3R6NA

Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin plakin domain
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
450
structure length
450
Chain Sequence
SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Desmoplakin
publication title Crystal structure of a rigid four-spectrin-repeat fragment of the human desmoplakin plakin domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 171
structure length 450
sequence length 450
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17902 SH3_10 SH3 domain
A PF18373 Spectrin_like Spectrin like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1060 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA02
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3r6nA03
2DF6A 2PNIA 2YUQA 2BTTA 1PRLC 4RTXA 1WXBA 1KSWA 1U06A 1AZEA 1AWWA 2JXBA 2AKKA 1ZSGA 1AWJA 2V1RA 2DL5A 1BBZA 2ECZA 1K0SA 1AD5A 2LJ0A 2BZXA 2KBTA 1HJDA 3O5ZA 1HSQA 2LX7A 1MUZA 2EYZA 2LJ3A 3REAB 4OMMA 2YUOA 2FG0A 1T0HA 1VA7A 2DJQA 2F2VA 2VWFA 2RPNA 4OMPA 1ZUYA 4GLMA 3PE0A 1YWPA 4OMOA 1B3QA 4FSSA 3UA6A 1WX6A 1AEYA 1UGVA 3IQLA 4RTUA 3PVQA 2DBKA 1FYNA 4J9FA 1VYTA 1JU5C 1ZX6A 4HXJA 2KRSA 1XOVA 3EGUA 1M30A 1SHFA 2K9GA 2KT8A 2HEQA 2CT4A 3VS0A 2JM9A 2EW3A 2L0AA 3EG0A 4JJCA 5IHNA 1JQQA 2DA9A 2KYBA 2SRCA 2KEAA 2EPDA 1WYXA 1KFZA 1UHFA 1E7OA 4ORZA 2YUNA 2VVKA 4WCIA 5L23A 2D8JA 1I07A 4GBQA 4Z8AA 4AG2C 2DNUA 2ROTA 1B07A 2XMFA 5ECAA 4IIOA 2AKLA 2DBMA 1FMKA 2DVJA 1QWEA 1WA7A 3THKA 1K0XA 2EGCA 3H41A 2FPDA 1RUWA 4J9CA 1TG0A 1M3AA 2AZSA 2LQNA 4CC7A 1GL5A 1ABOA 2CT3A 2EQIA 1AWXA 1PWTA 2ESWA 1QKWA 4KRTA 3SEMA 1M3BA 2KGTA 2GNCA 4J9GA 1W6XA 2CSQA 1NLPC 1GBQA 5I11A 1X6BA 3M0RA 2NWMA 4DEYA 4HCKA 3JV3A 2CUBA 2JM8A 1GCQA 3R6NA 2X3WD 3RNJA 3EDUA 1E6GA 1AWOA 1SSHA 2J7IA 3I5RA 3EHQA 2A37A 5IXBA 2A28A 2DE0X 2CH4A 2CREA 2ROLA 5EC7A 4J9IA 1EFNA 2HCKA 1X6GA 1UJ0A 3VS6A 1V1CA 2EKHA 2J05A 4F16A 2K6DA 1TUCA 2F2XA 2GTJA 3VS3A 2NUZA 4Z88A 2KR3A 1VYVA 2KRNA 2FRYA 2L3QA 4RUGA 1Y0MA 3PDYA 4LN2A 2ABLA 1ABQA 1K76A 1SEMA 3VS5A 1WFWA 5J1GA 1UHCA 3I35A 1WXUA 2E5KA 2GQIA 3VS4A 1OEBA 1X69A 2AZVA 1NG2A 1T3LA 2DL4A 5IHIA 1K4US 4LNPA 1BU1A 2DRMA 1GCQC 1UDLA 1U5SA 2C0OA 2BZYA 1SRMA 3TVTA 1J3TA 3KBTA 2K7AA 1H8KA 4CC2A 1S1NA 1AVZC 2OI3A 1Z9QA 1E6HA 1NEGA 1TUDA 1NM7A 2O9VA 3M0QA 2K79A 3U23A 4RTZA 1WDXA 2O31A 2O2OA 2MCNA 2X3XD 2JTEA 2KXCA 2LJ1A 1M8MA 2A36A 2RQWA 4J9DA 3REBB 1QCFA 2J6FA 4JJBA 2GBQA 3KFVA 1YCSB 2D8HA 3H0IA 2PTKA 3FJ5A 1PHTA 1UJYA 2DYBA 1G2BA 2ENMA 1X43A 1T0JA 2B86A 2J6KA 4AFSC 3VRYA 1K9AA 1K1ZA 1AZGB 2O9SA 3M0PA 2JW4A 1RI9A 3H0FA 4D8KA 2D1XA 2V1QA 3QWYA 1UECA 2LMJA 3PVLA 1KJWA 4IIMA 1PKTA 1NLOC 3F57A 2EGEA 4Y92A 1HD3A 2FO0A 2DM1A 2CSIA 3RBBB 5FWCA 3ZL7C 1ZUUA 2F2WA 2GTOA 2DX1A 2HSPA 2AK5A 4LUEA 3NMZC 1QLYA 2YDLA 1OOTA 1A0NB 4OMQA 4J9BA 4A63B 1AOJA 2KE9A 1WXTA 2I0NA 3I9QA 4EIKA 1YP5A 2J06A 5GJWB 2RQTA 2LP5A 1GFCA 4RTTA 4E6RA 1PRMC 1SRLA 4R0KA 3VRZA 2FPFA 1CKAA 1WIEA 3A98A 4M4ZA 4QT7A 5IXFA 4D8DA 2RF0A 3GBQA 2IIMA 1ZLMA 3VS2A 4CC4B 2K3BA 4AG1C 1NYFA 4OMLA 2CDTA 3CQTA 1ZBJA 2LZ6B 1M3CA 1UTIA 1RLPC 1WI7A 3KBUA 1N5ZA 4HVUA 1SHGA 1GBRA 2EBPA 2A08A 1H3HA 1X27A 2YUPA 2RN8A 2LCSA 2DMOA 3EDVA 2DL3A 1CSKA 4Z89A 1QKXA 2GGRA 3TSWA 1BB9A 1OPLA 2JT4A 4HVVA 2EVRA 1Y57A 2M0YA 4OMNA 4J9EA 2KXDA 1CKBA 1WLPB 2EYXA 2K2MA 4LE9A 2P4RA 4K11A 3UF4A 1T3SA 1YNZA 2KRMA 2VKNA 4RTYA 2KROA 4HVWA 1JXOA 4DEXA 2EGAA 1JO8A 1GFDA 2H8HA 2RQUA 1PKSA 2RQRA 2W10A 1PNJA 4CC3A 1YWOA 2MOXA 1QWFA 1U3OA 1UFFA 5GJVB 4ZNXA 2KYMA 3LH5A 2JS0A 3VS7A 1LCKA 3EHRA 2KT1A 2C0IA 2EYYA 2L3PA 3TSZA 3VS1A 3UATA 1H92A 2ED1A 4RTWA 1BK2A 4F17A 1NYGA 1UUEA 1ARKA 2M51A 1W1FA 2DILA 1GCPA 5IHKA 2RMOA 4AFUC 4X1VA 2CH4W 2C0TA 3I5SA 3M0TA 3ULRB 2FEIA 3NGPA 4AFQC 4LUDA 2DL8A 3H0HA 2O88A 2QDLA 2HBWA 1MV3A 1W70A 2SEMA 2MIOA 2HDAA 2FRWA 2ED0A 2D0NA 1SPKA 1KIKA 3QWXX 2DRKA 1NEBA 3M0UA 4AFZC 5FWBA 2CUDA 2L2PA 2PZ1A 1G8XA 5FW9A 4JPBW 3NPFA 2JMAA 1JXMA 4F14A 1RLQC 1YN8A 2YT6A 1X2KA 5I22A 1MV0B 4RTVA 1UG1A 2G6FX 2IAKA 1M27C 3C0CA 2KNBB 3EG1A 2FPEA 1OPKA 2RQVA 4JJDA 2JMCA 2LNHB 2J6OA 1UE9A 2EYWA 3M0SA 2BZ8A 2YSQA 1ZUKA 3NHNA 1G83A 1X2QA 4ESRA 1Z9ZA 1VYUA 2DLPA 4JZ3A 2DL7A 4JZ4A 4J9HA 2L3SA 2OJ2A 2RNAA 1I1JA 5HCKA 1I0CA 2OAWA 3SHWA 1IO6A 2LQWA 1JEGA 1OV3A 3UA7A 5IH2A 3EG2A 1GRIA 2W0ZA 3EG3A 2JS2A
chains in the Genus database with same CATH superfamily
2X0HA 2DF6A 2QEXA 3WVDB 3AAIA 1UCUA 4KGXB 2DWKA 3X20B 1PRLC 1VCSA 4RTXA 1D0XA 1H3ZA 3AE6A 5GAOp 4M7DE 4WBOA 2H7VC 2BS4A 1KSWA 1U06A 3UUMA 4JEHB 1LJOA 2R57A 3RERA 3S6WA 3AE3A 2RH2A 2NR4A 2VQET 2DL5A 3M65A 2MTQA 4AISA 2KLQA 3CX6B 3HTRA 2EIFA 3C98B 3AECA 4QH4A 2ES0A 2X9WA 2BZXA 3CXCA 4DVDA 2KBTA 5E0OA 2BKDN 4H9SE 4C8QD 2A0FB 2XDPA 5L3DB 4GIWA 1XMQT 4G63A 2E3IA 4OMMA 3CCMQ 4OB1B 1T8BA 3OKQA 2FG0A 2YUOA 4PL6A 5AQIB 3RMSA 4N4HA 4OMPA 4ELYC 5LMUT 4GLMA 2QAZA 3OYGA 4XTWA 2WSFE 4C8QC 3ZMVB 2QGSA 1JJ2P 4HFHA 3UA6A 1YITA 1EX4A 2XQ4A 3PMIA 5BMVE 4MMKA 4DR4T 4RTUA 3ZKRA 3VR9A 2DBKA 3PVQA 1VQNT 5ADXL 5HWXA 4HWHA 1VQ7A 1XOVA 2MWOA 3EGUA 1UK5A 2K9GA 4YY3T 3C4XA 3VS0A 1G3YA 5IYZE 4L6V5 3PU8A 1RAEB 2L0AA 3EG0A 3V7SA 1BI3A 2DA9A 2KYBA 1VIFA 2BZBA 3LW5E 2N1GA 2ZM0A 3FZFB 1KFZA 4BACA 2O01E 1YIJA 3PU3A 2VVKA 5L23A 4IE4A 4UV9B 2BE9B 2L8DA 2F4VT 2W2UA 2X4WA 3M57A 4X1IE 2ROTA 4UF0A 2DXTA 2XMFA 1P92A 5ABHA 4DR3T 1SG5A 3CCUQ 1Q81R 4H63H 1M8VA 2AKLA 5JTGA 2M1HA 2YRDA 3ASKA 3LGLA 3JCMP 1QWEA 1WA7A 2KAFA 4PNOA 2DERA 3PUAA 4JLEA 4LF7T 2EGCA 1U8RA 1M1FA 3CVRA 2F1LA 1U4QA 1IRXA 1VQ5Q 1M2VB 2AZSA 1IBMT 3I0QA 1AWXA 3TQ7P 4M1PA 1M7KA 4MFRA 4U3CA 2H3EB 1UGOA 2Y90A 5KYNA 3GPLA 2RI5A 4RG8A 3PUSA 4X20E 2V8KA 4PFOA 2CRBA 4XTVA 4EYUA 2CSQA 3H9NA 5JR9B 4GLKA 3T9NA 2V8IA 4RCBA 2SPCA 4PW8A 4B6MA 3CPZA 2H88A 2D9TA 1SE7A 2KWIB 1EIFA 4BJNA 3CC2Q 3UU6A 4EEDA 1JNZA 3JCMW 3RNJA 2V7JA 4H9NC 3I55Q 1AWOA 2J4GA 1HNWT 3ZSSA 1SSHA 1WLXA 5JDGA 2J7IA 1S94A 3I5RA 3LH0A 2QYZA 3G71Q 2DE0X 4HCBA 5EC7A 3R84B 1RI0A 2K5FA 1UJ0A 4F16A 4FI5A 2FVUA 5FRNA 3EAEA 1TUCA 1Z0PA 3OS2A 1X01A 2LEHA 4F7UB 1C6VX 3NKZA 2KR3A 2KSSA 1W09A 1VYVA 1D0ZA 3QC9A 3OYIA 2H89A 2LLYA 3P7IA 3MP8A 2OTLT 1QW1A 3VUBA 3OBWA 1K73U 1K76A 3VS5A 2QXFA 2M0OA 1WR0A 5LHHB 5J1GA 3CMAQ 2QA4A 3HPWA 4MZMA 3NRXA 3UU8A 5L3CB 3MA9A 2P84A 1T3LA 1U1SA 4IIJE 4XU0A 5IHIA 4ILCA 1US7B 3OYDA 3VHLA 3L09A 2NUPB 2X66A 2N9DA 1UDLA 4YJ2E 1M2VA 1U5SA 2E10A 2YLCA 2RA1A 1FX7A 1CUNA 5GANe 4HKAA 3CX8B 5KYYB 3JCMJ 1SA0E 5I2SA 1H8KA 3LYIA 4J2CA 3N2GE 4EMGA 3CC4Q 2QQAA 1O3XA 1S1NA 3VU3C 1K73C 1HG5A 2JQQA 4YTMA 2QVAA 4QXBB 2OI3A 1RAIB 1KC8C 5JR9A 5FMNA 1TUDA 2JQ9A 1NM7A 2V1DB 2O9VA 3OBVE 3U23A 2CBIA 1OU9A 2JIWA 3EI0A 3M58A 3PNWC 4RTZA 5FLXE 1VQKQ 2MCNA 2W61A 3FZKB 2DFUA 4R56A 1YQ4A 4J6WA 5EZYE 5JRCB 5LHGB 2DWGA 3P50A 1X6OA 2HKQB 1DJ7B 3I56A 3CCRA 1W4SA 7AT1B 3AA0B 4E7HA 1QCFA 4XAXB 5HEOA 5GAOr 2PTKA 3FJ5A 1N8RC 2GFUA 1UJYA 5I21A 3K3NA 4AKHA 3ZMTB 4MBQA 4LFAT 3EABA 5CKDA 4XU2A 4AFSC 4JRQA 4F7UA 2VKOA 2YDQA 1K9AA 1WNLA 3RQWA 1AZGB 3AVSA 2O9SA 2QQBA 4YSZA 1W9RA 3E08A 1RI9A 1WHGA 3B13A 4XTUA 2CZ1B 2X9HA 4Z90A 2D1XA 1MHNA 1TU0B 5LJ3g 3OQ5A 3A8MB 5LJ3e 3QWYA 4Y28E 5JDQA 3NTIA 2D2SA 4C8QG 1YI2Q 4QKUA 1YHQQ 3EFOB 2YXYA 4M7DB 4ZI3D 1NLOC 2EGEA 3FC3A 1HD3A 1VQPQ 4LDUA 3AE9A 5JVDE 3X1DA 4BJMA 1SKUB 2HHHT 1S72A 3ZCIA 1H641 5FWCA 3V5SA 2CYZB 2NUPA 5FU6C 2LM2A 4N0AA 2GTOA 3NMZC 2KMTA 4X65T 4ZI3C 5KYYA 3N9OA 4OMQA 5HAXA 2R6GF 4I50E 3I9QA 5GAOn 3AEFA 3RQUA 2CLYB 5HK0A 2XAHB 3A8HB 3VYGA 2BVMA 4ELZC 4U2YA 3MEUA 1MMDA 3AXJB 3P4QA 1PRMC 4R0KA 4TNWA 4EZHA 5A1LA 5M4YA 3A98A 3UQ7A 3CCVA 1NJIU 2PQWA 2ZCFB 3TLSA 4YT0A 3VS2A 4V2SA 4PKCC 1IHVA 2XAGB 4J5YA 2FB7A 2KT9A 1Q95G 3ONXA 3P4SA 2CDTA 5GMKj 2LZ6B 2I0MA 2EQKA 3PTRB 4A4EA 4C0DB 4AQGA 1SHGA 4DBHA 4E47A 5C8YE 2EBPA 5LJ5g 2CXFA 5L3GB 2A08A 5LJ5e 3TLWA 4BA9A 5LGNB 4HWDA 1R77A 5KXJA 4NXMT 4EPCA 1OEDE 1M9SA 1PSEA 4C5IA 3OMGA 3OW2P 1LOJA 2AIRB 4MHCA 4EYYR 