3R6NA

Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin plakin domain
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
450
structure length
450
Chain Sequence
SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Desmoplakin
publication title Crystal structure of a rigid four-spectrin-repeat fragment of the human desmoplakin plakin domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 171
structure length 450
sequence length 450
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17902 SH3_10 SH3 domain
A PF18373 Spectrin_like Spectrin like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1060 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA02
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3r6nA03
2JTEA 1H8KA 1TG0A 5IHNA 5I11A 2GBQA 2DNUA 2FPFA 1HJDA 1UJ0A 1KFZA 2HSPA 5IHIA 2FG0A 2LZ6B 3VS2A 1T3LA 2FRWA 4F17A 2LQNA 2IAKA 4CC7A 2KBTA 2DYBA 2JXBA 2MCNA 3EG1A 4WCIA 1K0SA 5FWBA 2JT4A 1K4US 1UECA 2VVKA 2JW4A 1MUZA 1YP5A 2J05A 2GNCA 1SHGA 2JS0A 2EGCA 1JEGA 4J9GA 2W10A 2FO0A 2RQUA 1JU5C 1QKXA 2GTJA 2GTOA 4RTWA 2LJ3A 2K2MA 4GBQA 2QDLA 2A36A 1B3QA 1SEMA 1YWOA 2HBWA 2L0AA 4HXJA 2X3XD 1QLYA 1MV0B 2EPDA 1VYUA 4R0KA 3IQLA 1K9AA 2DBKA 4ORZA 2LX7A 1PNJA 4AFUC 5ECAA 2YSQA 1OPKA 4KRTA 3PVLA 1AWXA 3VS1A 1ABOA 2DJQA 2CDTA 1UJYA 1ABQA 3I9QA 1E6HA 3NGPA 4CC2A 4A63B 1ZUYA 2C0OA 1AWJA 3EHRA 2CREA 1K0XA 2DLPA 3UA7A 1AZEA 4RUGA 1E6GA 1U5SA 1GCQA 4ZNXA 2VKNA 2K3BA 1GBRA 1LCKA 1VYVA 4D8KA 5IHKA 1NYGA 2LJ0A 4ESRA 1SHFA 1V1CA 1PRMC 1SRMA 3EGUA 2KT8A 1UE9A 2K9GA 2O9VA 1M3BA 4JZ4A 2CH4W 1N5ZA 2CT3A 1QCFA 1PKSA 3THKA 3ZL7C 1M3AA 4AG1C 1EFNA 2LQWA 2HDAA 2FRYA 3C0CA 2KYBA 2DL5A 2OAWA 1XOVA 1RI9A 1UUEA 2J7IA 1WI7A 4QT7A 2L3SA 2O31A 2J6OA 4JJDA 4RTZA 2G6FX 1OV3A 4J9IA 3RBBB 1SSHA 1ZUUA 2O9SA 1X2QA 1U3OA 1YNZA 1TUDA 1G8XA 3H41A 3H0IA 3SHWA 2CSIA 2EYZA 1ZX6A 2ED0A 3TSZA 4CC4B 4CC3A 2LMJA 3JV3A 5FW9A 4DEYA 1NLOC 1H92A 2CUBA 1JXOA 2BZ8A 1IO6A 2LJ1A 1UHCA 2F2VA 2RPNA 4AFZC 4OMPA 1CKAA 1ARKA 3A98A 2KROA 4AG2C 3KBUA 1NLPC 1AVZC 2A28A 3EG3A 1VYTA 1KJWA 1WIEA 3TSWA 2KYMA 1WXUA 1HSQA 2LP5A 1UHFA 1UFFA 2DA9A 1M30A 5GJWB 1M3CA 2JMAA 2OI3A 2JM9A 4LNPA 1NEGA 2I0NA 1I07A 3ULRB 1QKWA 4HVVA 3QWXX 1K1ZA 2ROTA 4E6RA 3KBTA 3I5SA 1H3HA 1UDLA 3PDYA 1KSWA 4RTTA 2DF6A 2DILA 3REAB 2RQVA 2YUPA 1I0CA 2AZVA 1K76A 3RNJA 1AEYA 1WLPB 2CUDA 4OMLA 4HCKA 2RF0A 1PWTA 4AFSC 1AWWA 3EDUA 1X6GA 3NHNA 3EG0A 1WYXA 2KRMA 2EYWA 1B07A 4J9HA 1NM7A 5IH2A 1HD3A 3H0HA 3UF4A 2C0IA 1W6XA 2D8JA 2X3WD 3VRZA 1T3SA 4FSSA 4J9BA 1WXBA 4J9EA 4HVUA 1OPLA 1GRIA 3O5ZA 4M4ZA 2KXCA 1WXTA 2ROLA 2ESWA 2K79A 1YCSB 3PE0A 2KNBB 2RMOA 1CKBA 2XMFA 4AFQC 2GQIA 1ZUKA 2VWFA 2F2WA 2IIMA 3TVTA 1OOTA 1I1JA 2E5KA 2JMCA 2P4RA 2ECZA 1RUWA 2BZXA 4LN2A 5GJVB 1J3TA 1PRLC 2DE0X 5IXFA 2DL4A 2J06A 2OJ2A 1UGVA 1S1NA 1BK2A 1MV3A 1WDXA 1X69A 1QWFA 2L2PA 1GFCA 2EW3A 2A08A 2FPEA 1E7OA 2KRNA 2YDLA 2KXDA 2PTKA 4OMNA 3M0QA 1M8MA 2GGRA 2NUZA 3FJ5A 1X2KA 1SPKA 1G2BA 2DX1A 1BB9A 1GFDA 4RTUA 4Z8AA 2EYXA 1RLPC 2M51A 2EGAA 2JS2A 4OMMA 4GLMA 1AOJA 2BTTA 2PNIA 3NMZC 5HCKA 1PKTA 1WA7A 4JJCA 5FWCA 1Y0MA 2RNAA 3UATA 1WX6A 2PZ1A 1M27C 4LUDA 3R6NA 2KR3A 3REBB 2H8HA 2YUNA 1JQQA 2HCKA 1GL5A 4LE9A 1Z9QA 2DVJA 3QWYA 2O2OA 1QWEA 4RTVA 3EDVA 4K11A 5I22A 2RQWA 2CSQA 2L3QA 2DL8A 3VS0A 3VS7A 1X27A 4Z88A 2MOXA 4F14A 1FYNA 1WFWA 1Z9ZA 3EHQA 3UA6A 1CSKA 5IXBA 2EGEA 2DRMA 1ZBJA 1TUCA 1PHTA 1FMKA 3M0PA 5L23A 2JM8A 1GCQC 2NWMA 1X6BA 2DL7A 2DL3A 3VRYA 2F2XA 2L3PA 1AWOA 2DBMA 1YWPA 1KIKA 2A37A 2CH4A 2SRCA 1YN8A 2AKKA 2AZSA 3VS6A 1ZSGA 4RTYA 2MIOA 1T0HA 3LH5A 2DRKA 1JXMA 4IIOA 2FEIA 5EC7A 1AZGB 2SEMA 2EKHA 3GBQA 4DEXA 2CT4A 1W70A 2KT1A 2DM1A 1NEBA 4F16A 2KE9A 3PVQA 3EG2A 3M0RA 1ZLMA 2ENMA 4JPBW 4LUEA 3I5RA 4OMQA 1U06A 1AD5A 3VS3A 3M0UA 2O88A 4D8DA 1A0NB 1VA7A 3I35A 2B86A 4EIKA 4Z89A 2RN8A 4RTXA 2YT6A 3H0FA 3KFVA 3U23A 2M0YA 2D0NA 2KRSA 1T0JA 2D1XA 2HEQA 2RQTA 2J6FA 5J1GA 2D8HA 1Y57A 2AK5A 2KGTA 4HVWA 1NYFA 1UG1A 2LCSA 2AKLA 2EVRA 4IIMA 2EYYA 3M0SA 3M0TA 2J6KA 1GCPA 2YUOA 4JZ3A 2KEAA 4OMOA 1OEBA 1UTIA 2V1RA 2BZYA 1W1FA 4J9CA 3VS4A 1BBZA 2W0ZA 4J9FA 2EQIA 2FPDA 3VS5A 1BU1A 1GBQA 2K6DA 2ED1A 4Y92A 4J9DA 1RLQC 1JO8A 4JJBA 2RQRA 2EBPA 1NG2A 2V1QA 2ABLA 2LNHB 1SRLA 3F57A 1X43A 2YUQA 3SEMA 2DMOA 3CQTA 2K7AA 2C0TA 1G83A 3NPFA 4X1VA
chains in the Genus database with same CATH superfamily
1VQPQ 2JTEA 4IE6A 1NZ9A 5IHNA 2XAHB 5I11A 2J47A 2X4JA 3SFMA 3O9XA 4BI4A 3AE7A 5LCYA 1HS7A 4AXPA 4XTWA 4P1NA 4JRIA 2LEHA 4U3CA 1ZA1B 5HEUA 4EOZB 1OI1A 3BDUA 4ILCA 2ZLYA 2FG0A 2LZ6B 4I55E 2VXFA 4DBHA 1Z0PA 3UU5A 4M7AF 2FRWA 5D6WA 4F17A 4DR4T 4CC7A 1NENA 5LHHB 4JV5T 2KBTA 5KYUB 2WSFE 1M5Q1 3QOFA 2MCNA 3OYMA 3RIUA 4A56A 3Q1JA 2WZIA 1UECA 2VYTA 1YP5A 4CQIA 3T1HT 2R5MA 4ZS2A 2COYA 5LBMA 3Q5DA 1HF8A 2JS0A 2OTLT 3CCVT 4B6XA 4J9GA 4H9QC 4ILBA 2JZ2A 2RQUA 3GLXA 2Z6EA 1OULA 1QKXA 4HKAA 3N2GE 3LDQB 3ANWB 4GBQA 1XJWB 2HBWA 4JUVA 3CC4A 3LGLA 3SWNA 5LGUB 2PBIA 2EPDA 4R0KA 3IQLA 3L2ZA 2X9HA 3AA1B 2LSYA 3AE1A 3CWZB 4C8QD 2NUPB 2DBKA 2LRKA 1PNJA 1ZQ1A 4X64T 4AKGA 1OPKA 1XQHA 2Y90A 3VR8A 2LT4A 2NW9A 3M59A 1WCRA 4BAYB 5GANj 1AWXA 1J5WA 1VQKA 1J5ET 5J3BA 3RRCA 1ABQA 3HKBE 1HNXT 4B9WA 4CC2A 4A63B 4ASKA 2DIQA 4DMVA 1WHGA 1WNLA 2A2FX 1VQPT 4YXDA 4LD6A 3EHRA 2YRDA 1K0XA 5CO7A 4ILAA 3NBXX 1LOJA 1U5SA 1WHMA 2WZHA 3CMAA 1GCQA 3ZSSA 2WBLA 2VKNA 4PL6A 3UT5E 3QJYA 3PU8A 3RHWA 5KYWA 5GANe 5IN1A 2K2VA 2JTFA 2VL0A 1SRMA 4JDSA 3EGUA 4CI1B 2GQVA 1VQ5Q 3ZMZB 1G3WA 1EX4A 4MBQA 1QCFA 2EHOA 3BY7A 1SKUB 1M3AA 4FYVB 2PG8A 1YKEB 1OX8A 4HWHA 1EFNA 3J81E 2FRYA 3V8KA 1U8RA 2CWOA 2HQHA 5LGTB 1RI9A 2FVUA 4HT8A 4A4HA 4IIJE 1BIAA 1T8BA 1KHCA 2FHDA 2L3SA 2F69A 4MDWA 1O3XA 3L39A 4AKLA 1TUGB 1UURA 2YLCA 3QSUA 2LDMA 2AT1B 3CCJT 1WZOA 4ANJA 3QC9A 4Q5WA 3AEAA 3KV4A 5L4HA 3PUGA 4LFBT 2RB6A 4BDYA 4HKEA 4U74A 4M78F 2H3JA 3EGDB 5HWYA 3PFSA 4FYXB 4KBMB 3TREA 1SF9A 4UF0A 3CC7A 5LBQB 2CUBA 5AQRB 4L6V5 2XU8A 3PUSA 2NLUA 2BIVA 2VGMA 4AG2C 2J4GA 4CI2B 3KBUA 4IHJE 1NLPC 2DJZA 3X25B 1I6ZA 2K57A 1KJWA 2HD0A 2L9QA 5HCJA 3EFRA 2UUAT 5KCOA 1M30A 5DJQC 1M3CA 3C4ZA 2FYKA 2JMAA 1T72A 2JM9A 4PJJA 1NEGA 1QW1A 4IDNA 3IEEA 2CP5A 4COFA 3PTAA 5GAN5 2V1DB 3I9WA 1UGSB 2DI4A 4O6JA 1D09B 3KXTA 4ME7A 1H3HA 2UXNB 4HA8A 3PTRB 4L9IA 2JTMA 4HWIB 1YJ9A 3PDYA 4U7YA 1KSWA 1VQ6Q 3JC6D 5AQOB 2DF6A 3L09A 3V8JA 1K76A 1VQ5T 1W2BP 1JNRA 1WLPB 2Y8DA 4LXCA 4C0DC 2E2AA 2DEQA 2XG8D 3L3PA 5JDNA 2WSCE 2RK2A 4M77A 4C0GA 4HCBA 4HCKA 2WSSV 2X68A 3CQGB 4M78C 1FIOA 3EVYA 2XK0A 4AFSC 1X6GA 4C8QA 3JCMd 3NHNA 3EG0A 4JLGA 4X9CA 3UU8A 3FXDB 1B07A 1NM7A 3NTIA 1XTDA 3L2QA 1IJ5A 3MKDA 1M7KA 1YI2Q 1CUNA 3AVRA 3OYCA 4H63H 2E9XD 4KUIA 3RF1A 4TZ4C 1T3SA 1KQ1A 1HNWT 1HX1B 5M4YA 2BDEA 2M0OA 2LNVA 4J6YA 3OMGA 3CBOA 2P0QA 3T1YT 3JB9G 4X20E 3QO3A 5JDFA 1OPLA 4HVUA 1KD1C 4CN4A 4J8OA 3ESLA 3LK3B 4XU2A 2KXCA 4QQDA 2ROLA 3PE0A 3KV9A 3WXMB 5IHYA 1KQSP 2EQKA 4HWCA 2KZ7B 1RACB 2DD5A 2XMFA 2JMKA 3OYJA 4OX9T 3K8PC 1YBYA 3C64A 2F2WA 5FL1A 4I4TE 1W09A 2JOYA 4M78G 3LSVA 1H3ZA 2BS3A 4XTZA 1OOTA 1I1JA 2JMCA 2P4RA 2DWGA 5JDLA 1RUWA 2BZXA 5GJVB 3NTKA 1PRLC 3FJPA 3KDSE 2OJ2A 2RD1A 2VK9A 2R6GF 5GMKj 1BK2A 3O1HA 5IAYA 2CCQA 5LJ5h 5AQGB 3QUIA 3P4WA 2RJFA 1VCSA 1QWFA 2EW3A 3RIUC 5GAOl 1E7OA 1VQ6T 3CCQQ 5ABEA 2W0GA 3ZPOA 2HKNA 1TXQA 2GGRA 2NUZA 5LJ3d 5FROA 1VOMA 1VQ7Q 3HRTA 4PKCC 1Q7YU 3OS1A 4ADZA 2DAQA 3JCMJ 4RTUA 4LDUA 4JEHB 1RLPC 2MTQA 5AQHB 4ZZBA 2EGAA 3AA6B 2DWKA 2JS2A 4FW1A 3JCMf 5GMKe 4B3MT 3M9QA 2LT1A 4EXTA 3SWHA 1PKTA 4LF8T 5F8PA 2ZCFB 3UATA 4EMKB 1M27C 3C4XA 2X0LB 3SWNC 4ZI7E 4ZGEB 5GAMg 1QCNA 3QJ6A 3NKZA 3LG7A 2HCKA 3FRNA 3JCMh 5FYMA 5ABFA 4L5GA 2KXPB 1KEYA 4MZTA 2OTLA 4C0FA 4X9DA 2CSQA 1US7B 3CCVA 2QA4Q 4AQFA 1IHVA 1RAEB 1X27A 1TTHB 2YN6A 5FU6B 4F14A 4QWNB 1Q82R 1WFWA 5AYFA 1Z9ZA 4EMHA 1CSKA 4IDPA 2EGEA 5FKYA 4LF9T 3P8BB 3ZT5A 5EK2A 1GCQC 4ERRA 2IG0A 2F2XA 4C0DB 1JRIA 2BE7D 5AQTB 1KIKA 3MO8A 2X9YA 3FB2A 2V6YA 2KAFA 2FZGB 3KV5A 2D5UA 4U31A 4JJNK 4M78B 2MAWA 3A8LB 3H9NA 4PJNA 4CXYA 1BCMA 4RG8A 1B7TA 2MIOA 2WB5A 5LJ3f 1LJOA 1M90R 2EHOC 4JRPA 1JXMA 3CCQT 2JQQA 2K9AA 4TVRA 5EC7A 1YD8G 3QZ9B 1AZGB 1SE7A 4GK0E 2NW7A 3OYZA 4YTNA 1VQPA 3GBQA 4DEXA 1VQ7T 2IMLA 2CT4A 4ZGJB 2CXFA 4J83A 4H9NC 3Q9DA 2KT1A 2DM1A 3MACA 5LJ3h 5ETWA 3EG2A 4IE0A 3ZC1A 4JPBW 5JRCA 1FXXA 3M0UA 3E22E 2H3RA 4Z91A 4OMFB 1A0NB 4IE7A 4IDZA 1VA7A 2B86A 2V7LA 2CWYA 2RH2A 1IGQA 4ELZC 2YT6A 2NW8A 2VKHA 3KFVA 4BJNA 2VKDA 4EGWA 1N8RU 5CA1E 2M0YA 5HEHA 1SHZC 2D0NA 3I56Q 2EQMA 4N0AA 2N1GA 5GONE 1SG5A 2J6FA 3EAEA 2E1HA 2CP7A 2CGHA 1K8AR 1BI2A 1N9SA 4HVWA 4WBOA 4YSZA 2EYYA 2QA4T 3J80E 3N9NA 4AKRB 2QXFA 5C8YE 2YUOA 1ZA2B 4OMOA 1UTIA 5AQMB 2XDBA 1JB0E 4KHPT 3CCLQ 1D1BA 1YQ4A 2CA5A 4AQYT 1M1FA 3VS5A 3L8RA 1BU1A 2M1HA 4XU1A 3MZKB 4JJBA 2CRBA 2W62A 1XZYA 2ABLA 4V2SA 3DP7A 4E7SA 3QBYA 2XPKA 1X43A 1EZ3A 2QTXA 4QXBB 3HL6A 4IE4A 2C0TA 3SWNB 4JI4T 3PUAA 1FMWA 5E0OA 4M77C 3ME9A 2BZBA 1WQWA 1JBMA 1VIEA 1HG2A 5A2QE 3INZA 2IVWA 2DNUA 2FPFA 3L1AA 3HKDE 3LWHA 3PGGA 1UJ0A 3RC3A 4EPCA 4NUUA 4LF4T 4C8QC 1NJIU 5IHIA 4ILUA 3G4ST 1MIYA 1M2VA 1T3LA 2F4VT 2LKGA 1Q81U 1LNXA 2LQNA 2F1LA 1D0ZA 4DNDA 4A4FA 3CCUQ 1QVFS 2JXBA 4M1PA 4GKJT 4QH5A 3CMEQ 3ZMUB 1B34A 2LTOA 1VQ5A 1N6AA 5FWBA 5FXZA 1WQ7A 2RHXA 2JT4A 1JJ2S 5LYJE 1K4US 5CIUA 4NOYA 2ODVA 1W0BA 2WY2A 3TEEA 3I56T 1WJQA 2GNCA 5J26A 2DTOA 2LRLA 2X35A 3MA9A 2BG9A 2DFUA 3O1JA 5KYWB 1AT1B 1BYMA 1JU5C 4M77G 2GTJA 4DUZT 3RUXA 1K8AC 3LJCA 2Q9QD 2PFVA 4DR5T 4QHOA 2QDLA 2XASB 2NOXA 3TLWA 2EHOB 1YWOA 3BQIA 2MPXC 4HXJA 3MP6A 2X3XD 2EYQA 4C8QG 1G3TA 1QLYA 5AQIB 1MV0B 4BD3A 3VUZA 4AKIA 1VYUA 3IF8B 1QUUA 3VHLA 2XZEA 5GAOm 1N33T 3OS2A 4ORZA 2SPCA 1M9SA 3AA0B 2ODUA 2DERA 3WVEB 3UULA 4KRTA 3UUBA 2LLYA 3CIRA 3AE9A 2DXBA 3S3NA 3VS1A 1ABOA 3HSBA 4GYRA 3V8LA 2CDTA 1W2BA 1YXRA 3H6ZA 2BBHA 5ADXL 3T9NA 1ZUYA 1AWJA 3IBPA 2EJ9A 1NWMX 5GAOp 4KGVB 1UX5A 1O9SA 3I1AA 3RRWA 3UA7A 1AZEA 1E6GA 4MZPA 4TNVA 4FCYA 3AE4A 4QXCB 2XSAA 3CPWS 3WI3A 4UVBB 4ZNXA 4ISTA 1GBRA 4D8KA 5IHKA 2LJ0A 4ESRA 5FRNA 5HEOA 1IJ6A 2W67A 3OA6A 1PRMC 1WYCA 2KLQA 1FWZA 1VQ6A 2CP0A 2KT8A 5JR9A 5AQUB 5LJMA 3LLRA 1M1KC 4JZ4A 4C92D 2I2LA 3E9FA 3CMET 4Z90A 2WWUA 6AT1B 5LA6E 3FHNA 2RJCA 2JNGA 2LQWA 1MMAA 2CM0A 4AQFC 2HDAA 3JSCA 4AMCA 4JRQA 4MDXA 3LBXB 3RESA 5CAIA 1C6VX 1LRZA 4UR9A 2J7IA 3OJAA 4QT7A 3H37A 