PFVA 1GFCA 5AQNB 1Q81R 1D0ZA 2CP3A 1UUEA 4XBFB 5FY7A 3C98B 4IL4A 3VYHB 4MFRA 3LK2B 5HCKA 1JNZA 1XWMA 3QC9A 4RTTA 2CPTA 5CVIA 4QXCB 1UJ0A 1YW0A 2PUKB 2XPKA 1K0XA 4D8DA 3AHUA 3CQGB 2BZBA 2CBIA 3EVYA 3C4SA 1M90R 1VCSA 4M78B 3AEFA 3FBZA 4JRPA 5JR9B 1M1KU 2WU2A 5JR9A 1K73C 1QP2A 2XTLA 3A5XA 3OQ5A 1WPYA 4KP3C 3RIRA 1MV0B 4ILBA 1FWZA 3RMSA 3PE0A 3EH2A 4AG2C 4UXNB 3QIIA 3BQLA 3ZPOA 2YUQA 2CHOA 3AE7A 3HKEE 4IUPA 2QRXA 4BJNA 3H3MA 1XTDA 4TWHA 1WIEA 3T1YT 3BK9A 1VYUA 3I9YA 2ACXA 3I56Q 4AFZC 4DIDB 1O3XA 1Q81U 5LJ5f 1XNQT 4F04B 4I55E 5DQVA 4CZZB 5HK3A 2BUDA 4O4LE 4H9SE 3OS5A 4IIOA 3RRCA 4JUYA 1J5ET 2LZ6B 3FDRA 2RI2A 2HKQB 4TVRA 3VR8A 4RCBA 1M90U 2OTLQ 1PWTA 4BD3A 5JVDE 5LNKA 4OB1B 3CD6A 4HVUA 4COFA 3TKLB 2HQXA 2JXBA 4C92G 2YDQA 2H7VC 2LKHA 4XU2A 1KJWA 3K8PC 3E1SA 2RD1A 2LHRA 1WHMA 3M53A 4XAXB 3GN5B 4H9PC 4QH4A 1WHHA 3D7SB 2JQKA 3K3OA 1HFAA 3FJ5A 4B6MA 4BUGA 1LOJA 2EW3A 3J81E 4M7DB 3ZN0B 2YDRA 3PUGA 2DM1A 4X65T 5CK9A 1VQPQ 3PDYA 1X01A 2P4RA 5JTGA 3V7SA 1M2OA 4DMWA 2LNHB 4FW2A 1M4ZA 1W09A 4C92B 2HDAA 5KYXB 5GMKh 2O31A 3CCST 3Q1JA 4JLEA 1H3ZA 2QAZA 4H9OC 1X6GA 2EJGA 1VQNA 3P8BB 3S3MA 3BDLA 1YI2T 4MZTA 1D09B 1YQ3A 1SSHA 2R5AA 5IAYA 4M75F 2P0KA 3C95A 2EYWA 2QK0A 3JCMd 1VQLT 2RHIA 2VL0A 2EVRA 2K3BA 2VVNA 1HD3A 5LHIB 4ZOLE 4E6RA 1UHCA 2AKKA 1E7PA 1YBYA 1ZA2B 3A98A 2CP0A 1YHQA 3JCMh 2J47A 3CC2T 4AKLA 5KYXA 1YKEB 3ULRB 4EMHA 4DVDA 2X0YA 2X9XA 4FM4B 4C8QC 1N8RC 3OYBA 1YJ9Q 2E2AA 4QVZA 2E41A 2BZXA 1RAFB 3LGLA 1R8OB 4HVVA 3Q9DA 2RJDA 2VUBA 4M7AG 5FU7C 3K1SA 4IUVA 1K9MR 3NWIA 4IE7A 4AKIA 1OOTA 5LOVE 4J9FA 4AFSC 3INZA 4ZN3A 1M8VA 3A8MB 2QGFB 1WHLA 4OMMA 5JRCA 2WM9A 1U5PA 1IJ6A 3CCUA 1IBMT 5KE2A 1QVGS 2CLYB 4J6XA 2C5IT 1BKBA 2X0HA 5M4YA 4E7SA 4G2AA 4YJ2E 4Y28E 1HK9A 2PVGB 3IA3A 5CIUA 2ZLYA 5FROA 1VIEA 4GY5A 4RMOA 4M7DE 1B34B 5KYNA 4O6JA 5D6XA 2HPLA 1FEWA 3VS0A 1I81A 1D0YA 1V9DA 1QVFP 2LTOA 3UQ4A 3P4WA 2QTVA 3MHXA 5GAMj 2PUOB 5HY6A 1AZEA 2CHNA 5D7UA 1RADB 3SB2A 4ISTA 2CP5A 2W67A 3UQ7A 2HBWA 4JEUB 2NUPB 3EG9B 4YT0A 2DFUA 5GAOm 1ZSGA 4WCIA 2N1GA 4DR4T 3CBMA 2LSIA 1YCYA 3OYIA 2F5KA 2XD0A 4PK6A 5FWCA 3AE6A 1RAHB 4FT4A 1OEDE 3PUZF 1YD8G 1M3BA 3PVLA 2WSFE 2EHOD 2COZA 3A5ZB 5J26A 2J6FA 1NBEB 1Q95G 2WCAA 3X1DA 4F8HA 1VQ6T 2UXBT 3A8GB 4EAHA 3H6ZA 3KV4A 1B7TA 3PURA 4JZ3A 4WBNE 2NW9A 4FU6A 5LJ3d 4MBQA 3M0SA 2YWWA 4K11A 5LHHB 1U8RA 3O1JA 1VQ7Q 2K48A 4XK8E 3GIBA 5I2SA 2YRCA 4QKNA 3CCEQ 3QJ6A 3EHRA 3LWHA 2OTLT 3VS5A 1YJWQ 3AE5A 2ZM2A 3KVBA 1AEYA 1I1JA 2HH7A 2FPDA 5GMKl 3P4PA 4ELYC 5KDMC 2BKDN 2ZCFB 2ZM0A 5GANg 1FXXA 1X2KA 2W63A 4M4ZA 4EPCA 1GL5A 2K79A 4LUEA 2XMFA 3BE3A 2X9YA 4AFUC 2LCSA 5KCOA 2KK4A 4B9WA 5LJ3j 3VRYA 3QWYA 2FUPA 2D8HA 4DV7T 1K9MC 5CB4E 2D9DA 5JR9C 2CH4W 2RO0A 1RAAB 1X2QA 2DNUA 4HFCA 1A0NB 4HFHA 1N5ZA 2HN1A 1I6ZA 1N9RA 3DP7A 2JMCA 4OP0A 1QVGA 2FJBA 2B8AA 3KBUA 2IC9A 4N4HA 4IE5A 4UV9B 2LOSA 1OULA 4JEHB 3AEDA 3L3PA 1VQKA 1SHZC 3LG7A 2DXCA 1UE9A 1SRLA 2VWAA 5A0DA 3CCSQ 5DABA 1WLPB 3P4RA 2OAUA 5LJ5j 2O88A 1QWFA 4P0BA 3GWHA 2LLYA 2M16A 4HWFA 1KQ2A 2WDVA 3PFSA 3M0PA 2VYTA 4KMCA 3G7ZA 2ESWA 3FZHB 5AT1B 1WHGA 1V76A 1VQLQ 3AECA 3CCQT 2LCCA 7AT1B 2XQAA 4DR2T 2J6OA 2E65A 4C0FA 1VQ8A 2ZPIB 1T0JA 2JM9A 3LK42 1SA0E 3HSBA 2WWUA 3G4SA 1Q86U 2D0UA 2I0MA 2DNXA 2KNDA 2Y4YA 1KHIA 3L1AA 5I22A 4GIWA 3HRTA 4X1KE 2EQKA 2XQYA 4LF6T 1OPKA 2C0TA 2P4TA 2F2XA 4A4EA 5GAMg 4MDWA 4M7DD 4HFBA 4NOYA 1RUWA 2LM2A 2FB7A 1OXZA 2N2NA 3WAJA 4L6V5 2J06A 3OPCA 4PFPA 4YLHA 3RYIE 4DO0A 4C92C 4HWDA 4M7AD 1WXBA 2ECZA 3Q5DA 3JCMJ 3N9MA 2Z0WA 4FSSA 2CXLA 5HXSA 1QP3A 1WJRA 4C8QG 5CCAA 4OMNA 1M3AA 4M77G 4OVAA 4M77F 3RMQA 3VV0A 1T98A 1ZUYA 4HWCA 1HTJF 4WF2A 4EEDA 4TV8E 3PUVF 2FPFA 3ASKA 4FYVB 4A4KA 3EAMA 1I4K1 2VVKA 2BKOA 2HQHA 1K8AC 2DJZA 1KNPA 3Q5WA 4B3TT 4ELZC 3LH0A 5LBQB 3U23A 3I35A 2WB5A 1M2VB 4XU1A 3V8KA 3SEMA 2DLPA 4GLMA 2J7IA 1UFFA 5FW9A 3CCQA 3QB5K 1WGSA 2K2MA 2L3QA 5J3BA 2RHYA 5FL0A 3PU8A 4AG1C 1JJ2P 3ZN1B 4PNIA 3RKOA 4KRTA 2DL4A 1JJ2A 4TZ4C 5BMVE 3J80E 1VQNQ 3HL8A 1VQKT 5IWAT 4XTYA 1SSFA 2Y8DA 4DR3T 2ED0A 4BAYB 5KYYA 3JCMP 2QEXA 4X62T 3RESA 3VU3C 2HSPA 2P84A 2YUPA 1J3TA 3N9OA 4ZS2A 1UUSA 3EABA 3OYDA 3EDUA 4DV4T 2J1DG 1OZ3A 2KAFA 2VKJA 2UUAT 4JS5A 1M1KR 2I59A 3VHLA 3X25B 1VQ4T 4M7AB 3PTRB 4H63H 3CXCP 2HBPA 4QQDA 2FPEA 4X9DA 4B3MT 3FXEB 4FJOA 1WQWA 4U7IA 4J9BA 3HL6A 4FCYA 4IE4A 2KE9A 2CSIA 4B9XA 3O4XE 2PZ1A 3VJPA 3DKMA 2EQJA 4PJMA 1CUNA 4M75G 5AFUL 3RH3A 4IDQA 1OZ2A 4QQ6A 3CWZB 2XAFB 5L3FB 5HAXA 3CCVA 1UX4A 5GAN2 1QLYA 2A37A 2EKOA 2JRKA 1BBZA 3MP1A 2VURA 3DTOA 2CWOA 2WSEE 4K0UA 2ZMAA 1I07A 3OS0A 3AAIA 4PJOD 2IAKA 5JDLA 3KV5A 1X69A 3AA1B 1MMNA 2PU9B 3MEUA 2ACZA 1NAFA 4LMJA 4LF5T 1D3BB 5CKFA 2BG9C 5CJ5A 5M9OA 3AE1A 1X79A 1XMOT 2QYZA 4YSZA 3NFCA 1HX8A 5CQXA 4CQIA 2QA4Q 4DV3T 3RQWA 2HCKA 4IE6A 3N9LA 3V7CA 3OYMA 4QVCA 3RRWA 2H3EB 2RHUA 3WVEB 5HXRA 3SFDA 3NMZC 3AE2A 3CCQQ 1MMAA 1PD1A 4KUDK 2H3RA 4C0ZA 2JT4A 3PUQA 3ONJA 1AHJB 1IZ6A 4F7UE 1G5VA 1PKTA 2D5UA 3G4ST 4JI4T 4FSXA 3G6ET 2DEUA 3PIOA 4QX8B 1WYBA 4KT0E 3VRBA 4CXWA 1VQ8T 4LDVA 5GAN5 3A1PA 3GNFB 3RR6A 2DRKA 5FMNA 3CEYA 1OU9A 2M6BA 5KXJA 2LSGA 4H9RC 1YWOA 2CEAA 1QVGP 3UFGA 3A8LB 2JPFA 4H9NC 5FVKA 1YP5A 3FIFA 5D6WA 3OYCA 2ZAEA 1PD0A 4BACA 3R6OA 2GQIA 4UC4A 4YXDA 3OW2A 4A5XA 1ZEEA 4JBWF 2C5JA 4CN4A 1JU5C 2DWKA 4J5YA 1FX7A 2X4JA 5CKDA 2DXTA 5EG2A 3CPWA 1FMKA 3E0ZA 1O9SA 2DYIA 2LJ3A 2X4WA 1NPRA 1P92A 1Z9ZA 1WZOA 2FRWA 1M90C 1QMCA 2NWBA 2IUBA 2DEQA 3CD6Q 1OEDA 2V7MA 4C8QD 2EHOA 1FYNA 2BIVA 2LNVA 4M77D 3SWNB 4AKGA 4HGAA 4VUBA 4DOWA 3PUAA 5HEUA 3LW5E 3ONXA 2H88A 2RMOA 2O01E 3KVAA 2COWA 4OGEA 2V7KA 1VQ5Q 2XQ6A 2LSJA 1ZUKA 2L2PA 3H0IA 4RTWA 5FXZA 3HR0A 3M65A 5LCYA 3KFVA 1E2AA 3UU3A 1KNZA 1BCOA 3ESLA 1O75A 4A56A 4IDPA 3EH1A 4M78G 4JPBW 4M7DF 2K2VA 2L8DA 4FYWB 4WW0A 3CCLQ 1W1FA 5DLQE 3RLFF 3VR9A 3JCMg 4DR5T 2G3RA 4QKUA 2MYSA 4JV5T 3CPFA 3HFOA 1B07A 4L9IA 4YFSA 4LN2A 2KROA 3G71A 3UUXB 3SFMA 2XHEB 3PV0F 3WI3A 3C4WA 4IL9A 2LRLA 3O5ZA 4OB0B 1QLBA 2RQRA 4CI0C 3ZMVB 1WFWA 4V2SA 3EI0A 5KX5E 4I0UA 1ABOA 2O2OA 3RIUA 3JB9D 2QGGA 1M1GA 5L23A 4FT2A 2Q9QB 3JC6C 2JVVA 1E1HB 2RJCA 5GAN3 3OY9A 4MHCA 1XNRT 1PSEA 2RI5A 2IHR1 2W66A 2BE9B 3AT1B 3REAB 4EMKB 2KLQA 3VS3A 3JAME 1QVFS 4DQ2A 1HNXT 1IHVA 4II1A 3EUHA 2E10A 2GQVA 4QXBB 3C94A 4LD6A 4F17A 4Y91A 4QQGA 4O4IE 5DLOA 1U1SA 1SKUB 1JRIA 4UV8B 1HF8A 1N8RU 1YN8A 3A8YC 3U3IA 5L3DB 2CREA 2HL3A 4XU0A 2K3YA 4OMPA 2CDTA 3CIRA 5HEGA 1H3HA 3QKJA 4BE2A 4PAGA 4ZI3C 2LCLA 2DAQA 5L47A 2MMPA 3DB4A 4HT9A 3RUXA 1T8BA 3VUZA 5AQJB 5ADXL 3CQCB 1VA7A 3QPHA 3F57A 2LSKA 2DKGA 2A0FB 1NM7A 3LBXA 2OA5A 4KHZF 1WA7A 3DLMA 4M75B 1CKBA 3M4GA 4X34A 5IYZE 3J7AF 3PUYF 1SPKA 1ZA1B 1U5SA 1GCQA 1UURA 3PGGA 4PLLA 5KCHA 3UPUA 3P50A 1JEGA 1W2BS 4M7AC 1OX8A 1RI9A 1VCTA 4EV6A 4LDXA 2A9UA 4I43B 2NOXA 4HWIB 4HXJA 4C8QF 3MACA 3QUJA 5H6RB 1Q86C 5LP6E 3K3NA 3M57A 2KINB 1UG1A 1M3CA 2R5MA 4QX7B 4F7UA 2MK5A 1QVPA 2K5BB 1Y57A 2VV5A 4DV1T 2DVJA 3UUNA 1M2VA 2YOEA 2MWOA 2L9QA 3CK6A 4YSXA 2CYZB 4O8SA 1VQLA 4OB3B 1TTHB 3HPWA 1X43A 3PJAA 1Q82R 4F6RC 5GAMh 3T8OA 3OS2A 3H9NA 4NIQA 3VS2A 3B5MA 4LFCT 2J05A 1MIWA 4ILCA 2NYSA 2Y90A 1FMWA 2E5LT 4IUTA 5JRCB 4YJ3E 3HHTB 4CXXA 1OU8A 4HCZA 3EGDA 2X4YA 2X0LB 2AZSA 2QGSA 1Z0PA 5HCMA 2LDMA 3ZBDA 4M1PA 2WACA 3C51A 2Z6EA 3X24B 3TSWA 4X64T 3EFSA 3DLLA 3JCMe 2R57A 2BVMA 2FVUA 1BIBA 1MIYA 3LH5A 3VYGA 5JH7E 3JCMQ 5AQFB 1YQ4A 4HCBA 3LX7A 2MBGA 1HNZT 2LVMA 4TUYE 1T72A 2XM1A 3UULA 2NUZA 4AIUA 2PVDB 4C8QA 2RM4A 4J9EA 4O2BE 1OEDB 2RA2A 3FHNA 4FW1A 4AT1B 5LJNA 4MMLA 5EK2A 4N0AC 4JUVA 1KHCA 4U2YA 3CBPA 4ZZBA 4LDYA 2D6FA 3PUSA 2E6NA 1YIJQ 5H6QB 2DI4A 1T3LA 4J6WA 5LG4A 2DBKA 5LL6S 2LJLA 5FU6C 1UK5A 2N9DA 4XTUA 2NLUA 2E9XA 5HWXA 4UF0B 2AXDS 3VRZA 2ODUA 4IDOA 3SDZA 1PCXA 4DUYT 1ZOYA 3N2KE 3JADA 1HCIA 2E8IA 4U31A 3IEEA 3G6EQ 4LE9A 4KBMB 4N78D 2HN2A 2XAJB 5IUXA 5CFBA 2YINA 3UU4A 5ABFB 4AQGA 3EGDB 2A72A 3REBB 3ZT6A 2M51A 1LJOA 2B86A 2XQ9A 1OQKA 2VXFA 3FLGA 2HEQA 4PJOA 3I55Q 2E3IA 2KRNA 4BA9A 1VRBA 1ZQ1A 3L2ZA 4HVWA 2LC4A 4KGVB 1UDLA 3SWNC 2DL8A 2HSEB 3SFEA 1W2BA 4E7LA 5LB7B 3NRXA 1X27A 2RF0A 3HP9A 4M77B 2FJAA 4M7AA 4MZMA 2JS0A 3HKDE 2XQ8A 3CMLA 3AA7B 2BS3A 3KINB 2YUNA 2JTMA 2WQYA 1LNXA 3HA4A 2KMTA 4HFDA 2QG9B 4JJCA 3FB9A 3QUIA 3EAEA 3OMGA 2GNCA 4AQFA 1AZGB 4PNOA 2ES0A 1IRXA 2QA7A 1WXUA 4C0DB 4J9DA 2ZGWA 3QK6A 4O4JE 3SHWA 1YJWT 5J39A 1W70A 4CN6A 1TUGB 3CCVQ 5AQTB 3CCLA 2HQEA 4MMKA 4O5VA 1LVKA 3UWNA 3ZSTA 4YTPA 3CQXC 3N2OA 1RLQC 3C12A 2H8HA 5KYWA 4OMOA 5AQRB 2I6HA 1WJQA 3FB2A 4ZNXA 4CC4B 2Q9QC 3CCJQ 2WDRA 2C0OA 5J2TE 2LJ1A 1HYOA 2YLCA 1ZV4X 4OHFA 4HWHA 2DA9A 3EHQA 4DBFA 4O2AE 2JJ9A 1TG0A 4AISA 4TX5A 2X3XD 2EYQA 2DF6A 2LJ0A 3CX8B 3P8HA 3E2UA 2KT1A 4IT4A 2IIMA 2HAXA 2OTJA 1CHUA 3M0UA 2H3JA 1IJ5A 4EIWA 2CXDA 1YCSB 5FL1A 3EG9A 4J83A 2JTFA 1AWJA 1QUUA 2BS2A 2YLBA 3P4SA 1VQPA 1IO6A 3ZJ2A 5LJ3f 1VYVA 5A1LA 3SOLA 2DJQA 2CS7A 4ZHQE 1G2BA 2NW8A 2QASA 1WQ7A 1NJIU 3NVOA 3AXJA 4KUIA 3E08A 1CKAA 5LJ3e 1U4QA 2WS3A 4GKKT 2PBIA 5AQQB 2E9XB 1JJ2S 3AEGA 2KT9A 1RL2A 2EYYA 4J9CA 2LP5A 2RNAA 4NL2A 3TCJA 4HFIA 2V8JA 4FIBA 4X66T 2EGAA 5ECAA 1PRLC 4ZI2C 1VQ9Q 3G06A 1PKSA 1NWMX 3R6NA 1JBMA 3JCMW 2NW7A 3PT9A 2OTLA 3RC8A 2ZPGB 