2DL3A 5AQRB 4DMWA 2EYQA 4X9CA 2XUEA 3TSWA 4JUYA 1QUUA 3V7CA 4M75B 2WAUA 4H63V 4HVVA 3S3MA 3HKCE 3EFOA 4M7DA 1CKBA 3CCSQ 2P4RA 1OXZA 2KRMA 4RTYA 1FXXA 5CKFA 1BCMA 4CI3B 5GAN6 1JXOA 4QWNB 5AQLB 4EOZB 2QK0A 5M9OA 1HXDA 4AIUA 3JB9D 3JB9F 3CCMA 1H3HA 3ABVA 1G3SA 2EGAA 4WW0A 3UT1A 1JO8A 2DHRA 2QQRA 2JMHA 4DV3T 2W10A 2E41A 1HNXT 1JNRA 5LJ3h 4O8SA 1PNJA 4CC3A 3PFSA 1U3OA 1UFFA 3KVAA 1WHHA 5DLQE 1RAAB 1SF9A 5CA0E 1YKHB 3RESA 1VQMT 2C06A 3CD6Q 3L42A 4FIBA 5A2QE 4AQFC 3VS7A 2FHDA 1Z8UA 1YQ3A 3KV5A 2NTYA 4EMKC 3AXJA 2CZ0B 2EYYA 2ZPEB 2LDMA 3UATA 5C0MA 5KE3A 4M7DD 1UUEA 4EGWA 2HN1A 2RPAA 1ARKA 3G1JA 3N9PA 2CMRA 4X1YE 2D0QB 2DTIA 1IBLT 5IHKA 4AFUC 2JRKA 1HYOA 2CH4W 3ULRB 3OVUA 2QTXA 3QJ6A 3SOLA 3CC7Q 4BE0A 3NGPA 4QVCA 1YJ9Q 4AFQC 3MKDA 2H3RA 2DL8A 1BR1A 2QDLA 1UUSA 2YLBA 4TWDA 2E4HA 1W70A 2A2FX 2SEMA 5GAN8 3OY9A 2HDAA 5ABEA 4RCCA 2XQ7A 4ATOA 4UELA 3U3IA 4P5NA 1VQ6Q 5AQGB 5AT1B 3CCUA 1NEBA 1TS9A 4M7AE 1M1KR 1M90C 1Q81C 3MZKB 3ANWB 2L2PA 2EHOD 2C0SA 2NLUA 4IUVA 4IKFA 5DJQC 3PUYF 2QEXT 2CLYC 2DJZA 3ETUA 4L5GA 2UUAT 3R6OA 2W0GA 1UGSB 1VQ5A 2W67A 4PLLA 2CP3A 4AQYT 2L3LA 3QSUA 4HTEA 3AEDA 2EHOC 4O6JA 2IAKA 1M27C 5LJ5h 3C0CA 4ZTFA 2KNBB 2WACA 4C5HA 5LYJE 3SRZA 1I5LA 3CCJQ 4XTYA 3C64A 3ZPOA 3TLUA 1OPKA 2RQVA 2JMCA 3EHZA 1UX5A 2FUPA 5KMGP 5FVLA 2J6OA 4ZS3A 4ERRA 2E5VA 5FY0A 1BKBA 2CP0A 4M78F 2LCLA 1N36T 3MEAA 3M0SA 4OB0B 2V8SV 2E65A 3QYGB 2CZ6B 4OB2B 2BZ8A 3CC2A 2XQ9A 3N2KE 1Y7XA 3M9QA 1Z9ZA 4ESRA 4JZ3A 4C92F 3LGFA 4QXCB 3ZSTA 4C92D 3I55A 4M78C 1C1AA 3L39A 3G71A 4CI0C 2IC9A 2I6HA 1YITT 2X0YA 4FCYA 2VV5A 2YU2A 1Y07A 1I8FA 1E2AA 1IO6A 4JEUB 4II1A 4J6YA 3UA7A 1YXRA 4HA8A 2KDSA 4C92C 1VQ7T 1QVFS 5F3JA 3VU7H 2R58A 2CHOA 4BB7A 1KQSP 1G73A 2JS2A 5LL6S 2ZAEA 3N9MA 4IDPA 2YUQA 4AI6A 5L3FB 4EB6E 1XTDA 4ZN3A 3EVYA 3OYBA 4U72A 5KCOA 1YIJT 4X64T 1AWWA 2VURA 3HHTB 3CMAA 2AKKA 4IREA 1ZSGA 1AWJA 4P09A 5CJ5A 3ANWA 1BBZA 2ECZA 5L4HA 4MDXA 3HFOA 4K0UA 2LJ0A 3NZPA 2BG9C 4CZZB 1HK9A 3O5ZA 2VYTA 2VC8A 3ZC0A 3HSBA 2WMOA 4M77B 4LD6A 2OX7A 2COZA 3PJAJ 4FT2A 1IZ6A 3OA6A 3BDLA 2VWFA 2RPNA 3DKMA 1HG2A 1KQ2A 4A4KA 3CC4A 3PE0A 1YWPA 4OMOA 1YD8G 2CWYA 1B3QA 4FSSA 3M56A 1UGVA 4OVAA 3MEVA 2VL8A 1FYNA 4J9FA 3O8VA 4V1Av 1VYTA 4LMKA 4HXJA 2KY9A 1M62A 3C4WA 2KRSA 1VQKA 4ISSA 1SHFA 5LB7B 2EQMA 2OLTA 2W00A 3SWHA 2CT4A 4B3ST 3JCMX 2DVEA 1IB8A 1VQ4Q 4PJOE 5GAMe 1QP3A 4OMFB 4JJCA 1JQQA 3CXCS 4ZGJB 2SRCA 4BDYA 3V7RA 3DP7A 2YHTA 1U5PA 1J5ET 5JREA 3CCJT 3OYJA 5LA6E 1XDPA 4QXHB 4EXTA 4WCIA 4LF4T 1I07A 2A7YA 4BY6C 1D3BB 4GBQA 1VQOQ 4DV6T 3QPHA 2XDBA 2NW9A 4TZ4C 5A0LA 2ZPGB 3JSCA 1FMKA 3OSSC 1O9SA 2F5TX 3CCQQ 3KV6A 4PJJA 5C2TA 4BI4A 1YJWQ 3NRYA 3SFDA 1ZEEA 1K0XA 1OEDB 2RK2A 5L8RE 1QVGP 4B9WA 3SDZA 1UURA 3O1JA 4YFSA 3NFCA 4MALA 4J9CA 5AYFA 1YI2A 1VQMA 1M3AA 1YHQA 4CC7A 4CXWA 2RD1A 3JB9G 2ODVA 4BD3A 2UUCT 2EJFA 3QZ9B 5HY6A 3CMEQ 2QA4T 1VQPA 1QVFA 1UGRB 1RADB 1SSFA 4U33A 2ESWA 4J9GA 4M77A 1W6XA 5GANf 1IZNB 3EGDB 1GQEA 1QP2A 3FEOA 2YINA 1W0AA 2NWMA 4DEYA 3TLTA 3JV3A 3PURA 2HNIA 4JLGA 3E9GA 1W2BS 2X3WD 4D6WA 2UXBT 4J7IA 4KBMB 1PD0A 2P0PA 1HX1B 4TV9E 1D09B 4J9IA 1EFNA 2HCKA 4LXCA 3OYNA 3OJAA 4YSXA 1Y96B 3QYHB 2J05A 2PVOB 2XI9A 3N9QA 4F04B 2HPJA 4BI3A 4DQ2A 3ME9A 2RJCA 5CIUA 4Z88A 4BAYB 2DI4A 1C0MA 1XWMA 5HXHA 4RUGA 3I56T 3CCRT 1TWBA 1D3BA 2ABLA 1NJIR 3QBYA 2JJ9A 1KEYA 1WFWA 4I55E 3I35A 1JJ2A 3CCLQ 3MK7C 4QX7B 1OULA 3G06A 3W15B 2VKJA 3K1SA 1NG2A 1YCYA 3BQLA 1OEDA 4C8QF 5LJ3f 3LWIA 4M7AB 2XM2A 4HFEA 1BU1A 2DRMA 3AA1B 3F70A 4E7LA 5HEUA 3QK6A 2C0OA 3EGXB 4ILUA 1XNQT 3BDUA 1ZSZB 4A53A 2BZYA 1SRMA 3QDRB 1K8AU 3TVTA 1J3TA 4CQIA 3CCSA 2X67A 2K7AA 4M78G 1LKXA 4X66T 4LDWA 1AVZC 4YTNA 2I2LA 4JI3T 3CCQT 1E6HA 3EGDA 1HTJF 5GAN7 4ZHQE 1S72T 1RAGB 2IDOB 3CWZB 4C92G 3T1YT 2K79A 2YK0A 2O31A 3QB5K 2O2OA 3X25B 3U78A 2JTEA 5HK3A 3K8PC 3NWIA 4QW2A 1NE8A 3FXDB 3FHNA 4EV6A 5GAOl 2KK4A 2V5DA 3OYXA 3L1AA 2RQWA 1LNXA 3ZEFB 1M1KU 1ZQ1A 4LDYA 2D8HA 4PK6A 2JQHA 2M9UA 2CE7A 2JNGA 3L8RA 2EFIA 2WM9A 4B3TT 1Y96A 3A5ZB 1G2BA 2ENMA 1WJSA 2Y4YA 1X43A 2RM4A 2NOXA 3GNGA 2J6KA 2RI3A 3OYCA 4M75E 1WGSA 3CC7A 3TREA 2IIUA 1WPYA 1YJ9A 1K1ZA 5CGMA 2VL0A 1BR2A 4YTPA 3CCVT 1W2BA 2A3LA 4D8KA 2VVSA 4IE7A 2M6BA 4WTOB 5LJ5f 1GXIE 2V1QA 1ZKEA 2DD5A 3ETVA 1VQ6A 4A98A 1UECA 4FJOA 1WFDA 2G3RA 3S4UA 2BS2A 3MACA 5IN1A 2LSGA 3F57A 4F8HA 2XQAA 5LGTB 2B8AA 4M7AA 2C5IT 4KX6A 2VGNA 4DV0T 1G3WA 1J1JA 2KNDA 3IEEA 2LCCA 3EGXA 4LUEA 2JPFA 1QLYA 1KD1U 3L2UA 2WSSV 2YDLA 2D0UA 1OOTA 3PGGA 2OTJQ 4O4LE 2YDRA 4HT9A 4Y91A 4A63B 4GK5E 4X9DA 5AQOB 3OYLA 2WS3A 3TKLB 3DB4A 3CIRA 3META 3M4YA 1E1HB 1WCRA 3CCJA 3J9X1 4IDOA 4E7IA 3JC6D 3HRUA 8AT1B 3ZYLA 1RACB 2K5LA 4RTTA 3PMTA 4UEMA 4XU3A 3KV9A 5GAN4 2RK1A 3VRZA 2Q9QB 5FROA 1RAHB 3CCMT 3HKSA 2ZLYA 3JC6C 2DD4A 3TCJA 3RPUA 1ZLMA 1XMOT 3PUQA 2IW5B 2YN6A 2EQJA 3MHXA 1ZHCA 1ZBJA 3ER0A 4PJOB 5LJNA 3CPWP 4JBWF 2KXPB 1RLPC 4ZGEB 3KBUA 3V8LA 2UXDT 4IL4A 1V29B 3LSVA 3QDFA 2K3WA 2YUPA 3KINB 2X9XA 5IUXA 3TU4K 3RKYA 2LCSA 1OZ2A 4JYAT 3QHSA 3EDVA 4LDVA 2GF7A 2MPKA 2VWAA 3SWNB 1CSKA 4KH1B 1QKXA 2BBJA 2GGRA 2HN2A 2CP6A 3AE2A 3WI3A 2FYKA 5CAIA 2ZM6T 4IE6A 4XK8E 5GANg 1YJNQ 4IDZA 1Y57A 2M0YA 2LSYA 5J0ZA 2LSJA 2QYWA 1NBEB 4FYXB 5FL1A 4UVBB 1YBYA 2F69A 4LE9A 2E12A 4C0GA 3CCUT 2QGFB 2LVMA 3RX6A 1HR0T 3UF4A 1T3SA 4NPPA 4NUVA 3M54A 3WXMB 4YHJA 3G4SQ 9ATCB 1AJ3A 4ZI7E 4OYKA 3GIBA 2DZ9A 5ETWA 2XAJB 2RQUA 1VQLQ 1VQ5T 5JH7E 2E2AA 2RB6A 4ZTJA 3RDVA 3GNFB 3L3PA 5EK3A 3EH1A 4ZNXA 1UGQB 3LH5A 1UEBA 1Q86R 2JS0A 4P1NA 1S35A 3ZMSB 1WHJA 2COYA 5GANj 2L3PA 2Q9QA 5DQWA 5ABGA 1NPPA 4RTWA 4F17A 2UXXB 2CP7A 1ZBXA 2AE9A 3UTKA 1W1FA 2DILA 1VQ4A 2X0LB 3VKHA 1TXQA 2MYSA 4X1VA 3I5SA 2C0TA 3M0TA 1QMCA 5CQYA 3AEGA 1QCOA 5L2LA 3CC2T 4NOYA 3ONLC 2LKGA 4ZI2D 4OYJA 4Z91A 4GYRA 3BE3A 3VRBA 4PJOA 2FZKB 4DR6T 3I55T 4CN1A 3IA3A 4Q5WA 3QZ5B 2MIOA 3FBLA 4TNVA 3G71T 2Y48B 2FRWA 3Q5WA 2ED0A 1VQOA 1QLBA 3RYHE 5H6RB 2E6ZA 3RR6A 1OX8A 3QWXX 2DRKA 5JR9C 4ZI2C 4XQ3A 4M77E 5KYUB 3CCQA 2G0UA 4K0KT 5CVIA 1YJWA 2PZ1A 4OB3B 3HKDE 1VQ9Q 1G8XA 3BK9A 3HKEE 2E6NA 2ODUA 5FW9A 1WYBA 5JDNA 4GKJT 2MWPA 2BDEA 5KH6A 2V6XA 2M67A 2WB5A 2RJEA 1JXMA 4F14A 1RLQC 1YN8A 2ZM8A 5GMKm 5I22A 1Q7YU 4U74A 4F7UF 3CKDA 3BFMA 3CMEA 3CMAT 3KXTA 2G6FX 5DY9A 1MMAA 2HZYA 2JZ2A 4HT8A 3O1HA 4JI7T 1BI2A 1TH7A 2P0QA 3CEYA 5LJ3j 4CN4A 4JJDA 5IAYA 2YU1A 3ONJA 2KVQG 4OGCA 2RJDA 1YFNA 3DTOA 2WU2A 2XASB 1QQJA 2WP9A 2XQ6A 1WJRA 4IGUA 4BDZA 3IBPA 5JRCA 3RI5A 2LSIA 3MJXA 4N78D 3EFRA 3M55A 3OMCA 5GANh 2YSQA 1ZHIA 2DCFA 1ZUKA 5DQVA 1X2QA 4KI0F 2HAXA 4DR5T 4ISTA 1OQKA 3TLVA 3EUHA 2HKNA 5JDFA 3CC4T 2NYSA 3V8JA 3FLGA 1NPRA 4ILAA 2WCAA 1X75C 3P8BB 2OJ2A 3FZLB 5FXWA 4OFZA 1I1JA 4KGZB 3NBXX 3H3MA 4A54A 3JCMg 5EK2A 3JCMe 2OAWA 3SHWA 2LQWA 5GAMf 1OV3A 3FBZA 1HF8A 4BE1A 5CFBA 1VQKT 4N0AC 2WMNA 2RJFA 3FB2A 3G7ZA 2PG8A 4CRIA 3FJPA 3N9LA 4QQDA 5FU7B 3RGLA 1D1AA 3VKGA 1BIBA 2BTTA 3QB5A 2CHNA 4E2FB 3Q1JA 1SHZC 1VUBA 5AQPB 1NJIC 1AZEA 3CCLA 1B34B 4DV7T 5KYUA 3AE5A 3D0TA 5GANd 3C95A 2VB6A 3P8HA 4DA4A 5J26A 3UU4A 1HSQA 2ACZA 5LJ5j 4DR7T 3HA4A 3OB9A 2LJ3A 3REAB 3AA7B 2H3JA 3PUGA 2WBLA 3RRWA 4QVZA 1JRIA 1T0HA 3A8OB 1N9RA 2DJQA 3P4PA 4U31A 2F2VA 3JCMQ 3B57A 3AA6B 1YI2T 1YHQT 2LHRA 3G6EQ 1K9MU 1V9DA 1WX6A 3MPUB 3F2EA 1VQPT 1N33T 5AQTB 3DLMA 4PFZA 4QH1A 4DUZT 5KE2A 1AEYA 1RAFB 3IQLA 4JDSA 1K8AR 1BYMA 4UVCB 1JU5C 4M7DF 2CWOA 2YOEA 5HKCA 5F8PA 5FKYA 2E70A 2KT8A 3RLFF 2E1HA 2HEQA 1IHWA 4UVAB 4A4HA 2JM9A 2EW3A 2C5KT 2UXCT 3LJCA 2RI2A 2KEAA 2QDYB 1WYXA 4M7DC 2R5AA 2J62A 3X26B 2ZZDA 2D8JA 1SUMB 2DLRA 4ANJA 2DNUA 4X34A 3X24B 3GP8A 4HKEA 5ECAA 4IIOA 3FXEB 5LJ3d 2XQYA 3OYEA 3LK3B 2A72A 2WU5A 3AAAB 2WDVA 2V6YB 2IPOB 3RKGA 4EAHA 3THKA 4CN6A 4O4IE 2KINB 2XIDA 3C94A 3ZN1B 4M75A 5EG2A 2BKOA 4GK0E 2BUDA 1RUWA 1TG0A 4LDXA 4YLHA 1GL5A 3JCMh 4J7FA 2X35A 4YJ3E 3WAJA 2CT3A 2EQIA 4PNIA 3V5UA 4FSXA 1WJQA 1QKWA 4KRTA 4HWCA 1XZYA 3SEMA 1M3BA 2WY2A 4BI8B 2GNCA 