4RTZA 1KQSA 3CBPA 1VQ9Q 3EH2A 1PD0A 3N9PA 4EZ4A 3O1IA 3J9X1 1ZUUA 3B5MA 3ZMSB 4O4HE 3PUYF 4DO0A 1U3OA 2V8JA 3OS5A 3ZLIA 2X0HA 1RAAB 2OX7A 5FP3A 1WHKA 4A97A 3SHWA 4M77B 3CKDA 2CSIA 1YI2A 3VUBA 1ZX6A 2Y6XA 2ED0A 1QQJA 3ONJA 3P8HA 3GNGA 4ZXLA 2UXXB 2ZM2A 1VQOQ 1KC8U 2EQJA 4CN6A 2YU1A 4DEYA 4O4JE 2CZ0B 1H92A 1G5VA 3OBWA 5FXVA 4G63A 4C8QB 3OSVA 2F2VA 4XTXA 3QUJA 4IL4A 1C1AA 2A72A 2I59A 2F5KA 3OYBA 3BE3A 2UXDT 4XTYA 4CI0C 3OTOT 1XMQT 3EG3A 2ZPEB 4DV7T 1VRBA 3OYGA 3HRSA 5KYXA 3E1SA 2HMAA 2KYMA 2VC8A 1UHFA 1QVGS 2HPJA 2QASA 5EK3A 2QRXA 5GJWB 2IHR1 3PURA 4H63V 3NRYA 3ULRB 4C5HA 4HFBA 3KBTA 4ZI2D 3RX6A 2VVNA 5GAN4 1IGUA 2QQSA 4X5TA 3A8OB 1LVKA 2CE7A 1BI3A 1QVPA 4M75D 4QVDA 5I2MA 5HXSA 2IPOB 2DILA 2XHEB 3CCJQ 4OK0A 4P09A 1I0CA 2AZVA 4TNWA 1LPLA 3ZN1B 4N0AC 1AEYA 1Q95G 2MAMA 3CQCB 4HGAA 4IUPA 1VQ4Q 2UUBT 2WDRA 4U7IA 4OMLA 2RHUA 3JCMV 2Q9QA 5LOVE 1VQ7A 2X9WA 3MEUA 4FYYB 2HN2A 3AAAB 2KSSA 5GAN3 1BI0A 2NR4A 3JB9J 1YJNQ 2CEAA 2EJFA 5D6YA 4U33A 2XKOC 1VQ9T 4F7UA 2ATCB 1Q86U 1YJWQ 3RQUA 3WAKA 2EYWA 3UFEA 2KMTA 1PD1A 4FT2A 1V29B 1IBKT 1HD3A 3A8MB 2KNDA 3UF4A 2YHTA 2H89A 1I5LA 2K5BB 1W6XA 2VQET 2D8JA 2X3WD 5FRMA 4C5IA 1Y7XA 4IUUA 3BQLA 5FU7C 3KUFA 5F3JA 4JS4A 3RR6A 4LDVA 1PC0A 3VYGA 4U72A 1VQOT 1PM3A 2RJEA 3O5ZA 4M78E 4RMOA 3JCMW 1LVFA 3TKLB 4Y91A 2IIUA 2MOZA 3QDFA 3V7RA 1Y71A 3ZFJA 1Q7YR 2VB6A 3C50A 2QA4A 2DZ9A 4K0KT 3AA7B 3J7Yq 2KNBB 2RMOA 4BJMA 1CKBA 3AE2A 4ZEYA 1PSEA 4AFQC 4DR3T 3F31A 4H9RC 3K3QC 2J1DG 2N2NA 2VWFA 5GAOr 2DNXA 2DTIA 5ABFB 5I2SA 3N2OA 4KP3C 4P0AA 3TVTA 3CC2Q 4QX8B 3FBLA 1N9RA 4FU6A 2ECZA 2VL8A 2MI6A 2HSEB 3QYGB 2DE0X 5IXFA 4R55A 2J06A 3ER0A 2D2SA 4WZXA 3JB9F 4C92A 1FMVA 3KFWX 1MV3A 2E41A 5AQSB 1X69A 3SOLA 4PJOA 2JRKA 3B13A 4DIDB 3PNWC 3NZPA 4C5GA 2K3WA 3M0QA 4HCZA 1G73A 3ZJ2A 2JQKA 3X20B 2LQ8A 2VGNA 3ETVA 4JRKA 1RI0A 4ZS3A 3KBGA 5DLOA 3AE5A 1SPKA 5CKHA 2NUTA 5EZYE 2K5FA 3RIAA 1VQ4T 2XIDA 3QNUA 4FL6A 2DX1A 3M54A 1BB9A 4ZZCA 3PMTA 4Z8AA 1GFDA 3MK7C 5LHGB 2V6YB 2NWBA 2EYXA 4H9OC 2M51A 4LDWA 3PUXF 3RKOA 1N34T 1HXDA 3C51A 3FLGA 4V1Av 2BTTA 2WAUA 1YJNT 3ZCIA 3LYIA 3CXCS 1MMGA 2M6IA 1WA7A 3HP9A 5HAXA 2DVEA 3DB3A 4E7KA 4EMKC 2XQ7A 4M7DD 4JUYA 3RERA 3C95A 2CXDA 3JCMe 4UEMA 1YJWT 2KR3A 5CQXA 4F8HA 3AEEA 5GAN6 3SFDA 3ETUA 3C4WA 1JQQA 1IRXA 5LJ5d 5GAMf 4NXMT 5L3BB 3N5LA 3G7ZA 2V7KA 1X9BA 5FXWA 3FB9A 3EH1A 1QWEA 1OEDA 2QVAA 3I56A 1VQMQ 2IC9A 3I0QA 4K11A 2CPTA 5JRCB 3N5BB 3GIBA 3V5SA 4TX5A 1YIJQ 2P0PA 4WBNE 4PJMA 2YDRA 1NE8A 3BFMA 2I6HA 2BS2A 3VS7A 2XQ8A 2LHNA 3QKJA 4EMGA 5FU6C 1I5OB 5GAMh 3BDLA 4OHFA 2C5JA 2XHCA 1VQLQ 3EHQA 2OLTA 3ONLC 3WAJA 4IDOA 3UA6A 1TUCA 2G0UA 2RJDA 4M75A 2PVOB 5LJ3j 3ZYMA 1K9MU 2H88A 2YINA 2DL7A 3CC2T 3CCLA 2LC4A 2YRCA 2DBMA 1YWPA 5LJNA 2A37A 1N8RR 4JS5A 2SRCA 2KMFA 2MF2A 4VUBA 2AKKA 2VUBA 2AZSA 3W15B 4LF6T 2LQKA 4PFOA 2YWWA 5HK0A 2P4TA 5JR9C 4L59A 3MHXA 5GAOn 1T0HA 3LH5A 4WNKA 2DRKA 3H3MA 1VUBA 2QI2A 4PW8A 3AXJA 2ACXA 4IIOA 2XI9A 2WCAA 1VQNQ 4N4IA 5KYNA 3PIPA 1T98A 3RKWA 2RI3A 5LJ3e 1NPPA 4U2ZA 4EB6E 3QYHB 3UQ7A 5FU7B 2V6XA 4F16A 1QVFP 5GAN2 3M0RA 3MEVA 2ENMA 2W66A 2VQFT 2WSEE 3OY9A 4OMQA 1U06A 2O88A 1TSFA 2DL1A 4X1KE 2KWIB 1KNZA 1P92A 4FM4B 4FIBA 1JJ2P 3NVOA 4EIKA 1WPYA 4Z89A 5LJ5f 3CCUA 3A8YC 3QXEB 4RTXA 3H0FA 5IWAT 3U23A 4G2AA 3CMEA 4J5YA 2K3XA 4WF2A 2JQHA 3AAEB 3LFMA 2RA1A 3QB5A 3URGA 3VRBA 2HEQA 5J1GA 1MIWA 1AHJB 3GN5A 1VQMT 2D8HA 1UEBA 1Y57A 2AK5A 3DTOA 1M2VB 1QCOA 1YIJT 4IIMA 2A9UA 3M0SA 4Y28E 2W63A 4DMWA 2DETA 3MCAB 2HAXA 2X0YA 4B3ST 4TWHA 3RYCE 1B34B 1OEBA 1WHJA 1ZV4X 2V1RA 4OF1A 2HQEA 2L8KA 1NJIR 1IB8A 4MMLA 2BZYA 3RDVA 2V7MA 3FEOA 1Q81R 2I0MA 1VQLT 1PCXA 5M9OA 2E3HA 2QQ9A 5HWXA 1M2OA 5L3GB 2LSKA 2R57A 3P4SA 3RYIE 4J9DA 4BI3A 2VASA 1WHHA 3EGXA 1JO8A 3AE6A 3AE3A 1OWAA 4OYJA 4WW0A 5LGNB 5LMUT 2GFAA 4PNOA 4KH1B 4UIGA 2ZM0A 3R84B 2LNHB 4XQ3A 3I55Q 2EKOA 4GY5A 4M7AD 3LWIA 2CHNA 2D6FA 2CZ1B 1W4SA 1G83A 1HCIA 4NXNT 2CLYC 2X51A 1TG0A 4ELYC 2PVGB 3CPWP 1VQNT 2XJ7A 3Q5WA 4DA4A 4JI3T 2GBQA 2XQAA 5FVKA 4TV9E 4LDXA 5FMNA 4M7DA 3OYKA 1HJDA 1UCUA 2OTJQ 3EI0A 3VU7H 1KFZA 2HSPA 4LD9K 3VS2A 3L2VA 4JLEA 4KUDK 4H9SE 2IAKA 3ONXA 4YFSA 1IBLT 3ZJ1A 3P4QA 5GAN7 4M77E 2KK4A 1K0SA 4LFAT 3M4GA 2VVKA 5C2TA 1RADB 3OW2P 3ZT6A 3CCRQ 4ZN3A 4OFZA 3LH0A 5D6XA 5CVIA 2E8IA 2WMNA 1SHGA 4GIWA 4UV8B 2FUPA 2EGCA 4C8QE 1JEGA 3A5XA 2E5VA 2E64A 3M53A 5BR8T 2EQUA 2FO0A 2DKGA 2W10A 3JAME 4FW2A 3L2WA 4BE2A 5D7UA 2XM2A 2GTOA 4X1YE 3EFOA 4JEUB 1R8IA 2A7YA 1KD1U 2LJ3A 1DJ7B 2GK9A 2QDYB 2K2MA 3C94A 4CRIA 5JR9B 1VQ9A 2RI2A 2V7IA 3CCMQ 1VIFA 1B3QA 2DO3A 3GWHA 4R56A 1UGRB 5AQKB 2L0AA 1M1GA 4E47A 2CS7A 5LP6E 3ZN0B 4F7UG 3G06A 4GKKT 5AFUL 4QH4A 2KT9A 4PAGA 1NJIC 3OYXA 4C92C 2Z0WA 3S3MA 3SB2A 2ZZDA 1XDPA 3N2KE 4II1A 4EYUA 2JIWA 4PJOC 1BR4A 1K9AA 2LX7A 1ZHCA 2NP9A 4AFUC 1DU2A 1VQOA 2YSQA 3G4SQ 2X67A 3UFGA 5EG2A 4EEDA 3PVLA 2E9XA 5GAN8 2DHRA 5KE2A 2YXYA 5KDMC 3D7SB 4M77F 2DJQA 1XWMA 3DLLA 3I55T 2BVMA 3I9QA 5LMNT 3NGPA 4BUGA 3G1JA 3OYYA 4CXWA 3A8GB 2C0OA 2V8KA 5GANg 3V5UA 4C8QF 5CKDA 1MIVA 3N9QA 4ZHQE 2DLPA 2CBIA 2RK1A 4QVCA 4RUGA 2HZYA 3N9MA 4YY3T 8AT1B 4P0BA 1F1BB 4QH1A 2OTJT 2DK3A 1K73U 4E7ZA 1LCKA 2QG9B 5CK9A 1NYGA 1WHLA 1SHFA 3RIRA 1KC8R 3JCMQ 3S3OA 4XBFB 4C92G 4A4KA 3META 5CJ5A 5KYXB 2LOSA 4PJOG 1UE9A 2K9GA 4BI8B 3CCJA 4DR2T 2CH4W 5DABA 3LGFA 3THKA 3ZL7C 3PJAA 5CFBA 4HFVA 1FX7A 1Q82C 4HWFA 3Q5EA 1VQ4A 2QAZA 4M78D 5KYYA 3C0CA 1ACMB 2DL5A 2KYBA 3CCRT 1M4ZA 1XOVA 1UUEA 2OAWA 1VCTA 4AI6A 1WI7A 3CCSQ 1YJNA 4OB0B 2J6OA 4F04B 1R0BG 4ZI2C 1WLXA 4JLIA 1SSHA 7AT1B 3A1PA 3CX7B 3E19A 1X2QA 4RCBA 1W0AA 2X9XA 3CCMT 1YJWA 1YITQ 3ZMVB 1TUDA 1G8XA 2IUBA 3EABA 2CZ6B 3H41A 2Q9QB 2KVQG 3A8HB 3RH3A 3H0IA 2CLYB 5ABHA 3FBZA 1M90C 1VQ8Q 2EYZA 3M58A 2YLBA 3TSZA 4M7AA 3PV0F 4CC4B 5C6SA 4TUYE 3CPFA 1XNQT 4CC3A 3RQWA 4X65T 1NLOC 2WQYA 4B3TT 4F6RC 1OQKA 2BZ8A 3JB9I 1IO6A 2LJ1A 1HNZT 2B8AA 4F7UB 2PUOB 2MWPA 2RPNA 1LKXA 4QQ6A 4AFZC 5GMKh 3A98A 2KROA 2XQ9A 4E7LA 4OB3B 1AVZC 4OYKA 1OXZA 2KQWA 3CBMA 4A53A 3CD6Q 2E5LT 3TSWA 2AXDS 1WXUA 1UFFA 1M62A 2DA9A 1Q86R 2DIGA 2D0TA 3E0ZA 3CC2A 4XTVA 5LG4A 3E08A 4LNPA 2WMOA 4HCCA 2I0NA 4IKFA 1UUSA 1QKWA 4HVVA 3QWXX 1K1ZA 1HX8A 1UGQB 2K5IA 4DV6T 1UDLA 1KFYA 1ZEEA 3ZKRA 3TLVA 2N9DA 3OYDA 1R77A 2K3YA 4RTTA 5AT1B 4D6WA 4FJOA 2RQVA 2PU9B 4QKUA 4QQGA 2RA2A 3AE8A 2LCLA 2D0QB 3RNJA 4KI0F 5FXXA 1KC8C 4CZZB 1YKHB 4LMLA 2B76A 1ZBXA 2CUDA 3PIOA 1QSDA 4O4IE 5L8RE 4JI1T 4A4GA 3SS1A 2DXTA 2NTYA 4C92B 5HYAA 3AEDA 3I9YA 5AQJB 4YHHT 2LX9A 3HTRA 4PJOB 2VVSA 3HKEE 1G3SA 3JCFA 1YJ9T 5H6RB 2FJBA 1PWTA 4RG2A 2M16A 3OBVE 4LDYA 3RGLA 3CCST 2QYZA 2QTVA 3EDUA 2EIFA 3CVRA 2QEXQ 2FZCB 2HL3A 3ZSTA 1WYXA 2KRMA 4PNIA 4ZGDB 4J9HA 4MMKA 5IH2A 3H0HA 3MEAA 5JDMA 4XU3A 1YITT 3RI5A 2XQ6A 2A0FB 2C0IA 3HFOA 4TWDA 3VRZA 2WS3A 2WU5A 4UXNB 1SSFA 4O5VA 4BDZA 2DTHA 4UF0B 1VQ8T 4GK5E 3ZEFB 1WXBA 2ES0A 4J9EA 2ACZA 5L2LA 2LM2A 1VQMA 4UC4A 1GRIA 2FJAA 1Y96A 4M4ZA 1XNIA 3GA8A 1YIJA 5A1LA 2K79A 4DBQA 3QPHA 4KGXB 1MNDA 1V9DA 1D3BA 1NBEB 5L3DB 3RC8A 2O01E 3EHZA 4Z02A 5GMKl 2JJ9A 2GQIA 3G71Q 3V7SA 2IIMA 1NEKA 1VQLA 3CD6T 1HFAA 5J0ZA 2WM9A 5JH7E 2E3IA 2X4WA 2Y48B 3KINB 2E5KA 2OV9A 4LN2A 1J3TA 4YTPA 1QVFA 3HKCE 2DL4A 2P9BA 1YQ3A 1UGVA 1S1NA 1Q86C 1H7CA 5ABGA 2YDQA 2BUDA 4HFIA 4UVCB 1TU0B 4C0ZA 1JJ2A 3FIFA 4CN1A 3MP1A 1XMOT 3H8ZA 4B6MA 3HI2A 5JQGE 1TWBA 3M4YA 2XQ4A 3QHSA 2A3LA 4PLIA 4B9XA 4M75B 3FJ5A 3JC6C 1WGSA 3OKQA 4A54A 1MNEA 2X66A 2XSBA 3GPLA 3TLSA 2D0UA 3GP8A 5TAOA 1G2BA 2DXCA 2BBJA 1VQNA 3FZHB 3U78A 3OQ5A 3AEGA 2EAYA 1S94A 1XDOA 8ATCB 4BE0A 4KHZF 2E6ZA 1D1AA 2GFUA 5L3FB 1U4QA 4GLMA 3ZBDA 1AOJA 4ZTJA 2XQYA 4DR7T 1K9MR 3UTKA 3S4UA 5HCMA 4UVAB 3NMZC 5HCKA 4C5EA 4HTEA 3C12A 3EAMA 1BCOA 3AXJB 3FXEB 2QEXT 1N36T 4LUDA 3R6NA 1EIFA 3REBB 5FVLA 2H8HA 4HFCA 2J62A 3N9OA 1X01A 2BG9E 5JDHA 3JB9H 4X1IE 4LE9A 1Z9QA 2DVJA 1MMDA 5KXJA 1UB4A 1U5PA 4E7JA 3M65A 4AIUA 1D0XA 4RTVA 3EDVA 2E9XC 3HA4A 3TU4K 5FY1A 2M6BA 3KV6A 4XTUA 1KF6A 5L3EB 3RKYA 5GAMe 3SRZA 4ZI3D 1I4K1 2CP2A 3BK9A 5L3CB 1PG5B 3UDCA 4Z88A 2MOXA 4QXHB 3M5AA 1RAHB 1FYNA 2W4XA 4PJLA 5GAOq 2L3LA 4MALA 5IXBA 2KSRA 4IL9A 3ABVA 1E2AA 3PUVF 1FMKA 1PHTA 3CPWA 3CCQA 5A0GA 3G71T 5L4EA 2A3DA 3M0PA 4IDQA 5L23A 3VRYA 2DCFA 2NWMA 3VU3C 1SA0E 3GN5B 2HPLA 3UUMA 3EFSA 1ZKEA 4QW2A 2LSGA 3J7AF 4IT4A 1N27A 2COZA 4RTYA 2W2UA 5JDGA 4M77D 3FC3A 1ZOYA 3I55A 4FT4A 3TCJA 2IC6A 4A98A 2UU9T 2FEIA 4IUVA 2F5TX 3OW2A 5JTGA 5AQNB 2EKHA 3VKHA 3DLMA 5LJ5j 4N78D 3EGXB 1UGOA 5LB7B 1M1KU 1W70A 4L0RA 2XM1A 3L42A 2LT3A 3NTHA 1IZ6A 2ZMAA 1NEBA 3K3OA 3AT1B 5GAMd 2O4XA 2KE9A 3RKGA 1ZLMA 3VJPA 2XAQB 2OTJA 4LUEA 3I5RA 3VS3A 2JMHA 1WJSA 2YDSA 4D8DA 1OYXA 3GOXA 2ZM6T 1K9MC 1AJ3A 4HT9A 4KX6A 2FL7A 4OB2B 5GMKi 5IT9E 4M7AC 1YHQQ 5FLXE 3AEBA 3P4RA 1FEWA 2FZKB 4TN7B 4A4EA 4M7DB 3SD4A 4X66T 2RP4A 2M9UA 4HFEA 5KX5E 2KRSA 2D1XA 1V76A 5HKCA 5CKBA 5LJ5e 2E4HA 3FDRA 2K4YA 5H6QB 3CCRA 4BY6C 4JI0T 2E10A 2UUCT 2HN1A 2MPKA 1UG1A 2AKLA 2LCSA 2WDVA 3M0TA 1QVGA 2J6KA 3M56A 1R0CB 4XAXB 3GMIA 1X75C 4JZ3A 1M8VA 2KEAA 1HG5A 1Y01A 5J2TE 2P0KA 3U3IA 1BR1A 3CCMA 3D0TA 1BBZA 1I8FA 3AHUA 3ZT7A 4HFDA 2C5IT 4IUQA 2CBJA 2FPDA 3HL8A 4GYSA 1GBQA 2K6DA 2ED1A 2BG9C 4LMJA 4EIWA 2C0SA 4ZN1A 5AQVB 2LVMA 2RQRA 3FZLB 3EFOB 2LHRA 5FL0A 4M7AG 5EK4A 1NG2A 4UELA 2LM9A 3G4SA 5HXEA 4JI6T 2BE9B 4FI5A 2H7OA 2HH7A 3F57A 4EEBA 3SEMA 4LFCT 4RKUE 3CQTA 1QP2A 2XUEA 4O8SA 4B3RT 3VV0A 3JCMP 4X1VA 3PUZF 4HEAA 1KD1R 1H8KA 1RAGB 4LF5T 1IAPA 2V26A 4XZCA 3RKXA 4N4HA 4YJ3E 4NPPA 4CI3B 2E9XB 4MHCA 1QMCA 1WR6A 3O8VA 4KH0B 5FNVE 4YJ2E 2JUFA 3HHTB 4DV4T 5GANd 2C06A 3RMQA 5DY9A 4GLKA 3RMSA 2DYBA 2L89A 2MWOA 3MEWA 2HHHT 1Q7YC 5HEGA 1WJRA 3X26B 3EG9A 1YW0A 2QQAA 2ZPFB 3EG1A 3LW5E 4WCIA 1BI1A 5LL6S 3ZYKA 1YHQT 3S6WA 2DLRA 2PQWA 1OU8A 2ZPIB 2XAGB 1X6OA 3K1SA 2JW4A 2R5AA 1MUZA 3E2UA 4DV0T 3LK42 4OVAA 2J05A 4X34A 1QLBA 2B1EA 4GOUA 3AECA 2FJEA 4HE8A 2BKDN 4QX7B 3QDRB 5CKEA 5J39A 1ZSZA 3LBXA 3HKSA 4F7UE 1WFDA 2WWVA 2HNIA 1XNRT 1H641 3H3AA 2CZ7B 4YLHA 4UV9B 3T8OA 3HRUA 4H9PC 4ISSA 4K0UA 1OZ3A 2COWA 4RTWA 3G6EQ 3CCSA 4KT0E 2ZPGB 2D9TA 4JI8T 2A36A 5HXHA 1SEMA 1K73R 2K48A 4DUYT 2X4YA 2QQRA 2QK0A 3WVDB 1YITA 5JDQA 4IGUA 3FZMB 5KYYB 3OYEA 4X62T 1VQ8A 3OB9A 1YFNA 2KY9A 2CXLA 2QA7A 4RCCA 1GXIE 4DBRA 1OX9A 2EFIA 1NPRA 2E70A 5ECAA 9ATCB 1WRDA 2OA5A 1TS9A 1Y64B 2ZPHB 1UJYA 3CCEQ 