3CC7T 2RHXA 2H7OA 3N9PA 4KX6A 3RPUA 4BI4A 5CKHA 1NJIC 1NEKA 2CUDA 1Q81C 2VXEA 1J5WA 2RHZA 2V5CA 3OYXA 2DRMA 2YRVA 5LJ5e 3HRSA 3ANWB 3JC6D 3R84B 2HD0A 2JQQA 4C90A 4JI0T 1N8RR 2CM0A 3ZEFB 4UR9A 3MEAA 4KGZB 2ROLA 3JCFA 4LUDA 1NJIR 4HE8A 1T7SA 3M55A 3CCUQ 2L89A 3AA6B 2DD5A 2O9VA 1S35A 3CPWS 5ABGA 4U7YA 2EFIA 3OA6A 2RP4A 1LKXA 3U78A 1ZP0A 1JQQA 5GANj 1ARKA 2IC6A 1UTIA 2ZZDA 5A2QE 3LWIA 2V8SV 4HFVA 3VKGA 3CMET 1UECA 5CKEA 4DOVA 4U72A 1LPLA 3CCRQ 2O4XB 2I0NA 4IURA 5L3GB 2V7LA 2Y6XA 2UXXB 3SWHA 1WR0A 4GK5E 2CZ7B 4OYKA 5KYUB 3V5SA 5I21A 1ZBJA 5GAN4 1VOMA 4UVBB 3J7Yq 4ILUA 1ZHIA 1X9BA 2P0PA 3PVQA 4TWFA 3UATA 4IGUA 4U74A 2GCXA 2DIQA 3V8JA 4C5HA 4TV9E 4U2ZA 3ZLIA 3Q5EA 1V1CA 1OPLA 3QO3A 3Q2MA 2K5FA 1G73A 3I55T 3G71T 3OYNA 2JQHA 3M5AA 5GANd 5JDHA 3MPUB 5LJ5h 5HEOA 1NG2A 3OYHA 2KZ7B 2XASB 3L39A 2MWPA 3RHWA 4A54A 3ZCIA 4C5IA 4ADZA 2DZ9A 1PRMC 2MAMA 3OSVA 3CCSA 2Y48B 2DTIA 4DEXA 4YHHT 3VS4A 2AKLA 1K1ZA 4PK5A 3AE4A 5EZYE 4N0AA 4UEMA 2AIRB 8AT1B 2G6FX 3V5UA 2V26A 3K3QC 4QVDA 3QBYA 1N32T 4P0AA 2VGNA 1Z9QA 1WFDA 1IGUA 2LQWA 1IZNB 4TNVA 1G3YA 1WCRA 3LGFA 4OMFB 4M78E 4EDUA 2W10A 2JMHA 2V1RA 2XAHB 3L42A 3ZSSA 5EC7A 4A4GA 3VKHA 2MF2A 5HYAA 1QCNA 1ZSZA 4DUZT 1WLXA 2BBJA 2JTEA 2MPXC 2NR4A 3TLWA 3JB9I 3CCJT 2RB6A 5FU7B 1KC8C 3ONLC 4JYAT 1JB0E 5AQOB 2QVAA 1OV3A 1RI0A 1KD1R 2Q9QD 3F70A 5GAOq 2CRBA 1YIJT 2KRSA 2F1LA 5AQIB 1AJ3A 3S4UA 4M78A 3NZPA 5LJ3g 3CCJA 2FZCB 2ENMA 4LDUA 5AQPB 3FJPA 2FHDA 2W2UA 2F2VA 5KH6A 2RI3A 4YSYA 2QQSA 2NWMA 5CA0E 3CXCS 2DBMA 3QG1A 3JRZA 2JOYA 1M7KA 3F31A 2X4XA 3HKCE 1PC0A 4FL6A 5AYFA 3O9XA 2VQFT 1RAIB 2NUPA 3H37A 2XHCA 1XZYA 3META 5F5WA 1KQ1A 1KIKA 2CZ1B 4ESRA 5ABEA 5J0ZA 2W61A 1MIVA 4PJNA 3OS1A 5HEHA 2RA1A 2EYXA 4C0DC 2YDSA 3RKYA 2KSSA 2PJQA 4IDNA 2V8KA 4R56A 3LFMA 4PJOF 2OTJT 2D2SA 2DXBA 2EAYA 3CC4A 2BKNA 2KMFA 1W9RA 3EFOA 1VQ9T 2LKGA 2PG8A 1TUCA 3EGXB 4ANJA 1VQOA 2F2WA 2CT4A 3I56T 4HN9A 3RKGA 2NP9A 3FZKB 4EXTA 3ZKRA 2UXDT 2MPKA 2XY8B 3N5BB 4Q25A 1I5LA 3UU6A 5EK4A 3QHSA 4LF9T 3NTIA 2VWFA 3BFMA 2CE7A 2YU1A 2GBQA 3CMAT 4J2CA 1EZ3A 1NEBA 2YT6A 3ETVA 1YI2Q 4ZI3D 3EG2A 4Z02A 2DVEA 3CCUT 4FI5A 4C92E 3I0QA 4ILAA 1T0HA 3OJAA 3RNJA 3CCVT 4JJBA 4PL6A 3CCEA 2FL7A 1QW1A 4JJDA 4DR7T 2AE9A 2JMAA 2RQWA 3V8LA 4DBHA 1AWXA 3OSSC 4PFZA 9ATCB 1IBKT 3JSCA 4JI1T 4JLGA 4EMGA 4IKFA 2W0GA 2KQWA 1H7CA 2MOZA 2V5DA 2IIUA 4HEAA 2DTOA 5GAOn 2WY2A 2ZM6T 1ZX6A 3NRYA 3CMEA 4LF4T 1UGOA 3N9QA 1K9MU 5GANf 1UGQB 5IH2A 2F69A 5FVLA 1C1AA 4F14A 4OFZA 5BR8T 4J7IA 4DMVA 1TH7A 3EDVA 4M75E 4HFEA 2CT3A 3I9QA 3OYGA 1I5OB 1I94T 4OK0A 5AQGB 3D0TA 3I9WA 4AKHA 3UU8A 3L2RA 4EOZB 2BKPA 2UXNB 3TREA 1DJ7B 2C5KT 3C50A 2FJDA 1YJWA 1D1CA 4YY3T 1B3QA 1KQSA 2L0AA 5FNVE 1Y01A 2L3PA 4WBOA 4M7DA 1XDPA 2YK0A 1NYFA 1XJWB 5HKCA 3RC3A 4QH1A 2QQAA 3KFWX 1N36T 2CBJA 4PJOB 3DJBA 2VKDA 2R6GF 4TN7B 1N6AA 2FZKB 4OX9T 4WTOB 3VKIA 3I0OA 2XM2A 4BJMA 5HXEA 3CC2Q 1D1BA 5F8PA 3MP8A 3L2WA 3OYLA 2XICA 3JB9H 4ZZCA 3P4QA 4PKCC 4M7AF 1OX9A 1AOJA 1MMDA 3O1IA 2RJEA 4OMQA 2NUTA 5FRNA 3HRUA 3CC4Q 2JQ9A 5CQYA 2QEXT 1SRMA 2FYKA 2CA5A 5C8YE 2EQMA 1QWEA 3B13A 4CC2A 3CCRA 3PIPA 5GMKm 1NENA 3RIFA 1F1BB 2W00A 5GAMd 4BDYA 4RG8A 5IHNA 2K9AA 3CVRA 4O4HE 4ASKA 3OMCA 1VQ6Q 1UGRB 2CXFA 4QT7A 1EX4A 1E6GA 4DV0T 3ZFJA 4NUUA 4LF8T 5J2UE 4D8KA 3M0QA 3G1JA 1GFDA 4M75A 5GMKi 1HXDA 2X9WA 3O1HA 1W0AA 3HTRA 1ACMB 2RQUA 3CCET 2OAWA 2VVSA 3BQIA 1J1JA 3PUXF 3SD4A 2K24A 2DL3A 4X1VA 1YJ9A 5DQWA 1IB8A 4FYXB 3ZT5A 2A28A 5GAN8 3CMAA 4ZGJB 4YTNA 1VQ7A 1K73U 2DERA 3CX6B 4MALA 3CKDA 2D0TA 3RYFE 5JDGA 1N34T 1G3TA 4A63B 3UDCA 3JB9F 2QQRA 5I2MA 3MEVA 2ZPHB 1H92A 1KK7A 2OV9A 4EZHA 5GAN6 1GRIA 3P8CD 1VQOT 5C2TA 3ZCJA 1PHTA 4KGXB 3QB5A 1UCUA 4JS4A 4E7ZA 5GAMf 2C0SA 4EZ4A 1YHQQ 4PJLA 3PUWF 2MAWA 2E64A 5IXFA 4Z89A 1KC8U 2M0YA 2GTOA 1MGQA 1YITA 3RIUC 1R0BG 1RLPC 3IHRA 4OGCA 4KH0B 3V7RA 2K7AA 2E3HA 3KV6A 3L2QA 3KUFA 5CGMA 3CCMT 1HJDA 5A0LA 4OYJA 3CMAQ 3ABVA 3ZJ1A 4CN1A 4OF1A 5JDFA 1BYMA 2DZCA 3J9X1 4ZGDB 5FXWA 1KG1A 5AQKB 3JCMX 5IHYA 1BIAA 2K6DA 2XSBA 1Q86R 1NEGA 1KD1C 4KH1B 3TLTA 2W4XA 3MK7C 1PSFA 4AQFC 3CPWP 2XQ4A 3C0CA 2QYWA 2IW5B 4C8QB 1S72A 3WAKA 5ABHA 4GKJT 1FMVA 3MEWA 3OYYA 3VUBA 2LT4A 3ZMZB 2XI9A 4PJOE 2RJFA 3KBGA 3NTHA 5LGTB 4HKEA 4J6YA 4LXCA 1QVFA 2X66A 3OTOT 3ZYKA 2OI3A 2NUTB 5FKYA 1ZKEA 1FJGT 1UHFA 2CZ6B 3ANWA 2MOXA 2E9XD 2R58A 2EPDA 1NPPA 3M9QA 3QOFA 4LFAT 4CC7A 1KD1U 1XMQT 3FRNA 2XAGB 2DE0X 3QWXX 3Q5XA 3ZC1A 1UGVA 5HWYA 5IXBA 1OWAA 3IF8B 4HA8A 3AEBA 3EHZA 2BG9B 5GANh 2PTFA 4JI3T 2QDYB 3UFEA 3THKA 1IGQA 2XQ7A 3NTKA 1LCKA 4JLIA 3ZEHA 3H41A 1IREB 1WNLA 1TS9A 4H9QC 4Z91A 4BE1A 4ZXLA 3PMTA 4F7UF 2XG8D 3BY7A 3BW1A 2A7YA 4XQ3A 2KBTA 2ZPEB 4YHJA 2X9HA 3AAAB 5AQSB 2XAQB 2E1HA 2M1HA 3EFRA 3T9NA 2A2FX 1K0SA 1RABB 1MUZA 3N9NA 1G3WA 1JXMA 1N27A 2CP6A 1M27C 2QEXQ 1M5Q1 3QJYA 3KV9A 3HKBE 5GMKj 3OYJA 4Z8XA 4C0GA 3JCMc 3WXMB 4LDWA 2J4GA 5CKBA 6AT1B 3I1AA 5HXHA 2CZ0B 4JRIA 1HX1B 3AAEB 3GN5A 3H8ZA 5LYJE 3LYIA 3UT1A 4V1Av 4F16A 1ZBXA 4RCCA 2LQ8A 2JUFA 2GF7A 2LQKA 3NGPA 1HR0T 3AXJB 3RERA 2KWHA 4NPPA 1PG5B 2J6KA 5E0OA 2M67A 1MHNA 2KYBA 3MKDA 4CC3A 4M7DG 5HEJA 3M59A 4C92A 2WZIA 5IHKA 2LE8A 4QHOA 3X28B 3OW2S 1LVFA 2WAUA 1S94A 2KGTA 2KXDA 1SEMA 1YIJA 5GJWB 2IPOB 2VQET 1VQ4Q 1AWWA 2EHOB 4RTUA 5L3EB 4PJOC 4M75D 3MO8A 1BI3A 1YJNA 1NLPC 4HCCA 4DV5T 4R0KA 1BU1A 1MNDA 5GAN7 4JI8T 2H89A 5J1GA 1L0VA 3S3OA 4TNWA 2NTYA 2RQTA 4P5NA 4RTXA 1K4US 2RQVA 2K5IA 3H0HA 1KSWA 3CX7B 2ZM8A 4ZS3A 5DM7R 2UXCT 1YJNT 3T1HT 3W15B 2V1DB 3TLSA 5AQVB 2LRKA 1N33T 1ZLMA 2EIFA 4M77A 4PJOG 4RTZA 2RK2A 2YSQA 3FXDB 3TQ7P 4G63A 1VQNT 1VQKQ 1WRDA 1YKHB 1NE8A 4X5TA 1M1KC 3AE9A 4ATOA 3JCMV 4LF7T 4I50E 3L09A 1D3BA 4AKRB 4EYYR 1QKWA 1UEBA 1FIOA 2EJFA 3OYKA 1D1AA 4ME7A 2XSAA 1OEBA 2AHJB 2KWIB 1UGSB 2EYZA 4Z8AA 5LJ5g 2BZYA 2K5LA 2MI6A 3VU7H 4UELA 2DIGA 1BI2A 3LK3B 3HKSA 3CC2A 3L2VA 1HSQA 5L4EA 2V7IA 2HL5C 4P1NA 2CWYA 1UX5A 3SRZA 5HCJA 1QKXA 2DL7A 2FZGB 4Q5WA 2MCNA 1TOVA 4EMKC 4QW2A 2CKKA 2OLTA 2QQ9A 3RX6A 2DK3A 4XTZA 2RK1A 3FZMB 4JI2T 1R8IA 1M8MA 4X20E 2E5VA 3CQTA 1NLOC 1SHFA 2LSYA 3C4ZA 4GOUA 4LD9K 1BK2A 2V6YB 2Q9QA 1XOVA 3I5RA 3M0TA 4Z90A 4L59A 3N5LA 2RPAA 5FP3A 2M6IA 4P09A 2IG0A 5LGUB 1E7OA 4QWNB 2QQBA 1VQMQ 3URGA 2XQ3A 2HHHT 3S3NA 3AEEA 3QYGB 4D6WA 1Q7YC 2EWNA 2M0OA 1AT1B 1XNIA 1C0MA 4IUQA 1VQ4A 3CMEQ 1HG5A 4A53A 1X6OA 1GQEA 2V8IA 5JDQA 4LMLA 5FWBA 2PNIA 4LNPA 3WVDB 4BY6C 3RF1A 2BG9A 2VB6A 2LOPA 1M9SA 3LJCA 1YNZA 2IVWA 2OJ2A 3GOXA 4QXHB 1H8KA 3AE3A 3SS1A
chains in the Genus database with same CATH topology
3C98B 2EGEA 4MFRA 3LK2B 1OV3A 4RTYA 5HCKA 3QC9A 2GQIA 4RTTA 1BB9A 2V7JA 4QXCB 1YW0A 2Q9QD 1UJ0A 1ZEEA 5FY0A 1GCQC 4D8DA 2C5JA 1K0XA 1ZHCA 2KRSA 3UA7A 3CQGB 1JU5C 2BZBA 3EVYA 2DWKA 1AJ3A 3S4UA 3NZPA 3FBZA 1GCPA 2ENMA 5JR9B 5JR9A 1FMKA 3E0ZA 4AG2C 2F2VA 2LJ3A 2XTLA 2NWMA 3A5XA 5CA0E 4KP3C 2DBMA 1MV0B 1Z9ZA 4Z88A 3F31A 3HKCE 2FRWA 3PE0A 2GTJA 2B1EA 4UXNB 3O9XA 3AVRA 3BQLA 3ZPOA 2NWBA 3HKEE 1TUDA 2KRMA 2X51A 4BJNA 3H37A 2V7MA 3M0RA 2EHOA 1FYNA 1WIEA 3BK9A 1VYUA 4AXPA 4AG1C 3I9YA 2ACXA 4AKGA 4HGAA 4AFZC 3PUAA 4ESRA 1KIKA 1O3XA 3ONXA 1JXOA 2BDEA 2RMOA 1MNEA 1EFNA 2W61A 3KVAA 1MIVA 1E6HA 2CCQA 4PJNA 2V1QA 3IQLA 2RA1A 2V7KA 2EYXA 2LSJA 4I55E 5DQVA 4CZZB 1ZUKA 2L2PA 3H0IA 4RTWA 5FXZA 3HR0A 4O4LE 4H9SE 2PJQA 3M65A 5LCYA 3KFVA 4IIOA 4OMLA 3RRCA 4JUYA 1KNZA 3LFMA 2LZ6B 2DILA 3ESLA 2VL8A 2D2SA 4A56A 3ZMUB 4JPBW 2KMFA 2VKOA 2JM8A 3VS7A 4WW0A 1PWTA 4C91A 5JVDE 1W1FA 5LNKA 3P7IA 2PG8A 1TUCA 5FXXA 4ANJA 4HVUA 3TKLB 2DYBA 2JXBA 1ZUYA 3TVTA 2MYSA 2F2WA 4CI1B 2X67A 2CT4A 2H7VC 4HN9A 4CI3B 1KFZA 1KJWA 1B07A 4L9IA 2NP9A 3K8PC 4LN2A 4HKAA 2BZ8A 2KROA 4L0RA 3UUXB 2FG0A 2LHRA 2XHEB 4EXTA 3WI3A 3C4WA 3O5ZA 2LMJA 4XAXB 3GN5B 2RQRA 4H9PC 1U3OA 5EK4A 3ZMVB 2DHRA 2VWFA 1WFWA 5KX5E 1CSKA 2C0IA 2CE7A 2YU1A 1BR1A 1HFAA 3H3AA 3K3OA 4PFOA 1ABOA 2GBQA 4J2CA 2O2OA 3FJ5A 1EZ3A 1NEBA 2EW3A 3ETVA 2PTKA 4ZI3D 2Q9QB 3JC6C 2YT6A 3ZN0B 3EG2A 5L23A 1E1HB 4FI5A 3PUGA 3I0QA 2FEIA 1T0HA 4MHCA 2DM1A 1WR6A 3OJAA 3RNJA 3PDYA 4JJBA 4MLKA 2JS2A 2P4RA 4JJDA 3REAB 4DMWA 2KLQA 2JMAA 2LNHB 2RQWA 3VS3A 4A63B 1AWXA 4RUGA 2HDAA 3OBVE 5LBMA 3EUHA 2W0GA 4ERRA 1YWPA 2O31A 5ETWA 4JLEA 4QXBB 1H7CA 2MOZA 4IIMA 4F17A 4HEAA 3EG3A 3OYZA 3PU3A 4H9OC 1X6GA 3NRYA 1ZX6A 2X68A 4O4IE 3OKQA 3N9QA 5L3BB 1SSHA 4UV8B 1HF8A 1ZUUA 5IH2A 1YN8A 3U3IA 5L3DB 2CREA 1M30A 2ROTA 4F14A 2DLRA 4OMPA 2CDTA 4OFZA 4HCKA 2EYWA 5CA1E 4DMVA 1H3HA 3EDVA 2SPCA 4PAGA 2CT3A 2EVRA 4ZI3C 2K3BA 3I9QA 2AZVA 1HD3A 4JZ4A 3RBBB 5LHIB 4ZOLE 2LM9A 4EYUA 1UHCA 2AKKA 4E6RA 2EHOC 4OK0A 2YEVC 4KUMB 4UIGA 3D0TA 4IE0A 3I9WA 4AKHA 3A98A 5EK3A 4AKLA 4EOZB 2UXNB 3BQKA 5ADXL 1YKEB 2C5KT 1K9AA 2L3LA 3C50A 3CQCB 3ULRB 1VA7A 4DVDA 1D1CA 2X9XA 1B3QA 3F57A 2LSKA 2L0AA 5FNVE 1NM7A 1LRZA 4DBRA 3LBXA 2L3PA 4AI6A 2OA5A 4WBOA 1WA7A 2YK0A 2CUBA 1CKBA 1NYFA 2BZXA 5IYZE 2JW4A 3RC3A 4HVVA 3Q9DA 3KFWX 1SPKA 1U5SA 3DJBA 1GCQA 2VKDA 4PW8A 4TN7B 4PJJA 1JEGA 1WI7A 1RI9A 5L3CB 3I0OA 4IE7A 4BJMA 4AKIA 5HXEA 1OOTA 3EG0A 5LOVE 1D1BA 5F8PA 4I43B 2NOXA 1Y0MA 4J9FA 4AFSC 4HXJA 3F2EA 3MACA 3QUJA 5H6RB 3NHNA 2DL5A 4OMMA 5JRCA 2WM9A 1U5PA 5LP6E 1IJ6A 3GBQA 1AOJA 3K3NA 1MMDA 