3PUXF 2IUBA 1GBQA 1NLPC 2XU8A 3MO8A 4JS5A 3PV0F 4OF1A 5I11A 4GYSA 1XNRT 2HL3A 2XD0A 1NEKA 1Q82U 4JRKA 5HEGA 4C0DC 2CUBA 2JM8A 1GCQA 5HWYA 2YDSA 2CCQA 4M75D 1KD1R 3CCST 1KHIA 3EDUA 1TUGB 1WYCA 1E6GA 3FZMB 4WNKA 2MBGA 2A37A 3A8GB 5IXBA 1WHKA 2A28A 4FL6A 4C5GA 2ROLA 3S3OA 4ME7A 4Z8XA 4IE0A 4CXXA 2J1DG 2KWHA 4ZN1A 1BR4A 1V76A 4QQ6A 2NW7A 1HFAA 2QGGA 3JB9J 4ZS2A 4M75C 3VS6A 1V1CA 4DUYT 4UV8B 4P0BA 3OYHA 1QVPA 3PUWF 2HPLA 5LJ5d 4KHPT 2XQ3A 4A56A 4WBNE 3CD6T 4IE5A 8ATCB 2DIQA 3UULA 3Q5XA 2L3QA 4QX8B 2M6IA 3PDYA 1HCIA 1ABQA 2BVLA 4WF2A 3VV0A 5L47A 2E9XB 3UUXB 4IDNA 2E5KA 2HBPA 2LQKA 2QTVA 2V6YA 2W63A 3MP6A 1VQ8Q 2V7IA 4KUIA 1OEBA 4F7UG 2L9QA 2DL4A 2XAQB 3K3QC 3B5MA 4MLKA 3CC7T 1YJ9T 5FRMA 4LNPA 4X5TA 1OU8A 5GAN3 4O4HE 4B6XA 1GCQC 1Q86U 3QUIA 3RIUA 1YJNA 1KNZA 1AT1B 3F31A 3I9WA 2LRKA 4JRIA 4DR1T 1NAFA 4I4TE 1VQ6T 2W62A 2VVNA 2HQEA 5GAOm 3KUFA 2EKOA 4UIGA 3QO3A 3JCMV 1IXDA 3G4SA 2RHYA 4JI4T 3UQ4A 2ACXA 2KZ7B 2VK9A 3SB2A 2LM9A 1VOMA 5TAOA 1NEGA 3I0OA 2QRXA 2ZPHB 5CK9A 1VQLA 5A0DA 1LPLA 5CQXA 1JJ2S 1BR0A 3OYMA 2X3XD 2ZPFB 1WHMA 5GAMg 2Y6XA 2KXCA 3S3NA 3LWHA 3FB9A 5GAN5 4ZZCA 1M8MA 2CPTA 5FXXA 4J9DA 3REBB 3GMIA 4JJBA 2GBQA 3KFVA 1YCSB 4OP0A 4U2ZA 4ASKA 1PHTA 4IUTA 1EZZB 4FM4B 1UB4A 3T8OA 4C8QB 3PT9A 1T0JA 2B86A 1PM3A 4L0RA 3SFEA 3JADA 5KCHA 3GOXA 2BKNA 3DLLA 5LOVE 4A4FA 4OHFA 3M0PA 4MDWA 3FIFA 4GY5A 5LXTE 3VJPA 2B1EA 2L3RA 4HE8A 4C0FA 2E9XA 1M1GA 5GAMj 2PUKB 2LMJA 2B76A 2FZGB 2QQSA 2XHEB 5LG3A 2PTFA 1KJWA 5DLOA 1PKTA 2Y8DA 3AT1B 4P0AA 4Y92A 6AT1B 4UXNB 1VQ9A 2FO0A 1N27A 3O4XE 5HYAA 3JAFA 1VQNQ 2L89A 1L0VA 2N2NA 3BQIA 4J6XA 5GMKi 1IJ6A 3A8YC 3CMLA 1A0NB 3ZMUB 2C5JA 1LVFA 2QA7A 3DB3A 4QQGA 3RUXA 1AOJA 2KE9A 5FP3A 5HCMA 1WXTA 2I0NA 3UUBA 4M7DG 4EIKA 4XBFB 4O5VA 5GJWB 2RQTA 1Q7YR 3OYFA 4EEBA 5JDLA 3L2QA 2DTHA 4J83A 4JRPA 4LMLA 3ZT7A 4UR9A 3OSVA 1M5Q1 4ADZA 3K3OA 2KMFA 5IHYA 3QNUA 2FL7A 1WIEA 2FPFA 4M4ZA 5HEJA 3QUJA 4QT7A 4D8DA 2CBJA 2OA5A 3EG9B 3GF5A 2IIMA 4M77D 1Y01A 2EJ9A 1YKEB 2KI7A 2RHUA 3AE1A 4AG1C 3JAEA 4C90A 3D7SB 4OMLA 3PUVF 3CQTA 3UT5E 1QVFP 5D6XA 3MCAB 1KQ1A 1M3CA 2LE8A 4C8QA 5AQKB 1WI7A 2E5QA 3H37A 3N5LA 4M77C 1TOVA 5GAN2 3DJBA 4IT4A 4KHZF 1PSFA 1KK7A 4UF0B 2RHIA 3VRAA 2RN8A 1N34T 4FYVB 3CCEQ 2NP9A 1VQ4T 5H6QB 3CPWS 4IHJE 3Q5DA 3LK42 5GAMh 1E7PA 4EZ4A 1BIAA 4X1KE 3RIRA 2GCXA 1BB9A 1LVKA 1CHUA 1OPLA 3HR0A 2JT4A 2BBHA 3I1AA 4TN7B 4OMNA 3MP1A 3C51A 4JV5T 3A7MA 1VQOT 4AXPA 4J9EA 3P8DA 1UX4A 1WLPB 2ZMAA 2FJEA 3VUZA 2EYXA 2K2MA 2X4XA 2K5BB 2P4TA 3M3ZB 2LKHA 2VUBA 2VKNA 4XTXA 4DMVA 1YJWT 3KFWX 2GQVA 4MZPA 2X4YA 4M75G 2CGHA 3QIIA 3RHWA 2H8HA 4R55A 1G5VA 2LT3A 4ZZBA 4PJLA 2MAMA 4UC4A 5LBQB 3J7Yq 3CQCB 4TVRA 4YTLA 2MOXA 4HFBA 3EFSA 3G6EA 3CD6A 1I94T 4KT0E 2V7MA 5AQVB 4AKIA 5GJVB 3CMET 3E22E 2V5CA 2DKGA 1KNPA 3EHRA 3CX7B 5GAMd 4ILBA 5F5WA 3M5AA 2OTLQ 2LT4A 2VKHA 2RHZA 3JCMb 2C0IA 1K8AC 4TX5A 3VS1A 1WRDA 3ZYMA 3BY7A 4N4GA 1H92A 3CXCP 3RRCA 2LOPA 1NYGA 1K9MR 4H9PC 2HD0A 1MNDA 3C4SA 1OEDC 2M51A 2DPPB 4FT4A 1Y71A 2RMOA 3EG9A 1BCOA 3CBMA 3ZBDA 4KMCA 2GK9A 3LBXB 5L4EA 1QCNA 2DYIA 1OZ3A 2RA2A 1ZA1B 1IREB 4AKGA 2FEIA 4LUDA 3INZA 3H0HA 3JCMf 2O88A 3MEWA 3AVRA 3GWHA 5LGUB 2HBWA 2LTOA 3JAME 3GLXA 3AE4A 4LF9T 2CXLA 1JBMA 4M78E 4H9RC 4A5XA 2V7KA 1SPKA 4FW2A 2DEUA 2NW8A 3LFMA 1HX8A 5CB4E 2QASA 1M1KC 3KV4A 4E7JA 4ZEYA 3M0UA 4AFZC 5FWBA 4C92E 1R8IA 2LHNA 2HH7A 4JI8T 3A1PA 4JI2T 3RYCE 3NPFA 2MAWA 2JMAA 3UFEA 1ZSZA 4NXNT 2J47A 3ZLIA 1X2KA 5DABA 4NL2A 1MV0B 2X51A 4RTVA 3C12A 4FYWB 3CCLT 3ZCJA 3EG1A 3CBOA 3NTKA 3Q2MA 3CCET 1FMVA 3CPWA 4PK4A 4IUQA 3Q5EA 4NIQA 4QKNA 5FXVA 4KP3C 2LNHB 2BG9E 2DEQA 2L5QA 1UE9A 3SFMA 5L3BB 1W2BP 3HL8A 3AE7A 2R5MA 5BR8T 4L9IA 4Z02A 2UU9T 2JUFA 1MMNA 2A3DA 2XG8D 2OAUA 4QH5A 2MPXC 3OS5A 3VYHB 4M7AF 3N2OA 4M7AD 3AEAA 5FU6B 1VYUA 1KD1C 4QHOA 1Q82R 4JZ4A 2RNAA 2X9YA 3RIFA 2VKDA 5HCKA 3L2VA 2YWWA 1I0CA 4M7AC 1JEGA 3AB3B 3LG7A 3UUNA 1U1TA 5DM7R 4LF8T 2HSEB 2YRVA 4JLIA 3LBXA 1I81A 1X9BA 1ZSZC 5L3EB 2DAQA 3EG3A 2D5UA 2BS3A 4DV4T 3E19A 2PNIA 1LRZA 4DOWA 1WXBA 1MNEA 1IBKT 1G3TA 5CA1E 2JTMA 3OW2S 1HNZT 1IGQA 4EDUA 1ZA2B 1R8OB 2D6FA 3RC3A 2JXBA 1N32T 1KC8U 1T7SA 4TV8E 2V1RA 1W0BA 4TWHA 1VQ8A 2D9DA 5CR2A 2D0TA 2FJDA 3J7AF 1MIWA 5CO7A 1K0SA 4AKRB 1AD5A 2BE7D 1MGQA 1HJDA 5LHIB 1XNIA 4IUPA 2LX7A 3AAEB 1MUZA 1UGPB 2EYZA 4B3MT 3AEBA 5JDHA 3I9YA 2XPKA 1AHJB 1VA7A 1VRBA 3QXEB 2IMLA 3NTHA 5C3JA 1ZUYA 1N8RU 5AQNB 5AQJB 2P0KA 2YRCA 5I2MA 2GFAA 1NWMX 2CA5A 2XSBA 2XSAA 2K48A 2YKSA 3AEEA 2A9UA 4M77G 1ZX6A 4BE2A 4KULA 2ZPIB 1M30A 2XQ8A 4L59A 2KQWA 2COWA 2OTJT 2QI2A 1TSFA 2PFVA 5D6WA 5D7UA 1EZ3A 1WQWA 3RIAA 5IHNA 3PUZF 2EPDA 3MXZA 3RKXA 4FU6A 1UHFA 1E7OA 4ORZA 2YUNA 5EK4A 3RYFE 5LNKA 5LCYA 2PUOB 1VIEA 5IWAT 4CXYA 4Z8AA 4AG2C 2LSKA 2XZEA 2XQ5A 2LNVA 3HRSA 1B07A 2HL5C 2P9BA 5FY7A 3LX7A 2QG9B 1IJ5A 3WAKA 4OX9T 2F5KA 2DBMA 4JUVA 4EMKB 2DVJA 4DOVA 3SWNA 1NENA 5KX5E 2DIGA 4HN9A 4DBRA 3J81E 3Q9DA 2Q9QD 4O2BE 2FZCB 3PIOA 2W66A 3IHRA 1ZOYA 1NZ9A 5J3BA 2JVVA 3H41A 3QG1A 2FPDA 2FJBA 2VASA 4OGEA 2LQNA 5FY1A 4PLIA 1ABOA 4Q25A 1VQMQ 4MMLA 2Q9QC 2UXNB 2CM0A 1PWTA 5AQFB 4PJOF 4BUGA 4PJOD 1O75A 1OWAA 3BQKA 2PBIA 1VQNA 2KSRA 2XY8B 4JS4A 5LMNT 2KGTA 5LJMA 2XJ7A 1M4ZA 5AQSB 4RMOA 5AQHB 3ZT6A 1KFYA 4JJNK 4A4GA 1T72A 3OW2A 1X6BA 5LP6E 3M0RA 5GMKe 4PJNA 4HCKA 4PJOC 1PC0A 5IT9E 1YJNT 1R0BG 1M2OA 2CXDA 3FDRA 3R6NA 1FMWA 2WZIA 1DU2A 3ZC1A 3CBPA 2X4JA 2K2VA 4C8QE 1M90U 1Q7YC 3JCMc 1ZP0A 4DV5T 5HXEA 3EHQA 4HCCA 2JMKA 3G4ST 2EHOB 2CH4A 2LRLA 2CREA 3SWNC 2DETA 1H7CA 3N9NA 1X6GA 2ZM2A 3E1SA 1VQLT 2EKHA 2JQKA 2CZ7B 1XDOA 2K6DA 2F2XA 2GTJA 2CP2A 3VS3A 2NUZA 2LT1A 4MZTA 2QQ9A 5ABFB 2KRNA 2QEXQ 4LFBT 3M4GA 2FRYA 4ZGDB 3KDSE 1Y0MA 2CKKA 4LN2A 2DO3A 1KQSS 5CKBA 3P4WA 1SEMA 2XDDA 4YHHT 3HRTA 3HFNA 2WQYA 4AQFA 1D0YA 4X62T 5LBMA 1UHCA 1WXUA 3OS0A 3OPCA 4B3RT 4EMKA 3CCEA 4GOUA 2GQIA 2O4XB 3OS1A 4LD9K 3VS4A 2K3YA 4M78B 4HFIA 1X69A 5GONE 2AZVA 3RF1A 1K4US 4ZOLE 2HMAA 2L8KA 2X68A 5HEHA 2ZPBB 3IF8B 3LLRA 1MIVA 2K4YA 4C92B 1PD1A 5HCJA 2NUTB 4JI6T 3KVBA 3KBTA 2DTOA 2XICA 4KGVB 4JI5T 5KYWB 4CC2A 4G2AA 4IURA 3O9XA 3QKJA 1OX9A 2HQHA 5LG4A 3JB9I 1VQ9T 5J2TE 1Z9QA 2VXFA 2WZHA 2IC6A 4FYYB 1YITQ 4M7AG 3OYYA 3OYZA 2W4XA 4HEAA 4COFA 1OI1A 3PJAA 4DIDB 3M0QA 2VGMA 5CKHA 1WDXA 4NUUA 2BKPA 5FNVE 2E3HA 1VQ7Q 5FXZA 1PG5B 1D1CA 3E2UA 5CCAA 1FJGT 2AXDS 2BG9B 1J5WA 3PTAA 2BIVA 2LJ1A 3N5BB 4PK5A 2E5LT 2A36A 2OTLA 4AMCA 2FJAA 2J6FA 2EHOA 1Q81U 3AHUA 1YIJQ 3H0IA 4I43B 2WSCE 2PVDB 4CI2B 2DYBA 1K9MC 3RMQA 3UPUA 4A97A 4ZXLA 2AT1B 4O2AE 4VUBA 5GMKh 3VRYA 3HL6A 3HP9A 3QJYA 4HWFA 5ABFA 4DR2T 4IDQA 3ZEHA 5AQMB 4JI0T 2JW4A 3H0FA 2MMPA 3BW1A 4EIWA 5JQGE 3C50A 3HKBE 3CPFA 5A0GA 3T1HT 1B34A 3H6ZA 4DBFA 3L2RA 2K5IA 1MIYA 2O4XA 3PVLA 4M78A 1I6ZA 2V8JA 3QOFA 4KH0B 4IIMA 1JB0E 5CKEA 1QVGS 2K3XA 5FYMA 2ZGWA 2DM1A 2CSIA 3RBBB 4BY6B 3VR8A 3V8KA 4CI1B 3UU3A 3ZL7C 4AKLA 2XAFB 1ZUUA 2F2WA 4C0ZA 2DK3A 4C92A 2DX1A 3P4RA 2AK5A 2HSPA 5KYXB 2OTJA 3NVOA 4HFVA 2NUTA 4NL3A 1KQSA 2MK5A 4J9BA 2JN0A 1MMGA 1VCTA 2NTXA 2M02A 4J8OA 3UDCA 5KYWA 2EJGA 4O4JE 3PIPA 1YP5A 2J06A 2XHCA 4JI1T 4M75F 2CP5A 1FIOA 3FRNA 1YW0A 2OV9A 2LP5A 2WSEE 4FW1A 2LX9A 1GFCA 4U7IA 5FU7C 4E7ZA 4E6RA 2H7OA 1SRLA 1CKAA 4M78D 2M16A 5J2UE 5GMKl 2BG9A 3JCMd 5IXFA 1KF6A 2Z6EA 4N4IA 2RF0A 3GBQA 2XK0A 2IVWA 4CC4B 3SS1A 3G6ET 2K3BA 5FVKA 4WZXA 4H9QC 1WHLA 4IUUA 1Q82C 1NYFA 3AE8A 4AT1B 2WDQA 5HXCA 4RG2A 3ZMZB 1UTIA 4NS5A 5D6YA 1N5ZA 4HVUA 1GBRA 2JTFA 2IG0A 2QA4Q 1X27A 4EMHA 1IAPA 3L2ZA 1X79A 4I0UA 2DMOA 2XKOC 4YSYA 2LQ8A 2Y4XA 3E0ZA 4Z89A 1TTHB 4RKUE 3ZJ1A 4HFDA 2VQFT 4PJOG 4B9XA 2DNXA 3UWNA 3RH3A 3ZT5A 2EVRA 1BI1A 1FWZA 4DBQA 4F6RC 3OTOT 2KXDA 3GA8A 4H9OC 3VKIA 5GAOq 3ZN0B 2IHR1 1K73R 4TWFA 2K57A 1KNRA 4K11A 2NWBA 1YNZA 2KROA 3A8LB 1KC8R 3A5XA 4HVWA 5KYXA 3CK6A 1N9SA 3ZFJA 4DEXA 4YXDA 1ACMB 2EWNA 3SD4A 3WVEB 5AQUB 1GFDA 1PKSA 3X28B 2RQRA 4GKKT 4QVDA 1YWOA 4IL9A 1QWFA 5JDMA 3RYIE 5AFUL 3GN5B 4TUYE 2LC4A 2LOSA 1OYXA 2KYMA 1Q86C 1QVGA 2MOZA 1KG1A 3RKOA 1WZOA 3L2WA 1LCKA 3I56Q 3CCRQ 2KT1A 4XZCA 2PU9B 2DXBA 1XJWB 4DO0A 3TSZA 1N8RR 3LK2B 3JB9H 2ED1A 2Z0WA 4F7UE 1BK2A 3CQXC 1XQHA 3H8ZA 2HQXA 1GCPA 3RIUC 2RHXA 1I4K1 4E7KA 2EQUA 1D1BA 2V7LA 2K24A 2PJQA 5C6SA 4KUMB 1MV3A 2PVGB 4LFCT 3UU5A 3RC8A 2ATCB 2D0NA 2YEVC 2CS7A 2LRQA 3NZQA 2K9AA 2I59A 2WWVA 1KIKA 2EAYA 3H3AA 4DV1T 4KUDK 3JCFA 1HS7A 2AHJB 4C5EA 2RO0A 2V26A 1BI0A 2CUDA 3RKWA 4LF5T 1ZV4X 4DV2T 2RP4A 3EAMA 4JPBW 1PCXA 1S72Q 2DZCA 1FEWA 1RABB 2VXEA 3CQGB 3O1IA 3E9FA 4E7SA 5J39A 1WR6A 2YT6A 3OYAA 1T98A 1IGUA 4LF6T 2WDRA 5FL0A 4HWIB 3TEEA 1N6AA 3UFGA 1UG1A 4C91A 2DXUA 3JRZA 3KBGA 4HFCA 1RL2A 3OBYA 2LJLA 2CEAA 4HGAA 4PJMA 3FZHB 2XTLA 4U7YA 1VQ8T 2E64A 2JOYA 2FPEA 3URGA 4DNDA 4HCZA 2E9XD 3ZYKA 5HXSA 1WQ7A 2EYWA 4WYVA 2WWUA 3HI2A 4PFPA 5HXRA 5AQQB 2E8IA 3GN5A 2XM1A 3P8CD 1B7TA 3ESLA 4PAGA 1G83A 3NHNA 4M77F 3CCVQ 2E9XC 1Y64B 1F1BB 3M53A 2DLPA 2DXCA 3OYKA 4LMJA 4OK0A 3J80E 2MI6A 2DL7A 1I5OB 4J9HA 2L3SA 4XTZA 3EH2A 4XU1A 3C4ZA 2MF2A 3M59A 5KDMC 2DL1A 1M90R 5IH2A 3EG2A 1QSDA 1KHCA 1GRIA 2FBWA 2UUBT 3LDQB 3ZJ2A 1R0CB 2W0ZA