1S72Q 3OBYA 3UT1A 2LE8A 1E6HA 5KYUA 2BVLA 4DR1T 3HPWA 1R8OB 2FJDA 3GF5A 2V8SV 1MMNA 2JVVA 4M7AB 3CD6A 4C92E 2W00A 4J7IA 2GCXA 1UX4A 5HXCA 3CXCA 4F7UF 2CMRA 4PJOE 2CREA 2WU2A 4KGZB 2YKSA 4YT0A 4EYYR 5GANf 3EUHA 3VRAA 2UXBT 2D9DA 2GF7A 3Q2MA 2ZGWA 4BY6B 2K3BA 4NIQA 2MYSA 4KULA 1VYVA 3OVUA 4C91A 2RHZA 1U1TA 5KMGP 3OYFA 1V1CA 3OYIA 3ANWA 4JI5T 4DV1T 3DB4A 2O9VA 3R6OA 5GANh 1M3BA 2HL5C 1N5ZA 4MFRA 2CT3A 1PKSA 3OYHA 4AG1C 1WYBA 4CXXA 5FY7A 2QYWA 2BKNA 3L2UA 2VWAA 2BG9B 4EZHA 4A5XA 2NUPA 2O31A 3QG1A 4JJDA 2G6FX 2C5KT 1OV3A 2ZAEA 4J9IA 4JBWF 1MGQA 3RBBB 2V7JA 3G6ET 1N8RC 2O9SA 1Y07A 3CC4Q 2QEXA 4C92F 1YNZA 1OEDE 3JADA 4PJOF 2Q9QC 2G3RA 2KI7A 4KMCA 1K73C 1KHIA 4DR6T 1IXDA 5BMVE 2LMJA 3JV3A 1QP3A 5FW9A 3A7MA 1KNPA 2XY8B 3SFEA 5CGMA 3FZKB 4ATOA 1JXOA 1VQKQ 3CQXC 3BW1A 4YTMA 3JAFA 1UHCA 3KVBA 4OMPA 1CKAA 1ARKA 4IURA 4QKNA 3MP8A 4M75E 3P4PA 4OGCA 4XK8E 2A28A 3P8CD 2DYIA 1VYTA 1D1CA 2PTFA 4DV5T 1S72T 3CCET 4DVDA 1WIEA 1E7PA 3DKMA 1HSQA 2CHOA 2LP5A 4DQ2A 1YI2T 3VYHB 1RAFB 5A0DA 2HQXA 3G71A 2RM4A 3UU4A 3SDZA 3I0OA 1J1JA 3RLFF 2OI3A 4J6WA 3CMAQ 2M67A 1Y96B 1I07A 5HY6A 4BB7A 1S35A 5LXTE 4DOVA 2ROTA 4E6RA 2MMPA 3I5SA 1G3YA 4AKHA 5I21A 2XAFB 4OGEA 3NZQA 1D3BB 3F70A 4DV2T 2CP3A 1X79A 3UU3A 3Q5XA 5DM7R 4BACA 3REAB 5C3JA 2Y4YA 5CQYA 2YUPA 2QQBA 3QIIA 4PK4A 2QGGA 1ZP0A 1KG1A 3PMIA 4FSXA 2XDDA 2E65A 3VR9A 2JQ9A 5JVDE 4PK5A 1JNZA 3MXZA 2PVDB 3EGDA 3L2RA 1Q81C 5A0LA 4OP0A 3QB5K 1HYOA 2RF0A 2YEVC 4M75F 5AQFB 1FJGT 1IBMT 4AISA 4IUTA 4TV8E 3TQ7P 1BR0A 3PU3A 3LK2B 4BE1A 5L47A 1AWWA 1WR0A 3V7CA 3AAIA 3C4SA 3P8DA 1QVGP 5KH6A 4O2AE 5LG3A 3RPUA 3CC4T 4J6XA 1CHUA 4EDUA 4IREA 2KINB 4HN9A 1UGPB 4E7HA 3CEYA 2XQ3A 2MK5A 4FSSA 4EV6A 4J7FA 5J2UE 1HTJF 2BKPA 4J9BA 3CC7Q 2UXCT 4NS5A 1RL2A 2W61A 4JI7T 2WDQA 4MZMA 3JB9D 1WXTA 2LKHA 1TH7A 5LJ5g 1VQKT 2ESWA 1YCSB 5C0MA 3P7IA 4PFZA 3K3NA 4IE5A 3RIFA 2XDPA 4NL3A 4OB1B 3VKIA 2VURA 2BKOA 2XTLA 3FZFB 4E2FB 2H7VC 1ZUKA 5IYZE 2YU2A 4KUMB 1IREB 2FB7A 4PK6A 2RI5A 1OEDC 2E12A 1TOVA 2RHIA 4DOWA 2LSJA 3MPUB 3CMAT 2ZM8A 1W9RA 3ZMTB 3UQ4A 2DPPB 3HFNA 3O4XE 2JN0A 1YJ9Q 5LHIB 2YOEA 1WDXA 3UUXB 2L2PA 5CB4E 2L5QA 1GFCA 1T7SA 1O75A 2A08A 2V5CA 2WP9A 2FPEA 2RO0A 4EAHA 4DBFA 4ZI3C 1PSFA 1SUMB 1MHNA 2HBPA 2KRNA 4Q25A 2YDLA 2KXDA 2PTKA 2R58A 4OMNA 4M75C 1M8MA 4M7DE 5AQLB 3AEFA 2V8IA 4I43B 3ZYLA 1I81A 3AB3B 1X2KA 3A5ZB 2ZPBB 1E1HB 3CK6A 3BQKA 1ZSZC 2PJQA 2CYZB 3JCMg 1W2BS 2LRQA 2RHYA 1NAFA 2FBWA 2EWNA 2YRVA 4OMMA 3ZC0A 2VKOA 5HEJA 5HK3A 4PFPA 4ZOLE 2PNIA 3JCMb 2MBGA 5CKFA 2LJLA 5FWCA 4J2CA 4JJCA 1Y0MA 4I0UA 2RNAA 2PUKB 1BR2A 5AQPB 1WX6A 3P50A 2PZ1A 1HR0T 3PUWF 3NFCA 2X4XA 3DJBA 2YUNA 5IUXA 5DLQE 3QK6A 1YHQA 1GL5A 2OAUA 3QWYA 2AE9A 2VXEA 1BIBA 4NUVA 2O2OA 1D0YA 2XAJB 2O4XB 3IHRA 5I22A 4ZTFA 2RQWA 3CC7T 4LMKA 2L3QA 4M75G 1I94T 2DL8A 3B57A 2KDSA 2DXUA 3VS0A 3ASKA 2QGSA 1M1KR 4WYVA 3OS0A 3NWIA 4M7DF 2WACA 3OPCA 2M02A 2NTXA 2E5QA 1IZNB 2DRMA 1ZBJA 4O4LE 1RAIB 4I50E 3RYFE 5DQWA 4C90A 1KQSS 3F2EA 4DV3T 2JM8A 2VV5A 1X6BA 2DL3A 1GQEA 2L3PA 2L8DA 1AWOA 3M55A 3CMLA 4YHJA 4E7IA 2LOPA 3CXCP 1OU9A 2VKJA 2CH4A 4N4GA 3UU6A 1YN8A 3OYAA 5GMKm 5LJ3g 1YCYA 4QVZA 3ZEHA 2AIRB 3X28B 5CCAA 3VS6A 1ZSGA 1BKBA 4HWDA 3X1DA 1N32T 4TWFA 2CP6A 2HKQB 3ZCJA 5LNKA 2V5DA 4EMKA 3VKGA 4PLLA 3UPUA 2E6NA 2NUTB 3CCLT 4WTOB 2SEMA 1ZHIA 2IDOB 4AT1B 2NYSA 4O2BE 3CX8B 2AHJB 3OMCA 3TLTA 2QGFB 1IHWA 3M3ZB 1Q82U 3PVQA 3X24B 3PJAJ 3JCMX 3HR0A 4U2YA 1C0MA 1AD5A 1RABB 2P84A 3N9LA 3M57A 3I35A 3CX6B 2IW5B 3UUNA 3E9GA 3GNFB 1KNRA 2Y4XA 2BS4A 2RN8A 1KQ2A 1L0VA 1EZZB 3LX7A 3MJXA 4JI2T 4M7DC 4AQGA 2JPFA 4HFHA 4YSYA 3KVAA 1OEDB 3NRXA 5KCHA 2OTLQ 4JYAT 4MLKA 1T0JA 2RPAA 2XICA 1KK7A 2LCCA 2RQTA 3CCVQ 5CR2A 1U1SA 2XQ5A 5FY0A 4LF7T 1M90U 2KGTA 4YTLA 3CPZA 1NYFA 2LSIA 2EVRA 2K24A 2EHOD 3OYLA 1GCPA 2L3RA 1OZ2A 5KE3A 2YK0A 4M78A 4YSXA 3CCUT 3EG9B 3OYNA 2K5LA 3G6EA 3TLUA 2XD0A 3RYHE 4M7AE 2DZCA 4FYWB 4P5NA 5F5WA 2DEUA 4Z8XA 3OSSC 1HK9A 1W1FA 4J9CA 3JCMc 3VS4A 4PJOD 2W0ZA 3UWNA 4J9FA 3PUQA 5CA0E 2EQIA 2H3EB 4BA9A 4Y92A 1ZSZB 1UK5A 3IA3A 1RLQC 5DQVA 3PT9A 3OW2S 2CKKA 2KWHA 2EBPA 5GAMj 5HXRA 3QZ5B 2V1QA 4M7DG 3JRZA 1Z8UA 3AVSA 1SRLA 2YUQA 5AQQB 2DMOA 3JAEA 4XU0A 2K7AA 4NL2A 3C98B 2DD4A 3CCEA 1S72A 5JREA 3NPFA 2EJGA 1K8AU
chains in the Genus database with same CATH topology
2JTEA 4IE6A 5IHNA 2XAHB 5I11A 3O9XA 5LCYA 1HS7A 4AXPA 2LEHA 4EOZB 2ZLYA 2FG0A 2LZ6B 4I55E 1Z0PA 2FRWA 4F17A 4CC7A 5LHHB 2KBTA 2MCNA 4A56A 1UECA 1YP5A 4CQIA 4ZS2A 5LBMA 1HF8A 2JS0A 4B6XA 4J9GA 4H9QC 2RQUA 2Z6EA 1QKXA 4HKAA 3N2GE 3ANWB 4GBQA 2HBWA 5LGUB 2PBIA 2EPDA 4R0KA 3IQLA 2X9HA 3AA1B 2LSYA 3CWZB 2DBKA 1PNJA 4AKGA 1OPKA 2NW9A 4BAYB 1AWXA 3RRCA 1ABQA 3HKBE 4CC2A 4A63B 4ASKA 4DMVA 2A2FX 3EHRA 1K0XA 3NBXX 1U5SA 1GCQA 2WBLA 2VKNA 3UT5E 3PU8A 1SRMA 3EGUA 4CI1B 3ZMZB 4MBQA 1QCFA 2EHOA 1M3AA 2PG8A 1YKEB 1EFNA 2FRYA 2CWOA 5LGTB 1RI9A 4IIJE 2L3SA 1O3XA 4AKLA 4ANJA 3QC9A 3KV4A 3PUGA 4U74A 5HWYA 4KBMB 4UF0A 5LBQB 2CUBA 3PUSA 4AG2C 4CI2B 3KBUA 4IHJE 1NLPC 1KJWA 2L9QA 1M30A 5DJQC 1M3CA 3C4ZA 2JMAA 2JM9A 4PJJA 1NEGA 3IEEA 2V1DB 3I9WA 2DI4A 1H3HA 2UXNB 3PTRB 4L9IA 3PDYA 1KSWA 3JC6D 2DF6A 3L09A 1K76A 1WLPB 2Y8DA 3L3PA 5JDNA 4HCKA 2WSSV 2X68A 3CQGB 1FIOA 3EVYA 4AFSC 1X6GA 3NHNA 3EG0A 3FXDB 1B07A 1NM7A 1IJ5A 3MKDA 1CUNA 3AVRA 4H63H 2E9XD 4TZ4C 1T3SA 5M4YA 2BDEA 4X20E 5JDFA 1OPLA 4HVUA 3ESLA 3LK3B 2KXCA 2ROLA 3PE0A 3KV9A 5IHYA 2KZ7B 2XMFA 2JMKA 3K8PC 3C64A 2F2WA 4I4TE 1OOTA 1I1JA 2JMCA 2P4RA 2DWGA 5JDLA 1RUWA 2BZXA 5GJVB 1PRLC 3KDSE 2OJ2A 2VK9A 1BK2A 3O1HA 2CCQA 1QWFA 2EW3A 1E7OA 2W0GA 3ZPOA 2GGRA 2NUZA 1VOMA 4ADZA 4RTUA 4JEHB 1RLPC 2MTQA 2EGAA 3AA6B 2DWKA 2JS2A 4EXTA 3SWHA 1PKTA 5F8PA 3UATA 1M27C 3C4XA 2X0LB 4ZI7E 3LG7A 2HCKA 5FYMA 4L5GA 2KXPB 2CSQA 1US7B 4AQFA 1X27A 4F14A 4QWNB 1WFWA 1Z9ZA 1CSKA 2EGEA 5EK2A 1GCQC 4ERRA 2F2XA 1KIKA 2X9YA 3FB2A 3KV5A 2D5UA 4PJNA 4CXYA 1B7TA 2MIOA 2EHOC 1JXMA 2JQQA 2K9AA 5EC7A 1YD8G 1AZGB 4GK0E 2NW7A 3OYZA 3GBQA 4DEXA 2CT4A 2CXFA 4H9NC 3Q9DA 2KT1A 2DM1A 3MACA 5ETWA 3EG2A 4IE0A 3ZC1A 4JPBW 5JRCA 3M0UA 3E22E 2H3RA 1A0NB 4IE7A 4IDZA 1VA7A 2B86A 2V7LA 2CWYA 2YT6A 2NW8A 2VKHA 3KFVA 4BJNA 2VKDA 5CA1E 2M0YA 1SHZC 2D0NA 2N1GA 5GONE 2J6FA 4HVWA 4WBOA 2EYYA 3N9NA 4AKRB 5C8YE 2YUOA 4OMOA 1UTIA 1D1BA 2CA5A 3VS5A 1BU1A 3MZKB 4JJBA 2W62A 2ABLA 3DP7A 4E7SA 1X43A 1EZ3A 4QXBB 3HL6A 4IE4A 2C0TA 3PUAA 1FMWA 5E0OA 2BZBA 1HG2A 2DNUA 2FPFA 3HKDE 1UJ0A 3RC3A 4NUUA 5IHIA 4ILUA 1MIYA 1T3LA 2LQNA 1D0ZA 4DNDA 2JXBA 4M1PA 3ZMUB 5FWBA 5FXZA 2JT4A 1K4US 5LYJE 2ODVA 2GNCA 3MA9A 3O1JA 1JU5C 2GTJA 3LJCA 2Q9QD 2PFVA 4QHOA 2QDLA 2XASB 2NOXA 2EHOB 1YWOA 3BQIA 4HXJA 2X3XD 1QLYA 1MV0B 4AKIA 1VYUA 3IF8B 1QUUA 3VHLA 4ORZA 2SPCA 3AA0B 2ODUA 3UULA 4KRTA 3VS1A 1ABOA 4GYRA 2CDTA 5ADXL 1ZUYA 1AWJA 3IBPA 1NWMX 1UX5A 3I1AA 3RRWA 3UA7A 1AZEA 1E6GA 4QXCB 3WI3A 4UVBB 4ZNXA 4ISTA 1GBRA 4D8KA 5IHKA 2LJ0A 4ESRA 1IJ6A 1PRMC 1WYCA 2KLQA 2KT8A 5JR9A 5LJMA 4JZ4A 2WWUA 5LA6E 3FHNA 2LQWA 1MMAA 2CM0A 4AQFC 2HDAA 3LBXB 1LRZA 2J7IA 3OJAA 4QT7A 3H37A 4RTZA 3N9PA 4EZ4A 3O1IA 3J9X1 1ZUUA 3ZMSB 4O4HE 4DO0A 1U3OA 3ZLIA 5FP3A 3SHWA 3CKDA 2CSIA 1ZX6A 2Y6XA 2ED0A 2UXXB 2ZM2A 2YU1A 4DEYA 4O4JE 1H92A 5FXVA 4G63A 2F2VA 3QUJA 2A72A 2I59A 3EG3A 1VRBA 2KYMA 1UHFA 2HPJA 5GJWB 5EK3A 3PURA 4H63V 3NRYA 3ULRB 3KBTA 4ZI2D 3RX6A 1LVKA 2CE7A 5HXSA 2DILA 2XHEB 4OK0A 4P09A 1I0CA 2AZVA 3ZN1B 1AEYA 3CQCB 4HGAA 4OMLA 2Q9QA 5LOVE 2X9WA 3AAAB 2CEAA 3WAKA 2EYWA 3UFEA 1HD3A 2KNDA 3UF4A 2K5BB 1W6XA 2D8JA 2X3WD 3BQLA 5F3JA 4U72A 3O5ZA 1LVFA 3TKLB 2MOZA 2VB6A 3C50A 3AA7B 3J7Yq 2KNBB 2RMOA 4BJMA 1CKBA 4AFQC 3F31A 4H9RC 3K3QC 2J1DG 2N2NA 2VWFA 2DNXA 3N2OA 4KP3C 4P0AA 3TVTA 4QX8B 3FBLA 2ECZA 2VL8A 2DE0X 5IXFA 2J06A 2D2SA 1FMVA 3KFWX 1MV3A 1X69A 3SOLA 2JRKA 3B13A 3NZPA 3M0QA 1G73A 3ZJ2A 3ETVA 4ZS3A 1SPKA 5EZYE 2DX1A 1BB9A 1GFDA 4Z8AA 3MK7C 5LHGB 2NWBA 2EYXA 4H9OC 2M51A 3RKOA 3C51A 4V1Av 2BTTA 2WAUA 3ZCIA 1MMGA 1WA7A 5HAXA 4JUYA 2CXDA 4UEMA 2KR3A 3ETUA 3C4WA 1JQQA 5L3BB 3N5LA 2V7KA 5FXWA 1QWEA 2IC9A 3I0QA 4K11A 5JRCB 3V5SA 4TX5A 4WBNE 4PJMA 3VS7A 2LHNA 4OHFA 2C5JA 3EHQA 3UA6A 3WAJA 1TUCA 2G0UA 3ZYMA 2YINA 2DL7A 2DBMA 1YWPA 5LJNA 2A37A 2SRCA 2KMFA 2AKKA 2AZSA 3W15B 4PFOA 5JR9C 1T0HA 3LH5A 4WNKA 2DRKA 4IIOA 4PW8A 2ACXA 1T98A 4EB6E 4F16A 3M0RA 2ENMA 4OMQA 1U06A 2O88A 4X1KE 2KWIB 1KNZA 4EIKA 4Z89A 4RTXA 3H0FA 3U23A 4G2AA 3AAEB 3LFMA 2RA1A 2HEQA 5J1GA 1MIWA 3GN5A 2D8HA 1Y57A 2AK5A 3DTOA 4IIMA 3M0SA 2W63A 4DMWA 3RYCE 1OEBA 1ZV4X 2V1RA 2L8KA 2BZYA 2V7MA 5HWXA 5L3GB 2LSKA 3RYIE 4J9DA 2VASA 1JO8A 4WW0A 4OYJA 1OWAA 5LGNB 4UIGA 2ZM0A 3R84B 2LNHB 1G83A 1HCIA 2CLYC 2X51A 1TG0A 3Q5WA 2GBQA 4TV9E 5FMNA 1HJDA 1UCUA 3VU7H 1KFZA 2HSPA 3VS2A 4JLEA 4H9SE 2IAKA 3ONXA 4YFSA 3ZJ1A 1K0SA 2VVKA 4OFZA 2E8IA 2WMNA 1SHGA 4GIWA 4UV8B 2EGCA 1JEGA 3A5XA 2W10A 2FO0A 2GTOA 4X1YE 4JEUB 2LJ3A 2GK9A 2K2MA 5JR9B 2V7IA 1B3QA 3GWHA 2L0AA 5LP6E 3ZN0B 5AFUL 2KT9A 4PAGA 3OYXA 3N2KE 4EYUA 1BR4A 1K9AA 2LX7A 1ZHCA 2NP9A 4AFUC 2YSQA 2X67A 3PVLA 2E9XA 2DHRA 5KDMC 2DJQA 2BVMA 3I9QA 3NGPA 4CXWA 2C0OA 3V5UA 1MIVA 3N9QA 4ZHQE 2DLPA 4RUGA 3N9MA 4P0BA 4E7ZA 1LCKA 1NYGA 1SHFA 4XBFB 2LOSA 1UE9A 2K9GA 2CH4W 5DABA 3THKA 3ZL7C 4HFVA 3C0CA 2KYBA 2DL5A 2OAWA 1XOVA 1UUEA 4AI6A 1WI7A 2J6OA 4ZI2C 1WLXA 1SSHA 3CX7B 1X2QA 2X9XA 3ZMVB 1TUDA 1G8XA 3H41A 2Q9QB 3RH3A 3H0IA 2CLYB 3FBZA 2EYZA 3TSZA 4CC4B 4TUYE 4CC3A 1NLOC 4F6RC 2BZ8A 1IO6A 2LJ1A 2RPNA 1LKXA 4AFZC 3A98A 2KROA 1AVZC 4OYKA 1OXZA 3TSWA 1WXUA 1UFFA 2DA9A 2D0TA 3E0ZA 5LG4A 3E08A 4LNPA 2WMOA 2I0NA 1QKWA 4HVVA 3QWXX 1K1ZA 1HX8A 1UDLA 1ZEEA 2N9DA 4RTTA 4FJOA 2RQVA 3RNJA 5FXXA 4CZZB 1YKHB 2CUDA 1QSDA 4O4IE 3SS1A 2NTYA 5HYAA 3I9YA 3HKEE 5H6RB 1PWTA 3OBVE 3EDUA 3CVRA 1WYXA 2KRMA 4PNIA 4J9HA 5IH2A 3H0HA 5JDMA 2C0IA 3VRZA 4UXNB 4UF0B 4GK5E 3ZEFB 1WXBA 2ES0A 4J9EA 5L2LA 1GRIA 4M4ZA 3GA8A 5A1LA 2K79A 4DBQA 1MNDA 1V9DA 5L3DB 3RC8A 2JJ9A 2GQIA 2IIMA 1HFAA 2WM9A 5JH7E 2Y48B 3KINB 2E5KA 4LN2A 1J3TA 3HKCE 2DL4A 2P9BA 1UGVA 1S1NA 1H7CA 4UVCB 3HI2A 5JQGE 3FJ5A 3JC6C 3OKQA 1MNEA 2X66A 2D0UA 5TAOA 1G2BA 3U78A 1S94A 1D1AA 5L3FB 1U4QA 4GLMA 1AOJA 2XQYA 3UTKA 3S4UA 3NMZC 4UVAB 5HCKA 4HTEA 3FXEB 4LUDA 3R6NA 3REBB 2H8HA 3N9OA 5JDHA 4X1IE 4LE9A 1Z9QA 2DVJA 1MMDA 1U5PA 3M65A 4RTVA 1D0XA 3EDVA 2E9XC 3HA4A 5FY1A 3KV6A 5L3EB 3SRZA 4ZI3D 3BK9A 5L3CB 4Z88A 2MOXA 4QXHB 