1K4US 2KINB 3O1IA 2CLYB 1M3CA 1UG1A 2C5IT 2CH4A 4OMQA 2VKNA 5M4YA 3UT5E 4G2AA 4E7SA 4QX7B 4YJ2E 2D8JA 1K0SA 1Y57A 2K5BB 4ZI2D 2CSQA 4J9GA 1SRMA 2ZLYA 2ODVA 2DVJA 1AWOA 2CA5A 3UUNA 3UTKA 5C8YE 2WBLA 2L9QA 1QWEA 3B13A 4O8SA 2RPNA 2HPLA 4CC2A 1FEWA 3VS0A 1D0YA 1V9DA 1X43A 2WSSV 1AZEA 5JQGE 2W00A 4F6RC 3T8OA 5IHNA 4UVCB 2K9AA 3CVRA 4I4TE 4ISTA 4O4HE 4ASKA 3VS2A 2J05A 5FXVA 2HBWA 1UJYA 1MIWA 2CXFA 4JEUB 1FMWA 4QT7A 1E6GA 3UF4A 5JRCB 4GYRA 4NUUA 5GONE 5J2UE 4YJ3E 2ED1A 3M0QA 1ZSGA 4WCIA 4D8KA 1GFDA 4CXXA 2N1GA 2X9WA 3O1HA 2LSIA 2X0LB 2AZSA 2QGSA 1Z0PA 4PK6A 5FWCA 3VS1A 2RQUA 2OAWA 3BQIA 2BVLA 1YD8G 4M1PA 4IDZA 1ARKA 3C51A 2Z6EA 3C64A 3AVSA 1M3BA 2EHOD 2VKHA 3PVLA 3TSWA 2K24A 2DL3A 2CMRA 2J6FA 4X1VA 5DQWA 2BVMA 2A28A 2L3SA 1MIYA 1US7B 4EAHA 3LH5A 3ZMSB 5JH7E 4RTZA 4DEYA 3CX6B 3KV4A 1B7TA 3PURA 4MALA 4WBNE 2NW9A 4JZ3A 3CKDA 5GJVB 4MBQA 2MBGA 3M0SA 2D0TA 3RYFE 5JDGA 4TUYE 2E9XC 2NUZA 3GA8A 3UULA 4DNDA 5LHHB 5JREA 1U06A 3O1JA 4J9EA 2K48A 2K9GA 4O2BE 3EG1A 1H92A 3FHNA 4QKNA 2XUEA 1KK7A 4DBQA 4EZHA 1MMGA 1GRIA 4HTEA 3P8CD 5LJNA 3EHRA 4NUVA 5EK2A 3ZCJA 1ABQA 5HXCA 1PHTA 3KDSE 3VS5A 1UCUA 2ZM2A 3KVBA 4J9IA 3PUSA 1AEYA 4E7ZA 5H6QB 1I1JA 2SRCA 2DI4A 2HH7A 2C0SA 1T3LA 2FPDA 4EZ4A 5LG4A 2DBKA 4PJLA 5KDMC 2LJLA 2N9DA 2ZM0A 1X2KA 2E9XA 5IXFA 4Z89A 1PNJA 2W63A 4UF0A 5HWXA 1WYXA 4UF0B 2GTOA 2M0YA 2K79A 4LUEA 4M4ZA 3VRZA 1GL5A 2ODUA 1RLPC 2XMFA 3IHRA 4K11A 4RTVA 2X9YA 3H0FA 2K7AA 4AFUC 1HG2A 2LCSA 3KV6A 3N2KE 1HCIA 3VRYA 3QWYA 1HJDA 5LHGB 4OYJA 2D8HA 2E8IA 3ZJ1A 3IEEA 5JDFA 5CB4E 3J9X1 4LE9A 4KBMB 5FXWA 5JR9C 2CH4W 5I11A 4N78D 2XAJB 3ZYLA 1X2QA 2DNUA 1NYGA 1A0NB 1N5ZA 5IHYA 5F3JA 3DP7A 2JMCA 2YINA 2K6DA 4Y92A 3UA6A 4AQGA 2A72A 3KBUA 2IC9A 1QCFA 2LHNA 4IIJE 4IE5A 4UV9B 5FY7A 2LOSA 2B86A 2FRYA 2M51A 1NEGA 2HEQA 3GMIA 3CPZA 3AB3B 4JEHB 1VRBA 4BA9A 3MA9A 2KRNA 3MK7C 4HVWA 2VASA 3L3PA 2QDLA 4AQFC 1UDLA 1BR4A 1SHZC 3LG7A 2DL8A 3C0CA 1UE9A 1I0CA 1SRLA 2VWAA 2WMOA 2IW5B 1QSDA 3NRXA 5DABA 1FMVA 3WAKA 1WLPB 1X27A 1QWFA 2RF0A 4P0BA 3ZMZB 2AK5A 3MZKB 3GWHA 1T3SA 5LGTB 2JS0A 3HKDE 1VYTA 2ABLA 3M0PA 2X66A 4J9HA 4KMCA 2BTTA 3CMLA 3ETUA 2ESWA 3AA7B 3KINB 2YUNA 3ZYKA 2KT8A 2OI3A 2YU2A 4JJCA 3HA4A 1ZKEA 1UHFA 2DX1A 3ANWA 2MOXA 2E9XD 2GGRA 2EPDA 4X1IE 2RN8A 4CC7A 5FY1A 2GNCA 4AQFA 2J6OA 3NZQA 1AZGB 2XAGB 2DE0X 3QWXX 2ES0A 3Q5XA 2QA7A 1T0JA 4GBQA 2JM9A 1WXUA 3LK42 3ZC1A 1SA0E 4J9DA 1UGVA 3QK6A 4O4JE 5HWYA 2MIOA 1OWAA 3IF8B 3SHWA 2WWUA 5IXBA 1W70A 1X6BA 2O9SA 4CI2B 2D0UA 2KNDA 2DNXA 4ZI7E 2A08A 3FBLA 3MXZA 1LVKA 3UFEA 2KYMA 3THKA 2NTXA 5I22A 3CQXC 3N2OA 4GIWA 1RLQC 4X1KE 1LCKA 2H8HA 3H41A 4OMOA 2KXPB 2XQYA 4H9QC 3ZL7C 3FB2A 4ZNXA 4CC4B 2Q9QC 1OPKA 2C0TA 2C0OA 5KMGP 3N2GE 5J2TE 2KNBB 2LJ1A 2LQNA 1ZV4X 2DWGA 4OHFA 2EGCA 2F2XA 2DA9A 2KR3A 3EHQA 4AFQC 4O2AE 2JJ9A 4CXYA 1BR0A 1TG0A 2X3WD 4TX5A 1WDXA 2KBTA 4YHJA 2LEHA 2X9HA 3AAAB 1RUWA 2XAQB 2X3XD 2DF6A 1OXZA 2N2NA 3AA0B 3WAJA 2A2FX 3CX8B 4PFPA 4YLHA 3RYIE 4DO0A 1BR2A 2J06A 2LJ0A 1WXBA 2ECZA 2KT1A 1GBQA 2DCFA 2IIMA 4ORZA 2YUQA 4EIKA 3N9MA 1MUZA 4FSSA 3N9NA 2CXLA 5HXSA 1JXMA 3ZC0A 5LJMA 2DMOA 2G0UA 4OMNA 1M3AA 1M27C 3M0UA 1T98A 1IJ5A 2CXDA 4H63V 3KV9A 4EIWA 3HKBE 4PK4A 1YCSB 4Z8XA 1HTJF 2YDLA 4TV8E 1IAPA 5TAOA 2FPFA 1WX6A 1AWJA 3I1AA 5HXHA 2O88A 1D0XA 1QUUA 2D1XA 1K76A 3TSZA 3AAEB 3GN5A 1IO6A 3ZJ2A 5LYJE 2LT3A 4V1Av 5A1LA 1VYVA 3SOLA 1AVZC 2VVKA 1S1NA 2DJQA 2FO0A 2EQIA 4ZHQE 3Q5WA 1G2BA 2NW8A 2KEAA 3NGPA 5LBQB 3U23A 3RYCE 2KWHA 2J6KA 3E08A 5L2LA 5E0OA 1CKAA 2M67A 3I35A 2KYBA 3MKDA 1U4QA 4CC3A 1Y64B 2PBIA 2GK9A 3SEMA 2DLPA 2EBPA 2E9XB 2LX7A 4GLMA 2J7IA 2LE8A 1UFFA 4QHOA 2KT9A 5FW9A 5IHKA 3NPFA 1MV3A 2EYYA 1LVFA 2LP5A 2RNAA 2K2MA 2L3QA 4J9CA 4F16A 2EGAA 5ECAA 2WAUA 1S94A 4WNKA 4L5GA 3KBTA 3SS1A 4ZI2C 3PU8A 1PRLC 1WXTA 2KGTA 2W0ZA 2KXDA 1SEMA 1PKSA 3ZN1B 5GJWB 1NWMX 4PNIA 3R6NA 4EB6E 1AWWA 2EHOB 3RKOA 4RTUA 2NW7A 5L3EB 2EKHA 4KRTA 2DL4A 3C4XA 3RC8A 2H7OA 3N9PA 1NLPC 4TZ4C 3RPUA 5BMVE 1SHGA 2CUDA 4R0KA 2Y8DA 2DRMA 1MNDA 2L8KA 3OYXA 4BAYB 5L3GB 1BU1A 2ED0A 5J1GA 3ANWB 3JC6D 2NTYA 3R84B 2RQTA 2JQQA 4RTXA 2HSPA 4C90A 2YUPA 1AD5A 3N9OA 4ZS2A 2HPJA 2CM0A 3ZEFB 5JDMA 2RQVA 1J3TA 2A3DA 1JO8A 3CX7B 2ZM8A 3EDUA 2J1DG 1KSWA 4ZS3A 2VKJA 2ROLA 4LUDA 2A36A 4HE8A 2I59A 3VHLA 3AA6B 3W15B 2V1DB 1W6XA 2O9VA 1S35A 1ZLMA 3PTRB 2MTQA 1LKXA 2RP4A 4H63H 3RYHE 3U78A 1JQQA 3FXDB 3FXEB 4FJOA 2IC6A 1UTIA 2FPEA 2YSQA 3ZYMA 3I5SA 5LXTE 4G63A 4HFVA 3VKGA 3HL6A 1UECA 4J9BA 1WRDA 1YKHB 4IE4A 4U72A 5JDNA 2CSIA 2KE9A 3O4XE 2PZ1A 2I0NA 1G8XA 1CUNA 4I50E 2CLYC 3L09A 2V7LA 2Y6XA 2UXXB 3HI2A 4PJMA 3RH3A 3SWHA 4AKRB 1FIOA 4GK5E 4EYYR 1D1AA 1QKWA 4OYKA 3CWZB 1OEBA 3V5SA 3REBB 1ZBJA 2KWIB 2XAFB 5HAXA 5L3FB 1VOMA 2EYZA 2BZYA 4Z8AA 4UVBB 5LGNB 3J7Yq 1UX4A 3B57A 2P9BA 4UELA 4ILUA 3VU7H 1QLYA 3PVQA 2A37A 3UATA 4IGUA 3LK3B 4U74A 2JRKA 3MJXA 1BBZA 1HS7A 4TV9E 5DJQC 1HSQA 2V7IA 3DTOA 3ZLIA 2D0NA 2CWOA 2CWYA 1UX5A 3SRZA 1QKXA 1V1CA 2DL7A 2KXCA 4K0UA 2ZMAA 1I07A 2MCNA 3AAIA 1OPLA 2IAKA 5FYMA 5JDLA 3KV5A 3Q2MA 3AA1B 3RX6A 1X69A 4XZCA 3EGUA 1MMNA 2VK9A 1G73A 3UUMA 1M8MA 4X20E 3CQTA 1NLOC 1GBRA 1NAFA 1SHFA 5JDHA 2LSYA 3C4ZA 1NG2A 4GOUA 2KZ7B 1BK2A 2XASB 2Q9QA 1X79A 3ZCIA 3NBXX 4ADZA 1XOVA 2SEMA 3I5RA 3M0TA 1PRMC 4IHJE 4GK0E 4X1YE 2YUOA 1HX8A 3N5LA 2W62A 5FP3A 4P09A 2Y48B 4UVAB 5LGUB 4DEXA 4ISSA 4CQIA 1E7OA 4QWNB 3E22E 3VS4A 2AKLA 2JMKA 4IE6A 3N9LA 4PK5A 1K1ZA 2HCKA 5EZYE 3RRWA 2WMNA 1G83A 5HXRA 4UEMA 3NMZC 1MMAA 2G6FX 4GYSA 3V5UA 2V26A 2H3RA 3K3QC 3VS6A 2JT4A 3PUQA 2E5KA 3LBXB 2D5UA 3IBPA 4P0AA 1PKTA 1Z9QA 5LA6E 3ZMTB 2LQWA 4B6XA 1IZNB 1HG5A 3H0HA 4QX8B 1WYBA 2W10A 5JDQA 2JMHA 4CXWA 2PNIA 3JV3A 4LNPA 2V1RA 2XAHB 5FWBA 2VB6A 5EC7A 2DRKA 5FMNA 2LOPA 3VKHA 3LJCA 1YNZA 5HYAA 1WYCA 2LSGA 4H9RC 1YWOA 1WLXA 2CEAA 2JTEA 2OJ2A 5IHIA 2PFVA 4QXHB 1GFCA 1H8KA 2JPFA 4H9NC 1YP5A 1D0ZA 5AFUL 1UUEA 4XBFB 4YFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGE A;  1OV3 A;  4RTY A;  5HCK A;  2GQI A;  4RTT A;  1BB9 A;  1UJ0 A;  1GCQ C;  1K0X A;  4D8D A;  2KRS A;  3UA7 A;  1JU5 C;  1GCP A;  2ENM A;  1FMK A;  2F2V A;  2LJ3 A;  2NWM A;  2DBM A;  1MV0 B;  1Z9Z A;  4Z88 A;  2FRW A;  3PE0 A;  2GTJ A;  3UF4 A;  1TUD A;  4AG2 C;  2YUQ A;  2KRM A;  3M0R A;  1FYN A;  1WIE A;  1VYU A;  4AFZ C;  1KIK A;  4ESR A;  1JXO A;  2RMO A;  1EFN A;  2V1Q A;  1E6H A;  3IQL A;  2EYX A;  1ZUK A;  2L2P A;  3H0I A;  4RTW A;  4OML A;  4IIO A;  3KFV A;  2LZ6 B;  2DIL A;  4JPB W;  2JM8 A;  3VS7 A;  1PWT A;  1W1F A;  1TUC A;  4HVU A;  3TVT A;  2DYB A;  2JXB A;  2F2W A;  2CT4 A;  1KJW A;  1B07 A;  4LN2 A;  2BZ8 A;  2KRO A;  2FG0 A;  3O5Z A;  2LMJ A;  2RQR A;  1U3O A;  2VWF A;  1WFW A;  1CSK A;  2C0I A;  1ABO A;  2O2O A;  2GBQ A;  1KFZ A;  3FJ5 A;  2PTK A;  1NEB A;  2EW3 A;  2YT6 A;  5L23 A;  3EG2 A;  2FEI A;  1T0H A;  2DM1 A;  3RNJ A;  3PDY A;  4JJB A;  2P4R A;  2JS2 A;  4JJD A;  3REA B;  2JMA A;  2LNH B;  2RQW A;  3VS3 A;  1AWX A;  4RUG A;  2HDA A;  1YWP A;  2O31 A;  4IIM A;  4F17 A;  3EG3 A;  1X6G A;  1ZX6 A;  1SSH A;  1ZUU A;  5IH2 A;  1YN8 A;  2CRE A;  1M30 A;  2ROT A;  4F14 A;  4OMP A;  2CDT A;  4HCK A;  2EYW A;  1H3H A;  3EDV A;  2CT3 A;  2EVR A;  3I9Q A;  2K3B A;  2AZV A;  1HD3 A;  4JZ4 A;  3RBB B;  4E6R A;  1UHC A;  2AKK A;  3A98 A;  1K9A A;  3ULR B;  1VA7 A;  1B3Q A;  3F57 A;  2L0A A;  1NM7 A;  2L3P A;  2CUB A;  1WA7 A;  1CKB A;  1NYF A;  2BZX A;  2JW4 A;  4HVV A;  1SPK A;  1U5S A;  1GCQ A;  1JEG A;  1WI7 A;  1RI9 A;  3EG0 A;  1OOT A;  1Y0M A;  4J9F A;  4AFS C;  4HXJ A;  3NHN A;  2DL5 A;  4OMM A;  3GBQ A;  1AOJ A;  1UG1 A;  1M3C A;  2CH4 A;  4OMQ A;  2VKN A;  2D8J A;  1Y57 A;  2CSQ A;  4J9G A;  1SRM A;  1AWO A;  2DVJ A;  1QWE A;  2RPN A;  4CC2 A;  3VS0 A;  1X43 A;  1AZE A;  5IHN A;  3VS2 A;  2J05 A;  2HBW A;  1UJY A;  4QT7 A;  1E6G A;  4D8K A;  2ED1 A;  3M0Q A;  1ZSG A;  4WCI A;  1GFD A;  2AZS A;  5FWC A;  3VS1 A;  2RQU A;  2OAW A;  1M3B A;  3PVL A;  3TSW A;  2DL3 A;  4X1V A;  2J6F A;  2L3S A;  2A28 A;  3LH5 A;  4DEY A;  4JZ3 A;  5GJV B;  3M0S A;  2NUZ A;  4A63 B;  4K11 A;  1U06 A;  4J9E A;  2K9G A;  3EG1 A;  1H92 A;  1GRI A;  3EHR A;  1ABQ A;  1PHT A;  3VS5 A;  4J9I A;  1AEY A;  1I1J A;  2SRC A;  1T3L A;  2FPD A;  2DBK A;  5IXF A;  1X2K A;  4Z89 A;  1PNJ A;  2M0Y A;  1WYX A;  2GTO A;  4M4Z A;  3VRZ A;  2K79 A;  4LUE A;  1GL5 A;  1RLP C;  2XMF A;  4RTV A;  3H0F A;  2K7A A;  4AFU C;  2LCS A;  3VRY A;  3QWY A;  1HJD A;  2D8H A;  4LE9 A;  5I11 A;  2CH4 W;  1X2Q A;  2DNU A;  1NYG A;  1A0N B;  1N5Z A;  2JMC A;  3UA6 A;  4Y92 A;  2K6D A;  3KBU A;  1QCF A;  3REB B;  2M51 A;  2B86 A;  2FRY A;  1NEG A;  2HEQ A;  2KRN A;  4HVW A;  2QDL A;  1UDL A;  2DL8 A;  3C0C A;  1UE9 A;  1I0C A;  1SRL A;  1X27 A;  1WLP B;  2O88 A;  1QWF A;  2RF0 A;  2AK5 A;  1T3S A;  2JS0 A;  1VYT A;  2ABL A;  3M0P A;  4J9H A;  2BTT A;  2ESW A;  2YUN A;  2KT8 A;  2OI3 A;  4JJC A;  1UHF A;  2DX1 A;  2MOX A;  2GGR A;  2RN8 A;  2EPD A;  4CC7 A;  2GNC A;  2J6O A;  1AZG B;  3QWX X;  2DE0 X;  1T0J A;  4GBQ A;  2JM9 A;  1WXU A;  4J9D A;  1UGV A;  3SHW A;  2MIO A;  5IXB A;  1W70 A;  1X6B A;  2O9S