chains in the Genus database with same CATH topology
2DF6A 3AAIA 1UCUA 2DWKA 1PRLC 4RTXA 1D0XA 4WBOA 2H7VC 1KSWA 1U06A 3UUMA 4JEHB 2DL5A 3M65A 2MTQA 2KLQA 3CX6B 3C98B 2ES0A 2X9WA 2BZXA 4DVDA 2KBTA 5E0OA 4H9SE 5L3DB 4GIWA 4G63A 4OMMA 3OKQA 2FG0A 2YUOA 4OMPA 4GLMA 3ZMVB 2QGSA 3UA6A 5BMVE 4RTUA 3PVQA 2DBKA 5ADXL 5HWXA 1XOVA 3EGUA 2K9GA 3C4XA 3VS0A 5IYZE 3PU8A 2L0AA 3EG0A 2DA9A 2KYBA 2BZBA 2N1GA 2ZM0A 1KFZA 3PU3A 2VVKA 5L23A 4IE4A 4UV9B 4X1IE 2ROTA 4UF0A 2XMFA 4H63H 2AKLA 1QWEA 1WA7A 3PUAA 4JLEA 2EGCA 3CVRA 1U4QA 2AZSA 3I0QA 1AWXA 4M1PA 4MFRA 3PUSA 4X20E 4PFOA 4EYUA 2CSQA 5JR9B 2SPCA 4PW8A 3CPZA 2KWIB 4BJNA 3RNJA 2V7JA 4H9NC 1AWOA 1SSHA 2J7IA 1WLXA 5JDGA 3I5RA 1S94A 2DE0X 5EC7A 3R84B 1UJ0A 4F16A 4FI5A 1TUCA 1Z0PA 2LEHA 2KR3A 1VYVA 1D0ZA 3QC9A 3P7IA 1K76A 3VS5A 5LHHB 5J1GA 3NRXA 5L3CB 3MA9A 1T3LA 4IIJE 5IHIA 1US7B 3VHLA 3L09A 2X66A 2N9DA 1UDLA 4YJ2E 1U5SA 2RA1A 1CUNA 4HKAA 3CX8B 1SA0E 1H8KA 4J2CA 3N2GE 1O3XA 1S1NA 1HG5A 2JQQA 4QXBB 2OI3A 5JR9A 5FMNA 1TUDA 1NM7A 2V1DB 2O9VA 3OBVE 3U23A 4RTZA 2MCNA 2W61A 5EZYE 5JRCB 5LHGB 2DWGA 3AA0B 1QCFA 4XAXB 2PTKA 3FJ5A 1UJYA 3K3NA 4AKHA 3ZMTB 4MBQA 4AFSC 2VKOA 1K9AA 1AZGB 3AVSA 2O9SA 3E08A 1RI9A 3B13A 2X9HA 2D1XA 3QWYA 5JDQA 2D2SA 4ZI3D 1NLOC 2EGEA 1HD3A 5JVDE 4BJMA 3ZCIA 5FWCA 3V5SA 2GTOA 3NMZC 4ZI3C 3N9OA 4OMQA 5HAXA 4I50E 3I9QA 2CLYB 2XAHB 2BVMA 1MMDA 1PRMC 4R0KA 4EZHA 5A1LA 5M4YA 3A98A 3VS2A 2XAGB 2KT9A 3ONXA 2CDTA 2LZ6B 3PTRB 4AQGA 1SHGA 5C8YE 2EBPA 2CXFA 5L3GB 2A08A 1H3HA 5LGNB 4BA9A 4MHCA 4EYYR 2DL3A 4DMWA 2XUEA 3TSWA 4JUYA 1QUUA 2WAUA 4H63V 4HVVA 3HKCE 1CKBA 2P4RA 1OXZA 2KRMA 4RTYA 4CI3B 1JXOA 4QWNB 4EOZB 2EGAA 4WW0A 1JO8A 2DHRA 2JMHA 2W10A 4O8SA 1PNJA 4CC3A 1U3OA 1UFFA 3KVAA 5CA0E 1YKHB 4AQFC 3VS7A 3KV5A 2NTYA 2EYYA 3UATA 1UUEA 1ARKA 5IHKA 3N9PA 2CMRA 4X1YE 4AFUC 2JRKA 2CH4W 3ULRB 3SOLA 3NGPA 4AFQC 3MKDA 2H3RA 2DL8A 1BR1A 2QDLA 1W70A 2A2FX 2SEMA 2HDAA 4UELA 3U3IA 1NEBA 3MZKB 3ANWB 2L2PA 2EHOD 2C0SA 5DJQC 2CLYC 3ETUA 4L5GA 2W0GA 2L3LA 4HTEA 2EHOC 2IAKA 1M27C 3C0CA 2KNBB 5LYJE 3SRZA 3C64A 3ZPOA 1OPKA 2RQVA 2JMCA 1UX5A 5KMGP 2J6OA 4ZS3A 4ERRA 5FY0A 3M0SA 2BZ8A 3N2KE 4ESRA 1Z9ZA 4JZ3A 4QXCB 2IC9A 2YU2A 1IO6A 4JEUB 3UA7A 5F3JA 3VU7H 1G73A 2JS2A 3N9MA 2YUQA 4AI6A 5L3FB 4EB6E 3EVYA 4U72A 1AWWA 2AKKA 1ZSGA 1AWJA 4P09A 3ANWA 1BBZA 2ECZA 4K0UA 2LJ0A 3NZPA 4CZZB 3O5ZA 3ZC0A 2WMOA 2VWFA 2RPNA 1HG2A 3PE0A 1YWPA 4OMOA 1YD8G 2CWYA 1B3QA 4FSSA 1UGVA 2VL8A 1FYNA 4J9FA 4V1Av 1VYTA 4HXJA 3C4WA 2KRSA 4ISSA 1SHFA 2W00A 3SWHA 2CT4A 4JJCA 1JQQA 2SRCA 3DP7A 1U5PA 5JREA 5LA6E 4QXHB 4WCIA 4EXTA 1I07A 4GBQA 2NW9A 4TZ4C 1FMKA 3KV6A 4PJJA 3NRYA 1ZEEA 1K0XA 3O1JA 4YFSA 4J9CA 4MALA 1M3AA 4CC7A 4CXWA 2ODVA 2ESWA 4J9GA 1W6XA 1IZNB 2YINA 2NWMA 4DEYA 3JV3A 3PURA 2X3WD 4KBMB 4TV9E 4J9IA 1EFNA 2HCKA 3OJAA 2J05A 3N9QA 2HPJA 4Z88A 4BAYB 2DI4A 5HXHA 4RUGA 2ABLA 2JJ9A 1WFWA 4I55E 3I35A 3MK7C 4QX7B 3W15B 2VKJA 1NG2A 3BQLA 1BU1A 2DRMA 3AA1B 3QK6A 2C0OA 4ILUA 2BZYA 1SRMA 3TVTA 1J3TA 4CQIA 2X67A 2K7AA 1LKXA 1AVZC 1E6HA 1HTJF 4ZHQE 3CWZB 2K79A 2YK0A 2O31A 2O2OA 3U78A 2JTEA 3K8PC 3FXDB 3FHNA 3OYXA 2RQWA 3ZEFB 2D8HA 4PK6A 2CE7A 2WM9A 1G2BA 2ENMA 1X43A 2NOXA 2J6KA 1K1ZA 1BR2A 4D8KA 4IE7A 2V1QA 1ZKEA 3ETVA 1UECA 4FJOA 3S4UA 3MACA 2LSGA 3F57A 5LGTB 2C5IT 2KNDA 3IEEA 4LUEA 2JPFA 1QLYA 2WSSV 2YDLA 2D0UA 1OOTA 4O4LE 4A63B 4GK5E 3TKLB 1E1HB 3J9X1 3JC6D 3ZYLA 4RTTA 4UEMA 3KV9A 3VRZA 2Q9QB 2ZLYA 3JC6C 3RPUA 1ZLMA 3PUQA 2IW5B 1ZHCA 1ZBJA 5LJNA 2KXPB 1RLPC 3KBUA 2YUPA 3KINB 2X9XA 2LCSA 3EDVA 2VWAA 1CSKA 1QKXA 2GGRA 3WI3A 4IE6A 4IDZA 1Y57A 2M0YA 2LSYA 2LSJA 4UVBB 4LE9A 3RX6A 3UF4A 1T3SA 4NUVA 4YHJA 1AJ3A 4ZI7E 4OYKA 5ETWA 2XAJB 2RQUA 5JH7E 3L3PA 5EK3A 4ZNXA 3LH5A 2JS0A 1S35A 3ZMSB 2L3PA 2Q9QA 5DQWA 4RTWA 4F17A 2UXXB 3UTKA 1W1FA 2DILA 2X0LB 3VKHA 2MYSA 4X1VA 3I5SA 2C0TA 3M0TA 5L2LA 4ZI2D 4OYJA 4GYRA 2MIOA 3FBLA 2Y48B 2FRWA 3Q5WA 2ED0A 3RYHE 5H6RB 3QWXX 2DRKA 5JR9C 4ZI2C 2G0UA 2PZ1A 3HKDE 1G8XA 3BK9A 3HKEE 5FW9A 2ODUA 1WYBA 5JDNA 2BDEA 2M67A 1JXMA 4F14A 1RLQC 1YN8A 2ZM8A 5I22A 4U74A 3CKDA 2G6FX 1MMAA 3O1HA 4JJDA 2YU1A 3DTOA 2XASB 4IGUA 3IBPA 5JRCA 2LSIA 3MJXA 4N78D 2YSQA 2DCFA 1ZUKA 5DQVA 1X2QA 4ISTA 3EUHA 5JDFA 2OJ2A 5FXWA 1I1JA 4OFZA 3NBXX 5EK2A 2OAWA 3SHWA 2LQWA 1OV3A 3FBZA 1HF8A 2WMNA 3FB2A 2PG8A 3N9LA 1D1AA 3VKGA 2BTTA 1SHZC 1AZEA 3D0TA 2VB6A 1HSQA 3HA4A 2LJ3A 3REAB 3AA7B 3PUGA 2WBLA 3RRWA 1T0HA 2DJQA 2F2VA 3B57A 3AA6B 2LHRA 1V9DA 1WX6A 3F2EA 1AEYA 3IQLA 4UVCB 1JU5C 2CWOA 5F8PA 2KT8A 2HEQA 4UVAB 2JM9A 2EW3A 2C5KT 3LJCA 2KEAA 1WYXA 2D8JA 2DLRA 4ANJA 2DNUA 5ECAA 4IIOA 3FXEB 2XQYA 3LK3B 2A72A 3AAAB 4EAHA 3THKA 4O4IE 2KINB 3ZN1B 4GK0E 1RUWA 1TG0A 4YLHA 1GL5A 4YJ3E 3WAJA 2CT3A 2EQIA 4PNIA 3V5UA 1QKWA 4KRTA 3SEMA 1M3BA 2GNCA 1NLPC 1GBQA 5I11A 4GYSA 2CUBA 2JM8A 1GCQA 5HWYA 2CCQA 3EDUA 1WYCA 1E6GA 4WNKA 2MBGA 2A37A 5IXBA 2A28A 2ROLA 4Z8XA 4IE0A 4CXXA 2J1DG 2KWHA 1BR4A 2NW7A 1HFAA 4ZS2A 3VS6A 1V1CA 4UV8B 4P0BA 2HPLA 4A56A 4WBNE 4IE5A 3UULA 3Q5XA 2L3QA 4QX8B 3PDYA 1HCIA 1ABQA 2BVLA 2E9XB 3UUXB 2E5KA 2W63A 2V7IA 1OEBA 2L9QA 2DL4A 2XAQB 3K3QC 4MLKA 4LNPA 4O4HE 4B6XA 1GCQC 1KNZA 3F31A 3I9WA 1NAFA 4I4TE 2W62A 4UIGA 2ACXA 2KZ7B 2VK9A 2LM9A 1VOMA 5TAOA 1NEGA 3I0OA 1BR0A 2X3XD 2Y6XA 2KXCA 1M8MA 5FXXA 4J9DA 3REBB 3GMIA 4JJBA 2GBQA 3KFVA 1YCSB 4ASKA 1PHTA 3T8OA 1T0JA 2B86A 4L0RA 5LOVE 4OHFA 3M0PA 5LXTE 2B1EA 4HE8A 2E9XA 2LMJA 2XHEB 1KJWA 1PKTA 2Y8DA 4P0AA 4Y92A 4UXNB 2FO0A 3O4XE 5HYAA 2N2NA 3BQIA 1IJ6A 3CMLA 1A0NB 3ZMUB 2C5JA 1LVFA 2QA7A 1AOJA 2KE9A 5FP3A 1WXTA 2I0NA 4EIKA 4XBFB 5GJWB 2RQTA 5JDLA 4ADZA 3K3OA 2KMFA 5IHYA 2FPFA 1WIEA 4M4ZA 3QUJA 4QT7A 4D8DA 2OA5A 2IIMA 1YKEB 4AG1C 4OMLA 4C90A 3CQTA 3UT5E 1M3CA 2LE8A 1WI7A 3H37A 3N5LA 3DJBA 1KK7A 4UF0B 2RN8A 2NP9A 5H6QB 4IHJE 3LK42 4EZ4A 4X1KE 1BB9A 1LVKA 1OPLA 3HR0A 2JT4A 3I1AA 4TN7B 4OMNA 3C51A 4AXPA 4J9EA 1UX4A 1WLPB 2ZMAA 2EYXA 2K2MA 2K5BB 2VKNA 4DMVA 3KFWX 2H8HA 2LT3A 4PJLA 5LBQB 3J7Yq 3CQCB 2MOXA 2V7MA 4AKIA 5GJVB 3E22E 3EHRA 3CX7B 2VKHA 2C0IA 4TX5A 3VS1A 1WRDA 3ZYMA 1H92A 3RRCA 2LOPA 1NYGA 4H9PC 1MNDA 2M51A 2RMOA 4KMCA 2GK9A 3LBXB 4AKGA 2FEIA 4LUDA 3H0HA 2O88A 3AVRA 3GWHA 5LGUB 2HBWA 2CXLA 4H9RC 2V7KA 1SPKA 2NW8A 3LFMA 1HX8A 5CB4E 3KV4A 3M0UA 4AFZC 5FWBA 2LHNA 2HH7A 3RYCE 3NPFA 2JMAA 3UFEA 3ZLIA 1X2KA 5DABA 1MV0B 2X51A 4RTVA 3ZCJA 3EG1A 3Q2MA 1FMVA 4PK4A 4QKNA 5FXVA 4KP3C 2LNHB 1UE9A 5L3BB 4L9IA 1MMNA 2A3DA 3N2OA 1VYUA 4QHOA 4JZ4A 2RNAA 2X9YA 2VKDA 5HCKA 1I0CA 1JEGA 3AB3B 3LG7A 3UUNA 3LBXA 5L3EB 3EG3A 2D5UA 2PNIA 1LRZA 1WXBA 1MNEA 5CA1E 3RC3A 2JXBA 4TV8E 2V1RA 2D0TA 1MIWA 1K0SA 4AKRB 1AD5A 1HJDA 5LHIB 2LX7A 3AAEB 1MUZA 2EYZA 5JDHA 3I9YA 1VA7A 1VRBA 1ZUYA 1NWMX 2CA5A 2K48A 1ZX6A 1M30A 2PFVA 1EZ3A 