1FYNA 4PJLA 2L3LA 4MALA 5IXBA 1PHTA 1FMKA 2A3DA 3M0PA 5L23A 3VRYA 2DCFA 2NWMA 1SA0E 3GN5B 2HPLA 3UUMA 1ZKEA 2LSGA 4RTYA 5JDGA 2IC6A 2FEIA 2EKHA 3VKHA 4N78D 1W70A 4L0RA 2LT3A 1NEBA 2ZMAA 3K3OA 2KE9A 1ZLMA 2XAQB 4LUEA 3I5RA 3VS3A 2JMHA 4D8DA 1AJ3A 1FEWA 4TN7B 2RP4A 2KRSA 5KX5E 2D1XA 5H6QB 1UG1A 2LCSA 2AKLA 3M0TA 2J6KA 4XAXB 3GMIA 4JZ3A 2KEAA 1HG5A 5J2TE 3U3IA 1BR1A 3D0TA 1BBZA 2C5IT 2FPDA 4GYSA 1GBQA 2K6DA 2ED1A 4EIWA 2C0SA 2RQRA 2LHRA 5EK4A 1NG2A 4UELA 2LM9A 5HXEA 4FI5A 2H7OA 2HH7A 3F57A 3SEMA 3CQTA 2XUEA 4O8SA 4X1VA 4HEAA 1H8KA 1IAPA 2V26A 4XZCA 4YJ3E 4CI3B 2E9XB 4MHCA 1WR6A 5FNVE 4YJ2E 2DYBA 1YW0A 3EG1A 4WCIA 3ZYKA 2DLRA 2XAGB 2JW4A 1MUZA 3LK42 2J05A 2B1EA 4GOUA 4HE8A 4QX7B 3LBXA 3H3AA 4YLHA 4UV9B 3T8OA 4H9PC 4ISSA 4K0UA 4RTWA 2A36A 5HXHA 1SEMA 2K48A 5JDQA 4IGUA 2QA7A 2CXLA 4DBRA 5ECAA 1WRDA 2OA5A 1Y64B 1UJYA 2LE8A 1E6HA 2BVLA 1MMNA 2W00A 1UX4A 5HXCA 2CMRA 2CREA 4EYYR 3EUHA 3Q2MA 2K3BA 2MYSA 1VYVA 4C91A 5KMGP 1V1CA 3ANWA 2O9VA 1M3BA 1N5ZA 4MFRA 2CT3A 1PKSA 4AG1C 1WYBA 4CXXA 5FY7A 2VWAA 4EZHA 2O31A 4JJDA 4J9IA 2G6FX 2C5KT 1OV3A 3RBBB 2V7JA 2O9SA 1YNZA 2Q9QC 4KMCA 5BMVE 2LMJA 3JV3A 5FW9A 1JXOA 3CQXC 1UHCA 3KVBA 4OMPA 1CKAA 1ARKA 4QKNA 2A28A 3P8CD 1VYTA 1D1CA 4DVDA 1WIEA 1HSQA 2LP5A 3I0OA 2OI3A 2M67A 1I07A 1S35A 5LXTE 2ROTA 4E6RA 3I5SA 4AKHA 2XAFB 3NZQA 1X79A 3Q5XA 3REAB 2YUPA 4PK4A 5JVDE 4PK5A 3MXZA 2RF0A 2YEVC 4TV8E 1BR0A 3PU3A 3LK2B 1AWWA 3AAIA 4O2AE 3RPUA 2KINB 4HN9A 4FSSA 5J2UE 1HTJF 4J9BA 2W61A 1WXTA 2ESWA 1YCSB 3P7IA 3K3NA 4IE5A 2XTLA 2H7VC 1ZUKA 5IYZE 2YU2A 4KUMB 4PK6A 2LSJA 2ZM8A 3ZMTB 3O4XE 5LHIB 1WDXA 3UUXB 2L2PA 5CB4E 1GFCA 2A08A 2FPEA 4EAHA 4ZI3C 2KRNA 2YDLA 2KXDA 2PTKA 4OMNA 1M8MA 4I43B 3ZYLA 3AB3B 1X2KA 1E1HB 3BQKA 2PJQA 1NAFA 4OMMA 3ZC0A 2VKOA 4PFPA 4ZOLE 2PNIA 2MBGA 2LJLA 5FWCA 4J2CA 4JJCA 1Y0MA 2RNAA 1BR2A 1WX6A 2PZ1A 3DJBA 2YUNA 3QK6A 1GL5A 3QWYA 4NUVA 2O2OA 1D0YA 2XAJB 3IHRA 5I22A 2RQWA 2L3QA 2DL8A 3B57A 3VS0A 2QGSA 2NTXA 1IZNB 2DRMA 1ZBJA 4O4LE 4I50E 3RYFE 5DQWA 4C90A 3F2EA 2JM8A 1X6BA 2DL3A 2L3PA 1AWOA 3CMLA 4YHJA 2LOPA 2VKJA 2CH4A 1YN8A 3VS6A 1ZSGA 3ZCJA 5LNKA 3VKGA 2SEMA 4O2BE 3CX8B 3PVQA 3HR0A 1AD5A 3N9LA 3I35A 3CX6B 2IW5B 3UUNA 2RN8A 3MJXA 4AQGA 2JPFA 3KVAA 3NRXA 1T0JA 4MLKA 1KK7A 2RQTA 5FY0A 2KGTA 3CPZA 1NYFA 2LSIA 2EVRA 2K24A 2EHOD 1GCPA 2YK0A 3RYHE 4Z8XA 1W1FA 4J9CA 3VS4A 2W0ZA 4J9FA 3PUQA 5CA0E 2EQIA 4BA9A 4Y92A 1RLQC 5DQVA 2EBPA 2KWHA 5HXRA 2V1QA 3AVSA 1SRLA 2YUQA 2DMOA 2K7AA 3C98B 5JREA 3NPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTE A;  1H8K A;  1TG0 A;  5IHN A;  5I11 A;  2GBQ A;  2DNU A;  2FPF A;  1HJD A;  1UJ0 A;  1KFZ A;  2HSP A;  5IHI A;  2FG0 A;  2LZ6 B;  3VS2 A;  1T3L A;  2FRW A;  4F17 A;  2LQN A;  2IAK A;  4CC7 A;  2KBT A;  2DYB A;  2JXB A;  2MCN A;  3EG1 A;  4WCI A;  1K0S A;  5FWB A;  2JT4 A;  1K4U S;  1UEC A;  2VVK A;  2JW4 A;  1MUZ A;  1YP5 A;  2J05 A;  2GNC A;  1SHG A;  2JS0 A;  2EGC A;  1JEG A;  4J9G A;  2W10 A;  2FO0 A;  2RQU A;  1JU5 C;  1QKX A;  2GTJ A;  2GTO A;  4RTW A;  2LJ3 A;  2K2M A;  4GBQ A;  2QDL A;  2A36 A;  1B3Q A;  1SEM A;  1YWO A;  2HBW A;  2L0A A;  4HXJ A;  2X3X D;  1QLY A;  1MV0 B;  2EPD A;  1VYU A;  4R0K A;  3IQL A;  1K9A A;  2DBK A;  4ORZ A;  2LX7 A;  1PNJ A;  4AFU C;  5ECA A;  2YSQ A;  1OPK A;  4KRT A;  3PVL A;  1AWX A;  3VS1 A;  1ABO A;  2DJQ A;  2CDT A;  1UJY A;  1ABQ A;  3I9Q A;  1E6H A;  3NGP A;  4CC2 A;  4A63 B;  1ZUY A;  2C0O A;  1AWJ A;  3EHR A;  2CRE A;  1K0X A;  2DLP A;  3UA7 A;  1AZE A;  4RUG A;  1E6G A;  1U5S A;  1GCQ A;  4ZNX A;  2VKN A;  2K3B A;  1GBR A;  1LCK A;  1VYV A;  4D8K A;  5IHK A;  1NYG A;  2LJ0 A;  4ESR A;  1SHF A;  1V1C A;  1PRM C;  1SRM A;  3EGU A;  2KT8 A;  1UE9 A;  2K9G A;  2O9V A;  1M3B A;  4JZ4 A;  2CH4 W;  1N5Z A;  2CT3 A;  1QCF A;  1PKS A;  3THK A;  3ZL7 C;  1M3A A;  4AG1 C;  1EFN A;  2LQW A;  2HDA A;  2FRY A;  3C0C A;  2KYB A;  2DL5 A;  2OAW A;  1XOV A;  1RI9 A;  1UUE A;  2J7I A;  1WI7 A;  4QT7 A;  2L3S A;  2O31 A;  2J6O A;  4JJD A;  4RTZ A;  2G6F X;  1OV3 A;  4J9I A;  3RBB B;  1SSH A;  1ZUU A;  2O9S A;  1X2Q A;  1U3O A;  1YNZ A;  1TUD A;  1G8X A;  3H41 A;  3H0I A;  3SHW A;  2CSI A;  2EYZ A;  1ZX6 A;  2ED0 A;  3TSZ A;  4CC4 B;  4CC3 A;  2LMJ A;  3JV3 A;  5FW9 A;  4DEY A;  1NLO C;  1H92 A;  2CUB A;  1JXO A;  2BZ8 A;  1IO6 A;  2LJ1 A;  1UHC A;  2F2V A;  2RPN A;  4AFZ C;  4OMP A;  1CKA A;  1ARK A;  3A98 A;  2KRO A;  4AG2 C;  3KBU A;  1NLP C;  1AVZ C;  2A28 A;  3EG3 A;  1VYT A;  1KJW A;  1WIE A;  3TSW A;  2KYM A;  1WXU A;  1HSQ A;  2LP5 A;  1UHF A;  1UFF A;  2DA9 A;  1M30 A;  5GJW B;  1M3C A;  2JMA A;  2OI3 A;  2JM9 A;  4LNP A;  1NEG A;  2I0N A;  1I07 A;  3ULR B;  1QKW A;  4HVV A;  3QWX X;  1K1Z A;  2ROT A;  4E6R A;  3KBT A;  3I5S A;  1H3H A;  1UDL A;  3PDY A;  1KSW A;  4RTT A;  2DF6 A;  2DIL A;  3REA B;  2RQV A;  2YUP A;  1I0C A;  2AZV A;  1K76 A;  3RNJ A;  1AEY A;  1WLP B;  2CUD A;  4OML A;  4HCK A;  2RF0 A;  1PWT A;  4AFS C;  1AWW A;  3EDU A;  1X6G A;  3NHN A;  3EG0 A;  1WYX A;  2KRM A;  2EYW A;  1B07 A;  4J9H A;  1NM7 A;  5IH2 A;  1HD3 A;  3H0H A;  3UF4 A;  2C0I A;  1W6X A;  2D8J A;  2X3W D;  3VRZ A;  1T3S A;  4FSS A;  4J9B A;  1WXB A;  4J9E A;  4HVU A;  1OPL A;  1GRI A;  3O5Z A;  4M4Z A;  2KXC A;  1WXT A;  2ROL A;  2ESW A;  2K79 A;  1YCS B;  3PE0 A;  2KNB B;  2RMO A;  1CKB A;  2XMF A;  4AFQ C;  2GQI A;  1ZUK A;  2VWF A;  2F2W A;  2IIM A;  3TVT A;  1OOT A;  1I1J A;  2E5K A;  2JMC A;  2P4R A;  2ECZ A;  1RUW A;  2BZX A;  4LN2 A;  5GJV B;  1J3T A;  1PRL C;  2DE0 X;  5IXF A;  2DL4 A;  2J06 A;  2OJ2 A;  1UGV A;  1S1N A;  1BK2 A;  1MV3 A;  1WDX A;  1X69 A;  1QWF A;  2L2P A;  1GFC A;  2EW3 A;  2A08 A;  2FPE A;  1E7O A;  2KRN A;  2YDL A;  2KXD A;  2PTK A;  4OMN A;  3M0Q A;  1M8M A;  2GGR A;  2NUZ A;  3FJ5 A;  1X2K A;  1SPK A;  1G2B A;  2DX1 A;  1BB9 A;  1GFD A;  4RTU A;  4Z8A A;  2EYX A;  1RLP C;  2M51 A;  2EGA A;  2JS2 A;  4OMM A;  4GLM A;  1AOJ A;  2BTT A;  2PNI A;  3NMZ C;  5HCK A;  1PKT A;  1WA7 A;  4JJC A;  5FWC A;  1Y0M A;  2RNA A;  3UAT A;  1WX6 A;  2PZ1 A;  1M27 C;  4LUD A;  3R6N A;  2KR3 A;  3REB B;  2H8H A;  2YUN A;  1JQQ A;  2HCK A;  1GL5 A;  4LE9 A;  1Z9Q A;  2DVJ A;  3QWY A;  2O2O A;  1QWE A;  4RTV A;  3EDV A;  4K11 A;  5I22 A;  2RQW A;  2CSQ A;  2L3Q A;  2DL8 A;  3VS0 A;  3VS7 A;  1X27 A;  4Z88 A;  2MOX A;  4F14 A;  1FYN A;  1WFW A;  1Z9Z A;  3EHQ A;  3UA6 A;  1CSK A;  5IXB A;  2EGE A;  2DRM A;  1ZBJ A;  1TUC A;  1PHT A;  1FMK A;  3M0P A;  5L23 A;  2JM8 A;  1GCQ C;  2NWM A;  1X6B A;  2DL7 A;  2DL3 A;  3VRY A;  2F2X A;  2L3P A;  1AWO A;  2DBM A;  1YWP A;  1KIK A;  2A37 A;  2CH4 A;  2SRC A;  1YN8 A;  2AKK A;  2AZS A;  3VS6 A;  1ZSG A;  4RTY A;  2MIO A;  1T0H A;  3LH5 A;  2DRK A;  1JXM A;  4IIO A;  2FEI A;  5EC7 A;  1AZG B;  2SEM A;  2EKH A;  3GBQ A;  4DEX A;  2CT4 A;  1W70 A;  2KT1 A;  2DM1 A;  1NEB A;  4F16 A;  2KE9 A;  3PVQ A;  3EG2 A;  3M0R A;  1ZLM A;  2ENM A;  4JPB W;  4LUE A;  3I5R A;  4OMQ A;  1U06 A;  1AD5 A;  3VS3 A;  3M0U A;  2O88 A;  4D8D A;  1A0N B;  1VA7 A;  3I35 A;  2B86 A;  4EIK A;  4Z89 A;  2RN8 A;  4RTX A;  2YT6 A;  3H0F A;  3KFV A;  3U23 A;  2M0Y A;  2D0N A;  2KRS A;  1T0J A;  2D1X A;  2HEQ A;  2RQT A;  2J6F A;  5J1G A;  2D8H A;  1Y57 A;  2AK5 A;  2KGT A;  4HVW A;  1NYF A;  1UG1 A;  2LCS A;  2AKL A;  2EVR A;  4IIM A;  2EYY A;  3M0S A;  3M0T A;  2J6K A;  1GCP A;  2YUO A;  4JZ3 A;  2KEA A;  4OMO A;  1OEB A;  1UTI A;  2V1R A;  2BZY A;  1W1F A;  4J9C A;  3VS4 A;  1BBZ A;  2W0Z A;  4J9F A;  2EQI A;  2FPD A;  3VS5 A;  1BU1 A;  1GBQ A;  2K6D A;  2ED1 A;  4Y92 A;  4J9D A;  1RLQ C;  1JO8 A;  4JJB A;  2RQR A;  2EBP A;  1NG2 A;  2V1Q A;  2ABL A;  2LNH B;  1SRL A;  3F57 A;  1X43 A;  2YUQ A;  3SEM A;  2DMO A;  3CQT A;  2K7A A;  2C0T A;  1G83 A;  3NPF A;  4X1V A; 
#chains in the Genus database with same CATH topology
 1VQP Q;  2JTE A;  4IE6 A;  1NZ9 A;  5IHN A;  2XAH B;  5I11 A;  2J47 A;  2X4J A;  3SFM A;  3O9X A;  4BI4 A;  3AE7 A;  5LCY A;  1HS7 A;  4AXP A;  4XTW A;  4P1N A;  4JRI A;  2LEH A;  4U3C A;  1ZA1 B;  5HEU A;  4EOZ B;  1OI1 A;  3BDU A;  4ILC A;  2ZLY A;  2FG0 A;  2LZ6 B;  4I55 E;  2VXF A;  4DBH A;  1Z0P A;  3UU5 A;  4M7A F;  2FRW A;  5D6W A;  4F17 A;  4DR4 T;  4CC7 A;  1NEN A;  5LHH B;  4JV5 T;  2KBT A;  5KYU B;  2WSF E;  1M5Q 1;  3QOF A;  2MCN A;  3OYM A;  3RIU A;  4A56 A;  3Q1J A;  2WZI A;  1UEC A;  2VYT A;  1YP5 A;  4CQI A;  3T1H T;  2R5M A;  4ZS2 A;  2COY A;  5LBM A;  3Q5D A;  1HF8 A;  2JS0 A;  2OTL T;  3CCV T;  4B6X A;  4J9G A;  4H9Q C;  4ILB A;  2JZ2 A;  2RQU A;  3GLX A;  2Z6E A;  1OUL A;  1QKX A;  4HKA A;  3N2G E;  3LDQ B;  3ANW B;  4GBQ A;  1XJW B;  2HBW A;  4JUV A;  3CC4 A;  3LGL A;  3SWN A;  5LGU B;  2PBI A;  2EPD A;  4R0K A;  3IQL A;  3L2Z A;  2X9H A;  3AA1 B;  2LSY A;  3AE1 A;  3CWZ B;  4C8Q D;  2NUP B;  2DBK A;  2LRK A;  1PNJ A;  1ZQ1 A;  4X64 T;  4AKG A;  1OPK A;  1XQH A;  2Y90 A;  3VR8 A;  2LT4 A;  2NW9 A;  3M59 A;  1WCR A;  4BAY B;  5GAN j;  1AWX A;  1J5W A;  1VQK A;  1J5E T;  5J3B A;  3RRC A;  1ABQ A;  3HKB E;  1HNX T;  4B9W A;  4CC2 A;  4A63 B;  4ASK A;  2DIQ A;  4DMV A;  1WHG A;  1WNL A;  2A2F X;  1VQP T;  4YXD A;  4LD6 A;  3EHR A;  2YRD A;  1K0X A;  5CO7 A;  4ILA A;  3NBX X;  1LOJ A;  1U5S A;  1WHM A;  2WZH A;  3CMA A;  1GCQ A;  3ZSS A;  2WBL A;  2VKN A;  4PL6 A;  3UT5 E;  3QJY A;  3PU8 A;  3RHW A;  5KYW A;  5GAN e;  5IN1 A;  2K2V A;  2JTF A;  2VL0 A;  1SRM A;  4JDS A;  3EGU A;  4CI1 B;  2GQV A;  1VQ5 Q;  3ZMZ B;  1G3W A;  1EX4 A;  4MBQ A;  1QCF A;  2EHO A;  3BY7 A;  1SKU B;  1M3A A;  4FYV B;  2PG8 A;  1YKE B;  1OX8 A;  4HWH A;  1EFN A;  3J81 E;  2FRY A;  3V8K A;  1U8R A;  2CWO A;  2HQH A;  5LGT B;  1RI9 A;  2FVU A;  4HT8 A;  4A4H A;  4IIJ E;  1BIA A;  1T8B A;  1KHC A;  2FHD A;  2L3S A;  2F69 A;  4MDW A;  1O3X A;  3L39 A;  4AKL A;  1TUG B;  1UUR A;  2YLC A;  3QSU A;  2LDM A;  2AT1 B;  3CCJ T;  1WZO A;  4ANJ A;  3QC9 A;  4Q5W A;  3AEA A;  3KV4 A;  5L4H A;  3PUG A;  4LFB T;  2RB6 A;  4BDY A;  4HKE A;  4U74 A;  4M78 F;  2H3J A;  3EGD B;  5HWY A;  3PFS A;  4FYX B;  4KBM B;  3TRE A;  1SF9 A;  4UF0 A;  3CC7 A;  5LBQ B;  2CUB A;  5AQR B;  4L6V 5;  2XU8 A;  3PUS A;  2NLU A;  2BIV A;  