A;  2A08 A;  5I22 A;  2KYM A;  3THK A;  1RLQ C;  1LCK A;  2H8H A;  3H41 A;  4OMO A;  3ZL7 C;  4ZNX A;  4CC4 B;  1OPK A;  2C0T A;  2C0O A;  2KNB B;  2LJ1 A;  2LQN A;  2EGC A;  2KR3 A;  2F2X A;  2DA9 A;  3EHQ A;  4AFQ C;  1TG0 A;  2X3W D;  1WDX A;  2KBT A;  1RUW A;  2X3X D;  2DF6 A;  2LJ0 A;  2J06 A;  1WXB A;  2ECZ A;  2KT1 A;  1GBQ A;  4ORZ A;  2IIM A;  4EIK A;  1K0S A;  4FSS A;  1MUZ A;  1JXM A;  4OMN A;  2DMO A;  1M3A A;  1M27 C;  3M0U A;  1YCS B;  1ZUY A;  2YDL A;  2FPF A;  1WX6 A;  1AWJ A;  2D1X A;  3TSZ A;  1K76 A;  4F16 A;  1IO6 A;  1VYV A;  1AVZ C;  2VVK A;  1S1N A;  2DJQ A;  2FO0 A;  2EQI A;  1G2B A;  3NGP A;  2KEA A;  3U23 A;  2J6K A;  1CKA A;  3I35 A;  2KYB A;  4CC3 A;  3SEM A;  2DLP A;  2EBP A;  2LX7 A;  4GLM A;  5IHK A;  2J7I A;  1UFF A;  5FW9 A;  3NPF A;  1MV3 A;  2EYY A;  4J9C A;  2LP5 A;  2RNA A;  2K2M A;  2L3Q A;  2EGA A;  5ECA A;  1WXT A;  1PRL C;  2KGT A;  3KBT A;  4AG1 C;  2W0Z A;  2KXD A;  1SEM A;  1PKS A;  5GJW B;  3R6N A;  1AWW A;  4RTU A;  2EKH A;  4KRT A;  2DL4 A;  1NLP C;  1SHG A;  2CUD A;  4R0K A;  2DRM A;  1BU1 A;  2ED0 A;  5J1G A;  2RQT A;  4RTX A;  2HSP A;  2YUP A;  1AD5 A;  1J3T A;  1K4U S;  2RQV A;  3H0H A;  1JO8 A;  1KSW A;  3EDU A;  2ROL A;  4LUD A;  2A36 A;  1W6X A;  2O9V A;  1ZLM A;  4RTZ A;  1JQQ A;  2FPE A;  2YSQ A;  1ARK A;  1UTI A;  3I5S A;  4J9B A;  1UEC A;  2KE9 A;  2CSI A;  2PZ1 A;  2I0N A;  1G8X A;  1QKW A;  1OEB A;  1ZBJ A;  2EYZ A;  4Z8A A;  2BZY A;  1QLY A;  3PVQ A;  2A37 A;  3UAT A;  1BBZ A;  1HSQ A;  2D0N A;  1V1C A;  2DL7 A;  1QKX A;  2KXC A;  1I07 A;  2MCN A;  1OPL A;  2IAK A;  1X69 A;  3EGU A;  1M8M A;  3CQT A;  1NLO C;  1GBR A;  1SHF A;  1NG2 A;  1BK2 A;  1XOV A;  3I5R A;  2SEM A;  3M0T A;  1PRM C;  2YUO A;  4DEX A;  1E7O A;  3VS4 A;  2AKL A;  1K1Z A;  2HCK A;  1G83 A;  3NMZ C;  2G6F X;  3VS6 A;  2JT4 A;  2E5K A;  1PKT A;  1Z9Q A;  2LQW A;  2W10 A;  5FWB A;  2PNI A;  3JV3 A;  4LNP A;  2V1R A;  5EC7 A;  2DRK A;  1YNZ A;  1YWO A;  2OJ2 A;  2JTE A;  5IHI A;  1GFC A;  1H8K A;  1YP5 A;  1UUE A; 
#chains in the Genus database with same CATH topology
 3SWN A;  2HMA A;  2EGE A;  1KQS P;  4RTY A;  3G4S Q;  1QQJ A;  1VQO Q;  1K73 R;  1BB9 A;  3OB9 A;  2V7J A;  2V6X A;  5FY0 A;  1GCQ C;  4BE0 A;  3QZ9 B;  1IHW A;  1ZHC A;  1KF6 A;  3UA7 A;  4F7U G;  1YI2 A;  4M78 D;  3FZL B;  2DD4 A;  4LMK A;  1GCP A;  2KDS A;  2D0Q B;  3G71 Q;  1TWB A;  2K57 A;  3EFO B;  3A8H B;  4Z88 A;  4XTV A;  3UF4 A;  2GTJ A;  2B1E A;  1G3S A;  1TUD A;  3AVR A;  1R77 A;  2FJE A;  2KRM A;  3CCM Q;  2X51 A;  3M0R A;  4U3C A;  1U1T A;  4XTW A;  4AXP A;  1W2B P;  1JXO A;  2E70 A;  2BDE A;  1MNE A;  1EFN A;  2V1Q A;  1E6H A;  3TLV A;  2CCQ A;  3IQL A;  1Q82 C;  3RQU A;  4JJN K;  4OML A;  1QCO A;  3TU4 K;  4JI6 T;  2DIL A;  3PTA A;  2VL8 A;  1VQ5 A;  3ZMU B;  1BI0 A;  2VKO A;  2JM8 A;  2YXY A;  3VS7 A;  1K8A U;  4C91 A;  2ATC B;  4EEB A;  3P7I A;  3EGX A;  5FXX A;  5CR2 A;  3TVT A;  2DYB A;  4KHP T;  4CI1 B;  2X67 A;  3OVU A;  4CI3 B;  1NZ9 A;  4XU3 A;  5D6Y A;  1S72 Q;  4MZP A;  2XDB A;  4HKA A;  2BZ8 A;  1IXD A;  4L0R A;  4X9C A;  2FG0 A;  1VQ5 T;  2WU5 A;  2KY9 A;  2JNG A;  2GFU A;  2LMJ A;  4NXN T;  1PM3 A;  1U3O A;  1SUM B;  1YXR A;  2DHR A;  1CSK A;  2C0I A;  2OX7 A;  4JRQ A;  1BR1 A;  3H3A A;  1KFZ A;  4PFO A;  3CCL T;  2PTK A;  1KNR A;  5LJ5 d;  3TEE A;  3GP8 A;  1Q7Y U;  1V29 B;  2FBW A;  1YJN Q;  2DXU A;  2FEI A;  2QI2 A;  2XKO C;  5GMK e;  4E7K A;  4JI5 T;  1WR6 A;  4R55 A;  4RG2 A;  4MLK A;  1X75 C;  2JS2 A;  4RKU E;  2PVO B;  4RUG A;  1K8A R;  1RAG B;  1UGP B;  3OBV E;  3GLX A;  5IN1 A;  5FU6 B;  5LBM A;  2EQU A;  3L2U A;  4ERR A;  1YWP A;  2C06 A;  5ETW A;  1IBL T;  2E6Z A;  4IIM A;  3EG3 A;  3OYZ A;  3PU3 A;  4LFB T;  1DU2 A;  2X68 A;  3OKQ A;  4TWD A;  3VRA A;  5L3B B;  1ZUU A;  3FEO A;  1BCM A;  1M30 A;  2ROT A;  2DLR A;  4HCK A;  3JAE A;  5CA1 E;  3JB9 G;  2SPC A;  3A8O B;  1UB4 A;  2AZV A;  4JZ4 A;  3RBB B;  1ZSZ B;  2K3X A;  4ZEY A;  2OTJ Q;  2LM9 A;  4EYU A;  1SF9 A;  3O8V A;  3GNG A;  2EHO C;  4C92 F;  1WHK A;  2YEV C;  1TU0 B;  4KUM B;  4UIG A;  4IE0 A;  5EK3 A;  3ZT7 A;  3BQK A;  1K9A A;  3MCA B;  2L3L A;  2M02 A;  4E7I A;  2VC8 A;  4M77 C;  1LRZ A;  4DBR A;  2CP7 A;  1H64 1;  4AI6 A;  4MDX A;  5KYW B;  2CUB A;  5C0M A;  1SG5 A;  4E7J A;  1BI1 A;  2BBH A;  2JW4 A;  5KYY B;  4M77 E;  4PW8 A;  4PJJ A;  4WZX A;  1TXQ A;  5GAO l;  4C8Q E;  4NL3 A;  1WI7 A;  3QXE B;  5L3C B;  1M62 A;  3EG0 A;  5KYU A;  4U33 A;  1Y0M A;  4YTM A;  3F2E A;  1R0C B;  3NHN A;  2VGM A;  2DL5 A;  5LMN T;  2HZY A;  4BI3 A;  3GBQ A;  2D9T A;  3M4Y A;  3NKZ A;  4DR6 T;  3PMI A;  2CH4 A;  5GAM e;  2VKN A;  3UT5 E;  2D8J A;  4ZI2 D;  2CSQ A;  2E12 A;  4J9G A;  1AWO A;  2ODV A;  1JNR A;  3UTK A;  2KI7 A;  2WBL A;  4YTL A;  2JN0 A;  4M78 F;  2RPN A;  3M56 A;  8ATC B;  4KI0 F;  2WSS V;  5JQG E;  3I56 A;  2A3L A;  4UVC B;  4WYV A;  4I4T E;  3E9G A;  4QH5 A;  1SE7 A;  5FXV A;  1VQ9 A;  1UJY A;  3JB9 J;  4E47 A;  4GYR A;  5GON E;  4BB7 A;  2ED1 A;  4JRK A;  3FC3 A;  4DR1 T;  3QDF A;  4C5E A;  3HFN A;  1XDO A;  4A97 A;  3VS1 A;  2BVL A;  4IDZ A;  3RKX A;  2JZ2 A;  2UU9 T;  3C64 A;  3AVS A;  2VKH A;  3LDQ B;  3UU5 A;  1I8F A;  4IRE A;  2CMR A;  2L3S A;  3E19 A;  3E9F A;  2PQW A;  1US7 B;  2IML A;  1Q7Y R;  3ZMS B;  4DEY A;  2COY A;  3JCM b;  5GJV B;  1YIT Q;  2E9X C;  3GA8 A;  4DND A;  3FZF B;  5JRE A;  1U06 A;  2EJ9 A;  2O4X A;  2K9G A;  2QA4 A;  3EG1 A;  2XUE A;  4DBQ A;  1MMG A;  4HTE A;  4BY6 B;  4NUV A;  1ABQ A;  5HXC A;  3KDS E;  4J9I A;  4FYY B;  3TLU A;  2SRC A;  3ME9 A;  3CC4 T;  3OW2 P;  1B34 A;  1VQM T;  2LX9 A;  4AQY T;  4HT8 A;  1PNJ A;  4UF0 A;  1KQS S;  1WYX A;  4RTV A;  3H0F A;  5DY9 A;  1HG2 A;  3A7M A;  1GXI E;  3JAF A;  5LJ3 h;  5LHG B;  5I11 A;  3ZYL A;  1NYG A;  2V6Y A;  2K4Y A;  5F3J A;  3UA6 A;  2E4H A;  4Y92 A;  2WSC E;  4XTX A;  1QCF A;  2LHN A;  2BS4 A;  4IIJ E;  3ER0 A;  4A4H A;  2FRY A;  3X20 B;  3GMI A;  2X35 A;  3CPZ A;  3AB3 B;  4C5G A;  3OYA A;  3MA9 A;  1EIF A;  2VAS A;  2QDL A;  1BR4 A;  4M78 C;  4J8O A;  3OYF A;  3CXC A;  1I0C A;  2XID A;  2WMO A;  3RIA A;  1QSD A;  3RI5 A;  2AK5 A;  3MZK B;  1T3S A;  3AEA A;  3L8R A;  4A4F A;  2M9U A;  4M75 C;  1VYT A;  2ABL A;  4J9H A;  2UUB T;  2BTT A;  3ETU A;  4EGW A;  3QZ5 B;  2KT8 A;  2YU2 A;  3I55 A;  2DX1 A;  3M58 A;  5LG3 A;  2GGR A;  2RN8 A;  4X1I E;  2GFA A;  4PLI A;  5FY1 A;  3NZQ A;  4GBQ A;  2MIO A;  1VQ6 A;  3G6E A;  3GF5 A;  3M54 A;  4N4I A;  3X26 B;  1X6B A;  2O9S A;  4JDS A;  4CI2 B;  4J7F A;  4ZI7 E;  1VQP T;  2A08 A;  1YHQ T;  3FBL A;  3MXZ A;  1Q82 U;  2KYM A;  2NTX A;  2HNI A;  2E5Q A;  2KXP B;  4K0K T;  3ZL7 C;  2WDQ A;  1Y07 A;  4AMC A;  2KNB B;  5KMG P;  3N2G E;  3AE8 A;  2LQN A;  1RAE B;  2DWG A;  2EGC A;  2KR3 A;  1HNW T;  2YRD A;  4CXY A;  2X3W D;  1BR0 A;  4AFQ C;  1WDX A;  2LEH A;  3QSU A;  3AA0 B;  4BI8 B;  3CBO A;  1Y71 A;  1BR2 A;  4ORZ A;  4EIK A;  1GBQ A;  2DCF A;  2F5T X;  3GPL A;  1W4S A;  5AQM B;  2YKS A;  2BE7 D;  1S72 T;  4ZN1 A;  4M7D C;  3ZC0 A;  5LJM A;  2DMO A;  2G0U A;  1C6V X;  4M7A E;  4H63 V;  4PK4 A;  2YDL A;  1IAP A;  5TAO A;  1WX6 A;  1D0X A;  2D1X A;  3TSZ A;  1K76 A;  2LT3 A;  1M1F A;  1AVZ C;  1KEY A;  1S1N A;  3BDU A;  2FO0 A;  2EQI A;  1ZSZ C;  2LT1 A;  2KEA A;  1KC8 R;  2WWV A;  2JIW A;  3RYC E;  1TSF A;  5L2L A;  4EMK A;  2BG9 E;  1Y64 B;  4B3R T;  2GK9 A;  4DA4 A;  2B76 A;  2EBP A;  2LX7 A;  2L3R A;  4C92 D;  3NPF A;  1MV3 A;  1OED C;  2YHT A;  2YN6 A;  2QXF A;  1KFY A;  3OBY A;  2CP2 A;  2WZH A;  1VQM A;  4WNK A;  1WXT A;  1W0B A;  4L5G A;  3KBT A;  5C3J A;  2W0Z A;  4BDZ A;  4EB6 E;  5GAO r;  2XDD A;  2EKH A;  3C4X A;  5FLX E;  1SHG A;  2Y4X A;  2XU8 A;  1Z8U A;  4E7H A;  3S6W A;  2L8K A;  5IT9 E;  4E2F B;  3MP6 A;  5GAN e;  5HK0 A;  2QA4 T;  4ZTF A;  1AD5 A;  4N4G A;  2HPJ A;  5JDM A;  1Y96 A;  2A3D A;  1JO8 A;  5AQL B;  2HKN A;  1VUB A;  2A36 A;  3CC7 A;  3RDV A;  5L4H A;  1W6X A;  3DB3 A;  2MTQ A;  4CRI A;  3RYH E;  3CCM A;  2DET A;  3CC7 Q;  3ZYM A;  3I5S A;  5LXT E;  5ABF A;  5JDN A;  2KVQ G;  2XZE A;  1VQ8 Q;  3OBW A;  5A0G A;  2QTX A;  2KSR A;  3RKW A;  1G8X A;  2CLY C;  2ZPF B;  3HI2 A;  2DPP B;  3RGL A;  1OYX A;  2DL1 A;  2XJ7 A;  5AQH B;  5LGN B;  1EZZ B;  3B57 A;  2P9B A;  1Y96 B;  4GLK A;  3PJA J;  1WJS A;  3MJX A;  3LSV A;  4IUU A;  3KXT A;  1HS7 A;  1OI1 A;  5DJQ C;  2D0N A;  5AQU B;  4NS5 A;  5GAO p;  3PNW C;  2DO3 A;  3M3Z B;  2KXC A;  3CCR T;  1XQH A;  5FYM A;  3JCM f;  3QNU A;  1YFN A;  4XZC A;  3EGU A;  2VK9 A;  3UUM A;  4F7U B;  2K3W A;  1VQ7 T;  4DV6 T;  4NXM T;  2XQ5 A;  5CO7 A;  5L8R E;  1GBR A;  2AT1 B;  5LMU T;  2F4V T;  1YJ9 T;  3CD6 T;  3NBX X;  2SEM A;  1RAC B;  4KUL A;  4IHJ E;  4GK0 E;  4X1Y E;  2L5Q A;  2YUO A;  4OB2 B;  2I2L A;  2W62 A;  4DV2 T;  4UVA B;  4ISS A;  2DTH A;  5C6S A;  3E22 E;  2JMK A;  3QYH B;  3LLR A;  2XDP A;  2WMN A;  2UUC T;  4A98 A;  1G83 A;  4B3S T;  3OYE A;  1VIF A;  4GYS A;  1N9S A;  