5IHNA 2EPDA 3MXZA 1UHFA 1E7OA 4ORZA 2YUNA 5EK4A 3RYFE 5LNKA 5LCYA 4CXYA 4Z8AA 4AG2C 2LSKA 1B07A 2P9BA 5FY7A 1IJ5A 3WAKA 2DBMA 2DVJA 5KX5E 4HN9A 4DBRA 3Q9DA 2Q9QD 4O2BE 3IHRA 3H41A 2FPDA 2VASA 2LQNA 5FY1A 1ABOA 2Q9QC 2UXNB 2CM0A 1PWTA 1OWAA 3BQKA 2PBIA 2KGTA 5LJMA 1X6BA 5LP6E 3M0RA 4PJNA 4HCKA 2CXDA 3R6NA 1FMWA 3ZC1A 5HXEA 3EHQA 2JMKA 2EHOB 2CH4A 2CREA 1H7CA 3N9NA 1X6GA 2ZM2A 2EKHA 2K6DA 2F2XA 2GTJA 3VS3A 2NUZA 2KRNA 2FRYA 3KDSE 1Y0MA 4LN2A 1SEMA 4AQFA 1D0YA 1UHCA 5LBMA 1WXUA 4GOUA 2GQIA 3VS4A 1X69A 5GONE 2AZVA 1K4US 4ZOLE 2L8KA 2X68A 3IF8B 1MIVA 3KVBA 3KBTA 4CC2A 4G2AA 3O9XA 5LG4A 5J2TE 1Z9QA 2IC6A 3OYZA 4HEAA 3M0QA 1WDXA 4NUUA 5FNVE 5FXZA 1D1CA 2LJ1A 4PK5A 2A36A 2J6FA 2EHOA 3H0IA 4I43B 4CI2B 2DYBA 4O2AE 3VRYA 3HL6A 2JW4A 3H0FA 4EIWA 5JQGE 3C50A 3HKBE 1MIYA 3PVLA 4IIMA 5FYMA 2DM1A 2CSIA 3RBBB 4CI1B 3ZL7C 4AKLA 2XAFB 1ZUUA 2F2WA 2DX1A 2HSPA 2AK5A 4HFVA 4J9BA 1MMGA 2NTXA 4O4JE 1YP5A 2J06A 1FIOA 1YW0A 2LP5A 1GFCA 4E7ZA 4E6RA 2H7OA 1SRLA 1CKAA 5J2UE 5IXFA 2Z6EA 2RF0A 3GBQA 4CC4B 3SS1A 2K3BA 4H9QC 1NYFA 5HXCA 3ZMZB 1UTIA 1N5ZA 4HVUA 1GBRA 1X27A 1IAPA 1X79A 2DMOA 3E0ZA 4Z89A 3ZJ1A 2DNXA 3RH3A 2EVRA 4DBQA 4F6RC 2KXDA 3GA8A 4H9OC 3ZN0B 4K11A 2NWBA 1YNZA 2KROA 3A5XA 4HVWA 4DEXA 1GFDA 1PKSA 2RQRA 1YWOA 1QWFA 5JDMA 3RYIE 5AFUL 3GN5B 4TUYE 2LOSA 2KYMA 2MOZA 3RKOA 1LCKA 2KT1A 4XZCA 4DO0A 3TSZA 3LK2B 2ED1A 1BK2A 3CQXC 1GCPA 1D1BA 2V7LA 2K24A 2PJQA 4KUMB 1MV3A 3RC8A 2D0NA 2YEVC 3NZQA 2K9AA 2I59A 1KIKA 3H3AA 1HS7A 2V26A 2CUDA 1ZV4X 2RP4A 4JPBW 1FEWA 3CQGB 3O1IA 4E7SA 1WR6A 2YT6A 1T98A 1UG1A 4C91A 2LJLA 2CEAA 4HGAA 4PJMA 2XTLA 2FPEA 4DNDA 2E9XD 2EYWA 3ZYKA 5HXSA 2WWUA 3HI2A 4PFPA 5HXRA 2E8IA 3GN5A 3P8CD 3NHNA 1B7TA 3ESLA 4PAGA 1G83A 2E9XC 1Y64B 2DLPA 4OK0A 2DL7A 4J9HA 2L3SA 3C4ZA 5KDMC 5IH2A 3EG2A 1QSDA 1GRIA 3ZJ2A 2W0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DF6 A;  2PNI A;  2YUQ A;  2BTT A;  1PRL C;  4RTX A;  1WXB A;  1KSW A;  1U06 A;  1AZE A;  1AWW A;  2JXB A;  2AKK A;  1ZSG A;  1AWJ A;  2V1R A;  2DL5 A;  1BBZ A;  2ECZ A;  1K0S A;  1AD5 A;  2LJ0 A;  2BZX A;  2KBT A;  1HJD A;  3O5Z A;  1HSQ A;  2LX7 A;  1MUZ A;  2EYZ A;  2LJ3 A;  3REA B;  4OMM A;  2YUO A;  2FG0 A;  1T0H A;  1VA7 A;  2DJQ A;  2F2V A;  2VWF A;  2RPN A;  4OMP A;  1ZUY A;  4GLM A;  3PE0 A;  1YWP A;  4OMO A;  1B3Q A;  4FSS A;  3UA6 A;  1WX6 A;  1AEY A;  1UGV A;  3IQL A;  4RTU A;  3PVQ A;  2DBK A;  1FYN A;  4J9F A;  1VYT A;  1JU5 C;  1ZX6 A;  4HXJ A;  2KRS A;  1XOV A;  3EGU A;  1M30 A;  1SHF A;  2K9G A;  2KT8 A;  2HEQ A;  2CT4 A;  3VS0 A;  2JM9 A;  2EW3 A;  2L0A A;  3EG0 A;  4JJC A;  5IHN A;  1JQQ A;  2DA9 A;  2KYB A;  2SRC A;  2KEA A;  2EPD A;  1WYX A;  1KFZ A;  1UHF A;  1E7O A;  4ORZ A;  2YUN A;  2VVK A;  4WCI A;  5L23 A;  2D8J A;  1I07 A;  4GBQ A;  4Z8A A;  4AG2 C;  2DNU A;  2ROT A;  1B07 A;  2XMF A;  5ECA A;  4IIO A;  2AKL A;  2DBM A;  1FMK A;  2DVJ A;  1QWE A;  1WA7 A;  3THK A;  1K0X A;  2EGC A;  3H41 A;  2FPD A;  1RUW A;  4J9C A;  1TG0 A;  1M3A A;  2AZS A;  2LQN A;  4CC7 A;  1GL5 A;  1ABO A;  2CT3 A;  2EQI A;  1AWX A;  1PWT A;  2ESW A;  1QKW A;  4KRT A;  3SEM A;  1M3B A;  2KGT A;  2GNC A;  4J9G A;  1W6X A;  2CSQ A;  1NLP C;  1GBQ A;  5I11 A;  1X6B A;  3M0R A;  2NWM A;  4DEY A;  4HCK A;  3JV3 A;  2CUB A;  2JM8 A;  1GCQ A;  3R6N A;  2X3W D;  3RNJ A;  3EDU A;  1E6G A;  1AWO A;  1SSH A;  2J7I A;  3I5R A;  3EHQ A;  2A37 A;  5IXB A;  2A28 A;  2DE0 X;  2CH4 A;  2CRE A;  2ROL A;  5EC7 A;  4J9I A;  1EFN A;  2HCK A;  1X6G A;  1UJ0 A;  3VS6 A;  1V1C A;  2EKH A;  2J05 A;  4F16 A;  2K6D A;  1TUC A;  2F2X A;  2GTJ A;  3VS3 A;  2NUZ A;  4Z88 A;  2KR3 A;  1VYV A;  2KRN A;  2FRY A;  2L3Q A;  4RUG A;  1Y0M A;  3PDY A;  4LN2 A;  2ABL A;  1ABQ A;  1K76 A;  1SEM A;  3VS5 A;  1WFW A;  5J1G A;  1UHC A;  3I35 A;  1WXU A;  2E5K A;  2GQI A;  3VS4 A;  1OEB A;  1X69 A;  2AZV A;  1NG2 A;  1T3L A;  2DL4 A;  5IHI A;  1K4U S;  4LNP A;  1BU1 A;  2DRM A;  1GCQ C;  1UDL A;  1U5S A;  2C0O A;  2BZY A;  1SRM A;  3TVT A;  1J3T A;  3KBT A;  2K7A A;  1H8K A;  4CC2 A;  1S1N A;  1AVZ C;  2OI3 A;  1Z9Q A;  1E6H A;  1NEG A;  1TUD A;  1NM7 A;  2O9V A;  3M0Q A;  2K79 A;  3U23 A;  4RTZ A;  1WDX A;  2O31 A;  2O2O A;  2MCN A;  2X3X D;  2JTE A;  2KXC A;  2LJ1 A;  1M8M A;  2A36 A;  2RQW A;  4J9D A;  3REB B;  1QCF A;  2J6F A;  4JJB A;  2GBQ A;  3KFV A;  1YCS B;  2D8H A;  3H0I A;  2PTK A;  3FJ5 A;  1PHT A;  1UJY A;  2DYB A;  1G2B A;  2ENM A;  1X43 A;  1T0J A;  2B86 A;  2J6K A;  4AFS C;  3VRY A;  1K9A A;  1K1Z A;  1AZG B;  2O9S A;  3M0P A;  2JW4 A;  1RI9 A;  3H0F A;  4D8K A;  2D1X A;  2V1Q A;  3QWY A;  1UEC A;  2LMJ A;  3PVL A;  1KJW A;  4IIM A;  1PKT A;  1NLO C;  3F57 A;  2EGE A;  4Y92 A;  1HD3 A;  2FO0 A;  2DM1 A;  2CSI A;  3RBB B;  5FWC A;  3ZL7 C;  1ZUU A;  2F2W A;  2GTO A;  2DX1 A;  2HSP A;  2AK5 A;  4LUE A;  3NMZ C;  1QLY A;  2YDL A;  1OOT A;  1A0N B;  4OMQ A;  4J9B A;  4A63 B;  1AOJ A;  2KE9 A;  1WXT A;  2I0N A;  3I9Q A;  4EIK A;  1YP5 A;  2J06 A;  5GJW B;  2RQT A;  2LP5 A;  1GFC A;  4RTT A;  4E6R A;  1PRM C;  1SRL A;  4R0K A;  3VRZ A;  2FPF A;  1CKA A;  1WIE A;  3A98 A;  4M4Z A;  4QT7 A;  5IXF A;  4D8D A;  2RF0 A;  3GBQ A;  2IIM A;  1ZLM A;  3VS2 A;  4CC4 B;  2K3B A;  4AG1 C;  1NYF A;  4OML A;  2CDT A;  3CQT A;  1ZBJ A;  2LZ6 B;  1M3C A;  1UTI A;  1RLP C;  1WI7 A;  3KBU A;  1N5Z A;  4HVU A;  1SHG A;  1GBR A;  2EBP A;  2A08 A;  1H3H A;  1X27 A;  2YUP A;  2RN8 A;  2LCS A;  2DMO A;  3EDV A;  2DL3 A;  1CSK A;  4Z89 A;  1QKX A;  2GGR A;  3TSW A;  1BB9 A;  1OPL A;  2JT4 A;  4HVV A;  2EVR A;  1Y57 A;  2M0Y A;  4OMN A;  4J9E A;  2KXD A;  1CKB A;  1WLP B;  2EYX A;  2K2M A;  4LE9 A;  2P4R A;  4K11 A;  3UF4 A;  1T3S A;  1YNZ A;  2KRM A;  2VKN A;  4RTY A;  2KRO A;  4HVW A;  1JXO A;  4DEX A;  2EGA A;  1JO8 A;  1GFD A;  2H8H A;  2RQU A;  1PKS A;  2RQR A;  2W10 A;  1PNJ A;  4CC3 A;  1YWO A;  2MOX A;  1QWF A;  1U3O A;  1UFF A;  5GJV B;  4ZNX A;  2KYM A;  3LH5 A;  2JS0 A;  3VS7 A;  1LCK A;  3EHR A;  2KT1 A;  2C0I A;  2EYY A;  2L3P A;  3TSZ A;  3VS1 A;  3UAT A;  1H92 A;  2ED1 A;  4RTW A;  1BK2 A;  4F17 A;  1NYG A;  1UUE A;  1ARK A;  2M51 A;  1W1F A;  2DIL A;  1GCP A;  5IHK A;  2RMO A;  4AFU C;  4X1V A;  2CH4 W;  2C0T A;  3I5S A;  3M0T A;  3ULR B;  2FEI A;  3NGP A;  4AFQ C;  4LUD A;  2DL8 A;  3H0H A;  2O88 A;  2QDL A;  2HBW A;  1MV3 A;  1W70 A;  2SEM A;  2MIO A;  2HDA A;  2FRW A;  2ED0 A;  2D0N A;  1SPK A;  1KIK A;  3QWX X;  2DRK A;  1NEB A;  3M0U A;  4AFZ C;  5FWB A;  2CUD A;  2L2P A;  2PZ1 A;  1G8X A;  5FW9 A;  4JPB W;  3NPF A;  2JMA A;  1JXM A;  4F14 A;  1RLQ C;  1YN8 A;  2YT6 A;  1X2K A;  5I22 A;  1MV0 B;  4RTV A;  1UG1 A;  2G6F X;  2IAK A;  1M27 C;  3C0C A;  2KNB B;  3EG1 A;  2FPE A;  1OPK A;  2RQV A;  4JJD A;  2JMC A;  2LNH B;  2J6O A;  1UE9 A;  2EYW A;  3M0S A;  2BZ8 A;  2YSQ A;  1ZUK A;  3NHN A;  1G83 A;  1X2Q A;  4ESR A;  1Z9Z A;  1VYU A;  2DLP A;  4JZ3 A;  2DL7 A;  4JZ4 A;  4J9H A;  2L3S A;  2OJ2 A;  2RNA A;  1I1J A;  5HCK A;  1I0C A;  2OAW A;  3SHW A;  1IO6 A;  2LQW A;  1JEG A;  1OV3 A;  3UA7 A;  5IH2 A;  3EG2 A;  1GRI A;  2W0Z A;  3EG3 A;  2JS2 A; 
#chains in the Genus database with same CATH topology