2VGM A;  4AG2 C;  2J4G A;  4CI2 B;  3KBU A;  4IHJ E;  1NLP C;  2DJZ A;  3X25 B;  1I6Z A;  2K57 A;  1KJW A;  2HD0 A;  2L9Q A;  5HCJ A;  3EFR A;  2UUA T;  5KCO A;  1M30 A;  5DJQ C;  1M3C A;  3C4Z A;  2FYK A;  2JMA A;  1T72 A;  2JM9 A;  4PJJ A;  1NEG A;  1QW1 A;  4IDN A;  3IEE A;  2CP5 A;  4COF A;  3PTA A;  5GAN 5;  2V1D B;  3I9W A;  1UGS B;  2DI4 A;  4O6J A;  1D09 B;  3KXT A;  4ME7 A;  1H3H A;  2UXN B;  4HA8 A;  3PTR B;  4L9I A;  2JTM A;  4HWI B;  1YJ9 A;  3PDY A;  4U7Y A;  1KSW A;  1VQ6 Q;  3JC6 D;  5AQO B;  2DF6 A;  3L09 A;  3V8J A;  1K76 A;  1VQ5 T;  1W2B P;  1JNR A;  1WLP B;  2Y8D A;  4LXC A;  4C0D C;  2E2A A;  2DEQ A;  2XG8 D;  3L3P A;  5JDN A;  2WSC E;  2RK2 A;  4M77 A;  4C0G A;  4HCB A;  4HCK A;  2WSS V;  2X68 A;  3CQG B;  4M78 C;  1FIO A;  3EVY A;  2XK0 A;  4AFS C;  1X6G A;  4C8Q A;  3JCM d;  3NHN A;  3EG0 A;  4JLG A;  4X9C A;  3UU8 A;  3FXD B;  1B07 A;  1NM7 A;  3NTI A;  1XTD A;  3L2Q A;  1IJ5 A;  3MKD A;  1M7K A;  1YI2 Q;  1CUN A;  3AVR A;  3OYC A;  4H63 H;  2E9X D;  4KUI A;  3RF1 A;  4TZ4 C;  1T3S A;  1KQ1 A;  1HNW T;  1HX1 B;  5M4Y A;  2BDE A;  2M0O A;  2LNV A;  4J6Y A;  3OMG A;  3CBO A;  2P0Q A;  3T1Y T;  3JB9 G;  4X20 E;  3QO3 A;  5JDF A;  1OPL A;  4HVU A;  1KD1 C;  4CN4 A;  4J8O A;  3ESL A;  3LK3 B;  4XU2 A;  2KXC A;  4QQD A;  2ROL A;  3PE0 A;  3KV9 A;  3WXM B;  5IHY A;  1KQS P;  2EQK A;  4HWC A;  2KZ7 B;  1RAC B;  2DD5 A;  2XMF A;  2JMK A;  3OYJ A;  4OX9 T;  3K8P C;  1YBY A;  3C64 A;  2F2W A;  5FL1 A;  4I4T E;  1W09 A;  2JOY A;  4M78 G;  3LSV A;  1H3Z A;  2BS3 A;  4XTZ A;  1OOT A;  1I1J A;  2JMC A;  2P4R A;  2DWG A;  5JDL A;  1RUW A;  2BZX A;  5GJV B;  3NTK A;  1PRL C;  3FJP A;  3KDS E;  2OJ2 A;  2RD1 A;  2VK9 A;  2R6G F;  5GMK j;  1BK2 A;  3O1H A;  5IAY A;  2CCQ A;  5LJ5 h;  5AQG B;  3QUI A;  3P4W A;  2RJF A;  1VCS A;  1QWF A;  2EW3 A;  3RIU C;  5GAO l;  1E7O A;  1VQ6 T;  3CCQ Q;  5ABE A;  2W0G A;  3ZPO A;  2HKN A;  1TXQ A;  2GGR A;  2NUZ A;  5LJ3 d;  5FRO A;  1VOM A;  1VQ7 Q;  3HRT A;  4PKC C;  1Q7Y U;  3OS1 A;  4ADZ A;  2DAQ A;  3JCM J;  4RTU A;  4LDU A;  4JEH B;  1RLP C;  2MTQ A;  5AQH B;  4ZZB A;  2EGA A;  3AA6 B;  2DWK A;  2JS2 A;  4FW1 A;  3JCM f;  5GMK e;  4B3M T;  3M9Q A;  2LT1 A;  4EXT A;  3SWH A;  1PKT A;  4LF8 T;  5F8P A;  2ZCF B;  3UAT A;  4EMK B;  1M27 C;  3C4X A;  2X0L B;  3SWN C;  4ZI7 E;  4ZGE B;  5GAM g;  1QCN A;  3QJ6 A;  3NKZ A;  3LG7 A;  2HCK A;  3FRN A;  3JCM h;  5FYM A;  5ABF A;  4L5G A;  2KXP B;  1KEY A;  4MZT A;  2OTL A;  4C0F A;  4X9D A;  2CSQ A;  1US7 B;  3CCV A;  2QA4 Q;  4AQF A;  1IHV A;  1RAE B;  1X27 A;  1TTH B;  2YN6 A;  5FU6 B;  4F14 A;  4QWN B;  1Q82 R;  1WFW A;  5AYF A;  1Z9Z A;  4EMH A;  1CSK A;  4IDP A;  2EGE A;  5FKY A;  4LF9 T;  3P8B B;  3ZT5 A;  5EK2 A;  1GCQ C;  4ERR A;  2IG0 A;  2F2X A;  4C0D B;  1JRI A;  2BE7 D;  5AQT B;  1KIK A;  3MO8 A;  2X9Y A;  3FB2 A;  2V6Y A;  2KAF A;  2FZG B;  3KV5 A;  2D5U A;  4U31 A;  4JJN K;  4M78 B;  2MAW A;  3A8L B;  3H9N A;  4PJN A;  4CXY A;  1BCM A;  4RG8 A;  1B7T A;  2MIO A;  2WB5 A;  5LJ3 f;  1LJO A;  1M90 R;  2EHO C;  4JRP A;  1JXM A;  3CCQ T;  2JQQ A;  2K9A A;  4TVR A;  5EC7 A;  1YD8 G;  3QZ9 B;  1AZG B;  1SE7 A;  4GK0 E;  2NW7 A;  3OYZ A;  4YTN A;  1VQP A;  3GBQ A;  4DEX A;  1VQ7 T;  2IML A;  2CT4 A;  4ZGJ B;  2CXF A;  4J83 A;  4H9N C;  3Q9D A;  2KT1 A;  2DM1 A;  3MAC A;  5LJ3 h;  5ETW A;  3EG2 A;  4IE0 A;  3ZC1 A;  4JPB W;  5JRC A;  1FXX A;  3M0U A;  3E22 E;  2H3R A;  4Z91 A;  4OMF B;  1A0N B;  4IE7 A;  4IDZ A;  1VA7 A;  2B86 A;  2V7L A;  2CWY A;  2RH2 A;  1IGQ A;  4ELZ C;  2YT6 A;  2NW8 A;  2VKH A;  3KFV A;  4BJN A;  2VKD A;  4EGW A;  1N8R U;  5CA1 E;  2M0Y A;  5HEH A;  1SHZ C;  2D0N A;  3I56 Q;  2EQM A;  4N0A A;  2N1G A;  5GON E;  1SG5 A;  2J6F A;  3EAE A;  2E1H A;  2CP7 A;  2CGH A;  1K8A R;  1BI2 A;  1N9S A;  4HVW A;  4WBO A;  4YSZ A;  2EYY A;  2QA4 T;  3J80 E;  3N9N A;  4AKR B;  2QXF A;  5C8Y E;  2YUO A;  1ZA2 B;  4OMO A;  1UTI A;  5AQM B;  2XDB A;  1JB0 E;  4KHP T;  3CCL Q;  1D1B A;  1YQ4 A;  2CA5 A;  4AQY T;  1M1F A;  3VS5 A;  3L8R A;  1BU1 A;  2M1H A;  4XU1 A;  3MZK B;  4JJB A;  2CRB A;  2W62 A;  1XZY A;  2ABL A;  4V2S A;  3DP7 A;  4E7S A;  3QBY A;  2XPK A;  1X43 A;  1EZ3 A;  2QTX A;  4QXB B;  3HL6 A;  4IE4 A;  2C0T A;  3SWN B;  4JI4 T;  3PUA A;  1FMW A;  5E0O A;  4M77 C;  3ME9 A;  2BZB A;  1WQW A;  1JBM A;  1VIE A;  1HG2 A;  5A2Q E;  3INZ A;  2IVW A;  2DNU A;  2FPF A;  3L1A A;  3HKD E;  3LWH A;  3PGG A;  1UJ0 A;  3RC3 A;  4EPC A;  4NUU A;  4LF4 T;  4C8Q C;  1NJI U;  5IHI A;  4ILU A;  3G4S T;  1MIY A;  1M2V A;  1T3L A;  2F4V T;  2LKG A;  1Q81 U;  1LNX A;  2LQN A;  2F1L A;  1D0Z A;  4DND A;  4A4F A;  3CCU Q;  1QVF S;  2JXB A;  4M1P A;  4GKJ T;  4QH5 A;  3CME Q;  3ZMU B;  1B34 A;  2LTO A;  1VQ5 A;  1N6A A;  5FWB A;  5FXZ A;  1WQ7 A;  2RHX A;  2JT4 A;  1JJ2 S;  5LYJ E;  1K4U S;  5CIU A;  4NOY A;  2ODV A;  1W0B A;  2WY2 A;  3TEE A;  3I56 T;  1WJQ A;  2GNC A;  5J26 A;  2DTO A;  2LRL A;  2X35 A;  3MA9 A;  2BG9 A;  2DFU A;  3O1J A;  5KYW B;  1AT1 B;  1BYM A;  1JU5 C;  4M77 G;  2GTJ A;  4DUZ T;  3RUX A;  1K8A C;  3LJC A;  2Q9Q D;  2PFV A;  4DR5 T;  4QHO A;  2QDL A;  2XAS B;  2NOX A;  3TLW A;  2EHO B;  1YWO A;  3BQI A;  2MPX C;  4HXJ A;  3MP6 A;  2X3X D;  2EYQ A;  4C8Q G;  1G3T A;  1QLY A;  5AQI B;  1MV0 B;  4BD3 A;  3VUZ A;  4AKI A;  1VYU A;  3IF8 B;  1QUU A;  3VHL A;  2XZE A;  5GAO m;  1N33 T;  3OS2 A;  4ORZ A;  2SPC A;  1M9S A;  3AA0 B;  2ODU A;  2DER A;  3WVE B;  3UUL A;  4KRT A;  3UUB A;  2LLY A;  3CIR A;  3AE9 A;  2DXB A;  3S3N A;  3VS1 A;  1ABO A;  3HSB A;  4GYR A;  3V8L A;  2CDT A;  1W2B A;  1YXR A;  3H6Z A;  2BBH A;  5ADX L;  3T9N A;  1ZUY A;  1AWJ A;  3IBP A;  2EJ9 A;  1NWM X;  5GAO p;  4KGV B;  1UX5 A;  1O9S A;  3I1A A;  3RRW A;  3UA7 A;  1AZE A;  1E6G A;  4MZP A;  4TNV A;  4FCY A;  3AE4 A;  4QXC B;  2XSA A;  3CPW S;  3WI3 A;  4UVB B;  4ZNX A;  4IST A;  1GBR A;  4D8K A;  5IHK A;  2LJ0 A;  4ESR A;  5FRN A;  5HEO A;  1IJ6 A;  2W67 A;  3OA6 A;  1PRM C;  1WYC A;  2KLQ A;  1FWZ A;  1VQ6 A;  2CP0 A;  2KT8 A;  5JR9 A;  5AQU B;  5LJM A;  3LLR A;  1M1K C;  4JZ4 A;  4C92 D;  2I2L A;  3E9F A;  3CME T;  4Z90 A;  2WWU A;  6AT1 B;  5LA6 E;  3FHN A;  2RJC A;  2JNG A;  2LQW A;  1MMA A;  2CM0 A;  4AQF C;  2HDA A;  3JSC A;  4AMC A;  4JRQ A;  4MDX A;  3LBX B;  3RES A;  5CAI A;  1C6V X;  1LRZ A;  4UR9 A;  2J7I A;  3OJA A;  4QT7 A;  3H37 A;  4RTZ A;  1KQS A;  3CBP A;  1VQ9 Q;  3EH2 A;  1PD0 A;  3N9P A;  4EZ4 A;  3O1I A;  3J9X 1;  1ZUU A;  3B5M A;  3ZMS B;  4O4H E;  3PUY F;  4DO0 A;  1U3O A;  2V8J A;  3OS5 A;  3ZLI A;  2X0H A;  1RAA B;  2OX7 A;  5FP3 A;  1WHK A;  4A97 A;  3SHW A;  4M77 B;  3CKD A;  2CSI A;  1YI2 A;  3VUB A;  1ZX6 A;  2Y6X A;  2ED0 A;  1QQJ A;  3ONJ A;  3P8H A;  3GNG A;  4ZXL A;  2UXX B;  2ZM2 A;  1VQO Q;  1KC8 U;  2EQJ A;  4CN6 A;  2YU1 A;  4DEY A;  4O4J E;  2CZ0 B;  1H92 A;  1G5V A;  3OBW A;  5FXV A;  4G63 A;  4C8Q B;  3OSV A;  2F2V A;  4XTX A;  3QUJ A;  4IL4 A;  1C1A A;  2A72 A;  2I59 A;  2F5K A;  3OYB A;  3BE3 A;  2UXD T;  4XTY A;  4CI0 C;  3OTO T;  1XMQ T;  3EG3 A;  2ZPE B;  4DV7 T;  1VRB A;  3OYG A;  3HRS A;  5KYX A;  3E1S A;  2HMA A;  2KYM A;  2VC8 A;  1UHF A;  1QVG S;  2HPJ A;  2QAS A;  5EK3 A;  2QRX A;  5GJW B;  2IHR 1;  3PUR A;  4H63 V;  3NRY A;  3ULR B;  4C5H A;  4HFB A;  3KBT A;  4ZI2 D;  3RX6 A;  2VVN A;  5GAN 4;  1IGU A;  2QQS A;  4X5T A;  3A8O B;  1LVK A;  2CE7 A;  1BI3 A;  1QVP A;  4M75 D;  4QVD A;  5I2M A;  5HXS A;  2IPO B;  2DIL A;  2XHE B;  3CCJ Q;  4OK0 A;  4P09 A;  1I0C A;  2AZV A;  4TNW A;  1LPL A;  3ZN1 B;  4N0A C;  1AEY A;  1Q95 G;  2MAM A;  3CQC B;  4HGA A;  4IUP A;  1VQ4 Q;  2UUB T;  2WDR A;  4U7I A;  4OML A;  2RHU A;  3JCM V;  2Q9Q A;  5LOV E;  1VQ7 A;  2X9W A;  3MEU A;  4FYY B;  2HN2 A;  3AAA B;  2KSS A;  5GAN 3;  1BI0 A;  2NR4 A;  3JB9 J;  1YJN Q;  2CEA A;  2EJF A;  5D6Y A;  4U33 A;  2XKO C;  1VQ9 T;  4F7U A;  2ATC B;  1Q86 U;  1YJW Q;  3RQU A;  3WAK A;  2EYW A;  3UFE A;  2KMT A;  1PD1 A;  4FT2 A;  1V29 B;  1IBK T;  1HD3 A;  3A8M B;  2KND A;  3UF4 A;  2YHT A;  2H89 A;  1I5L A;  2K5B B;  1W6X A;  2VQE T;  2D8J A;  2X3W D;  5FRM A;  4C5I A;  1Y7X A;  4IUU A;  3BQL A;  5FU7 C;  3KUF A;  5F3J A;  4JS4 A;  3RR6 A;  4LDV A;  1PC0 A;  3VYG A;  4U72 A;  1VQO T;  1PM3 A;  2RJE A;  3O5Z A;  4M78 E;  4RMO A;  3JCM W;  1LVF A;  3TKL B;  4Y91 A;  2IIU A;  2MOZ A;  3QDF A;  3V7R A;  1Y71 A;  3ZFJ A;  1Q7Y R;  2VB6 A;  3C50 A;  2QA4 A;  2DZ9 A;  4K0K T;  3AA7 B;  3J7Y q;  2KNB B;  2RMO A;  4BJM A;  1CKB A;  3AE2 A;  4ZEY A;  1PSE A;  4AFQ C;  4DR3 T;  3F31 A;  4H9R C;  3K3Q C;  2J1D G;  2N2N A;  2VWF A;  5GAO r;  2DNX A;  2DTI A;  5ABF B;  5I2S A;  3N2O A;  4KP3 C;  4P0A A;  3TVT A;  3CC2 Q;  4QX8 B;  3FBL A;  1N9R A;  4FU6 A;  2ECZ A;  2VL8 A;  2MI6 A;  2HSE B;  3QYG B;  2DE0 X;  5IXF A;  4R55 A;  2J06 A;  3ER0 A;  2D2S A;  4WZX A;  3JB9 F;  4C92 A;  1FMV A;  3KFW X;  1MV3 A;  2E41 A;  5AQS B;  1X69 A;  3SOL A;  4PJO A;  2JRK A;  3B13 A;  4DID B;  3PNW C;  3NZP A;  4C5G A;  2K3W A;  3M0Q A;  4HCZ A;  1G73 A;  3ZJ2 A;  2JQK A;  3X20 B;  2LQ8 A;  2VGN A;  3ETV A;  4JRK A;  1RI0 A;  4ZS3 A;  3KBG A;  5DLO A;  3AE5 A;  1SPK A;  5CKH A;  2NUT A;  5EZY E;  2K5F A;  3RIA A;  1VQ4 T;  2XID A;  3QNU A;  4FL6 A;  2DX1 A;  3M54 A;  1BB9 A;  4ZZC A;  3PMT A;  4Z8A A;  1GFD A;  3MK7 C;  5LHG B;  2V6Y B;  2NWB A;  2EYX A;  4H9O C;  2M51 A;  4LDW A;  3PUX F;  3RKO A;  1N34 T;  1HXD A;  3C51 A;  3FLG A;  4V1A v;  2BTT A;  2WAU A;  1YJN T;  3ZCI A;  3LYI A;  3CXC S;  1MMG A;  2M6I A;  1WA7 A;  3HP9 A;  5HAX A;  2DVE A;  3DB3 A;  4E7K A;  4EMK C;  2XQ7 A;  4M7D D;  4JUY A;  3RER A;  3C95 A;  2CXD A;  3JCM e;  4UEM A;  1YJW T;  2KR3 A;  5CQX A;  4F8H A;  3AEE A;  5GAN 6;  3SFD A;  3ETU A;  3C4W A;  1JQQ A;  1IRX A;  5LJ5 d;  5GAM f;  4NXM T;  5L3B B;  3N5L A;  3G7Z A;  2V7K A;  1X9B A;  5FXW A;  3FB9 A;  3EH1 A;  1QWE A;  1OED A;  2QVA A;  3I56 A;  1VQM Q;  2IC9 A;  3I0Q A;  4K11 A;  2CPT A;  5JRC B;  3N5B B;  3GIB A;  3V5S A;  4TX5 A;  1YIJ Q;  2P0P A;  4WBN E;  4PJM A;  2YDR A;  1NE8 A;  3BFM A;  2I6H A;  2BS2 A;  3VS7 A;  2XQ8 A;  