3QDR B;  3VS6 A;  2CGH A;  5KE3 A;  3P8D A;  2E5K A;  3LBX B;  4ZGE B;  3IBP A;  2J62 A;  5LA6 E;  1WHJ A;  3ZMT B;  4B6X A;  1Y7X A;  2RH2 A;  4ZTJ A;  2P0Q A;  2LRQ A;  2ZPB B;  3JV3 A;  4JI7 T;  2IDO B;  5CAI A;  5FRM A;  3UUB A;  1WYC A;  2WP9 A;  1YIT T;  2XK0 A;  5IHI A;  2PFV A;  1GFC A;  5AQN B;  1Q81 R;  1D0Z A;  2CP3 A;  1UUE A;  4XBF B;  5FY7 A;  3C98 B;  4IL4 A;  3VYH B;  4MFR A;  3LK2 B;  5HCK A;  1JNZ A;  1XWM A;  3QC9 A;  4RTT A;  2CPT A;  5CVI A;  4QXC B;  1UJ0 A;  1YW0 A;  2PUK B;  2XPK A;  1K0X A;  4D8D A;  3AHU A;  3CQG B;  2BZB A;  2CBI A;  3EVY A;  3C4S A;  1M90 R;  1VCS A;  4M78 B;  3AEF A;  3FBZ A;  4JRP A;  5JR9 B;  1M1K U;  2WU2 A;  5JR9 A;  1K73 C;  1QP2 A;  2XTL A;  3A5X A;  3OQ5 A;  1WPY A;  4KP3 C;  3RIR A;  1MV0 B;  4ILB A;  1FWZ A;  3RMS A;  3PE0 A;  3EH2 A;  4AG2 C;  4UXN B;  3QII A;  3BQL A;  3ZPO A;  2YUQ A;  2CHO A;  3AE7 A;  3HKE E;  4IUP A;  2QRX A;  4BJN A;  3H3M A;  1XTD A;  4TWH A;  1WIE A;  3T1Y T;  3BK9 A;  1VYU A;  3I9Y A;  2ACX A;  3I56 Q;  4AFZ C;  4DID B;  1O3X A;  1Q81 U;  5LJ5 f;  1XNQ T;  4F04 B;  4I55 E;  5DQV A;  4CZZ B;  5HK3 A;  2BUD A;  4O4L E;  4H9S E;  3OS5 A;  4IIO A;  3RRC A;  4JUY A;  1J5E T;  2LZ6 B;  3FDR A;  2RI2 A;  2HKQ B;  4TVR A;  3VR8 A;  4RCB A;  1M90 U;  2OTL Q;  1PWT A;  4BD3 A;  5JVD E;  5LNK A;  4OB1 B;  3CD6 A;  4HVU A;  4COF A;  3TKL B;  2HQX A;  2JXB A;  4C92 G;  2YDQ A;  2H7V C;  2LKH A;  4XU2 A;  1KJW A;  3K8P C;  3E1S A;  2RD1 A;  2LHR A;  1WHM A;  3M53 A;  4XAX B;  3GN5 B;  4H9P C;  4QH4 A;  1WHH A;  3D7S B;  2JQK A;  3K3O A;  1HFA A;  3FJ5 A;  4B6M A;  4BUG A;  1LOJ A;  2EW3 A;  3J81 E;  4M7D B;  3ZN0 B;  2YDR A;  3PUG A;  2DM1 A;  4X65 T;  5CK9 A;  1VQP Q;  3PDY A;  1X01 A;  2P4R A;  5JTG A;  3V7S A;  1M2O A;  4DMW A;  2LNH B;  4FW2 A;  1M4Z A;  1W09 A;  4C92 B;  2HDA A;  5KYX B;  5GMK h;  2O31 A;  3CCS T;  3Q1J A;  4JLE A;  1H3Z A;  2QAZ A;  4H9O C;  1X6G A;  2EJG A;  1VQN A;  3P8B B;  3S3M A;  3BDL A;  1YI2 T;  4MZT A;  1D09 B;  1YQ3 A;  1SSH A;  2R5A A;  5IAY A;  4M75 F;  2P0K A;  3C95 A;  2EYW A;  2QK0 A;  3JCM d;  1VQL T;  2RHI A;  2VL0 A;  2EVR A;  2K3B A;  2VVN A;  1HD3 A;  5LHI B;  4ZOL E;  4E6R A;  1UHC A;  2AKK A;  1E7P A;  1YBY A;  1ZA2 B;  3A98 A;  2CP0 A;  1YHQ A;  3JCM h;  2J47 A;  3CC2 T;  4AKL A;  5KYX A;  1YKE B;  3ULR B;  4EMH A;  4DVD A;  2X0Y A;  2X9X A;  4FM4 B;  4C8Q C;  1N8R C;  3OYB A;  1YJ9 Q;  2E2A A;  4QVZ A;  2E41 A;  2BZX A;  1RAF B;  3LGL A;  1R8O B;  4HVV A;  3Q9D A;  2RJD A;  2VUB A;  4M7A G;  5FU7 C;  3K1S A;  4IUV A;  1K9M R;  3NWI A;  4IE7 A;  4AKI A;  1OOT A;  5LOV E;  4J9F A;  4AFS C;  3INZ A;  4ZN3 A;  1M8V A;  3A8M B;  2QGF B;  1WHL A;  4OMM A;  5JRC A;  2WM9 A;  1U5P A;  1IJ6 A;  3CCU A;  1IBM T;  5KE2 A;  1QVG S;  2CLY B;  4J6X A;  2C5I T;  1BKB A;  2X0H A;  5M4Y A;  4E7S A;  4G2A A;  4YJ2 E;  4Y28 E;  1HK9 A;  2PVG B;  3IA3 A;  5CIU A;  2ZLY A;  5FRO A;  1VIE A;  4GY5 A;  4RMO A;  4M7D E;  1B34 B;  5KYN A;  4O6J A;  5D6X A;  2HPL A;  1FEW A;  3VS0 A;  1I81 A;  1D0Y A;  1V9D A;  1QVF P;  2LTO A;  3UQ4 A;  3P4W A;  2QTV A;  3MHX A;  5GAM j;  2PUO B;  5HY6 A;  1AZE A;  2CHN A;  5D7U A;  1RAD B;  3SB2 A;  4IST A;  2CP5 A;  2W67 A;  3UQ7 A;  2HBW A;  4JEU B;  2NUP B;  3EG9 B;  4YT0 A;  2DFU A;  5GAO m;  1ZSG A;  4WCI A;  2N1G A;  4DR4 T;  3CBM A;  2LSI A;  1YCY A;  3OYI A;  2F5K A;  2XD0 A;  4PK6 A;  5FWC A;  3AE6 A;  1RAH B;  4FT4 A;  1OED E;  3PUZ F;  1YD8 G;  1M3B A;  3PVL A;  2WSF E;  2EHO D;  2COZ A;  3A5Z B;  5J26 A;  2J6F A;  1NBE B;  1Q95 G;  2WCA A;  3X1D A;  4F8H A;  1VQ6 T;  2UXB T;  3A8G B;  4EAH A;  3H6Z A;  3KV4 A;  1B7T A;  3PUR A;  4JZ3 A;  4WBN E;  2NW9 A;  4FU6 A;  5LJ3 d;  4MBQ A;  3M0S A;  2YWW A;  4K11 A;  5LHH B;  1U8R A;  3O1J A;  1VQ7 Q;  2K48 A;  4XK8 E;  3GIB A;  5I2S A;  2YRC A;  4QKN A;  3CCE Q;  3QJ6 A;  3EHR A;  3LWH A;  2OTL T;  3VS5 A;  1YJW Q;  3AE5 A;  2ZM2 A;  3KVB A;  1AEY A;  1I1J A;  2HH7 A;  2FPD A;  5GMK l;  3P4P A;  4ELY C;  5KDM C;  2BKD N;  2ZCF B;  2ZM0 A;  5GAN g;  1FXX A;  1X2K A;  2W63 A;  4M4Z A;  4EPC A;  1GL5 A;  2K79 A;  4LUE A;  2XMF A;  3BE3 A;  2X9Y A;  4AFU C;  2LCS A;  5KCO A;  2KK4 A;  4B9W A;  5LJ3 j;  3VRY A;  3QWY A;  2FUP A;  2D8H A;  4DV7 T;  1K9M C;  5CB4 E;  2D9D A;  5JR9 C;  2CH4 W;  2RO0 A;  1RAA B;  1X2Q A;  2DNU A;  4HFC A;  1A0N B;  4HFH A;  1N5Z A;  2HN1 A;  1I6Z A;  1N9R A;  3DP7 A;  2JMC A;  4OP0 A;  1QVG A;  2FJB A;  2B8A A;  3KBU A;  2IC9 A;  4N4H A;  4IE5 A;  4UV9 B;  2LOS A;  1OUL A;  4JEH B;  3AED A;  3L3P A;  1VQK A;  1SHZ C;  3LG7 A;  2DXC A;  1UE9 A;  1SRL A;  2VWA A;  5A0D A;  3CCS Q;  5DAB A;  1WLP B;  3P4R A;  2OAU A;  5LJ5 j;  2O88 A;  1QWF A;  4P0B A;  3GWH A;  2LLY A;  2M16 A;  4HWF A;  1KQ2 A;  2WDV A;  3PFS A;  3M0P A;  2VYT A;  4KMC A;  3G7Z A;  2ESW A;  3FZH B;  5AT1 B;  1WHG A;  1V76 A;  1VQL Q;  3AEC A;  3CCQ T;  2LCC A;  7AT1 B;  2XQA A;  4DR2 T;  2J6O A;  2E65 A;  4C0F A;  1VQ8 A;  2ZPI B;  1T0J A;  2JM9 A;  3LK4 2;  1SA0 E;  3HSB A;  2WWU A;  3G4S A;  1Q86 U;  2D0U A;  2I0M A;  2DNX A;  2KND A;  2Y4Y A;  1KHI A;  3L1A A;  5I22 A;  4GIW A;  3HRT A;  4X1K E;  2EQK A;  2XQY A;  4LF6 T;  1OPK A;  2C0T A;  2P4T A;  2F2X A;  4A4E A;  5GAM g;  4MDW A;  4M7D D;  4HFB A;  4NOY A;  1RUW A;  2LM2 A;  2FB7 A;  1OXZ A;  2N2N A;  3WAJ A;  4L6V 5;  2J06 A;  3OPC A;  4PFP A;  4YLH A;  3RYI E;  4DO0 A;  4C92 C;  4HWD A;  4M7A D;  1WXB A;  2ECZ A;  3Q5D A;  3JCM J;  3N9M A;  2Z0W A;  4FSS A;  2CXL A;  5HXS A;  1QP3 A;  1WJR A;  4C8Q G;  5CCA A;  4OMN A;  1M3A A;  4M77 G;  4OVA A;  4M77 F;  3RMQ A;  3VV0 A;  1T98 A;  1ZUY A;  4HWC A;  1HTJ F;  4WF2 A;  4EED A;  4TV8 E;  3PUV F;  2FPF A;  3ASK A;  4FYV B;  4A4K A;  3EAM A;  1I4K 1;  2VVK A;  2BKO A;  2HQH A;  1K8A C;  2DJZ A;  1KNP A;  3Q5W A;  4B3T T;  4ELZ C;  3LH0 A;  5LBQ B;  3U23 A;  3I35 A;  2WB5 A;  1M2V B;  4XU1 A;  3V8K A;  3SEM A;  2DLP A;  4GLM A;  2J7I A;  1UFF A;  5FW9 A;  3CCQ A;  3QB5 K;  1WGS A;  2K2M A;  2L3Q A;  5J3B A;  2RHY A;  5FL0 A;  3PU8 A;  4AG1 C;  1JJ2 P;  3ZN1 B;  4PNI A;  3RKO A;  4KRT A;  2DL4 A;  1JJ2 A;  4TZ4 C;  5BMV E;  3J80 E;  1VQN Q;  3HL8 A;  1VQK T;  5IWA T;  4XTY A;  1SSF A;  2Y8D A;  4DR3 T;  2ED0 A;  4BAY B;  5KYY A;  3JCM P;  2QEX A;  4X62 T;  3RES A;  3VU3 C;  2HSP A;  2P84 A;  2YUP A;  1J3T A;  3N9O A;  4ZS2 A;  1UUS A;  3EAB A;  3OYD A;  3EDU A;  4DV4 T;  2J1D G;  1OZ3 A;  2KAF A;  2VKJ A;  2UUA T;  4JS5 A;  1M1K R;  2I59 A;  3VHL A;  3X25 B;  1VQ4 T;  4M7A B;  3PTR B;  4H63 H;  3CXC P;  2HBP A;  4QQD A;  2FPE A;  4X9D A;  4B3M T;  3FXE B;  4FJO A;  1WQW A;  4U7I A;  4J9B A;  3HL6 A;  4FCY A;  4IE4 A;  2KE9 A;  2CSI A;  4B9X A;  3O4X E;  2PZ1 A;  3VJP A;  3DKM A;  2EQJ A;  4PJM A;  1CUN A;  4M75 G;  5AFU L;  3RH3 A;  4IDQ A;  1OZ2 A;  4QQ6 A;  3CWZ B;  2XAF B;  5L3F B;  5HAX A;  3CCV A;  1UX4 A;  5GAN 2;  1QLY A;  2A37 A;  2EKO A;  2JRK A;  1BBZ A;  3MP1 A;  2VUR A;  3DTO A;  2CWO A;  2WSE E;  4K0U A;  2ZMA A;  1I07 A;  3OS0 A;  3AAI A;  4PJO D;  2IAK A;  5JDL A;  3KV5 A;  1X69 A;  3AA1 B;  1MMN A;  2PU9 B;  3MEU A;  2ACZ A;  1NAF A;  4LMJ A;  4LF5 T;  1D3B B;  5CKF A;  2BG9 C;  5CJ5 A;  5M9O A;  3AE1 A;  1X79 A;  1XMO T;  2QYZ A;  4YSZ A;  3NFC A;  1HX8 A;  5CQX A;  4CQI A;  2QA4 Q;  4DV3 T;  3RQW A;  2HCK A;  4IE6 A;  3N9L A;  3V7C A;  3OYM A;  4QVC A;  3RRW A;  2H3E B;  2RHU A;  3WVE B;  5HXR A;  3SFD A;  3NMZ C;  3AE2 A;  3CCQ Q;  1MMA A;  1PD1 A;  4KUD K;  2H3R A;  4C0Z A;  2JT4 A;  3PUQ A;  3ONJ A;  1AHJ B;  1IZ6 A;  4F7U E;  1G5V A;  1PKT A;  2D5U A;  3G4S T;  4JI4 T;  4FSX A;  3G6E T;  2DEU A;  3PIO A;  4QX8 B;  1WYB A;  4KT0 E;  3VRB A;  4CXW A;  1VQ8 T;  4LDV A;  5GAN 5;  3A1P A;  3GNF B;  3RR6 A;  2DRK A;  5FMN A;  3CEY A;  1OU9 A;  2M6B A;  5KXJ A;  2LSG A;  4H9R C;  1YWO A;  2CEA A;  1QVG P;  3UFG A;  3A8L B;  2JPF A;  4H9N C;  5FVK A;  1YP5 A;  3FIF A;  5D6W A;  3OYC A;  2ZAE A;  1PD0 A;  4BAC A;  3R6O A;  2GQI A;  4UC4 A;  4YXD A;  3OW2 A;  4A5X A;  1ZEE A;  4JBW F;  2C5J A;  4CN4 A;  1JU5 C;  2DWK A;  4J5Y A;  1FX7 A;  2X4J A;  5CKD A;  2DXT A;  5EG2 A;  3CPW A;  1FMK A;  3E0Z A;  1O9S A;  2DYI A;  2LJ3 A;  2X4W A;  1NPR A;  1P92 A;  1Z9Z A;  1WZO A;  2FRW A;  1M90 C;  1QMC A;  2NWB A;  2IUB A;  2DEQ A;  3CD6 Q;  1OED A;  2V7M A;  4C8Q D;  2EHO A;  1FYN A;  2BIV A;  2LNV A;  4M77 D;  3SWN B;  4AKG A;  4HGA A;  4VUB A;  4DOW A;  3PUA A;  5HEU A;  3LW5 E;  3ONX A;  2H88 A;  2RMO A;  2O01 E;  3KVA A;  2COW A;  4OGE A;  2V7K A;  1VQ5 Q;  2XQ6 A;  2LSJ A;  1ZUK A;  2L2P A;  3H0I A;  4RTW A;  5FXZ A;  3HR0 A;  3M65 A;  5LCY A;  3KFV A;  1E2A A;  3UU3 A;  1KNZ A;  1BCO A;  3ESL A;  1O75 A;  4A56 A;  4IDP A;  3EH1 A;  4M78 G;  4JPB W;  4M7D F;  2K2V A;  2L8D A;  4FYW B;  4WW0 A;  3CCL Q;  1W1F A;  5DLQ E;  3RLF F;  3VR9 A;  3JCM g;  4DR5 T;  2G3R A;  4QKU A;  2MYS A;  4JV5 T;  3CPF A;  3HFO A;  1B07 A;  4L9I A;  4YFS A;  4LN2 A;  2KRO A;  3G71 A;  3UUX B;  3SFM