 2X0H A;  2DF6 A;  2QEX A;  3WVD B;  3AAI A;  1UCU A;  4KGX B;  2DWK A;  3X20 B;  1PRL C;  1VCS A;  4RTX A;  1D0X A;  1H3Z A;  3AE6 A;  5GAO p;  4M7D E;  4WBO A;  2H7V C;  2BS4 A;  1KSW A;  1U06 A;  3UUM A;  4JEH B;  1LJO A;  2R57 A;  3RER A;  3S6W A;  3AE3 A;  2RH2 A;  2NR4 A;  2VQE T;  2DL5 A;  3M65 A;  2MTQ A;  4AIS A;  2KLQ A;  3CX6 B;  3HTR A;  2EIF A;  3C98 B;  3AEC A;  4QH4 A;  2ES0 A;  2X9W A;  2BZX A;  3CXC A;  4DVD A;  2KBT A;  5E0O A;  2BKD N;  4H9S E;  4C8Q D;  2A0F B;  2XDP A;  5L3D B;  4GIW A;  1XMQ T;  4G63 A;  2E3I A;  4OMM A;  3CCM Q;  4OB1 B;  1T8B A;  3OKQ A;  2FG0 A;  2YUO A;  4PL6 A;  5AQI B;  3RMS A;  4N4H A;  4OMP A;  4ELY C;  5LMU T;  4GLM A;  2QAZ A;  3OYG A;  4XTW A;  2WSF E;  4C8Q C;  3ZMV B;  2QGS A;  1JJ2 P;  4HFH A;  3UA6 A;  1YIT A;  1EX4 A;  2XQ4 A;  3PMI A;  5BMV E;  4MMK A;  4DR4 T;  4RTU A;  3ZKR A;  3VR9 A;  2DBK A;  3PVQ A;  1VQN T;  5ADX L;  5HWX A;  4HWH A;  1VQ7 A;  1XOV A;  2MWO A;  3EGU A;  1UK5 A;  2K9G A;  4YY3 T;  3C4X A;  3VS0 A;  1G3Y A;  5IYZ E;  4L6V 5;  3PU8 A;  1RAE B;  2L0A A;  3EG0 A;  3V7S A;  1BI3 A;  2DA9 A;  2KYB A;  1VIF A;  2BZB A;  3LW5 E;  2N1G A;  2ZM0 A;  3FZF B;  1KFZ A;  4BAC A;  2O01 E;  1YIJ A;  3PU3 A;  2VVK A;  5L23 A;  4IE4 A;  4UV9 B;  2BE9 B;  2L8D A;  2F4V T;  2W2U A;  2X4W A;  3M57 A;  4X1I E;  2ROT A;  4UF0 A;  2DXT A;  2XMF A;  1P92 A;  5ABH A;  4DR3 T;  1SG5 A;  3CCU Q;  1Q81 R;  4H63 H;  1M8V A;  2AKL A;  5JTG A;  2M1H A;  2YRD A;  3ASK A;  3LGL A;  3JCM P;  1QWE A;  1WA7 A;  2KAF A;  4PNO A;  2DER A;  3PUA A;  4JLE A;  4LF7 T;  2EGC A;  1U8R A;  1M1F A;  3CVR A;  2F1L A;  1U4Q A;  1IRX A;  1VQ5 Q;  1M2V B;  2AZS A;  1IBM T;  3I0Q A;  1AWX A;  3TQ7 P;  4M1P A;  1M7K A;  4MFR A;  4U3C A;  2H3E B;  1UGO A;  2Y90 A;  5KYN A;  3GPL A;  2RI5 A;  4RG8 A;  3PUS A;  4X20 E;  2V8K A;  4PFO A;  2CRB A;  4XTV A;  4EYU A;  2CSQ A;  3H9N A;  5JR9 B;  4GLK A;  3T9N A;  2V8I A;  4RCB A;  2SPC A;  4PW8 A;  4B6M A;  3CPZ A;  2H88 A;  2D9T A;  1SE7 A;  2KWI B;  1EIF A;  4BJN A;  3CC2 Q;  3UU6 A;  4EED A;  1JNZ A;  3JCM W;  3RNJ A;  2V7J A;  4H9N C;  3I55 Q;  1AWO A;  2J4G A;  1HNW T;  3ZSS A;  1SSH A;  1WLX A;  5JDG A;  2J7I A;  1S94 A;  3I5R A;  3LH0 A;  2QYZ A;  3G71 Q;  2DE0 X;  4HCB A;  5EC7 A;  3R84 B;  1RI0 A;  2K5F A;  1UJ0 A;  4F16 A;  4FI5 A;  2FVU A;  5FRN A;  3EAE A;  1TUC A;  1Z0P A;  3OS2 A;  1X01 A;  2LEH A;  4F7U B;  1C6V X;  3NKZ A;  2KR3 A;  2KSS A;  1W09 A;  1VYV A;  1D0Z A;  3QC9 A;  3OYI A;  2H89 A;  2LLY A;  3P7I A;  3MP8 A;  2OTL T;  1QW1 A;  3VUB A;  3OBW A;  1K73 U;  1K76 A;  3VS5 A;  2QXF A;  2M0O A;  1WR0 A;  5LHH B;  5J1G A;  3CMA Q;  2QA4 A;  3HPW A;  4MZM A;  3NRX A;  3UU8 A;  5L3C B;  3MA9 A;  2P84 A;  1T3L A;  1U1S A;  4IIJ E;  4XU0 A;  5IHI A;  4ILC A;  1US7 B;  3OYD A;  3VHL A;  3L09 A;  2NUP B;  2X66 A;  2N9D A;  1UDL A;  4YJ2 E;  1M2V A;  1U5S A;  2E10 A;  2YLC A;  2RA1 A;  1FX7 A;  1CUN A;  5GAN e;  4HKA A;  3CX8 B;  5KYY B;  3JCM J;  1SA0 E;  5I2S A;  1H8K A;  3LYI A;  4J2C A;  3N2G E;  4EMG A;  3CC4 Q;  2QQA A;  1O3X A;  1S1N A;  3VU3 C;  1K73 C;  1HG5 A;  2JQQ A;  4YTM A;  2QVA A;  4QXB B;  2OI3 A;  1RAI B;  1KC8 C;  5JR9 A;  5FMN A;  1TUD A;  2JQ9 A;  1NM7 A;  2V1D B;  2O9V A;  3OBV E;  3U23 A;  2CBI A;  1OU9 A;  2JIW A;  3EI0 A;  3M58 A;  3PNW C;  4RTZ A;  5FLX E;  1VQK Q;  2MCN A;  2W61 A;  3FZK B;  2DFU A;  4R56 A;  1YQ4 A;  4J6W A;  5EZY E;  5JRC B;  5LHG B;  2DWG A;  3P50 A;  1X6O A;  2HKQ B;  1DJ7 B;  3I56 A;  3CCR A;  1W4S A;  7AT1 B;  3AA0 B;  4E7H A;  1QCF A;  4XAX B;  5HEO A;  5GAO r;  2PTK A;  3FJ5 A;  1N8R C;  2GFU A;  1UJY A;  5I21 A;  3K3N A;  4AKH A;  3ZMT B;  4MBQ A;  4LFA T;  3EAB A;  5CKD A;  4XU2 A;  4AFS C;  4JRQ A;  4F7U A;  2VKO A;  2YDQ A;  1K9A A;  1WNL A;  3RQW A;  1AZG B;  3AVS A;  2O9S A;  2QQB A;  4YSZ A;  1W9R A;  3E08 A;  1RI9 A;  1WHG A;  3B13 A;  4XTU A;  2CZ1 B;  2X9H A;  4Z90 A;  2D1X A;  1MHN A;  1TU0 B;  5LJ3 g;  3OQ5 A;  3A8M B;  5LJ3 e;  3QWY A;  4Y28 E;  5JDQ A;  3NTI A;  2D2S A;  4C8Q G;  1YI2 Q;  4QKU A;  1YHQ Q;  3EFO B;  2YXY A;  4M7D B;  4ZI3 D;  1NLO C;  2EGE A;  3FC3 A;  1HD3 A;  1VQP Q;  4LDU A;  3AE9 A;  5JVD E;  3X1D A;  4BJM A;  1SKU B;  2HHH T;  1S72 A;  3ZCI A;  1H64 1;  5FWC A;  3V5S A;  2CYZ B;  2NUP A;  5FU6 C;  2LM2 A;  4N0A A;  2GTO A;  3NMZ C;  2KMT A;  4X65 T;  4ZI3 C;  5KYY A;  3N9O A;  4OMQ A;  5HAX A;  2R6G F;  4I50 E;  3I9Q A;  5GAO n;  3AEF A;  3RQU A;  2CLY B;  5HK0 A;  2XAH B;  3A8H B;  3VYG A;  2BVM A;  4ELZ C;  4U2Y A;  3MEU A;  1MMD A;  3AXJ B;  3P4Q A;  1PRM C;  4R0K A;  4TNW A;  4EZH A;  5A1L A;  5M4Y A;  3A98 A;  3UQ7 A;  3CCV A;  1NJI U;  2PQW A;  2ZCF B;  3TLS A;  4YT0 A;  3VS2 A;  4V2S A;  4PKC C;  1IHV A;  2XAG B;  4J5Y A;  2FB7 A;  2KT9 A;  1Q95 G;  3ONX A;  3P4S A;  2CDT A;  5GMK j;  2LZ6 B;  2I0M A;  2EQK A;  3PTR B;  4A4E A;  4C0D B;  4AQG A;  1SHG A;  4DBH A;  4E47 A;  5C8Y E;  2EBP A;  5LJ5 g;  2CXF A;  5L3G B;  2A08 A;  5LJ5 e;  3TLW A;  4BA9 A;  5LGN B;  4HWD A;  1R77 A;  5KXJ A;  4NXM T;  4EPC A;  1OED E;  1M9S A;  1PSE A;  4C5I A;  3OMG A;  3OW2 P;  1LOJ A;  2AIR B;  4MHC A;  4EYY R;  2DL3 A;  5AQR B;  4DMW A;  2EYQ A;  4X9C A;  2XUE A;  3TSW A;  4JUY A;  1QUU A;  3V7C A;  4M75 B;  2WAU A;  4H63 V;  4HVV A;  3S3M A;  3HKC E;  3EFO A;  4M7D A;  1CKB A;  3CCS Q;  2P4R A;  1OXZ A;  2KRM A;  4RTY A;  1FXX A;  5CKF A;  1BCM A;  4CI3 B;  5GAN 6;  1JXO A;  4QWN B;  5AQL B;  4EOZ B;  2QK0 A;  5M9O A;  1HXD A;  4AIU A;  3JB9 D;  3JB9 F;  3CCM A;  1H3H A;  3ABV A;  1G3S A;  2EGA A;  4WW0 A;  3UT1 A;  1JO8 A;  2DHR A;  2QQR A;  2JMH A;  4DV3 T;  2W10 A;  2E41 A;  1HNX T;  1JNR A;  5LJ3 h;  4O8S A;  1PNJ A;  4CC3 A;  3PFS A;  1U3O A;  1UFF A;  3KVA A;  1WHH A;  5DLQ E;  1RAA B;  1SF9 A;  5CA0 E;  1YKH B;  3RES A;  1VQM T;  2C06 A;  3CD6 Q;  3L42 A;  4FIB A;  5A2Q E;  4AQF C;  3VS7 A;  2FHD A;  1Z8U A;  1YQ3 A;  3KV5 A;  2NTY A;  4EMK C;  3AXJ A;  2CZ0 B;  2EYY A;  2ZPE B;  2LDM A;  3UAT A;  5C0M A;  5KE3 A;  4M7D D;  1UUE A;  4EGW A;  2HN1 A;  2RPA A;  1ARK A;  3G1J A;  3N9P A;  2CMR A;  4X1Y E;  2D0Q B;  2DTI A;  1IBL T;  5IHK A;  4AFU C;  2JRK A;  1HYO A;  2CH4 W;  3ULR B;  3OVU A;  2QTX A;  3QJ6 A;  3SOL A;  3CC7 Q;  4BE0 A;  3NGP A;  4QVC A;  1YJ9 Q;  4AFQ C;  3MKD A;  2H3R A;  2DL8 A;  1BR1 A;  2QDL A;  1UUS A;  2YLB A;  4TWD A;  2E4H A;  1W70 A;  2A2F X;  2SEM A;  5GAN 8;  3OY9 A;  2HDA A;  5ABE A;  4RCC A;  2XQ7 A;  4ATO A;  4UEL A;  3U3I A;  4P5N A;  1VQ6 Q;  5AQG B;  5AT1 B;  3CCU A;  1NEB A;  1TS9 A;  4M7A E;  1M1K R;  1M90 C;  1Q81 C;  3MZK B;  3ANW B;  2L2P A;  2EHO D;  2C0S A;  2NLU A;  4IUV A;  4IKF A;  5DJQ C;  3PUY F;  2QEX T;  2CLY C;  2DJZ A;  3ETU A;  4L5G A;  2UUA T;  3R6O A;  2W0G A;  1UGS B;  1VQ5 A;  2W67 A;  4PLL A;  2CP3 A;  4AQY T;  2L3L A;  3QSU A;  4HTE A;  3AED A;  2EHO C;  4O6J A;  2IAK A;  1M27 C;  5LJ5 h;  3C0C A;  4ZTF A;  2KNB B;  2WAC A;  4C5H A;  5LYJ E;  3SRZ A;  1I5L A;  3CCJ Q;  4XTY A;  3C64 A;  3ZPO A;  3TLU A;  1OPK A;  2RQV A;  2JMC A;  3EHZ A;  1UX5 A;  2FUP A;  5KMG P;  5FVL A;  2J6O A;  4ZS3 A;  4ERR A;  2E5V A;  5FY0 A;  1BKB A;  2CP0 A;  4M78 F;  2LCL A;  1N36 T;  3MEA A;  3M0S A;  4OB0 B;  2V8S V;  2E65 A;  3QYG B;  2CZ6 B;  4OB2 B;  2BZ8 A;  3CC2 A;  2XQ9 A;  3N2K E;  1Y7X A;  3M9Q A;  1Z9Z A;  4ESR A;  4JZ3 A;  4C92 F;  3LGF A;  4QXC B;  3ZST A;  4C92 D;  3I55 A;  4M78 C;  1C1A A;  3L39 A;  3G71 A;  4CI0 C;  2IC9 A;  2I6H A;  1YIT T;  2X0Y A;  4FCY A;  2VV5 A;  2YU2 A;  1Y07 A;  1I8F A;  1E2A A;  1IO6 A;  4JEU B;  4II1 A;  4J6Y A;  3UA7 A;  1YXR A;  4HA8 A;  2KDS A;  4C92 C;  1VQ7 T;  1QVF S;  5F3J A;  3VU7 H;  2R58 A;  2CHO A;  4BB7 A;  1KQS P;  1G73 A;  2JS2 A;  5LL6 S;  2ZAE A;  3N9M A;  4IDP A;  2YUQ A;  4AI6 A;  5L3F B;  4EB6 E;  1XTD A;  4ZN3 A;  3EVY A;  3OYB A;  4U72 A;  5KCO A;  1YIJ T;  4X64 T;  1AWW A;  2VUR A;  3HHT B;  3CMA A;  2AKK A;  4IRE A;  1ZSG A;  1AWJ A;  4P09 A;  5CJ5 A;  3ANW A;  1BBZ A;  2ECZ A;  5L4H A;  4MDX A;  3HFO A;  4K0U A;  2LJ0 A;  3NZP A;  2BG9 C;  4CZZ B;  1HK9 A;  3O5Z A;  2VYT A;  2VC8 A;  3ZC0 A;  3HSB A;  2WMO A;  4M77 B;  4LD6 A;  2OX7 A;  2COZ A;  3PJA J;  4FT2 A;  1IZ6 A;  3OA6 A;  3BDL A;  2VWF A;  2RPN A;  3DKM A;  1HG2 A;  1KQ2 A;  4A4K A;  3CC4 A;  3PE0 A;  1YWP A;  4OMO A;  1YD8 G;  2CWY A;  1B3Q A;  4FSS A;  3M56 