2LHN A;  3QKJ A;  4EMG A;  5FU6 C;  1I5O B;  5GAM h;  3BDL A;  4OHF A;  2C5J A;  2XHC A;  1VQL Q;  3EHQ A;  2OLT A;  3ONL C;  3WAJ A;  4IDO A;  3UA6 A;  1TUC A;  2G0U A;  2RJD A;  4M75 A;  2PVO B;  5LJ3 j;  3ZYM A;  1K9M U;  2H88 A;  2YIN A;  2DL7 A;  3CC2 T;  3CCL A;  2LC4 A;  2YRC A;  2DBM A;  1YWP A;  5LJN A;  2A37 A;  1N8R R;  4JS5 A;  2SRC A;  2KMF A;  2MF2 A;  4VUB A;  2AKK A;  2VUB A;  2AZS A;  3W15 B;  4LF6 T;  2LQK A;  4PFO A;  2YWW A;  5HK0 A;  2P4T A;  5JR9 C;  4L59 A;  3MHX A;  5GAO n;  1T0H A;  3LH5 A;  4WNK A;  2DRK A;  3H3M A;  1VUB A;  2QI2 A;  4PW8 A;  3AXJ A;  2ACX A;  4IIO A;  2XI9 A;  2WCA A;  1VQN Q;  4N4I A;  5KYN A;  3PIP A;  1T98 A;  3RKW A;  2RI3 A;  5LJ3 e;  1NPP A;  4U2Z A;  4EB6 E;  3QYH B;  3UQ7 A;  5FU7 B;  2V6X A;  4F16 A;  1QVF P;  5GAN 2;  3M0R A;  3MEV A;  2ENM A;  2W66 A;  2VQF T;  2WSE E;  3OY9 A;  4OMQ A;  1U06 A;  2O88 A;  1TSF A;  2DL1 A;  4X1K E;  2KWI B;  1KNZ A;  1P92 A;  4FM4 B;  4FIB A;  1JJ2 P;  3NVO A;  4EIK A;  1WPY A;  4Z89 A;  5LJ5 f;  3CCU A;  3A8Y C;  3QXE B;  4RTX A;  3H0F A;  5IWA T;  3U23 A;  4G2A A;  3CME A;  4J5Y A;  2K3X A;  4WF2 A;  2JQH A;  3AAE B;  3LFM A;  2RA1 A;  3QB5 A;  3URG A;  3VRB A;  2HEQ A;  5J1G A;  1MIW A;  1AHJ B;  3GN5 A;  1VQM T;  2D8H A;  1UEB A;  1Y57 A;  2AK5 A;  3DTO A;  1M2V B;  1QCO A;  1YIJ T;  4IIM A;  2A9U A;  3M0S A;  4Y28 E;  2W63 A;  4DMW A;  2DET A;  3MCA B;  2HAX A;  2X0Y A;  4B3S T;  4TWH A;  3RYC E;  1B34 B;  1OEB A;  1WHJ A;  1ZV4 X;  2V1R A;  4OF1 A;  2HQE A;  2L8K A;  1NJI R;  1IB8 A;  4MML A;  2BZY A;  3RDV A;  2V7M A;  3FEO A;  1Q81 R;  2I0M A;  1VQL T;  1PCX A;  5M9O A;  2E3H A;  2QQ9 A;  5HWX A;  1M2O A;  5L3G B;  2LSK A;  2R57 A;  3P4S A;  3RYI E;  4J9D A;  4BI3 A;  2VAS A;  1WHH A;  3EGX A;  1JO8 A;  3AE6 A;  3AE3 A;  1OWA A;  4OYJ A;  4WW0 A;  5LGN B;  5LMU T;  2GFA A;  4PNO A;  4KH1 B;  4UIG A;  2ZM0 A;  3R84 B;  2LNH B;  4XQ3 A;  3I55 Q;  2EKO A;  4GY5 A;  4M7A D;  3LWI A;  2CHN A;  2D6F A;  2CZ1 B;  1W4S A;  1G83 A;  1HCI A;  4NXN T;  2CLY C;  2X51 A;  1TG0 A;  4ELY C;  2PVG B;  3CPW P;  1VQN T;  2XJ7 A;  3Q5W A;  4DA4 A;  4JI3 T;  2GBQ A;  2XQA A;  5FVK A;  4TV9 E;  4LDX A;  5FMN A;  4M7D A;  3OYK A;  1HJD A;  1UCU A;  2OTJ Q;  3EI0 A;  3VU7 H;  1KFZ A;  2HSP A;  4LD9 K;  3VS2 A;  3L2V A;  4JLE A;  4KUD K;  4H9S E;  2IAK A;  3ONX A;  4YFS A;  1IBL T;  3ZJ1 A;  3P4Q A;  5GAN 7;  4M77 E;  2KK4 A;  1K0S A;  4LFA T;  3M4G A;  2VVK A;  5C2T A;  1RAD B;  3OW2 P;  3ZT6 A;  3CCR Q;  4ZN3 A;  4OFZ A;  3LH0 A;  5D6X A;  5CVI A;  2E8I A;  2WMN A;  1SHG A;  4GIW A;  4UV8 B;  2FUP A;  2EGC A;  4C8Q E;  1JEG A;  3A5X A;  2E5V A;  2E64 A;  3M53 A;  5BR8 T;  2EQU A;  2FO0 A;  2DKG A;  2W10 A;  3JAM E;  4FW2 A;  3L2W A;  4BE2 A;  5D7U A;  2XM2 A;  2GTO A;  4X1Y E;  3EFO A;  4JEU B;  1R8I A;  2A7Y A;  1KD1 U;  2LJ3 A;  1DJ7 B;  2GK9 A;  2QDY B;  2K2M A;  3C94 A;  4CRI A;  5JR9 B;  1VQ9 A;  2RI2 A;  2V7I A;  3CCM Q;  1VIF A;  1B3Q A;  2DO3 A;  3GWH A;  4R56 A;  1UGR B;  5AQK B;  2L0A A;  1M1G A;  4E47 A;  2CS7 A;  5LP6 E;  3ZN0 B;  4F7U G;  3G06 A;  4GKK T;  5AFU L;  4QH4 A;  2KT9 A;  4PAG A;  1NJI C;  3OYX A;  4C92 C;  2Z0W A;  3S3M A;  3SB2 A;  2ZZD A;  1XDP A;  3N2K E;  4II1 A;  4EYU A;  2JIW A;  4PJO C;  1BR4 A;  1K9A A;  2LX7 A;  1ZHC A;  2NP9 A;  4AFU C;  1DU2 A;  1VQO A;  2YSQ A;  3G4S Q;  2X67 A;  3UFG A;  5EG2 A;  4EED A;  3PVL A;  2E9X A;  5GAN 8;  2DHR A;  5KE2 A;  2YXY A;  5KDM C;  3D7S B;  4M77 F;  2DJQ A;  1XWM A;  3DLL A;  3I55 T;  2BVM A;  3I9Q A;  5LMN T;  3NGP A;  4BUG A;  3G1J A;  3OYY A;  4CXW A;  3A8G B;  2C0O A;  2V8K A;  5GAN g;  3V5U A;  4C8Q F;  5CKD A;  1MIV A;  3N9Q A;  4ZHQ E;  2DLP A;  2CBI A;  2RK1 A;  4QVC A;  4RUG A;  2HZY A;  3N9M A;  4YY3 T;  8AT1 B;  4P0B A;  1F1B B;  4QH1 A;  2OTJ T;  2DK3 A;  1K73 U;  4E7Z A;  1LCK A;  2QG9 B;  5CK9 A;  1NYG A;  1WHL A;  1SHF A;  3RIR A;  1KC8 R;  3JCM Q;  3S3O A;  4XBF B;  4C92 G;  4A4K A;  3MET A;  5CJ5 A;  5KYX B;  2LOS A;  4PJO G;  1UE9 A;  2K9G A;  4BI8 B;  3CCJ A;  4DR2 T;  2CH4 W;  5DAB A;  3LGF A;  3THK A;  3ZL7 C;  3PJA A;  5CFB A;  4HFV A;  1FX7 A;  1Q82 C;  4HWF A;  3Q5E A;  1VQ4 A;  2QAZ A;  4M78 D;  5KYY A;  3C0C A;  1ACM B;  2DL5 A;  2KYB A;  3CCR T;  1M4Z A;  1XOV A;  1UUE A;  2OAW A;  1VCT A;  4AI6 A;  1WI7 A;  3CCS Q;  1YJN A;  4OB0 B;  2J6O A;  4F04 B;  1R0B G;  4ZI2 C;  1WLX A;  4JLI A;  1SSH A;  7AT1 B;  3A1P A;  3CX7 B;  3E19 A;  1X2Q A;  4RCB A;  1W0A A;  2X9X A;  3CCM T;  1YJW A;  1YIT Q;  3ZMV B;  1TUD A;  1G8X A;  2IUB A;  3EAB A;  2CZ6 B;  3H41 A;  2Q9Q B;  2KVQ G;  3A8H B;  3RH3 A;  3H0I A;  2CLY B;  5ABH A;  3FBZ A;  1M90 C;  1VQ8 Q;  2EYZ A;  3M58 A;  2YLB A;  3TSZ A;  4M7A A;  3PV0 F;  4CC4 B;  5C6S A;  4TUY E;  3CPF A;  1XNQ T;  4CC3 A;  3RQW A;  4X65 T;  1NLO C;  2WQY A;  4B3T T;  4F6R C;  1OQK A;  2BZ8 A;  3JB9 I;  1IO6 A;  2LJ1 A;  1HNZ T;  2B8A A;  4F7U B;  2PUO B;  2MWP A;  2RPN A;  1LKX A;  4QQ6 A;  4AFZ C;  5GMK h;  3A98 A;  2KRO A;  2XQ9 A;  4E7L A;  4OB3 B;  1AVZ C;  4OYK A;  1OXZ A;  2KQW A;  3CBM A;  4A53 A;  3CD6 Q;  2E5L T;  3TSW A;  2AXD S;  1WXU A;  1UFF A;  1M62 A;  2DA9 A;  1Q86 R;  2DIG A;  2D0T A;  3E0Z A;  3CC2 A;  4XTV A;  5LG4 A;  3E08 A;  4LNP A;  2WMO A;  4HCC A;  2I0N A;  4IKF A;  1UUS A;  1QKW A;  4HVV A;  3QWX X;  1K1Z A;  1HX8 A;  1UGQ B;  2K5I A;  4DV6 T;  1UDL A;  1KFY A;  1ZEE A;  3ZKR A;  3TLV A;  2N9D A;  3OYD A;  1R77 A;  2K3Y A;  4RTT A;  5AT1 B;  4D6W A;  4FJO A;  2RQV A;  2PU9 B;  4QKU A;  4QQG A;  2RA2 A;  3AE8 A;  2LCL A;  2D0Q B;  3RNJ A;  4KI0 F;  5FXX A;  1KC8 C;  4CZZ B;  1YKH B;  4LML A;  2B76 A;  1ZBX A;  2CUD A;  3PIO A;  1QSD A;  4O4I E;  5L8R E;  4JI1 T;  4A4G A;  3SS1 A;  2DXT A;  2NTY A;  4C92 B;  5HYA A;  3AED A;  3I9Y A;  5AQJ B;  4YHH T;  2LX9 A;  3HTR A;  4PJO B;  2VVS A;  3HKE E;  1G3S A;  3JCF A;  1YJ9 T;  5H6R B;  2FJB A;  1PWT A;  4RG2 A;  2M16 A;  3OBV E;  4LDY A;  3RGL A;  3CCS T;  2QYZ A;  2QTV A;  3EDU A;  2EIF A;  3CVR A;  2QEX Q;  2FZC B;  2HL3 A;  3ZST A;  1WYX A;  2KRM A;  4PNI A;  4ZGD B;  4J9H A;  4MMK A;  5IH2 A;  3H0H A;  3MEA A;  5JDM A;  4XU3 A;  1YIT T;  3RI5 A;  2XQ6 A;  2A0F B;  2C0I A;  3HFO A;  4TWD A;  3VRZ A;  2WS3 A;  2WU5 A;  4UXN B;  1SSF A;  4O5V A;  4BDZ A;  2DTH A;  4UF0 B;  1VQ8 T;  4GK5 E;  3ZEF B;  1WXB A;  2ES0 A;  4J9E A;  2ACZ A;  5L2L A;  2LM2 A;  1VQM A;  4UC4 A;  1GRI A;  2FJA A;  1Y96 A;  4M4Z A;  1XNI A;  3GA8 A;  1YIJ A;  5A1L A;  2K79 A;  4DBQ A;  3QPH A;  4KGX B;  1MND A;  1V9D A;  1D3B A;  1NBE B;  5L3D B;  3RC8 A;  2O01 E;  3EHZ A;  4Z02 A;  5GMK l;  2JJ9 A;  2GQI A;  3G71 Q;  3V7S A;  2IIM A;  1NEK A;  1VQL A;  3CD6 T;  1HFA A;  5J0Z A;  2WM9 A;  5JH7 E;  2E3I A;  2X4W A;  2Y48 B;  3KIN B;  2E5K A;  2OV9 A;  4LN2 A;  1J3T A;  4YTP A;  1QVF A;  3HKC E;  2DL4 A;  2P9B A;  1YQ3 A;  1UGV A;  1S1N A;  1Q86 C;  1H7C A;  5ABG A;  2YDQ A;  2BUD A;  4HFI A;  4UVC B;  1TU0 B;  4C0Z A;  1JJ2 A;  3FIF A;  4CN1 A;  3MP1 A;  1XMO T;  3H8Z A;  4B6M A;  3HI2 A;  5JQG E;  1TWB A;  3M4Y A;  2XQ4 A;  3QHS A;  2A3L A;  4PLI A;  4B9X A;  4M75 B;  3FJ5 A;  3JC6 C;  1WGS A;  3OKQ A;  4A54 A;  1MNE A;  2X66 A;  2XSB A;  3GPL A;  3TLS A;  2D0U A;  3GP8 A;  5TAO A;  1G2B A;  2DXC A;  2BBJ A;  1VQN A;  3FZH B;  3U78 A;  3OQ5 A;  3AEG A;  2EAY A;  1S94 A;  1XDO A;  8ATC B;  4BE0 A;  4KHZ F;  2E6Z A;  1D1A A;  2GFU A;  5L3F B;  1U4Q A;  4GLM A;  3ZBD A;  1AOJ A;  4ZTJ A;  2XQY A;  4DR7 T;  1K9M R;  3UTK A;  3S4U A;  5HCM A;  4UVA B;  3NMZ C;  5HCK A;  4C5E A;  4HTE A;  3C12 A;  3EAM A;  1BCO A;  3AXJ B;  3FXE B;  2QEX T;  1N36 T;  4LUD A;  3R6N A;  1EIF A;  3REB B;  5FVL A;  2H8H A;  4HFC A;  2J62 A;  3N9O A;  1X01 A;  2BG9 E;  5JDH A;  3JB9 H;  4X1I E;  4LE9 A;  1Z9Q A;  2DVJ A;  1MMD A;  5KXJ A;  1UB4 A;  1U5P A;  4E7J A;  3M65 A;  4AIU A;  1D0X A;  4RTV A;  3EDV A;  2E9X C;  3HA4 A;  3TU4 K;  5FY1 A;  2M6B A;  3KV6 A;  4XTU A;  1KF6 A;  5L3E B;  3RKY A;  5GAM e;  3SRZ A;  4ZI3 D;  1I4K 1;  2CP2 A;  3BK9 A;  5L3C B;  1PG5 B;  3UDC A;  4Z88 A;  2MOX A;  4QXH B;  3M5A A;  1RAH B;  1FYN A;  2W4X A;  4PJL A;  5GAO q;  2L3L A;  4MAL A;  5IXB A;  2KSR A;  4IL9 A;  3ABV A;  1E2A A;  3PUV F;  1FMK A;  1PHT A;  3CPW A;  3CCQ A;  5A0G A;  3G71 T;  5L4E A;  2A3D A;  3M0P A;  4IDQ A;  5L23 A;  3VRY A;  2DCF A;  2NWM A;  3VU3 C;  1SA0 E;  3GN5 B;  2HPL A;  3UUM A;  3EFS A;  1ZKE A;  4QW2 A;  2LSG A;  3J7A F;  4IT4 A;  1N27 A;  2COZ A;  4RTY A;  2W2U A;  5JDG A;  4M77 D;  3FC3 A;  1ZOY A;  3I55 A;  4FT4 A;  3TCJ A;  2IC6 A;  4A98 A;  2UU9 T;  2FEI A;  4IUV A;  2F5T X;  3OW2 A;  5JTG A;  5AQN B;  2EKH A;  3VKH A;  3DLM A;  5LJ5 j;  4N78 D;  3EGX B;  1UGO A;  5LB7 B;  1M1K U;  1W70 A;  4L0R A;  2XM1 A;  3L42 A;  2LT3 A;  3NTH A;  1IZ6 A;  2ZMA A;  1NEB A;  3K3O A;  3AT1 B;  5GAM d;  2O4X A;  2KE9 A;  3RKG A;  1ZLM A;  3VJP A;  2XAQ B;  2OTJ A;  4LUE A;  3I5R A;  3VS3 A;  2JMH A;  1WJS A;  2YDS A;  4D8D A;  1OYX A;  3GOX A;  2ZM6 T;  1K9M C;  1AJ3 A;  4HT9 A;  4KX6 A;  2FL7 A;  4OB2 B;  5GMK i;  5IT9 E;  4M7A C;  1YHQ Q;  5FLX E;  3AEB A;  3P4R A;  1FEW A;  2FZK B;  4TN7 B;  4A4E A;  4M7D B;  3SD4 A;  4X66 T;  2RP4 A;  2M9U A;  4HFE A;  5KX5 E;  2KRS A;  2D1X A;  1V76 A;  5HKC A;  5CKB A;  5LJ5 e;  2E4H A;  3FDR A;  2K4Y A;  5H6Q B;  3CCR A;  4BY6 C;  4JI0 T;  2E10 A;  2UUC T;  2HN1 A;  2MPK A;  1UG1 A;  2AKL A;  2LCS A;  2WDV A;  3M0T A;  1QVG A;  2J6K A;  3M56 A;  1R0C B;  4XAX B;  3GMI A;  1X75 C;  4JZ3 A;  1M8V A;  2KEA A;  1HG5 A;  1Y01 A;  5J2T E;  2P0K A;  3U3I A;  1BR1 A;  3CCM A;  3D0T A;  1BBZ A;  1I8F A;  3AHU A;  3ZT7 A;  4HFD A;  2C5I T;  4IUQ A;  2CBJ A;  2FPD A;  3HL8 A;  4GYS A;  1GBQ A;  2K6D A;  2ED1 A;  2BG9 C;  4LMJ A;  4EIW A;  2C0S A;  4ZN1 A;  5AQV B;  2LVM A;  2RQR A;  3FZL B;  3EFO B;  2LHR A;  5FL0 A;  4M7A G;  5EK4 A;  1NG2 A;  4UEL A;  2LM9 A;  3G4S A;  5HXE A;  4JI6 T;  2BE9 B;  4FI5 A;  2H7O A;  2HH7 A;  3F57 A;  4EEB A;  3SEM A;  4LFC T;  4RKU E;  3CQT A;  1QP2 A;  2XUE A;  4O8S A;  4B3R T;  3VV0 A;  3JCM P;  4X1V A;  3PUZ F;  4HEA A;  1KD1 R;  1H8K