A;  2XHE B;  3PV0 F;  3WI3 A;  3C4W A;  4IL9 A;  2LRL A;  3O5Z A;  4OB0 B;  1QLB A;  2RQR A;  4CI0 C;  3ZMV B;  1WFW A;  4V2S A;  3EI0 A;  5KX5 E;  4I0U A;  1ABO A;  2O2O A;  3RIU A;  3JB9 D;  2QGG A;  1M1G A;  5L23 A;  4FT2 A;  2Q9Q B;  3JC6 C;  2JVV A;  1E1H B;  2RJC A;  5GAN 3;  3OY9 A;  4MHC A;  1XNR T;  1PSE A;  2RI5 A;  2IHR 1;  2W66 A;  2BE9 B;  3AT1 B;  3REA B;  4EMK B;  2KLQ A;  3VS3 A;  3JAM E;  1QVF S;  4DQ2 A;  1HNX T;  1IHV A;  4II1 A;  3EUH A;  2E10 A;  2GQV A;  4QXB B;  3C94 A;  4LD6 A;  4F17 A;  4Y91 A;  4QQG A;  4O4I E;  5DLO A;  1U1S A;  1SKU B;  1JRI A;  4UV8 B;  1HF8 A;  1N8R U;  1YN8 A;  3A8Y C;  3U3I A;  5L3D B;  2CRE A;  2HL3 A;  4XU0 A;  2K3Y A;  4OMP A;  2CDT A;  3CIR A;  5HEG A;  1H3H A;  3QKJ A;  4BE2 A;  4PAG A;  4ZI3 C;  2LCL A;  2DAQ A;  5L47 A;  2MMP A;  3DB4 A;  4HT9 A;  3RUX A;  1T8B A;  3VUZ A;  5AQJ B;  5ADX L;  3CQC B;  1VA7 A;  3QPH A;  3F57 A;  2LSK A;  2DKG A;  2A0F B;  1NM7 A;  3LBX A;  2OA5 A;  4KHZ F;  1WA7 A;  3DLM A;  4M75 B;  1CKB A;  3M4G A;  4X34 A;  5IYZ E;  3J7A F;  3PUY F;  1SPK A;  1ZA1 B;  1U5S A;  1GCQ A;  1UUR A;  3PGG A;  4PLL A;  5KCH A;  3UPU A;  3P50 A;  1JEG A;  1W2B S;  4M7A C;  1OX8 A;  1RI9 A;  1VCT A;  4EV6 A;  4LDX A;  2A9U A;  4I43 B;  2NOX A;  4HWI B;  4HXJ A;  4C8Q F;  3MAC A;  3QUJ A;  5H6R B;  1Q86 C;  5LP6 E;  3K3N A;  3M57 A;  2KIN B;  1UG1 A;  1M3C A;  2R5M A;  4QX7 B;  4F7U A;  2MK5 A;  1QVP A;  2K5B B;  1Y57 A;  2VV5 A;  4DV1 T;  2DVJ A;  3UUN A;  1M2V A;  2YOE A;  2MWO A;  2L9Q A;  3CK6 A;  4YSX A;  2CYZ B;  4O8S A;  1VQL A;  4OB3 B;  1TTH B;  3HPW A;  1X43 A;  3PJA A;  1Q82 R;  4F6R C;  5GAM h;  3T8O A;  3OS2 A;  3H9N A;  4NIQ A;  3VS2 A;  3B5M A;  4LFC T;  2J05 A;  1MIW A;  4ILC A;  2NYS A;  2Y90 A;  1FMW A;  2E5L T;  4IUT A;  5JRC B;  4YJ3 E;  3HHT B;  4CXX A;  1OU8 A;  4HCZ A;  3EGD A;  2X4Y A;  2X0L B;  2AZS A;  2QGS A;  1Z0P A;  5HCM A;  2LDM A;  3ZBD A;  4M1P A;  2WAC A;  3C51 A;  2Z6E A;  3X24 B;  3TSW A;  4X64 T;  3EFS A;  3DLL A;  3JCM e;  2R57 A;  2BVM A;  2FVU A;  1BIB A;  1MIY A;  3LH5 A;  3VYG A;  5JH7 E;  3JCM Q;  5AQF B;  1YQ4 A;  4HCB A;  3LX7 A;  2MBG A;  1HNZ T;  2LVM A;  4TUY E;  1T72 A;  2XM1 A;  3UUL A;  2NUZ A;  4AIU A;  2PVD B;  4C8Q A;  2RM4 A;  4J9E A;  4O2B E;  1OED B;  2RA2 A;  3FHN A;  4FW1 A;  4AT1 B;  5LJN A;  4MML A;  5EK2 A;  4N0A C;  4JUV A;  1KHC A;  4U2Y A;  3CBP A;  4ZZB A;  4LDY A;  2D6F A;  3PUS A;  2E6N A;  1YIJ Q;  5H6Q B;  2DI4 A;  1T3L A;  4J6W A;  5LG4 A;  2DBK A;  5LL6 S;  2LJL A;  5FU6 C;  1UK5 A;  2N9D A;  4XTU A;  2NLU A;  2E9X A;  5HWX A;  4UF0 B;  2AXD S;  3VRZ A;  2ODU A;  4IDO A;  3SDZ A;  1PCX A;  4DUY T;  1ZOY A;  3N2K E;  3JAD A;  1HCI A;  2E8I A;  4U31 A;  3IEE A;  3G6E Q;  4LE9 A;  4KBM B;  4N78 D;  2HN2 A;  2XAJ B;  5IUX A;  5CFB A;  2YIN A;  3UU4 A;  5ABF B;  4AQG A;  3EGD B;  2A72 A;  3REB B;  3ZT6 A;  2M51 A;  1LJO A;  2B86 A;  2XQ9 A;  1OQK A;  2VXF A;  3FLG A;  2HEQ A;  4PJO A;  3I55 Q;  2E3I A;  2KRN A;  4BA9 A;  1VRB A;  1ZQ1 A;  3L2Z A;  4HVW A;  2LC4 A;  4KGV B;  1UDL A;  3SWN C;  2DL8 A;  2HSE B;  3SFE A;  1W2B A;  4E7L A;  5LB7 B;  3NRX A;  1X27 A;  2RF0 A;  3HP9 A;  4M77 B;  2FJA A;  4M7A A;  4MZM A;  2JS0 A;  3HKD E;  2XQ8 A;  3CML A;  3AA7 B;  2BS3 A;  3KIN B;  2YUN A;  2JTM A;  2WQY A;  1LNX A;  3HA4 A;  2KMT A;  4HFD A;  2QG9 B;  4JJC A;  3FB9 A;  3QUI A;  3EAE A;  3OMG A;  2GNC A;  4AQF A;  1AZG B;  4PNO A;  2ES0 A;  1IRX A;  2QA7 A;  1WXU A;  4C0D B;  4J9D A;  2ZGW A;  3QK6 A;  4O4J E;  3SHW A;  1YJW T;  5J39 A;  1W70 A;  4CN6 A;  1TUG B;  3CCV Q;  5AQT B;  3CCL A;  2HQE A;  4MMK A;  4O5V A;  1LVK A;  3UWN A;  3ZST A;  4YTP A;  3CQX C;  3N2O A;  1RLQ C;  3C12 A;  2H8H A;  5KYW A;  4OMO A;  5AQR B;  2I6H A;  1WJQ A;  3FB2 A;  4ZNX A;  4CC4 B;  2Q9Q C;  3CCJ Q;  2WDR A;  2C0O A;  5J2T E;  2LJ1 A;  1HYO A;  2YLC A;  1ZV4 X;  4OHF A;  4HWH A;  2DA9 A;  3EHQ A;  4DBF A;  4O2A E;  2JJ9 A;  1TG0 A;  4AIS A;  4TX5 A;  2X3X D;  2EYQ A;  2DF6 A;  2LJ0 A;  3CX8 B;  3P8H A;  3E2U A;  2KT1 A;  4IT4 A;  2IIM A;  2HAX A;  2OTJ A;  1CHU A;  3M0U A;  2H3J A;  1IJ5 A;  4EIW A;  2CXD A;  1YCS B;  5FL1 A;  3EG9 A;  4J83 A;  2JTF A;  1AWJ A;  1QUU A;  2BS2 A;  2YLB A;  3P4S A;  1VQP A;  1IO6 A;  3ZJ2 A;  5LJ3 f;  1VYV A;  5A1L A;  3SOL A;  2DJQ A;  2CS7 A;  4ZHQ E;  1G2B A;  2NW8 A;  2QAS A;  1WQ7 A;  1NJI U;  3NVO A;  3AXJ A;  4KUI A;  3E08 A;  1CKA A;  5LJ3 e;  1U4Q A;  2WS3 A;  4GKK T;  2PBI A;  5AQQ B;  2E9X B;  1JJ2 S;  3AEG A;  2KT9 A;  1RL2 A;  2EYY A;  4J9C A;  2LP5 A;  2RNA A;  4NL2 A;  3TCJ A;  4HFI A;  2V8J A;  4FIB A;  4X66 T;  2EGA A;  5ECA A;  1PRL C;  4ZI2 C;  1VQ9 Q;  3G06 A;  1PKS A;  1NWM X;  3R6N A;  1JBM A;  3JCM W;  2NW7 A;  3PT9 A;  2OTL A;  3RC8 A;  2ZPG B;  3CC7 T;  2RHX A;  2H7O A;  3N9P A;  4KX6 A;  3RPU A;  4BI4 A;  5CKH A;  1NJI C;  1NEK A;  2CUD A;  1Q81 C;  2VXE A;  1J5W A;  2RHZ A;  2V5C A;  3OYX A;  2DRM A;  2YRV A;  5LJ5 e;  3HRS A;  3ANW B;  3JC6 D;  3R84 B;  2HD0 A;  2JQQ A;  4C90 A;  4JI0 T;  1N8R R;  2CM0 A;  3ZEF B;  4UR9 A;  3MEA A;  4KGZ B;  2ROL A;  3JCF A;  4LUD A;  1NJI R;  4HE8 A;  1T7S A;  3M55 A;  3CCU Q;  2L89 A;  3AA6 B;  2DD5 A;  2O9V A;  1S35 A;  3CPW S;  5ABG A;  4U7Y A;  2EFI A;  3OA6 A;  2RP4 A;  1LKX A;  3U78 A;  1ZP0 A;  1JQQ A;  5GAN j;  1ARK A;  2IC6 A;  1UTI A;  2ZZD A;  5A2Q E;  3LWI A;  2V8S V;  4HFV A;  3VKG A;  3CME T;  1UEC A;  5CKE A;  4DOV A;  4U72 A;  1LPL A;  3CCR Q;  2O4X B;  2I0N A;  4IUR A;  5L3G B;  2V7L A;  2Y6X A;  2UXX B;  3SWH A;  1WR0 A;  4GK5 E;  2CZ7 B;  4OYK A;  5KYU B;  3V5S A;  5I21 A;  1ZBJ A;  5GAN 4;  1VOM A;  4UVB B;  3J7Y q;  4ILU A;  1ZHI A;  1X9B A;  2P0P A;  3PVQ A;  4TWF A;  3UAT A;  4IGU A;  4U74 A;  2GCX A;  2DIQ A;  3V8J A;  4C5H A;  4TV9 E;  4U2Z A;  3ZLI A;  3Q5E A;  1V1C A;  1OPL A;  3QO3 A;  3Q2M A;  2K5F A;  1G73 A;  3I55 T;  3G71 T;  3OYN A;  2JQH A;  3M5A A;  5GAN d;  5JDH A;  3MPU B;  5LJ5 h;  5HEO A;  1NG2 A;  3OYH A;  2KZ7 B;  2XAS B;  3L39 A;  2MWP A;  3RHW A;  4A54 A;  3ZCI A;  4C5I A;  4ADZ A;  2DZ9 A;  1PRM C;  2MAM A;  3OSV A;  3CCS A;  2Y48 B;  2DTI A;  4DEX A;  4YHH T;  3VS4 A;  2AKL A;  1K1Z A;  4PK5 A;  3AE4 A;  5EZY E;  4N0A A;  4UEM A;  2AIR B;  8AT1 B;  2G6F X;  3V5U A;  2V26 A;  3K3Q C;  4QVD A;  3QBY A;  1N32 T;  4P0A A;  2VGN A;  1Z9Q A;  1WFD A;  1IGU A;  2LQW A;  1IZN B;  4TNV A;  1G3Y A;  1WCR A;  3LGF A;  4OMF B;  4M78 E;  4EDU A;  2W10 A;  2JMH A;  2V1R A;  2XAH B;  3L42 A;  3ZSS A;  5EC7 A;  4A4G A;  3VKH A;  2MF2 A;  5HYA A;  1QCN A;  1ZSZ A;  4DUZ T;  1WLX A;  2BBJ A;  2JTE A;  2MPX C;  2NR4 A;  3TLW A;  3JB9 I;  3CCJ T;  2RB6 A;  5FU7 B;  1KC8 C;  3ONL C;  4JYA T;  1JB0 E;  5AQO B;  2QVA A;  1OV3 A;  1RI0 A;  1KD1 R;  2Q9Q D;  3F70 A;  5GAO q;  2CRB A;  1YIJ T;  2KRS A;  2F1L A;  5AQI B;  1AJ3 A;  3S4U A;  4M78 A;  3NZP A;  5LJ3 g;  3CCJ A;  2FZC B;  2ENM A;  4LDU A;  5AQP B;  3FJP A;  2FHD A;  2W2U A;  2F2V A;  5KH6 A;  2RI3 A;  4YSY A;  2QQS A;  2NWM A;  5CA0 E;  3CXC S;  2DBM A;  3QG1 A;  3JRZ A;  2JOY A;  1M7K A;  3F31 A;  2X4X A;  3HKC E;  1PC0 A;  4FL6 A;  5AYF A;  3O9X A;  2VQF T;  1RAI B;  2NUP A;  3H37 A;  2XHC A;  1XZY A;  3MET A;  5F5W A;  1KQ1 A;  1KIK A;  2CZ1 B;  4ESR A;  5ABE A;  5J0Z A;  2W61 A;  1MIV A;  4PJN A;  3OS1 A;  5HEH A;  2RA1 A;  2EYX A;  4C0D C;  2YDS A;  3RKY A;  2KSS A;  2PJQ A;  4IDN A;  2V8K A;  4R56 A;  3LFM A;  4PJO F;  2OTJ T;  2D2S A;  2DXB A;  2EAY A;  3CC4 A;  2BKN A;  2KMF A;  1W9R A;  3EFO A;  1VQ9 T;  2LKG A;  2PG8 A;  1TUC A;  3EGX B;  4ANJ A;  1VQO A;  2F2W A;  2CT4 A;  3I56 T;  4HN9 A;  3RKG A;  2NP9 A;  3FZK B;  4EXT A;  3ZKR A;  2UXD T;  2MPK A;  2XY8 B;  3N5B B;  4Q25 A;  1I5L A;  3UU6 A;  5EK4 A;  3QHS A;  4LF9 T;  3NTI A;  2VWF A;  3BFM A;  2CE7 A;  2YU1 A;  2GBQ A;  3CMA T;  4J2C A;  1EZ3 A;  1NEB A;  2YT6 A;  3ETV A;  1YI2 Q;  4ZI3 D;  3EG2 A;  4Z02 A;  2DVE A;  3CCU T;  4FI5 A;  4C92 E;  3I0Q A;  4ILA A;  1T0H A;  3OJA A;  3RNJ A;  3CCV T;  4JJB A;  4PL6 A;  3CCE A;  2FL7 A;  1QW1 A;  4JJD A;  4DR7 T;  2AE9 A;  2JMA A;  2RQW A;  3V8L A;  4DBH A;  1AWX A;  3OSS C;  4PFZ A;  9ATC B;  1IBK T;  3JSC A;  4JI1 T;  4JLG A;  4EMG A;  4IKF A;  2W0G A;  2KQW A;  1H7C A;  2MOZ A;  2V5D A;  2IIU A;  4HEA A;  2DTO A;  5GAO n;  2WY2 A;  2ZM6 T;  1ZX6 A;  3NRY A;  3CME A;  4LF4 T;  1UGO A;  3N9Q A;  1K9M U;  5GAN f;  1UGQ B;  5IH2 A;  2F69 A;  5FVL A;  1C1A A;  4F14 A;  4OFZ A;  5BR8 T;  4J7I A;  4DMV A;  1TH7 A;  3EDV A;  4M75 E;  4HFE A;  2CT3 A;  3I9Q A;  3OYG A;  1I5O B;  1I94 T;  4OK0 A;  5AQG B;  3D0T A;  3I9W A;  4AKH A;  3UU8 A;  3L2R A;  4EOZ B;  2BKP A;  2UXN B;  3TRE A;  1DJ7 B;  2C5K T;  3C50 A;  2FJD A;  1YJW A;  1D1C A;  4YY3 T;  1B3Q A;  1KQS A;  2L0A A;  5FNV E;  1Y01 A;  2L3P A;  4WBO A;  4M7D A;  1XDP A;  2YK0 A;  1NYF A;  1XJW B;  5HKC A;  3RC3 A;  4QH1 A;  2QQA A;  3KFW X;  1N36 T;  2CBJ A;  4PJO B;  3DJB A;  2VKD A;  2R6G F;  4TN7 B;  1N6A A;  2FZK