A;  1UGV A;  4OVA A;  3MEV A;  2VL8 A;  1FYN A;  4J9F A;  3O8V A;  4V1A v;  1VYT A;  4LMK A;  4HXJ A;  2KY9 A;  1M62 A;  3C4W A;  2KRS A;  1VQK A;  4ISS A;  1SHF A;  5LB7 B;  2EQM A;  2OLT A;  2W00 A;  3SWH A;  2CT4 A;  4B3S T;  3JCM X;  2DVE A;  1IB8 A;  1VQ4 Q;  4PJO E;  5GAM e;  1QP3 A;  4OMF B;  4JJC A;  1JQQ A;  3CXC S;  4ZGJ B;  2SRC A;  4BDY A;  3V7R A;  3DP7 A;  2YHT A;  1U5P A;  1J5E T;  5JRE A;  3CCJ T;  3OYJ A;  5LA6 E;  1XDP A;  4QXH B;  4EXT A;  4WCI A;  4LF4 T;  1I07 A;  2A7Y A;  4BY6 C;  1D3B B;  4GBQ A;  1VQO Q;  4DV6 T;  3QPH A;  2XDB A;  2NW9 A;  4TZ4 C;  5A0L A;  2ZPG B;  3JSC A;  1FMK A;  3OSS C;  1O9S A;  2F5T X;  3CCQ Q;  3KV6 A;  4PJJ A;  5C2T A;  4BI4 A;  1YJW Q;  3NRY A;  3SFD A;  1ZEE A;  1K0X A;  1OED B;  2RK2 A;  5L8R E;  1QVG P;  4B9W A;  3SDZ A;  1UUR A;  3O1J A;  4YFS A;  3NFC A;  4MAL A;  4J9C A;  5AYF A;  1YI2 A;  1VQM A;  1M3A A;  1YHQ A;  4CC7 A;  4CXW A;  2RD1 A;  3JB9 G;  2ODV A;  4BD3 A;  2UUC T;  2EJF A;  3QZ9 B;  5HY6 A;  3CME Q;  2QA4 T;  1VQP A;  1QVF A;  1UGR B;  1RAD B;  1SSF A;  4U33 A;  2ESW A;  4J9G A;  4M77 A;  1W6X A;  5GAN f;  1IZN B;  3EGD B;  1GQE A;  1QP2 A;  3FEO A;  2YIN A;  1W0A A;  2NWM A;  4DEY A;  3TLT A;  3JV3 A;  3PUR A;  2HNI A;  4JLG A;  3E9G A;  1W2B S;  2X3W D;  4D6W A;  2UXB T;  4J7I A;  4KBM B;  1PD0 A;  2P0P A;  1HX1 B;  4TV9 E;  1D09 B;  4J9I A;  1EFN A;  2HCK A;  4LXC A;  3OYN A;  3OJA A;  4YSX A;  1Y96 B;  3QYH B;  2J05 A;  2PVO B;  2XI9 A;  3N9Q A;  4F04 B;  2HPJ A;  4BI3 A;  4DQ2 A;  3ME9 A;  2RJC A;  5CIU A;  4Z88 A;  4BAY B;  2DI4 A;  1C0M A;  1XWM A;  5HXH A;  4RUG A;  3I56 T;  3CCR T;  1TWB A;  1D3B A;  2ABL A;  1NJI R;  3QBY A;  2JJ9 A;  1KEY A;  1WFW A;  4I55 E;  3I35 A;  1JJ2 A;  3CCL Q;  3MK7 C;  4QX7 B;  1OUL A;  3G06 A;  3W15 B;  2VKJ A;  3K1S A;  1NG2 A;  1YCY A;  3BQL A;  1OED A;  4C8Q F;  5LJ3 f;  3LWI A;  4M7A B;  2XM2 A;  4HFE A;  1BU1 A;  2DRM A;  3AA1 B;  3F70 A;  4E7L A;  5HEU A;  3QK6 A;  2C0O A;  3EGX B;  4ILU A;  1XNQ T;  3BDU A;  1ZSZ B;  4A53 A;  2BZY A;  1SRM A;  3QDR B;  1K8A U;  3TVT A;  1J3T A;  4CQI A;  3CCS A;  2X67 A;  2K7A A;  4M78 G;  1LKX A;  4X66 T;  4LDW A;  1AVZ C;  4YTN A;  2I2L A;  4JI3 T;  3CCQ T;  1E6H A;  3EGD A;  1HTJ F;  5GAN 7;  4ZHQ E;  1S72 T;  1RAG B;  2IDO B;  3CWZ B;  4C92 G;  3T1Y T;  2K79 A;  2YK0 A;  2O31 A;  3QB5 K;  2O2O A;  3X25 B;  3U78 A;  2JTE A;  5HK3 A;  3K8P C;  3NWI A;  4QW2 A;  1NE8 A;  3FXD B;  3FHN A;  4EV6 A;  5GAO l;  2KK4 A;  2V5D A;  3OYX A;  3L1A A;  2RQW A;  1LNX A;  3ZEF B;  1M1K U;  1ZQ1 A;  4LDY A;  2D8H A;  4PK6 A;  2JQH A;  2M9U A;  2CE7 A;  2JNG A;  3L8R A;  2EFI A;  2WM9 A;  4B3T T;  1Y96 A;  3A5Z B;  1G2B A;  2ENM A;  1WJS A;  2Y4Y A;  1X43 A;  2RM4 A;  2NOX A;  3GNG A;  2J6K A;  2RI3 A;  3OYC A;  4M75 E;  1WGS A;  3CC7 A;  3TRE A;  2IIU A;  1WPY A;  1YJ9 A;  1K1Z A;  5CGM A;  2VL0 A;  1BR2 A;  4YTP A;  3CCV T;  1W2B A;  2A3L A;  4D8K A;  2VVS A;  4IE7 A;  2M6B A;  4WTO B;  5LJ5 f;  1GXI E;  2V1Q A;  1ZKE A;  2DD5 A;  3ETV A;  1VQ6 A;  4A98 A;  1UEC A;  4FJO A;  1WFD A;  2G3R A;  3S4U A;  2BS2 A;  3MAC A;  5IN1 A;  2LSG A;  3F57 A;  4F8H A;  2XQA A;  5LGT B;  2B8A A;  4M7A A;  2C5I T;  4KX6 A;  2VGN A;  4DV0 T;  1G3W A;  1J1J A;  2KND A;  3IEE A;  2LCC A;  3EGX A;  4LUE A;  2JPF A;  1QLY A;  1KD1 U;  3L2U A;  2WSS V;  2YDL A;  2D0U A;  1OOT A;  3PGG A;  2OTJ Q;  4O4L E;  2YDR A;  4HT9 A;  4Y91 A;  4A63 B;  4GK5 E;  4X9D A;  5AQO B;  3OYL A;  2WS3 A;  3TKL B;  3DB4 A;  3CIR A;  3MET A;  3M4Y A;  1E1H B;  1WCR A;  3CCJ A;  3J9X 1;  4IDO A;  4E7I A;  3JC6 D;  3HRU A;  8AT1 B;  3ZYL A;  1RAC B;  2K5L A;  4RTT A;  3PMT A;  4UEM A;  4XU3 A;  3KV9 A;  5GAN 4;  2RK1 A;  3VRZ A;  2Q9Q B;  5FRO A;  1RAH B;  3CCM T;  3HKS A;  2ZLY A;  3JC6 C;  2DD4 A;  3TCJ A;  3RPU A;  1ZLM A;  1XMO T;  3PUQ A;  2IW5 B;  2YN6 A;  2EQJ A;  3MHX A;  1ZHC A;  1ZBJ A;  3ER0 A;  4PJO B;  5LJN A;  3CPW P;  4JBW F;  2KXP B;  1RLP C;  4ZGE B;  3KBU A;  3V8L A;  2UXD T;  4IL4 A;  1V29 B;  3LSV A;  3QDF A;  2K3W A;  2YUP A;  3KIN B;  2X9X A;  5IUX A;  3TU4 K;  3RKY A;  2LCS A;  1OZ2 A;  4JYA T;  3QHS A;  3EDV A;  4LDV A;  2GF7 A;  2MPK A;  2VWA A;  3SWN B;  1CSK A;  4KH1 B;  1QKX A;  2BBJ A;  2GGR A;  2HN2 A;  2CP6 A;  3AE2 A;  3WI3 A;  2FYK A;  5CAI A;  2ZM6 T;  4IE6 A;  4XK8 E;  5GAN g;  1YJN Q;  4IDZ A;  1Y57 A;  2M0Y A;  2LSY A;  5J0Z A;  2LSJ A;  2QYW A;  1NBE B;  4FYX B;  5FL1 A;  4UVB B;  1YBY A;  2F69 A;  4LE9 A;  2E12 A;  4C0G A;  3CCU T;  2QGF B;  2LVM A;  3RX6 A;  1HR0 T;  3UF4 A;  1T3S A;  4NPP A;  4NUV A;  3M54 A;  3WXM B;  4YHJ A;  3G4S Q;  9ATC B;  1AJ3 A;  4ZI7 E;  4OYK A;  3GIB A;  2DZ9 A;  5ETW A;  2XAJ B;  2RQU A;  1VQL Q;  1VQ5 T;  5JH7 E;  2E2A A;  2RB6 A;  4ZTJ A;  3RDV A;  3GNF B;  3L3P A;  5EK3 A;  3EH1 A;  4ZNX A;  1UGQ B;  3LH5 A;  1UEB A;  1Q86 R;  2JS0 A;  4P1N A;  1S35 A;  3ZMS B;  1WHJ A;  2COY A;  5GAN j;  2L3P A;  2Q9Q A;  5DQW A;  5ABG A;  1NPP A;  4RTW A;  4F17 A;  2UXX B;  2CP7 A;  1ZBX A;  2AE9 A;  3UTK A;  1W1F A;  2DIL A;  1VQ4 A;  2X0L B;  3VKH A;  1TXQ A;  2MYS A;  4X1V A;  3I5S A;  2C0T A;  3M0T A;  1QMC A;  5CQY A;  3AEG A;  1QCO A;  5L2L A;  3CC2 T;  4NOY A;  3ONL C;  2LKG A;  4ZI2 D;  4OYJ A;  4Z91 A;  4GYR A;  3BE3 A;  3VRB A;  4PJO A;  2FZK B;  4DR6 T;  3I55 T;  4CN1 A;  3IA3 A;  4Q5W A;  3QZ5 B;  2MIO A;  3FBL A;  4TNV A;  3G71 T;  2Y48 B;  2FRW A;  3Q5W A;  2ED0 A;  1VQO A;  1QLB A;  3RYH E;  5H6R B;  2E6Z A;  3RR6 A;  1OX8 A;  3QWX X;  2DRK A;  5JR9 C;  4ZI2 C;  4XQ3 A;  4M77 E;  5KYU B;  3CCQ A;  2G0U A;  4K0K T;  5CVI A;  1YJW A;  2PZ1 A;  4OB3 B;  3HKD E;  1VQ9 Q;  1G8X A;  3BK9 A;  3HKE E;  2E6N A;  2ODU A;  5FW9 A;  1WYB A;  5JDN A;  4GKJ T;  2MWP A;  2BDE A;  5KH6 A;  2V6X A;  2M67 A;  2WB5 A;  2RJE A;  1JXM A;  4F14 A;  1RLQ C;  1YN8 A;  2ZM8 A;  5GMK m;  5I22 A;  1Q7Y U;  4U74 A;  4F7U F;  3CKD A;  3BFM A;  3CME A;  3CMA T;  3KXT A;  2G6F X;  5DY9 A;  1MMA A;  2HZY A;  2JZ2 A;  4HT8 A;  3O1H A;  4JI7 T;  1BI2 A;  1TH7 A;  2P0Q A;  3CEY A;  5LJ3 j;  4CN4 A;  4JJD A;  5IAY A;  2YU1 A;  3ONJ A;  2KVQ G;  4OGC A;  2RJD A;  1YFN A;  3DTO A;  2WU2 A;  2XAS B;  1QQJ A;  2WP9 A;  2XQ6 A;  1WJR A;  4IGU A;  4BDZ A;  3IBP A;  5JRC A;  3RI5 A;  2LSI A;  3MJX A;  4N78 D;  3EFR A;  3M55 A;  3OMC A;  5GAN h;  2YSQ A;  1ZHI A;  2DCF A;  1ZUK A;  5DQV A;  1X2Q A;  4KI0 F;  2HAX A;  4DR5 T;  4IST A;  1OQK A;  3TLV A;  3EUH A;  2HKN A;  5JDF A;  3CC4 T;  2NYS A;  3V8J A;  3FLG A;  1NPR A;  4ILA A;  2WCA A;  1X75 C;  3P8B B;  2OJ2 A;  3FZL B;  5FXW A;  4OFZ A;  1I1J A;  4KGZ B;  3NBX X;  3H3M A;  4A54 A;  3JCM g;  5EK2 A;  3JCM e;  2OAW A;  3SHW A;  2LQW A;  5GAM f;  1OV3 A;  3FBZ A;  1HF8 A;  4BE1 A;  5CFB A;  1VQK T;  4N0A C;  2WMN A;  2RJF A;  3FB2 A;  3G7Z A;  2PG8 A;  4CRI A;  3FJP A;  3N9L A;  4QQD A;  5FU7 B;  3RGL A;  1D1A A;  3VKG A;  1BIB A;  2BTT A;  3QB5 A;  2CHN A;  4E2F B;  3Q1J A;  1SHZ C;  1VUB A;  5AQP B;  1NJI C;  1AZE A;  3CCL A;  1B34 B;  4DV7 T;  5KYU A;  3AE5 A;  3D0T A;  5GAN d;  3C95 A;  2VB6 A;  3P8H A;  4DA4 A;  5J26 A;  3UU4 A;  1HSQ A;  2ACZ A;  5LJ5 j;  4DR7 T;  3HA4 A;  3OB9 A;  2LJ3 A;  3REA B;  3AA7 B;  2H3J A;  3PUG A;  2WBL A;  3RRW A;  4QVZ A;  1JRI A;  1T0H A;  3A8O B;  1N9R A;  2DJQ A;  3P4P A;  4U31 A;  2F2V A;  3JCM Q;  3B57 A;  3AA6 B;  1YI2 T;  1YHQ T;  2LHR A;  3G6E Q;  1K9M U;  1V9D A;  1WX6 A;  3MPU B;  3F2E A;  1VQP T;  1N33 T;  5AQT B;  3DLM A;  4PFZ A;  4QH1 A;  4DUZ T;  5KE2 A;  1AEY A;  1RAF B;  3IQL A;  4JDS A;  1K8A R;  1BYM A;  4UVC B;  1JU5 C;  4M7D F;  2CWO A;  2YOE A;  5HKC A;  5F8P A;  5FKY A;  2E70 A;  2KT8 A;  3RLF F;  2E1H A;  2HEQ A;  1IHW A;  4UVA B;  4A4H A;  2JM9 A;  2EW3 A;  2C5K T;  