A;  1RAG B;  4LF5 T;  1IAP A;  2V26 A;  4XZC A;  3RKX A;  4N4H A;  4YJ3 E;  4NPP A;  4CI3 B;  2E9X B;  4MHC A;  1QMC A;  1WR6 A;  3O8V A;  4KH0 B;  5FNV E;  4YJ2 E;  2JUF A;  3HHT B;  4DV4 T;  5GAN d;  2C06 A;  3RMQ A;  5DY9 A;  4GLK A;  3RMS A;  2DYB A;  2L89 A;  2MWO A;  3MEW A;  2HHH T;  1Q7Y C;  5HEG A;  1WJR A;  3X26 B;  3EG9 A;  1YW0 A;  2QQA A;  2ZPF B;  3EG1 A;  3LW5 E;  4WCI A;  1BI1 A;  5LL6 S;  3ZYK A;  1YHQ T;  3S6W A;  2DLR A;  2PQW A;  1OU8 A;  2ZPI B;  2XAG B;  1X6O A;  3K1S A;  2JW4 A;  2R5A A;  1MUZ A;  3E2U A;  4DV0 T;  3LK4 2;  4OVA A;  2J05 A;  4X34 A;  1QLB A;  2B1E A;  4GOU A;  3AEC A;  2FJE A;  4HE8 A;  2BKD N;  4QX7 B;  3QDR B;  5CKE A;  5J39 A;  1ZSZ A;  3LBX A;  3HKS A;  4F7U E;  1WFD A;  2WWV A;  2HNI A;  1XNR T;  1H64 1;  3H3A A;  2CZ7 B;  4YLH A;  4UV9 B;  3T8O A;  3HRU A;  4H9P C;  4ISS A;  4K0U A;  1OZ3 A;  2COW A;  4RTW A;  3G6E Q;  3CCS A;  4KT0 E;  2ZPG B;  2D9T A;  4JI8 T;  2A36 A;  5HXH A;  1SEM A;  1K73 R;  2K48 A;  4DUY T;  2X4Y A;  2QQR A;  2QK0 A;  3WVD B;  1YIT A;  5JDQ A;  4IGU A;  3FZM B;  5KYY B;  3OYE A;  4X62 T;  1VQ8 A;  3OB9 A;  1YFN A;  2KY9 A;  2CXL A;  2QA7 A;  4RCC A;  1GXI E;  4DBR A;  1OX9 A;  2EFI A;  1NPR A;  2E70 A;  5ECA A;  9ATC B;  1WRD A;  2OA5 A;  1TS9 A;  1Y64 B;  2ZPH B;  1UJY A;  3CCE Q;  1S72 Q;  3OBY A;  3UT1 A;  2LE8 A;  1E6H A;  5KYU A;  2BVL A;  4DR1 T;  3HPW A;  1R8O B;  2FJD A;  3GF5 A;  2V8S V;  1MMN A;  2JVV A;  4M7A B;  3CD6 A;  4C92 E;  2W00 A;  4J7I A;  2GCX A;  1UX4 A;  5HXC A;  3CXC A;  4F7U F;  2CMR A;  4PJO E;  2CRE A;  2WU2 A;  4KGZ B;  2YKS A;  4YT0 A;  4EYY R;  5GAN f;  3EUH A;  3VRA A;  2UXB T;  2D9D A;  2GF7 A;  3Q2M A;  2ZGW A;  4BY6 B;  2K3B A;  4NIQ A;  2MYS A;  4KUL A;  1VYV A;  3OVU A;  4C91 A;  2RHZ A;  1U1T A;  5KMG P;  3OYF A;  1V1C A;  3OYI A;  3ANW A;  4JI5 T;  4DV1 T;  3DB4 A;  2O9V A;  3R6O A;  5GAN h;  1M3B A;  2HL5 C;  1N5Z A;  4MFR A;  2CT3 A;  1PKS A;  3OYH A;  4AG1 C;  1WYB A;  4CXX A;  5FY7 A;  2QYW A;  2BKN A;  3L2U A;  2VWA A;  2BG9 B;  4EZH A;  4A5X A;  2NUP A;  2O31 A;  3QG1 A;  4JJD A;  2G6F X;  2C5K T;  1OV3 A;  2ZAE A;  4J9I A;  4JBW F;  1MGQ A;  3RBB B;  2V7J A;  3G6E T;  1N8R C;  2O9S A;  1Y07 A;  3CC4 Q;  2QEX A;  4C92 F;  1YNZ A;  1OED E;  3JAD A;  4PJO F;  2Q9Q C;  2G3R A;  2KI7 A;  4KMC A;  1K73 C;  1KHI A;  4DR6 T;  1IXD A;  5BMV E;  2LMJ A;  3JV3 A;  1QP3 A;  5FW9 A;  3A7M A;  1KNP A;  2XY8 B;  3SFE A;  5CGM A;  3FZK B;  4ATO A;  1JXO A;  1VQK Q;  3CQX C;  3BW1 A;  4YTM A;  3JAF A;  1UHC A;  3KVB A;  4OMP A;  1CKA A;  1ARK A;  4IUR A;  4QKN A;  3MP8 A;  4M75 E;  3P4P A;  4OGC A;  4XK8 E;  2A28 A;  3P8C D;  2DYI A;  1VYT A;  1D1C A;  2PTF A;  4DV5 T;  1S72 T;  3CCE T;  4DVD A;  1WIE A;  1E7P A;  3DKM A;  1HSQ A;  2CHO A;  2LP5 A;  4DQ2 A;  1YI2 T;  3VYH B;  1RAF B;  5A0D A;  2HQX A;  3G71 A;  2RM4 A;  3UU4 A;  3SDZ A;  3I0O A;  1J1J A;  3RLF F;  2OI3 A;  4J6W A;  3CMA Q;  2M67 A;  1Y96 B;  1I07 A;  5HY6 A;  4BB7 A;  1S35 A;  5LXT E;  4DOV A;  2ROT A;  4E6R A;  2MMP A;  3I5S A;  1G3Y A;  4AKH A;  5I21 A;  2XAF B;  4OGE A;  3NZQ A;  1D3B B;  3F70 A;  4DV2 T;  2CP3 A;  1X79 A;  3UU3 A;  3Q5X A;  5DM7 R;  4BAC A;  3REA B;  5C3J A;  2Y4Y A;  5CQY A;  2YUP A;  2QQB A;  3QII A;  4PK4 A;  2QGG A;  1ZP0 A;  1KG1 A;  3PMI A;  4FSX A;  2XDD A;  2E65 A;  3VR9 A;  2JQ9 A;  5JVD E;  4PK5 A;  1JNZ A;  3MXZ A;  2PVD B;  3EGD A;  3L2R A;  1Q81 C;  5A0L A;  4OP0 A;  3QB5 K;  1HYO A;  2RF0 A;  2YEV C;  4M75 F;  5AQF B;  1FJG T;  1IBM T;  4AIS A;  4IUT A;  4TV8 E;  3TQ7 P;  1BR0 A;  3PU3 A;  3LK2 B;  4BE1 A;  5L47 A;  1AWW A;  1WR0 A;  3V7C A;  3AAI A;  3C4S A;  3P8D A;  1QVG P;  5KH6 A;  4O2A E;  5LG3 A;  3RPU A;  3CC4 T;  4J6X A;  1CHU A;  4EDU A;  4IRE A;  2KIN B;  4HN9 A;  1UGP B;  4E7H A;  3CEY A;  2XQ3 A;  2MK5 A;  4FSS A;  4EV6 A;  4J7F A;  5J2U E;  1HTJ F;  2BKP A;  4J9B A;  3CC7 Q;  2UXC T;  4NS5 A;  1RL2 A;  2W61 A;  4JI7 T;  2WDQ A;  4MZM A;  3JB9 D;  1WXT A;  2LKH A;  1TH7 A;  5LJ5 g;  1VQK T;  2ESW A;  1YCS B;  5C0M A;  3P7I A;  4PFZ A;  3K3N A;  4IE5 A;  3RIF A;  2XDP A;  4NL3 A;  4OB1 B;  3VKI A;  2VUR A;  2BKO A;  2XTL A;  3FZF B;  4E2F B;  2H7V C;  1ZUK A;  5IYZ E;  2YU2 A;  4KUM B;  1IRE B;  2FB7 A;  4PK6 A;  2RI5 A;  1OED C;  2E12 A;  1TOV A;  2RHI A;  4DOW A;  2LSJ A;  3MPU B;  3CMA T;  2ZM8 A;  1W9R A;  3ZMT B;  3UQ4 A;  2DPP B;  3HFN A;  3O4X E;  2JN0 A;  1YJ9 Q;  5LHI B;  2YOE A;  1WDX A;  3UUX B;  2L2P A;  5CB4 E;  2L5Q A;  1GFC A;  1T7S A;  1O75 A;  2A08 A;  2V5C A;  2WP9 A;  2FPE A;  2RO0 A;  4EAH A;  4DBF A;  4ZI3 C;  1PSF A;  1SUM B;  1MHN A;  2HBP A;  2KRN A;  4Q25 A;  2YDL A;  2KXD A;  2PTK A;  2R58 A;  4OMN A;  4M75 C;  1M8M A;  4M7D E;  5AQL B;  3AEF A;  2V8I A;  4I43 B;  3ZYL A;  1I81 A;  3AB3 B;  1X2K A;  3A5Z B;  2ZPB B;  1E1H B;  3CK6 A;  3BQK A;  1ZSZ C;  2PJQ A;  2CYZ B;  3JCM g;  1W2B S;  2LRQ A;  2RHY A;  1NAF A;  2FBW A;  2EWN A;  2YRV A;  4OMM A;  3ZC0 A;  2VKO A;  5HEJ A;  5HK3 A;  4PFP A;  4ZOL E;  2PNI A;  3JCM b;  2MBG A;  5CKF A;  2LJL A;  5FWC A;  4J2C A;  4JJC A;  1Y0M A;  4I0U A;  2RNA A;  2PUK B;  1BR2 A;  5AQP B;  1WX6 A;  3P50 A;  2PZ1 A;  1HR0 T;  3PUW F;  3NFC A;  2X4X A;  3DJB A;  2YUN A;  5IUX A;  5DLQ E;  3QK6 A;  1YHQ A;  1GL5 A;  2OAU A;  3QWY A;  2AE9 A;  2VXE A;  1BIB A;  4NUV A;  2O2O A;  1D0Y A;  2XAJ B;  2O4X B;  3IHR A;  5I22 A;  4ZTF A;  2RQW A;  3CC7 T;  4LMK A;  2L3Q A;  4M75 G;  1I94 T;  2DL8 A;  3B57 A;  2KDS A;  2DXU A;  3VS0 A;  3ASK A;  2QGS A;  1M1K R;  4WYV A;  3OS0 A;  3NWI A;  4M7D F;  2WAC A;  3OPC A;  2M02 A;  2NTX A;  2E5Q A;  1IZN B;  2DRM A;  1ZBJ A;  4O4L E;  1RAI B;  4I50 E;  3RYF E;  5DQW A;  4C90 A;  1KQS S;  3F2E A;  4DV3 T;  2JM8 A;  2VV5 A;  1X6B A;  2DL3 A;  1GQE A;  2L3P A;  2L8D A;  1AWO A;  3M55 A;  3CML A;  4YHJ A;  4E7I A;  2LOP A;  3CXC P;  1OU9 A;  2VKJ A;  2CH4 A;  4N4G A;  3UU6 A;  1YN8 A;  3OYA A;  5GMK m;  5LJ3 g;  1YCY A;  4QVZ A;  3ZEH A;  2AIR B;  3X28 B;  5CCA A;  3VS6 A;  1ZSG A;  1BKB A;  4HWD A;  3X1D A;  1N32 T;  4TWF A;  2CP6 A;  2HKQ B;  3ZCJ A;  5LNK A;  2V5D A;  4EMK A;  3VKG A;  4PLL A;  3UPU A;  2E6N A;  2NUT B;  3CCL T;  4WTO B;  2SEM A;  1ZHI A;  2IDO B;  4AT1 B;  2NYS A;  4O2B E;  3CX8 B;  2AHJ B;  3OMC A;  3TLT A;  2QGF B;  1IHW A;  3M3Z B;  1Q82 U;  3PVQ A;  3X24 B;  3PJA J;  3JCM X;  3HR0 A;  4U2Y A;  1C0M A;  1AD5 A;  1RAB B;  2P84 A;  3N9L A;  3M57 A;  3I35 A;  3CX6 B;  2IW5 B;  3UUN A;  3E9G A;  3GNF B;  1KNR A;  2Y4X A;  2BS4 A;  2RN8 A;  1KQ2 A;  1L0V A;  1EZZ B;  3LX7 A;  3MJX A;  4JI2 T;  4M7D C;  4AQG A;  2JPF A;  4HFH A;  4YSY A;  3KVA A;  1OED B;  3NRX A;  5KCH A;  2OTL Q;  4JYA T;  4MLK A;  1T0J A;  2RPA A;  2XIC A;  1KK7 A;  2LCC A;  2RQT A;  3CCV Q;  5CR2 A;  1U1S A;  2XQ5 A;  5FY0 A;  4LF7 T;  1M90 U;  2KGT A;  4YTL A;  3CPZ A;  1NYF A;  2LSI A;  2EVR A;  2K24 A;  2EHO D;  3OYL A;  1GCP A;  2L3R A;  1OZ2 A;  5KE3 A;  2YK0 A;  4M78 A;  4YSX A;  3CCU T;  3EG9 B;  3OYN A;  2K5L A;  3G6E A;  3TLU A;  2XD0 A;  3RYH E;  4M7A E;  2DZC A;  4FYW B;  4P5N A;  5F5W A;  2DEU A;  4Z8X A;  3OSS C;  1HK9 A;  1W1F A;  4J9C A;  3JCM c;  3VS4 A;  4PJO D;  2W0Z A;  3UWN A;  4J9F A;  3PUQ A;  5CA0 E;  2EQI A;  2H3E B;  4BA9 A;  4Y92 A;  1ZSZ B;  1UK5 A;  3IA3 A;  1RLQ C;  5DQV A;  3PT9 A;  3OW2 S;  2CKK A;  2KWH A;  2EBP A;  5GAM j;  5HXR A;  3QZ5 B;  2V1Q A;  4M7D G;  3JRZ A;  1Z8U A;  3AVS A;  1SRL A;  2YUQ A;  5AQQ B;  2DMO A;  3JAE A;  4XU0 A;  2K7A A;  4NL2 A;  3C98 B;  2DD4 A;  3CCE A;  1S72 A;  5JRE A;  3NPF A;  2EJG A;  1K8A U; 
#chains in the Genus database with same CATH homology
 2JTE A;  4IE6 A;  5IHN A;  2XAH B;  5I11 A;  3O9X A;  5LCY A;  1HS7 A;  4AXP A;  2LEH A;  4EOZ B;  2ZLY A;  2FG0 A;  2LZ6 B;  4I55 E;  1Z0P A;  2FRW A;  4F17 A;  4CC7 A;  5LHH B;  2KBT A;  2MCN A;  4A56 A;  1UEC A;  1YP5 A;  4CQI A;  4ZS2 A;  5LBM A;  1HF8 A;  2JS0 A;  4B6X A;  4J9G A;  4H9Q C;  2RQU A;  2Z6E A;  1QKX A;  4HKA A;  3N2G E;  3ANW B;  4GBQ A;  2HBW A;  5LGU B;  2PBI A;  2EPD A;  4R0K A;  3IQL A;  2X9H A;  3AA1 B;  2LSY A;  3CWZ B;  2DBK A;  1PNJ A;  4AKG A;  1OPK A;  2NW9 A;  4BAY B;  1AWX A;  3RRC A;  1ABQ A;  3HKB E;  4CC2 A;  4A63 B;  4ASK A;  4DMV A;  2A2F X;  3EHR A;  1K0X A;  3NBX X;  1U5S A;  1GCQ A;  2WBL A;  2VKN A;  3UT5 E;  3PU8 A;  1SRM A;  3EGU A;  4CI1 B;  3ZMZ B;  4MBQ A;  1QCF A;  2EHO A;  1M3A A;  2PG8 A;  1YKE B;  1EFN A;  2FRY A;  2CWO A;  5LGT B;  1RI9 A;  4IIJ E;  2L3S A;  1O3X A;  4AKL A;  4ANJ A;  3QC9 A;  3KV4 A;  3PUG A;  4U74 A;  5HWY A;  4KBM B;  4UF0 A;  5LBQ B;  2CUB A;  3PUS A;  4AG2 C;  4CI2 B;  3KBU A;  4IHJ E;  1NLP C;  1KJW A;  2L9Q A;  1M30 A;  5DJQ C;  1M3C A;  3C4Z A;  2JMA A;  2JM9 A;  4PJJ A;  1NEG A;  3IEE A;  2V1D B;  3I9W A;  2DI4 A;  1H3H A;  2UXN B;  3PTR B;  4L9I A;  3PDY A;  1KSW A;  3JC6 D;  2DF6 A;  3L09 A;  1K76 A;  1WLP B;  2Y8D A;  3L3P A;  5JDN A;  4HCK A;  2WSS V;  2X68 A;  3CQG B;  1FIO A;  3EVY A;  4AFS C;  1X6G A;  3NHN A;  3EG0 A;  3FXD B;  1B07 A;  1NM7 A;  1IJ5 A;  3MKD A;  1CUN A;  3AVR A;  4H63 H;  2E9X D;  4TZ4 C;  1T3S A;  5M4Y A;  2BDE A;  4X20 E;  5JDF A;  1OPL A;  4HVU A;  3ESL A;  3LK3 B;  2KXC A;  2ROL A;  3PE0 A;  3KV9 A;  5IHY A;  2KZ7 B;  2XMF A;  2JMK A;  3K8P C;  3C64 A;  2F2W A;  4I4T E;  1OOT A;  1I1J A;  2JMC A;  2P4R A;  2DWG A;  5JDL A;  1RUW A;  2BZX A;  5GJV B;  1PRL C;  3KDS E;  2OJ2 A;  2VK9 A;  1BK2 A;  3O1H A;  2CCQ A;  1QWF A;  2EW3 A;  1E7O A;  2W0G A;  3ZPO A;  2GGR A;  2NUZ A;  1VOM A;  4ADZ A;  4RTU A;  4JEH B;  1RLP C;  2MTQ A;  2EGA A;  3AA6 B;  2DWK A;  2JS2 A;  4EXT A;  3SWH A;  1PKT A;  5F8P A;  3UAT A;  1M27 C;  3C4X A;  2X0L B;  4ZI7 E;  3LG7 A;  2HCK A;  5FYM A;  4L5G A;  2KXP B;  2CSQ A;  1US7 B;  4AQF A;  1X27 A;  4F14 A;  4QWN B;  1WFW A;  1Z9Z A;  1CSK A;  2EGE A;  5EK2 A;  1GCQ C;  4ERR A;  2F2X A;  1KIK A;  2X9Y A;  3FB2 A;  3KV5 A;  2D5U A;  4PJN A;  4CXY A;  1B7T A;  2MIO A;  2EHO C;  1JXM A;  2JQQ A;  2K9A A;  5EC7 A;  1YD8 G;  1AZG B;  4GK0 E;  2NW7 A;  3OYZ A;  3GBQ A;  4DEX A;  2CT4 A;  2CXF A;  4H9N C;  