B;  4OX9 T;  4WTO B;  3VKI A;  3I0O A;  2XM2 A;  4BJM A;  5HXE A;  3CC2 Q;  1D1B A;  5F8P A;  3MP8 A;  3L2W A;  3OYL A;  2XIC A;  3JB9 H;  4ZZC A;  3P4Q A;  4PKC C;  4M7A F;  1OX9 A;  1AOJ A;  1MMD A;  3O1I A;  2RJE A;  4OMQ A;  2NUT A;  5FRN A;  3HRU A;  3CC4 Q;  2JQ9 A;  5CQY A;  2QEX T;  1SRM A;  2FYK A;  2CA5 A;  5C8Y E;  2EQM A;  1QWE A;  3B13 A;  4CC2 A;  3CCR A;  3PIP A;  5GMK m;  1NEN A;  3RIF A;  1F1B B;  2W00 A;  5GAM d;  4BDY A;  4RG8 A;  5IHN A;  2K9A A;  3CVR A;  4O4H E;  4ASK A;  3OMC A;  1VQ6 Q;  1UGR B;  2CXF A;  4QT7 A;  1EX4 A;  1E6G A;  4DV0 T;  3ZFJ A;  4NUU A;  4LF8 T;  5J2U E;  4D8K A;  3M0Q A;  3G1J A;  1GFD A;  4M75 A;  5GMK i;  1HXD A;  2X9W A;  3O1H A;  1W0A A;  3HTR A;  1ACM B;  2RQU A;  3CCE T;  2OAW A;  2VVS A;  3BQI A;  1J1J A;  3PUX F;  3SD4 A;  2K24 A;  2DL3 A;  4X1V A;  1YJ9 A;  5DQW A;  1IB8 A;  4FYX B;  3ZT5 A;  2A28 A;  5GAN 8;  3CMA A;  4ZGJ B;  4YTN A;  1VQ7 A;  1K73 U;  2DER A;  3CX6 B;  4MAL A;  3CKD A;  2D0T A;  3RYF E;  5JDG A;  1N34 T;  1G3T A;  4A63 B;  3UDC A;  3JB9 F;  2QQR A;  5I2M A;  3MEV A;  2ZPH B;  1H92 A;  1KK7 A;  2OV9 A;  4EZH A;  5GAN 6;  1GRI A;  3P8C D;  1VQO T;  5C2T A;  3ZCJ A;  1PHT A;  4KGX B;  3QB5 A;  1UCU A;  4JS4 A;  4E7Z A;  5GAM f;  2C0S A;  4EZ4 A;  1YHQ Q;  4PJL A;  3PUW F;  2MAW A;  2E64 A;  5IXF A;  4Z89 A;  1KC8 U;  2M0Y A;  2GTO A;  1MGQ A;  1YIT A;  3RIU C;  1R0B G;  1RLP C;  3IHR A;  4OGC A;  4KH0 B;  3V7R A;  2K7A A;  2E3H A;  3KV6 A;  3L2Q A;  3KUF A;  5CGM A;  3CCM T;  1HJD A;  5A0L A;  4OYJ A;  3CMA Q;  3ABV A;  3ZJ1 A;  4CN1 A;  4OF1 A;  5JDF A;  1BYM A;  2DZC A;  3J9X 1;  4ZGD B;  5FXW A;  1KG1 A;  5AQK B;  3JCM X;  5IHY A;  1BIA A;  2K6D A;  2XSB A;  1Q86 R;  1NEG A;  1KD1 C;  4KH1 B;  3TLT A;  2W4X A;  3MK7 C;  1PSF A;  4AQF C;  3CPW P;  2XQ4 A;  3C0C A;  2QYW A;  2IW5 B;  4C8Q B;  1S72 A;  3WAK A;  5ABH A;  4GKJ T;  1FMV A;  3MEW A;  3OYY A;  3VUB A;  2LT4 A;  3ZMZ B;  2XI9 A;  4PJO E;  2RJF A;  3KBG A;  3NTH A;  5LGT B;  4HKE A;  4J6Y A;  4LXC A;  1QVF A;  2X66 A;  3OTO T;  3ZYK A;  2OI3 A;  2NUT B;  5FKY A;  1ZKE A;  1FJG T;  1UHF A;  2CZ6 B;  3ANW A;  2MOX A;  2E9X D;  2R58 A;  2EPD A;  1NPP A;  3M9Q A;  3QOF A;  4LFA T;  4CC7 A;  1KD1 U;  1XMQ T;  3FRN A;  2XAG B;  2DE0 X;  3QWX X;  3Q5X A;  3ZC1 A;  1UGV A;  5HWY A;  5IXB A;  1OWA A;  3IF8 B;  4HA8 A;  3AEB A;  3EHZ A;  2BG9 B;  5GAN h;  2PTF A;  4JI3 T;  2QDY B;  3UFE A;  3THK A;  1IGQ A;  2XQ7 A;  3NTK A;  1LCK A;  4JLI A;  3ZEH A;  3H41 A;  1IRE B;  1WNL A;  1TS9 A;  4H9Q C;  4Z91 A;  4BE1 A;  4ZXL A;  3PMT A;  4F7U F;  2XG8 D;  3BY7 A;  3BW1 A;  2A7Y A;  4XQ3 A;  2KBT A;  2ZPE B;  4YHJ A;  2X9H A;  3AAA B;  5AQS B;  2XAQ B;  2E1H A;  2M1H A;  3EFR A;  3T9N A;  2A2F X;  1K0S A;  1RAB B;  1MUZ A;  3N9N A;  1G3W A;  1JXM A;  1N27 A;  2CP6 A;  1M27 C;  2QEX Q;  1M5Q 1;  3QJY A;  3KV9 A;  3HKB E;  5GMK j;  3OYJ A;  4Z8X A;  4C0G A;  3JCM c;  3WXM B;  4LDW A;  2J4G A;  5CKB A;  6AT1 B;  3I1A A;  5HXH A;  2CZ0 B;  4JRI A;  1HX1 B;  3AAE B;  3GN5 A;  3H8Z A;  5LYJ E;  3LYI A;  3UT1 A;  4V1A v;  4F16 A;  1ZBX A;  4RCC A;  2LQ8 A;  2JUF A;  2GF7 A;  2LQK A;  3NGP A;  1HR0 T;  3AXJ B;  3RER A;  2KWH A;  4NPP A;  1PG5 B;  2J6K A;  5E0O A;  2M67 A;  1MHN A;  2KYB A;  3MKD A;  4CC3 A;  4M7D G;  5HEJ A;  3M59 A;  4C92 A;  2WZI A;  5IHK A;  2LE8 A;  4QHO A;  3X28 B;  3OW2 S;  1LVF A;  2WAU A;  1S94 A;  2KGT A;  2KXD A;  1SEM A;  1YIJ A;  5GJW B;  2IPO B;  2VQE T;  1VQ4 Q;  1AWW A;  2EHO B;  4RTU A;  5L3E B;  4PJO C;  4M75 D;  3MO8 A;  1BI3 A;  1YJN A;  1NLP C;  4HCC A;  4DV5 T;  4R0K A;  1BU1 A;  1MND A;  5GAN 7;  4JI8 T;  2H89 A;  5J1G A;  1L0V A;  3S3O A;  4TNW A;  2NTY A;  2RQT A;  4P5N A;  4RTX A;  1K4U S;  2RQV A;  2K5I A;  3H0H A;  1KSW A;  3CX7 B;  2ZM8 A;  4ZS3 A;  5DM7 R;  2UXC T;  1YJN T;  3T1H T;  3W15 B;  2V1D B;  3TLS A;  5AQV B;  2LRK A;  1N33 T;  1ZLM A;  2EIF A;  4M77 A;  4PJO G;  4RTZ A;  2RK2 A;  2YSQ A;  3FXD B;  3TQ7 P;  4G63 A;  1VQN T;  1VQK Q;  1WRD A;  1YKH B;  1NE8 A;  4X5T A;  1M1K C;  3AE9 A;  4ATO A;  3JCM V;  4LF7 T;  4I50 E;  3L09 A;  1D3B A;  4AKR B;  4EYY R;  1QKW A;  1UEB A;  1FIO A;  2EJF A;  3OYK A;  1D1A A;  4ME7 A;  2XSA A;  1OEB A;  2AHJ B;  2KWI B;  1UGS B;  2EYZ A;  4Z8A A;  5LJ5 g;  2BZY A;  2K5L A;  2MI6 A;  3VU7 H;  4UEL A;  2DIG A;  1BI2 A;  3LK3 B;  3HKS A;  3CC2 A;  3L2V A;  1HSQ A;  5L4E A;  2V7I A;  2HL5 C;  4P1N A;  2CWY A;  1UX5 A;  3SRZ A;  5HCJ A;  1QKX A;  2DL7 A;  2FZG B;  4Q5W A;  2MCN A;  1TOV A;  4EMK C;  4QW2 A;  2CKK A;  2OLT A;  2QQ9 A;  3RX6 A;  2DK3 A;  4XTZ A;  2RK1 A;  3FZM B;  4JI2 T;  1R8I A;  1M8M A;  4X20 E;  2E5V A;  3CQT A;  1NLO C;  1SHF A;  2LSY A;  3C4Z A;  4GOU A;  4LD9 K;  1BK2 A;  2V6Y B;  2Q9Q A;  1XOV A;  3I5R A;  3M0T A;  4Z90 A;  4L59 A;  3N5L A;  2RPA A;  5FP3 A;  2M6I A;  4P09 A;  2IG0 A;  5LGU B;  1E7O A;  4QWN B;  2QQB A;  1VQM Q;  3URG A;  2XQ3 A;  2HHH T;  3S3N A;  3AEE A;  3QYG B;  4D6W A;  1Q7Y C;  2EWN A;  2M0O A;  1AT1 B;  1XNI A;  1C0M A;  4IUQ A;  1VQ4 A;  3CME Q;  1HG5 A;  4A53 A;  1X6O A;  1GQE A;  2V8I A;  5JDQ A;  4LML A;  5FWB A;  2PNI A;  4LNP A;  3WVD B;  4BY6 C;  3RF1 A;  2BG9 A;  2VB6 A;  2LOP A;  1M9S A;  3LJC A;  1YNZ A;  2IVW A;  2OJ2 A;  3GOX A;  4QXH B;  1H8K A;  3AE3 A;  3SS1 A; 
#chains in the Genus database with same CATH homology
 3C98 B;  2EGE A;  4MFR A;  3LK2 B;  1OV3 A;  4RTY A;  5HCK A;  3QC9 A;  2GQI A;  4RTT A;  1BB9 A;  2V7J A;  4QXC B;  1YW0 A;  2Q9Q D;  1UJ0 A;  1ZEE A;  5FY0 A;  1GCQ C;  4D8D A;  2C5J A;  1K0X A;  1ZHC A;  2KRS A;  3UA7 A;  3CQG B;  1JU5 C;  2BZB A;  3EVY A;  2DWK A;  1AJ3 A;  3S4U A;  3NZP A;  3FBZ A;  1GCP A;  2ENM A;  5JR9 B;  5JR9 A;  1FMK A;  3E0Z A;  4AG2 C;  2F2V A;  2LJ3 A;  2XTL A;  2NWM A;  3A5X A;  5CA0 E;  4KP3 C;  2DBM A;  1MV0 B;  1Z9Z A;  4Z88 A;  3F31 A;  3HKC E;  2FRW A;  3PE0 A;  2GTJ A;  2B1E A;  4UXN B;  3O9X A;  3AVR A;  3BQL A;  3ZPO A;  2NWB A;  3HKE E;  1TUD A;  2KRM A;  2X51 A;  4BJN A;  3H37 A;  2V7M A;  3M0R A;  2EHO A;  1FYN A;  1WIE A;  3BK9 A;  1VYU A;  4AXP A;  4AG1 C;  3I9Y A;  2ACX A;  4AKG A;  4HGA A;  4AFZ C;  3PUA A;  4ESR A;  1KIK A;  1O3X A;  3ONX A;  1JXO A;  2BDE A;  2RMO A;  1MNE A;  1EFN A;  2W61 A;  3KVA A;  1MIV A;  1E6H A;  2CCQ A;  4PJN A;  2V1Q A;  3IQL A;  2RA1 A;  2V7K A;  2EYX A;  2LSJ A;  4I55 E;  5DQV A;  4CZZ B;  1ZUK A;  2L2P A;  3H0I A;  4RTW A;  5FXZ A;  3HR0 A;  4O4L E;  4H9S E;  2PJQ A;  3M65 A;  5LCY A;  3KFV A;  4IIO A;  4OML A;  3RRC A;  4JUY A;  1KNZ A;  3LFM A;  2LZ6 B;  2DIL A;  3ESL A;  2VL8 A;  2D2S A;  4A56 A;  3ZMU B;  4JPB W;  2KMF A;  2VKO A;  2JM8 A;  3VS7 A;  4WW0 A;  1PWT A;  4C91 A;  5JVD E;  1W1F A;  5LNK A;  3P7I A;  2PG8 A;  1TUC A;  5FXX A;  4ANJ A;  4HVU A;  3TKL B;  2DYB A;  2JXB A;  1ZUY A;  3TVT A;  2MYS A;  2F2W A;  4CI1 B;  2X67 A;  2CT4 A;  2H7V C;  4HN9 A;  4CI3 B;  1KFZ A;  1KJW A;  1B07 A;  4L9I A;  2NP9 A;  3K8P C;  4LN2 A;  4HKA A;  2BZ8 A;  2KRO A;  4L0R A;  3UUX B;  2FG0 A;  2LHR A;  2XHE B;  4EXT A;  3WI3 A;  3C4W A;  3O5Z A;  2LMJ A;  4XAX B;  3GN5 B;  2RQR A;  4H9P C;  1U3O A;  5EK4 A;  3ZMV B;  2DHR A;  2VWF A;  1WFW A;  5KX5 E;  1CSK A;  2C0I A;  2CE7 A;  2YU1 A;  1BR1 A;  1HFA A;  3H3A A;  3K3O A;  4PFO A;  1ABO A;  2GBQ A;  4J2C A;  2O2O A;  3FJ5 A;  1EZ3 A;  1NEB A;  2EW3 A;  3ETV A;  2PTK A;  4ZI3 D;  2Q9Q B;  3JC6 C;  2YT6 A;  3ZN0 B;  3EG2 A;  5L23 A;  1E1H B;  4FI5 A;  3PUG A;  3I0Q A;  2FEI A;  1T0H A;  4MHC A;  2DM1 A;  1WR6 A;  3OJA A;  3RNJ A;  3PDY A;  4JJB A;  4MLK A;  2JS2 A;  2P4R A;  4JJD A;  3REA B;  4DMW A;  2KLQ A;  2JMA A;  2LNH B;  2RQW A;  3VS3 A;  4A63 B;  1AWX A;  4RUG A;  2HDA A;  3OBV E;  5LBM A;  3EUH A;  2W0G A;  4ERR A;  1YWP A;  2O31 A;  5ETW A;  4JLE A;  4QXB B;  1H7C A;  2MOZ A;  4IIM A;  4F17 A;  4HEA A;  3EG3 A;  3OYZ A;  3PU3 A;  4H9O C;  1X6G A;  3NRY A;  1ZX6 A;  2X68 A;  4O4I E;  3OKQ A;  3N9Q A;  5L3B B;  1SSH A;  4UV8 B;  1HF8 A;  1ZUU A;  5IH2 A;  1YN8 A;  3U3I A;  5L3D B;  2CRE A;  1M30 A;  2ROT A;  4F14 A;  2DLR A;  4OMP A;  2CDT A;  4OFZ A;  4HCK A;  2EYW A;  5CA1 E;  4DMV A;  1H3H A;  3EDV A;  2SPC A;  4PAG A;  2CT3 A;  2EVR A;  4ZI3 C;  2K3B A;  3I9Q A;  2AZV A;  1HD3 A;  4JZ4 A;  3RBB B;  5LHI B;  4ZOL E;  2LM9 A;  4EYU A;  1UHC A;  2AKK A;  4E6R A;  2EHO C;  4OK0 A;  2YEV C;  4KUM B;  4UIG A;  3D0T A;  4IE0 A;  3I9W A;  4AKH A;  3A98 A;  5EK3 A;  4AKL A;  4EOZ B;  2UXN B;  3BQK A;  5ADX L;  1YKE B;  2C5K T;  1K9A A;  2L3L A;  3C50 A;  3CQC B;  3ULR B;  1VA7 A;  4DVD A;  1D1C A;  2X9X A;  1B3Q A;  3F57 A;  2LSK A;  2L0A A;  5FNV E;  1NM7 A;  1LRZ A;  4DBR A;  3LBX A;  2L3P A;  4AI6 A;  2OA5 A;  4WBO A;  1WA7 A;  2YK0 A;  2CUB A;  1CKB A;  1NYF A;  2BZX A;  5IYZ E;  2JW4 A;  3RC3 A;  4HVV A;  3Q9D A;  3KFW X;  1SPK A;  1U5S A;  3DJB A;  1GCQ A;  2VKD A;  4PW8 A;  4TN7 B;  4PJJ A;  1JEG A;  1WI7 A;  1RI9 A;  5L3C B;  3I0O A;  4IE7 A;  4BJM A;  4AKI A;  