3Q9D A;  2KT1 A;  2DM1 A;  3MAC A;  5ETW A;  3EG2 A;  4IE0 A;  3ZC1 A;  4JPB W;  5JRC A;  3M0U A;  3E22 E;  2H3R A;  1A0N B;  4IE7 A;  4IDZ A;  1VA7 A;  2B86 A;  2V7L A;  2CWY A;  2YT6 A;  2NW8 A;  2VKH A;  3KFV A;  4BJN A;  2VKD A;  5CA1 E;  2M0Y A;  1SHZ C;  2D0N A;  2N1G A;  5GON E;  2J6F A;  4HVW A;  4WBO A;  2EYY A;  3N9N A;  4AKR B;  5C8Y E;  2YUO A;  4OMO A;  1UTI A;  1D1B A;  2CA5 A;  3VS5 A;  1BU1 A;  3MZK B;  4JJB A;  2W62 A;  2ABL A;  3DP7 A;  4E7S A;  1X43 A;  1EZ3 A;  4QXB B;  3HL6 A;  4IE4 A;  2C0T A;  3PUA A;  1FMW A;  5E0O A;  2BZB A;  1HG2 A;  2DNU A;  2FPF A;  3HKD E;  1UJ0 A;  3RC3 A;  4NUU A;  5IHI A;  4ILU A;  1MIY A;  1T3L A;  2LQN A;  1D0Z A;  4DND A;  2JXB A;  4M1P A;  3ZMU B;  5FWB A;  5FXZ A;  2JT4 A;  1K4U S;  5LYJ E;  2ODV A;  2GNC A;  3MA9 A;  3O1J A;  1JU5 C;  2GTJ A;  3LJC A;  2Q9Q D;  2PFV A;  4QHO A;  2QDL A;  2XAS B;  2NOX A;  2EHO B;  1YWO A;  3BQI A;  4HXJ A;  2X3X D;  1QLY A;  1MV0 B;  4AKI A;  1VYU A;  3IF8 B;  1QUU A;  3VHL A;  4ORZ A;  2SPC A;  3AA0 B;  2ODU A;  3UUL A;  4KRT A;  3VS1 A;  1ABO A;  4GYR A;  2CDT A;  5ADX L;  1ZUY A;  1AWJ A;  3IBP A;  1NWM X;  1UX5 A;  3I1A A;  3RRW A;  3UA7 A;  1AZE A;  1E6G A;  4QXC B;  3WI3 A;  4UVB B;  4ZNX A;  4IST A;  1GBR A;  4D8K A;  5IHK A;  2LJ0 A;  4ESR A;  1IJ6 A;  1PRM C;  1WYC A;  2KLQ A;  2KT8 A;  5JR9 A;  5LJM A;  4JZ4 A;  2WWU A;  5LA6 E;  3FHN A;  2LQW A;  1MMA A;  2CM0 A;  4AQF C;  2HDA A;  3LBX B;  1LRZ A;  2J7I A;  3OJA A;  4QT7 A;  3H37 A;  4RTZ A;  3N9P A;  4EZ4 A;  3O1I A;  3J9X 1;  1ZUU A;  3ZMS B;  4O4H E;  4DO0 A;  1U3O A;  3ZLI A;  5FP3 A;  3SHW A;  3CKD A;  2CSI A;  1ZX6 A;  2Y6X A;  2ED0 A;  2UXX B;  2ZM2 A;  2YU1 A;  4DEY A;  4O4J E;  1H92 A;  5FXV A;  4G63 A;  2F2V A;  3QUJ A;  2A72 A;  2I59 A;  3EG3 A;  1VRB A;  2KYM A;  1UHF A;  2HPJ A;  5GJW B;  5EK3 A;  3PUR A;  4H63 V;  3NRY A;  3ULR B;  3KBT A;  4ZI2 D;  3RX6 A;  1LVK A;  2CE7 A;  5HXS A;  2DIL A;  2XHE B;  4OK0 A;  4P09 A;  1I0C A;  2AZV A;  3ZN1 B;  1AEY A;  3CQC B;  4HGA A;  4OML A;  2Q9Q A;  5LOV E;  2X9W A;  3AAA B;  2CEA A;  3WAK A;  2EYW A;  3UFE A;  1HD3 A;  2KND A;  3UF4 A;  2K5B B;  1W6X A;  2D8J A;  2X3W D;  3BQL A;  5F3J A;  4U72 A;  3O5Z A;  1LVF A;  3TKL B;  2MOZ A;  2VB6 A;  3C50 A;  3AA7 B;  3J7Y q;  2KNB B;  2RMO A;  4BJM A;  1CKB A;  4AFQ C;  3F31 A;  4H9R C;  3K3Q C;  2J1D G;  2N2N A;  2VWF A;  2DNX A;  3N2O A;  4KP3 C;  4P0A A;  3TVT A;  4QX8 B;  3FBL A;  2ECZ A;  2VL8 A;  2DE0 X;  5IXF A;  2J06 A;  2D2S A;  1FMV A;  3KFW X;  1MV3 A;  1X69 A;  3SOL A;  2JRK A;  3B13 A;  3NZP A;  3M0Q A;  1G73 A;  3ZJ2 A;  3ETV A;  4ZS3 A;  1SPK A;  5EZY E;  2DX1 A;  1BB9 A;  1GFD A;  4Z8A A;  3MK7 C;  5LHG B;  2NWB A;  2EYX A;  4H9O C;  2M51 A;  3RKO A;  3C51 A;  4V1A v;  2BTT A;  2WAU A;  3ZCI A;  1MMG A;  1WA7 A;  5HAX A;  4JUY A;  2CXD A;  4UEM A;  2KR3 A;  3ETU A;  3C4W A;  1JQQ A;  5L3B B;  3N5L A;  2V7K A;  5FXW A;  1QWE A;  2IC9 A;  3I0Q A;  4K11 A;  5JRC B;  3V5S A;  4TX5 A;  4WBN E;  4PJM A;  3VS7 A;  2LHN A;  4OHF A;  2C5J A;  3EHQ A;  3UA6 A;  3WAJ A;  1TUC A;  2G0U A;  3ZYM A;  2YIN A;  2DL7 A;  2DBM A;  1YWP A;  5LJN A;  2A37 A;  2SRC A;  2KMF A;  2AKK A;  2AZS A;  3W15 B;  4PFO A;  5JR9 C;  1T0H A;  3LH5 A;  4WNK A;  2DRK A;  4IIO A;  4PW8 A;  2ACX A;  1T98 A;  4EB6 E;  4F16 A;  3M0R A;  2ENM A;  4OMQ A;  1U06 A;  2O88 A;  4X1K E;  2KWI B;  1KNZ A;  4EIK A;  4Z89 A;  4RTX A;  3H0F A;  3U23 A;  4G2A A;  3AAE B;  3LFM A;  2RA1 A;  2HEQ A;  5J1G A;  1MIW A;  3GN5 A;  2D8H A;  1Y57 A;  2AK5 A;  3DTO A;  4IIM A;  3M0S A;  2W63 A;  4DMW A;  3RYC E;  1OEB A;  1ZV4 X;  2V1R A;  2L8K A;  2BZY A;  2V7M A;  5HWX A;  5L3G B;  2LSK A;  3RYI E;  4J9D A;  2VAS A;  1JO8 A;  4WW0 A;  4OYJ A;  1OWA A;  5LGN B;  4UIG A;  2ZM0 A;  3R84 B;  2LNH B;  1G83 A;  1HCI A;  2CLY C;  2X51 A;  1TG0 A;  3Q5W A;  2GBQ A;  4TV9 E;  5FMN A;  1HJD A;  1UCU A;  3VU7 H;  1KFZ A;  2HSP A;  3VS2 A;  4JLE A;  4H9S E;  2IAK A;  3ONX A;  4YFS A;  3ZJ1 A;  1K0S A;  2VVK A;  4OFZ A;  2E8I A;  2WMN A;  1SHG A;  4GIW A;  4UV8 B;  2EGC A;  1JEG A;  3A5X A;  2W10 A;  2FO0 A;  2GTO A;  4X1Y E;  4JEU B;  2LJ3 A;  2GK9 A;  2K2M A;  5JR9 B;  2V7I A;  1B3Q A;  3GWH A;  2L0A A;  5LP6 E;  3ZN0 B;  5AFU L;  2KT9 A;  4PAG A;  3OYX A;  3N2K E;  4EYU A;  1BR4 A;  1K9A A;  2LX7 A;  1ZHC A;  2NP9 A;  4AFU C;  2YSQ A;  2X67 A;  3PVL A;  2E9X A;  2DHR A;  5KDM C;  2DJQ A;  2BVM A;  3I9Q A;  3NGP A;  4CXW A;  2C0O A;  3V5U A;  1MIV A;  3N9Q A;  4ZHQ E;  2DLP A;  4RUG A;  3N9M A;  4P0B A;  4E7Z A;  1LCK A;  1NYG A;  1SHF A;  4XBF B;  2LOS A;  1UE9 A;  2K9G A;  2CH4 W;  5DAB A;  3THK A;  3ZL7 C;  4HFV A;  3C0C A;  2KYB A;  2DL5 A;  2OAW A;  1XOV A;  1UUE A;  4AI6 A;  1WI7 A;  2J6O A;  4ZI2 C;  1WLX A;  1SSH A;  3CX7 B;  1X2Q A;  2X9X A;  3ZMV B;  1TUD A;  1G8X A;  3H41 A;  2Q9Q B;  3RH3 A;  3H0I A;  2CLY B;  3FBZ A;  2EYZ A;  3TSZ A;  4CC4 B;  4TUY E;  4CC3 A;  1NLO C;  4F6R C;  2BZ8 A;  1IO6 A;  2LJ1 A;  2RPN A;  1LKX A;  4AFZ C;  3A98 A;  2KRO A;  1AVZ C;  4OYK A;  1OXZ A;  3TSW A;  1WXU A;  1UFF A;  2DA9 A;  2D0T A;  3E0Z A;  5LG4 A;  3E08 A;  4LNP A;  2WMO A;  2I0N A;  1QKW A;  4HVV A;  3QWX X;  1K1Z A;  1HX8 A;  1UDL A;  1ZEE A;  2N9D A;  4RTT A;  4FJO A;  2RQV A;  3RNJ A;  5FXX A;  4CZZ B;  1YKH B;  2CUD A;  1QSD A;  4O4I E;  3SS1 A;  2NTY A;  5HYA A;  3I9Y A;  3HKE E;  5H6R B;  1PWT A;  3OBV E;  3EDU A;  3CVR A;  1WYX A;  2KRM A;  4PNI A;  4J9H A;  5IH2 A;  3H0H A;  5JDM A;  2C0I A;  3VRZ A;  4UXN B;  4UF0 B;  4GK5 E;  3ZEF B;  1WXB A;  2ES0 A;  4J9E A;  5L2L A;  1GRI A;  4M4Z A;  3GA8 A;  5A1L A;  2K79 A;  4DBQ A;  1MND A;  1V9D A;  5L3D B;  3RC8 A;  2JJ9 A;  2GQI A;  2IIM A;  1HFA A;  2WM9 A;  5JH7 E;  2Y48 B;  3KIN B;  2E5K A;  4LN2 A;  1J3T A;  3HKC E;  2DL4 A;  2P9B A;  1UGV A;  1S1N A;  1H7C A;  4UVC B;  3HI2 A;  5JQG E;  3FJ5 A;  3JC6 C;  3OKQ A;  1MNE A;  2X66 A;  2D0U A;  5TAO A;  1G2B A;  3U78 A;  1S94 A;  1D1A A;  5L3F B;  1U4Q A;  4GLM A;  1AOJ A;  2XQY A;  3UTK A;  3S4U A;  3NMZ C;  4UVA B;  5HCK A;  4HTE A;  3FXE B;  4LUD A;  3R6N A;  3REB B;  2H8H A;  3N9O A;  5JDH A;  4X1I E;  4LE9 A;  1Z9Q A;  2DVJ A;  1MMD A;  1U5P A;  3M65 A;  4RTV A;  1D0X A;  3EDV A;  2E9X C;  3HA4 A;  5FY1 A;  3KV6 A;  5L3E B;  3SRZ A;  4ZI3 D;  3BK9 A;  5L3C B;  4Z88 A;  2MOX A;  4QXH B;  1FYN A;  4PJL A;  2L3L A;  4MAL A;  5IXB A;  1PHT A;  1FMK A;  2A3D A;  3M0P A;  5L23 A;  3VRY A;  2DCF A;  2NWM A;  1SA0 E;  3GN5 B;  2HPL A;  3UUM A;  1ZKE A;  2LSG A;  4RTY A;  5JDG A;  2IC6 A;  2FEI A;  2EKH A;  3VKH A;  4N78 D;  1W70 A;  4L0R A;  2LT3 A;  1NEB A;  2ZMA A;  3K3O A;  2KE9 A;  1ZLM A;  2XAQ B;  4LUE A;  3I5R A;  3VS3 A;  2JMH A;  4D8D A;  1AJ3 A;  1FEW A;  4TN7 B;  2RP4 A;  2KRS A;  5KX5 E;  2D1X A;  5H6Q B;  1UG1 A;  2LCS A;  2AKL A;  3M0T A;  2J6K A;  4XAX B;  3GMI A;  4JZ3 A;  2KEA A;  1HG5 A;  5J2T E;  3U3I A;  1BR1 A;  3D0T A;  1BBZ A;  2C5I T;  2FPD A;  4GYS A;  1GBQ A;  2K6D A;  2ED1 A;  4EIW A;  2C0S A;  2RQR A;  2LHR A;  5EK4 A;  1NG2 A;  4UEL A;  2LM9 A;  5HXE A;  4FI5 A;  2H7O A;  2HH7 A;  3F57 A;  3SEM A;  3CQT A;  2XUE A;  4O8S A;  4X1V A;  4HEA A;  1H8K A;  1IAP A;  2V26 A;  4XZC A;  4YJ3 E;  4CI3 B;  2E9X B;  4MHC A;  1WR6 A;  5FNV E;  4YJ2 E;  2DYB A;  1YW0 A;  3EG1 A;  4WCI A;  3ZYK A;  2DLR A;  2XAG B;  2JW4 A;  1MUZ A;  3LK4 2;  2J05 A;  2B1E A;  4GOU A;  4HE8 A;  4QX7 B;  3LBX A;  3H3A A;  4YLH A;  4UV9 B;  3T8O A;  4H9P C;  4ISS A;  4K0U A;  4RTW A;  2A36 A;  5HXH A;  1SEM A;  2K48 A;  5JDQ A;  4IGU A;  2QA7 A;  2CXL A;  4DBR A;  5ECA A;  1WRD A;  2OA5 A;  1Y64 B;  1UJY A;  2LE8 A;  1E6H A;  2BVL A;  1MMN A;  2W00 A;  1UX4 A;  5HXC A;  2CMR A;  2CRE A;  4EYY R;  3EUH A;  3Q2M A;  2K3B A;  2MYS A;  1VYV A;  4C91 A;  5KMG P;  1V1C A;  3ANW A;  2O9V A;  1M3B A;  1N5Z A;  4MFR A;  2CT3 A;  1PKS A;  4AG1 C;  1WYB A;  4CXX A;  5FY7 A;  2VWA A;  4EZH A;  2O31 A;  4JJD A;  4J9I A;  2G6F X;  2C5K T;  1OV3 A;  3RBB B;  2V7J A;  2O9S A;  1YNZ A;  2Q9Q C;  4KMC A;  5BMV E;  2LMJ A;  3JV3 A;  5FW9 A;  1JXO A;  3CQX C;  1UHC A;  3KVB A;  4OMP A;  1CKA A;  1ARK A;  4QKN A;  2A28 A;  3P8C D;  1VYT A;  1D1C A;  4DVD A;  1WIE A;  1HSQ A;  2LP5 A;  3I0O A;  2OI3 A;  2M67 A;  1I07 A;  1S35 A;  5LXT E;  2ROT A;  4E6R A;  3I5S A;  4AKH A;  2XAF B;  3NZQ A;  1X79 A;  3Q5X A;  3REA B;  2YUP A;  4PK4 A;  5JVD E;  4PK5 A;  3MXZ A;  2RF0 A;  2YEV C;  4TV8 E;  1BR0 A;  3PU3 A;  3LK2 B;  1AWW A;  3AAI A;  4O2A E;  3RPU A;  2KIN B;  4HN9 A;  4FSS A;  5J2U E;  1HTJ F;  4J9B A;  2W61 A;  1WXT A;  2ESW A;  1YCS B;  3P7I A;  3K3N A;  4IE5 A;  2XTL A;  2H7V C;  1ZUK A;  5IYZ E;  2YU2 A;  4KUM B;  4PK6 A;  2LSJ A;  2ZM8 A;  3ZMT B;  3O4X E;  5LHI B;  1WDX A;  3UUX B;  2L2P A;  5CB4 E;  1GFC A;  2A08 A;  2FPE A;  4EAH A;  4ZI3 C;  2KRN A;  2YDL A;  2KXD A;  2PTK A;  4OMN A;  1M8M A;  4I43 B;  3ZYL A;  3AB3 B;  1X2K A;  1E1H B;  3BQK A;  2PJQ A;  1NAF A;  4OMM A;  3ZC0 A;  2VKO A;  4PFP A;  4ZOL E;  2PNI A;  2MBG A;  2LJL A;  5FWC A;  4J2C A;  4JJC A;  1Y0M A;  2RNA A;  1BR2 A;  1WX6 A;  2PZ1 A;  3DJB A;  2YUN A;  3QK6 A;  1GL5 A;  3QWY A;  4NUV A;  2O2O A;  1D0Y A;  2XAJ B;  3IHR A;  5I22 A;  2RQW A;  2L3Q A;  2DL8 A;  3B57 A;  3VS0 A;  2QGS A;  2NTX A;  1IZN B;  2DRM A;  1ZBJ A;  4O4L E;  4I50 E;  3RYF E;  5DQW A;  4C90 A;  3F2E A;  2JM8 A;  1X6B A;  2DL3 A;  2L3P A;  1AWO A;  3CML A;  4YHJ A;  2LOP A;  2VKJ A;  2CH4 A;  1YN8 A;  3VS6 A;  1ZSG A;  3ZCJ A;  5LNK A;  3VKG A;  2SEM A;  4O2B E;  3CX8 B;  3PVQ A;  3HR0 A;  1AD5 A;  3N9L A;  3I35 A;  3CX6 B;  2IW5 B;  3UUN A;  2RN8 A;  3MJX A;  4AQG A;  2JPF A;  3KVA A;  3NRX A;  1T0J A;  4MLK A;  1KK7 A;  2RQT A;  5FY0 A;  2KGT A;  3CPZ A;  1NYF A;  2LSI A;  2EVR A;  2K24 A;  2EHO D;  1GCP A;  2YK0 A;  3RYH E;  4Z8X A;  1W1F A;  4J9C A;  3VS4 A;  2W0Z A;  4J9F A;  3PUQ A;  5CA0 E;  2EQI A;  4BA9 A;  4Y92 A;  1RLQ C;  5DQV A;  2EBP A;  2KWH A;  5HXR A;  2V1Q A;  3AVS A;  1SRL A;  2YUQ A;  2DMO A;  2K7A A;  3C98 B;  5JRE A;  3NPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...