5HXE A;  1OOT A;  3EG0 A;  5LOV E;  1D1B A;  5F8P A;  4I43 B;  2NOX A;  1Y0M A;  4J9F A;  4AFS C;  4HXJ A;  3F2E A;  3MAC A;  3QUJ A;  5H6R B;  3NHN A;  2DL5 A;  4OMM A;  5JRC A;  2WM9 A;  1U5P A;  5LP6 E;  1IJ6 A;  3GBQ A;  1AOJ A;  3K3N A;  1MMD A;  1K4U S;  2KIN B;  3O1I A;  2CLY B;  1M3C A;  1UG1 A;  2C5I T;  2CH4 A;  4OMQ A;  2VKN A;  5M4Y A;  3UT5 E;  4G2A A;  4E7S A;  4QX7 B;  4YJ2 E;  2D8J A;  1K0S A;  1Y57 A;  2K5B B;  4ZI2 D;  2CSQ A;  4J9G A;  1SRM A;  2ZLY A;  2ODV A;  2DVJ A;  1AWO A;  2CA5 A;  3UUN A;  3UTK A;  5C8Y E;  2WBL A;  2L9Q A;  1QWE A;  3B13 A;  4O8S A;  2RPN A;  2HPL A;  4CC2 A;  1FEW A;  3VS0 A;  1D0Y A;  1V9D A;  1X43 A;  2WSS V;  1AZE A;  5JQG E;  2W00 A;  4F6R C;  3T8O A;  5IHN A;  4UVC B;  2K9A A;  3CVR A;  4I4T E;  4IST A;  4O4H E;  4ASK A;  3VS2 A;  2J05 A;  5FXV A;  2HBW A;  1UJY A;  1MIW A;  2CXF A;  4JEU B;  1FMW A;  4QT7 A;  1E6G A;  3UF4 A;  5JRC B;  4GYR A;  4NUU A;  5GON E;  5J2U E;  4YJ3 E;  2ED1 A;  3M0Q A;  1ZSG A;  4WCI A;  4D8K A;  1GFD A;  4CXX A;  2N1G A;  2X9W A;  3O1H A;  2LSI A;  2X0L B;  2AZS A;  2QGS A;  1Z0P A;  4PK6 A;  5FWC A;  3VS1 A;  2RQU A;  2OAW A;  3BQI A;  2BVL A;  1YD8 G;  4M1P A;  4IDZ A;  1ARK A;  3C51 A;  2Z6E A;  3C64 A;  3AVS A;  1M3B A;  2EHO D;  2VKH A;  3PVL A;  3TSW A;  2K24 A;  2DL3 A;  2CMR A;  2J6F A;  4X1V A;  5DQW A;  2BVM A;  2A28 A;  2L3S A;  1MIY A;  1US7 B;  4EAH A;  3LH5 A;  3ZMS B;  5JH7 E;  4RTZ A;  4DEY A;  3CX6 B;  3KV4 A;  1B7T A;  3PUR A;  4MAL A;  4WBN E;  2NW9 A;  4JZ3 A;  3CKD A;  5GJV B;  4MBQ A;  2MBG A;  3M0S A;  2D0T A;  3RYF E;  5JDG A;  4TUY E;  2E9X C;  2NUZ A;  3GA8 A;  3UUL A;  4DND A;  5LHH B;  5JRE A;  1U06 A;  3O1J A;  4J9E A;  2K48 A;  2K9G A;  4O2B E;  3EG1 A;  1H92 A;  3FHN A;  4QKN A;  2XUE A;  1KK7 A;  4DBQ A;  4EZH A;  1MMG A;  1GRI A;  4HTE A;  3P8C D;  5LJN A;  3EHR A;  4NUV A;  5EK2 A;  3ZCJ A;  1ABQ A;  5HXC A;  1PHT A;  3KDS E;  3VS5 A;  1UCU A;  2ZM2 A;  3KVB A;  4J9I A;  3PUS A;  1AEY A;  4E7Z A;  5H6Q B;  1I1J A;  2SRC A;  2DI4 A;  2HH7 A;  2C0S A;  1T3L A;  2FPD A;  4EZ4 A;  5LG4 A;  2DBK A;  4PJL A;  5KDM C;  2LJL A;  2N9D A;  2ZM0 A;  1X2K A;  2E9X A;  5IXF A;  4Z89 A;  1PNJ A;  2W63 A;  4UF0 A;  5HWX A;  1WYX A;  4UF0 B;  2GTO A;  2M0Y A;  2K79 A;  4LUE A;  4M4Z A;  3VRZ A;  1GL5 A;  2ODU A;  1RLP C;  2XMF A;  3IHR A;  4K11 A;  4RTV A;  2X9Y A;  3H0F A;  2K7A A;  4AFU C;  1HG2 A;  2LCS A;  3KV6 A;  3N2K E;  1HCI A;  3VRY A;  3QWY A;  1HJD A;  5LHG B;  4OYJ A;  2D8H A;  2E8I A;  3ZJ1 A;  3IEE A;  5JDF A;  5CB4 E;  3J9X 1;  4LE9 A;  4KBM B;  5FXW A;  5JR9 C;  2CH4 W;  5I11 A;  4N78 D;  2XAJ B;  3ZYL A;  1X2Q A;  2DNU A;  1NYG A;  1A0N B;  1N5Z A;  5IHY A;  5F3J A;  3DP7 A;  2JMC A;  2YIN A;  2K6D A;  4Y92 A;  3UA6 A;  4AQG A;  2A72 A;  3KBU A;  2IC9 A;  1QCF A;  2LHN A;  4IIJ E;  4IE5 A;  4UV9 B;  5FY7 A;  2LOS A;  2B86 A;  2FRY A;  2M51 A;  1NEG A;  2HEQ A;  3GMI A;  3CPZ A;  3AB3 B;  4JEH B;  1VRB A;  4BA9 A;  3MA9 A;  2KRN A;  3MK7 C;  4HVW A;  2VAS A;  3L3P A;  2QDL A;  4AQF C;  1UDL A;  1BR4 A;  1SHZ C;  3LG7 A;  2DL8 A;  3C0C A;  1UE9 A;  1I0C A;  1SRL A;  2VWA A;  2WMO A;  2IW5 B;  1QSD A;  3NRX A;  5DAB A;  1FMV A;  3WAK A;  1WLP B;  1X27 A;  1QWF A;  2RF0 A;  4P0B A;  3ZMZ B;  2AK5 A;  3MZK B;  3GWH A;  1T3S A;  5LGT B;  2JS0 A;  3HKD E;  1VYT A;  2ABL A;  3M0P A;  2X66 A;  4J9H A;  4KMC A;  2BTT A;  3CML A;  3ETU A;  2ESW A;  3AA7 B;  3KIN B;  2YUN A;  3ZYK A;  2KT8 A;  2OI3 A;  2YU2 A;  4JJC A;  3HA4 A;  1ZKE A;  1UHF A;  2DX1 A;  3ANW A;  2MOX A;  2E9X D;  2GGR A;  2EPD A;  4X1I E;  2RN8 A;  4CC7 A;  5FY1 A;  2GNC A;  4AQF A;  2J6O A;  3NZQ A;  1AZG B;  2XAG B;  2DE0 X;  3QWX X;  2ES0 A;  3Q5X A;  2QA7 A;  1T0J A;  4GBQ A;  2JM9 A;  1WXU A;  3LK4 2;  3ZC1 A;  1SA0 E;  4J9D A;  1UGV A;  3QK6 A;  4O4J E;  5HWY A;  2MIO A;  1OWA A;  3IF8 B;  3SHW A;  2WWU A;  5IXB A;  1W70 A;  1X6B A;  2O9S A;  4CI2 B;  2D0U A;  2KND A;  2DNX A;  4ZI7 E;  2A08 A;  3FBL A;  3MXZ A;  1LVK A;  3UFE A;  2KYM A;  3THK A;  2NTX A;  5I22 A;  3CQX C;  3N2O A;  4GIW A;  1RLQ C;  4X1K E;  1LCK A;  2H8H A;  3H41 A;  4OMO A;  2KXP B;  2XQY A;  4H9Q C;  3ZL7 C;  3FB2 A;  4ZNX A;  4CC4 B;  2Q9Q C;  1OPK A;  2C0T A;  2C0O A;  5KMG P;  3N2G E;  5J2T E;  2KNB B;  2LJ1 A;  2LQN A;  1ZV4 X;  2DWG A;  4OHF A;  2EGC A;  2F2X A;  2DA9 A;  2KR3 A;  3EHQ A;  4AFQ C;  4O2A E;  2JJ9 A;  4CXY A;  1BR0 A;  1TG0 A;  2X3W D;  4TX5 A;  1WDX A;  2KBT A;  4YHJ A;  2LEH A;  2X9H A;  3AAA B;  1RUW A;  2XAQ B;  2X3X D;  2DF6 A;  1OXZ A;  2N2N A;  3AA0 B;  3WAJ A;  2A2F X;  3CX8 B;  4PFP A;  4YLH A;  3RYI E;  4DO0 A;  1BR2 A;  2J06 A;  2LJ0 A;  1WXB A;  2ECZ A;  2KT1 A;  1GBQ A;  2DCF A;  2IIM A;  4ORZ A;  2YUQ A;  4EIK A;  3N9M A;  1MUZ A;  4FSS A;  3N9N A;  2CXL A;  5HXS A;  1JXM A;  3ZC0 A;  5LJM A;  2DMO A;  2G0U A;  4OMN A;  1M3A A;  1M27 C;  3M0U A;  1T98 A;  1IJ5 A;  2CXD A;  4H63 V;  3KV9 A;  4EIW A;  3HKB E;  4PK4 A;  1YCS B;  4Z8X A;  1HTJ F;  2YDL A;  4TV8 E;  1IAP A;  5TAO A;  2FPF A;  1WX6 A;  1AWJ A;  3I1A A;  5HXH A;  2O88 A;  1D0X A;  1QUU A;  2D1X A;  1K76 A;  3TSZ A;  3AAE B;  3GN5 A;  1IO6 A;  3ZJ2 A;  5LYJ E;  2LT3 A;  4V1A v;  5A1L A;  1VYV A;  3SOL A;  1AVZ C;  2VVK A;  1S1N A;  2DJQ A;  2FO0 A;  2EQI A;  4ZHQ E;  3Q5W A;  1G2B A;  2NW8 A;  2KEA A;  3NGP A;  5LBQ B;  3U23 A;  3RYC E;  2KWH A;  2J6K A;  3E08 A;  5L2L A;  5E0O A;  1CKA A;  2M67 A;  3I35 A;  2KYB A;  3MKD A;  1U4Q A;  4CC3 A;  1Y64 B;  2PBI A;  2GK9 A;  3SEM A;  2DLP A;  2EBP A;  2E9X B;  2LX7 A;  4GLM A;  2J7I A;  2LE8 A;  1UFF A;  4QHO A;  2KT9 A;  5FW9 A;  5IHK A;  3NPF A;  1MV3 A;  2EYY A;  1LVF A;  2LP5 A;  2RNA A;  2K2M A;  2L3Q A;  4J9C A;  4F16 A;  2EGA A;  5ECA A;  2WAU A;  1S94 A;  4WNK A;  4L5G A;  3KBT A;  3SS1 A;  4ZI2 C;  3PU8 A;  1PRL C;  1WXT A;  2KGT A;  2W0Z A;  2KXD A;  1SEM A;  1PKS A;  3ZN1 B;  5GJW B;  1NWM X;  4PNI A;  3R6N A;  4EB6 E;  1AWW A;  2EHO B;  3RKO A;  4RTU A;  2NW7 A;  5L3E B;  2EKH A;  4KRT A;  2DL4 A;  3C4X A;  3RC8 A;  2H7O A;  3N9P A;  1NLP C;  4TZ4 C;  3RPU A;  5BMV E;  1SHG A;  2CUD A;  4R0K A;  2Y8D A;  2DRM A;  1MND A;  2L8K A;  3OYX A;  4BAY B;  5L3G B;  1BU1 A;  2ED0 A;  5J1G A;  3ANW B;  3JC6 D;  2NTY A;  3R84 B;  2RQT A;  2JQQ A;  4RTX A;  2HSP A;  4C90 A;  2YUP A;  1AD5 A;  3N9O A;  4ZS2 A;  2HPJ A;  2CM0 A;  3ZEF B;  5JDM A;  2RQV A;  1J3T A;  2A3D A;  1JO8 A;  3CX7 B;  2ZM8 A;  3EDU A;  2J1D G;  1KSW A;  4ZS3 A;  2VKJ A;  2ROL A;  4LUD A;  2A36 A;  4HE8 A;  2I59 A;  3VHL A;  3AA6 B;  3W15 B;  2V1D B;  1W6X A;  2O9V A;  1S35 A;  1ZLM A;  3PTR B;  2MTQ A;  1LKX A;  2RP4 A;  4H63 H;  3RYH E;  3U78 A;  1JQQ A;  3FXD B;  3FXE B;  4FJO A;  2IC6 A;  1UTI A;  2FPE A;  2YSQ A;  3ZYM A;  3I5S A;  5LXT E;  4G63 A;  4HFV A;  3VKG A;  3HL6 A;  1UEC A;  4J9B A;  1WRD A;  1YKH B;  4IE4 A;  4U72 A;  5JDN A;  2CSI A;  2KE9 A;  3O4X E;  2PZ1 A;  2I0N A;  1G8X A;  1CUN A;  4I50 E;  2CLY C;  3L09 A;  2V7L A;  2Y6X A;  2UXX B;  3HI2 A;  4PJM A;  3RH3 A;  3SWH A;  4AKR B;  1FIO A;  4GK5 E;  4EYY R;  1D1A A;  1QKW A;  4OYK A;  3CWZ B;  1OEB A;  3V5S A;  3REB B;  1ZBJ A;  2KWI B;  2XAF B;  5HAX A;  5L3F B;  1VOM A;  2EYZ A;  2BZY A;  4Z8A A;  4UVB B;  5LGN B;  3J7Y q;  1UX4 A;  3B57 A;  2P9B A;  4UEL A;  4ILU A;  3VU7 H;  1QLY A;  3PVQ A;  2A37 A;  3UAT A;  4IGU A;  3LK3 B;  4U74 A;  2JRK A;  3MJX A;  1BBZ A;  1HS7 A;  4TV9 E;  5DJQ C;  1HSQ A;  2V7I A;  3DTO A;  3ZLI A;  2D0N A;  2CWO A;  2CWY A;  1UX5 A;  3SRZ A;  1QKX A;  1V1C A;  2DL7 A;  2KXC A;  4K0U A;  2ZMA A;  1I07 A;  2MCN A;  3AAI A;  1OPL A;  2IAK A;  5FYM A;  5JDL A;  3KV5 A;  3Q2M A;  3AA1 B;  3RX6 A;  1X69 A;  4XZC A;  3EGU A;  1MMN A;  2VK9 A;  1G73 A;  3UUM A;  1M8M A;  4X20 E;  3CQT A;  1NLO C;  1GBR A;  1NAF A;  1SHF A;  5JDH A;  2LSY A;  3C4Z A;  1NG2 A;  4GOU A;  2KZ7 B;  1BK2 A;  2XAS B;  2Q9Q A;  1X79 A;  3ZCI A;  3NBX X;  4ADZ A;  1XOV A;  2SEM A;  3I5R A;  3M0T A;  1PRM C;  4IHJ E;  4GK0 E;  4X1Y E;  2YUO A;  1HX8 A;  3N5L A;  2W62 A;  5FP3 A;  4P09 A;  2Y48 B;  4UVA B;  5LGU B;  4DEX A;  4ISS A;  4CQI A;  1E7O A;  4QWN B;  3E22 E;  3VS4 A;  2AKL A;  2JMK A;  4IE6 A;  3N9L A;  4PK5 A;  1K1Z A;  2HCK A;  5EZY E;  3RRW A;  2WMN A;  1G83 A;  5HXR A;  4UEM A;  3NMZ C;  1MMA A;  2G6F X;  4GYS A;  3V5U A;  2V26 A;  2H3R A;  3K3Q C;  3VS6 A;  2JT4 A;  3PUQ A;  2E5K A;  3LBX B;  2D5U A;  3IBP A;  4P0A A;  1PKT A;  1Z9Q A;  5LA6 E;  3ZMT B;  2LQW A;  4B6X A;  1IZN B;  1HG5 A;  3H0H A;  4QX8 B;  1WYB A;  2W10 A;  5JDQ A;  2JMH A;  4CXW A;  2PNI A;  3JV3 A;  4LNP A;  2V1R A;  2XAH B;  5FWB A;  2VB6 A;  5EC7 A;  2DRK A;  5FMN A;  2LOP A;  3VKH A;  3LJC A;  1YNZ A;  5HYA A;  1WYC A;  2LSG A;  4H9R C;  1YWO A;  1WLX A;  2CEA A;  2JTE A;  2OJ2 A;  5IHI A;  2PFV A;  4QXH B;  1GFC A;  1H8K A;  2JPF A;  4H9N C;  1YP5 A;  1D0Z A;  5AFU L;  1UUE A;  4XBF B;  4YFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...