2UXC T;  3LJC A;  2RI2 A;  2KEA A;  2QDY B;  1WYX A;  4M7D C;  2R5A A;  2J62 A;  3X26 B;  2ZZD A;  2D8J A;  1SUM B;  2DLR A;  4ANJ A;  2DNU A;  4X34 A;  3X24 B;  3GP8 A;  4HKE A;  5ECA A;  4IIO A;  3FXE B;  5LJ3 d;  2XQY A;  3OYE A;  3LK3 B;  2A72 A;  2WU5 A;  3AAA B;  2WDV A;  2V6Y B;  2IPO B;  3RKG A;  4EAH A;  3THK A;  4CN6 A;  4O4I E;  2KIN B;  2XID A;  3C94 A;  3ZN1 B;  4M75 A;  5EG2 A;  2BKO A;  4GK0 E;  2BUD A;  1RUW A;  1TG0 A;  4LDX A;  4YLH A;  1GL5 A;  3JCM h;  4J7F A;  2X35 A;  4YJ3 E;  3WAJ A;  2CT3 A;  2EQI A;  4PNI A;  3V5U A;  4FSX A;  1WJQ A;  1QKW A;  4KRT A;  4HWC A;  1XZY A;  3SEM A;  1M3B A;  2WY2 A;  4BI8 B;  2GNC A;  3PUX F;  2IUB A;  1GBQ A;  1NLP C;  2XU8 A;  3MO8 A;  4JS5 A;  3PV0 F;  4OF1 A;  5I11 A;  4GYS A;  1XNR T;  2HL3 A;  2XD0 A;  1NEK A;  1Q82 U;  4JRK A;  5HEG A;  4C0D C;  2CUB A;  2JM8 A;  1GCQ A;  5HWY A;  2YDS A;  2CCQ A;  4M75 D;  1KD1 R;  3CCS T;  1KHI A;  3EDU A;  1TUG B;  1WYC A;  1E6G A;  3FZM B;  4WNK A;  2MBG A;  2A37 A;  3A8G B;  5IXB A;  1WHK A;  2A28 A;  4FL6 A;  4C5G A;  2ROL A;  3S3O A;  4ME7 A;  4Z8X A;  4IE0 A;  4CXX A;  2J1D G;  2KWH A;  4ZN1 A;  1BR4 A;  1V76 A;  4QQ6 A;  2NW7 A;  1HFA A;  2QGG A;  3JB9 J;  4ZS2 A;  4M75 C;  3VS6 A;  1V1C A;  4DUY T;  4UV8 B;  4P0B A;  3OYH A;  1QVP A;  3PUW F;  2HPL A;  5LJ5 d;  4KHP T;  2XQ3 A;  4A56 A;  4WBN E;  3CD6 T;  4IE5 A;  8ATC B;  2DIQ A;  3UUL A;  3Q5X A;  2L3Q A;  4QX8 B;  2M6I A;  3PDY A;  1HCI A;  1ABQ A;  2BVL A;  4WF2 A;  3VV0 A;  5L47 A;  2E9X B;  3UUX B;  4IDN A;  2E5K A;  2HBP A;  2LQK A;  2QTV A;  2V6Y A;  2W63 A;  3MP6 A;  1VQ8 Q;  2V7I A;  4KUI A;  1OEB A;  4F7U G;  2L9Q A;  2DL4 A;  2XAQ B;  3K3Q C;  3B5M A;  4MLK A;  3CC7 T;  1YJ9 T;  5FRM A;  4LNP A;  4X5T A;  1OU8 A;  5GAN 3;  4O4H E;  4B6X A;  1GCQ C;  1Q86 U;  3QUI A;  3RIU A;  1YJN A;  1KNZ A;  1AT1 B;  3F31 A;  3I9W A;  2LRK A;  4JRI A;  4DR1 T;  1NAF A;  4I4T E;  1VQ6 T;  2W62 A;  2VVN A;  2HQE A;  5GAO m;  3KUF A;  2EKO A;  4UIG A;  3QO3 A;  3JCM V;  1IXD A;  3G4S A;  2RHY A;  4JI4 T;  3UQ4 A;  2ACX A;  2KZ7 B;  2VK9 A;  3SB2 A;  2LM9 A;  1VOM A;  5TAO A;  1NEG A;  3I0O A;  2QRX A;  2ZPH B;  5CK9 A;  1VQL A;  5A0D A;  1LPL A;  5CQX A;  1JJ2 S;  1BR0 A;  3OYM A;  2X3X D;  2ZPF B;  1WHM A;  5GAM g;  2Y6X A;  2KXC A;  3S3N A;  3LWH A;  3FB9 A;  5GAN 5;  4ZZC A;  1M8M A;  2CPT A;  5FXX A;  4J9D A;  3REB B;  3GMI A;  4JJB A;  2GBQ A;  3KFV A;  1YCS B;  4OP0 A;  4U2Z A;  4ASK A;  1PHT A;  4IUT A;  1EZZ B;  4FM4 B;  1UB4 A;  3T8O A;  4C8Q B;  3PT9 A;  1T0J A;  2B86 A;  1PM3 A;  4L0R A;  3SFE A;  3JAD A;  5KCH A;  3GOX A;  2BKN A;  3DLL A;  5LOV E;  4A4F A;  4OHF A;  3M0P A;  4MDW A;  3FIF A;  4GY5 A;  5LXT E;  3VJP A;  2B1E A;  2L3R A;  4HE8 A;  4C0F A;  2E9X A;  1M1G A;  5GAM j;  2PUK B;  2LMJ A;  2B76 A;  2FZG B;  2QQS A;  2XHE B;  5LG3 A;  2PTF A;  1KJW A;  5DLO A;  1PKT A;  2Y8D A;  3AT1 B;  4P0A A;  4Y92 A;  6AT1 B;  4UXN B;  1VQ9 A;  2FO0 A;  1N27 A;  3O4X E;  5HYA A;  3JAF A;  1VQN Q;  2L89 A;  1L0V A;  2N2N A;  3BQI A;  4J6X A;  5GMK i;  1IJ6 A;  3A8Y C;  3CML A;  1A0N B;  3ZMU B;  2C5J A;  1LVF A;  2QA7 A;  3DB3 A;  4QQG A;  3RUX A;  1AOJ A;  2KE9 A;  5FP3 A;  5HCM A;  1WXT A;  2I0N A;  3UUB A;  4M7D G;  4EIK A;  4XBF B;  4O5V A;  5GJW B;  2RQT A;  1Q7Y R;  3OYF A;  4EEB A;  5JDL A;  3L2Q A;  2DTH A;  4J83 A;  4JRP A;  4LML A;  3ZT7 A;  4UR9 A;  3OSV A;  1M5Q 1;  4ADZ A;  3K3O A;  2KMF A;  5IHY A;  3QNU A;  2FL7 A;  1WIE A;  2FPF A;  4M4Z A;  5HEJ A;  3QUJ A;  4QT7 A;  4D8D A;  2CBJ A;  2OA5 A;  3EG9 B;  3GF5 A;  2IIM A;  4M77 D;  1Y01 A;  2EJ9 A;  1YKE B;  2KI7 A;  2RHU A;  3AE1 A;  4AG1 C;  3JAE A;  4C90 A;  3D7S B;  4OML A;  3PUV F;  3CQT A;  3UT5 E;  1QVF P;  5D6X A;  3MCA B;  1KQ1 A;  1M3C A;  2LE8 A;  4C8Q A;  5AQK B;  1WI7 A;  2E5Q A;  3H37 A;  3N5L A;  4M77 C;  1TOV A;  5GAN 2;  3DJB A;  4IT4 A;  4KHZ F;  1PSF A;  1KK7 A;  4UF0 B;  2RHI A;  3VRA A;  2RN8 A;  1N34 T;  4FYV B;  3CCE Q;  2NP9 A;  1VQ4 T;  5H6Q B;  3CPW S;  4IHJ E;  3Q5D A;  3LK4 2;  5GAM h;  1E7P A;  4EZ4 A;  1BIA A;  4X1K E;  3RIR A;  2GCX A;  1BB9 A;  1LVK A;  1CHU A;  1OPL A;  3HR0 A;  2JT4 A;  2BBH A;  3I1A A;  4TN7 B;  4OMN A;  3MP1 A;  3C51 A;  4JV5 T;  3A7M A;  1VQO T;  4AXP A;  4J9E A;  3P8D A;  1UX4 A;  1WLP B;  2ZMA A;  2FJE A;  3VUZ A;  2EYX A;  2K2M A;  2X4X A;  2K5B B;  2P4T A;  3M3Z B;  2LKH A;  2VUB A;  2VKN A;  4XTX A;  4DMV A;  1YJW T;  3KFW X;  2GQV A;  4MZP A;  2X4Y A;  4M75 G;  2CGH A;  3QII A;  3RHW A;  2H8H A;  4R55 A;  1G5V A;  2LT3 A;  4ZZB A;  4PJL A;  2MAM A;  4UC4 A;  5LBQ B;  3J7Y q;  3CQC B;  4TVR A;  4YTL A;  2MOX A;  4HFB A;  3EFS A;  3G6E A;  3CD6 A;  1I94 T;  4KT0 E;  2V7M A;  5AQV B;  4AKI A;  5GJV B;  3CME T;  3E22 E;  2V5C A;  2DKG A;  1KNP A;  3EHR A;  3CX7 B;  5GAM d;  4ILB A;  5F5W A;  3M5A A;  2OTL Q;  2LT4 A;  2VKH A;  2RHZ A;  3JCM b;  2C0I A;  1K8A C;  4TX5 A;  3VS1 A;  1WRD A;  3ZYM A;  3BY7 A;  4N4G A;  1H92 A;  3CXC P;  3RRC A;  2LOP A;  1NYG A;  1K9M R;  4H9P C;  2HD0 A;  1MND A;  3C4S A;  1OED C;  2M51 A;  2DPP B;  4FT4 A;  1Y71 A;  2RMO A;  3EG9 A;  1BCO A;  3CBM A;  3ZBD A;  4KMC A;  2GK9 A;  3LBX B;  5L4E A;  1QCN A;  2DYI A;  1OZ3 A;  2RA2 A;  1ZA1 B;  1IRE B;  4AKG A;  2FEI A;  4LUD A;  3INZ A;  3H0H A;  3JCM f;  2O88 A;  3MEW A;  3AVR A;  3GWH A;  5LGU B;  2HBW A;  2LTO A;  3JAM E;  3GLX A;  3AE4 A;  4LF9 T;  2CXL A;  1JBM A;  4M78 E;  4H9R C;  4A5X A;  2V7K A;  1SPK A;  4FW2 A;  2DEU A;  2NW8 A;  3LFM A;  1HX8 A;  5CB4 E;  2QAS A;  1M1K C;  3KV4 A;  4E7J A;  4ZEY A;  3M0U A;  4AFZ C;  5FWB A;  4C92 E;  1R8I A;  2LHN A;  2HH7 A;  4JI8 T;  3A1P A;  4JI2 T;  3RYC E;  3NPF A;  2MAW A;  2JMA A;  3UFE A;  1ZSZ A;  4NXN T;  2J47 A;  3ZLI A;  1X2K A;  5DAB A;  4NL2 A;  1MV0 B;  2X51 A;  4RTV A;  3C12 A;  4FYW B;  3CCL T;  3ZCJ A;  3EG1 A;  3CBO A;  3NTK A;  3Q2M A;  3CCE T;  1FMV A;  3CPW A;  4PK4 A;  4IUQ A;  3Q5E A;  4NIQ A;  4QKN A;  5FXV A;  4KP3 C;  2LNH B;  2BG9 E;  2DEQ A;  2L5Q A;  1UE9 A;  3SFM A;  5L3B B;  1W2B P;  3HL8 A;  3AE7 A;  2R5M A;  5BR8 T;  4L9I A;  4Z02 A;  2UU9 T;  2JUF A;  1MMN A;  2A3D A;  2XG8 D;  2OAU A;  4QH5 A;  2MPX C;  3OS5 A;  3VYH B;  4M7A F;  3N2O A;  4M7A D;  3AEA A;  5FU6 B;  1VYU A;  1KD1 C;  4QHO A;  1Q82 R;  4JZ4 A;  2RNA A;  2X9Y A;  3RIF A;  2VKD A;  5HCK A;  3L2V A;  2YWW A;  1I0C A;  4M7A C;  1JEG A;  3AB3 B;  3LG7 A;  3UUN A;  1U1T A;  5DM7 R;  4LF8 T;  2HSE B;  2YRV A;  4JLI A;  3LBX A;  1I81 A;  1X9B A;  1ZSZ C;  5L3E B;  2DAQ A;  3EG3 A;  2D5U A;  2BS3 A;  4DV4 T;  3E19 A;  2PNI A;  1LRZ A;  4DOW A;  1WXB A;  1MNE A;  1IBK T;  1G3T A;  5CA1 E;  2JTM A;  3OW2 S;  1HNZ T;  1IGQ A;  4EDU A;  1ZA2 B;  1R8O B;  2D6F A;  3RC3 A;  2JXB A;  1N32 T;  1KC8 U;  1T7S A;  4TV8 E;  2V1R A;  1W0B A;  4TWH A;  1VQ8 A;  2D9D A;  5CR2 A;  2D0T A;  2FJD A;  3J7A F;  1MIW A;  5CO7 A;  1K0S A;  4AKR B;  1AD5 A;  2BE7 D;  1MGQ A;  1HJD A;  5LHI B;  1XNI A;  4IUP A;  2LX7 A;  3AAE B;  1MUZ A;  1UGP B;  2EYZ A;  4B3M T;  3AEB A;  5JDH A;  3I9Y A;  2XPK A;  1AHJ B;  1VA7 A;  1VRB A;  3QXE B;  2IML A;  3NTH A;  5C3J A;  1ZUY A;  1N8R U;  5AQN B;  5AQJ B;  2P0K A;  2YRC A;  5I2M A;  2GFA A;  1NWM X;  2CA5 A;  2XSB A;  2XSA A;  2K48 A;  2YKS A;  3AEE A;  2A9U A;  4M77 G;  1ZX6 A;  4BE2 A;  4KUL A;  2ZPI B;  1M30 A;  2XQ8 A;  4L59 A;  2KQW A;  2COW A;  2OTJ T;  2QI2 A;  1TSF A;  2PFV A;  5D6W A;  5D7U A;  1EZ3 A;  1WQW A;  3RIA A;  5IHN A;  3PUZ F;  2EPD A;  3MXZ A;  3RKX A;  4FU6 A;  1UHF A;  1E7O A;  4ORZ A;  2YUN A;  5EK4 A;  3RYF E;  5LNK A;  5LCY A;  2PUO B;  1VIE A;  5IWA T;  4CXY A;  4Z8A A;  4AG2 C;  2LSK A;  2XZE A;  2XQ5 A;  2LNV A;  3HRS A;  1B07 A;  2HL5 C;  2P9B A;  5FY7 A;  3LX7 A;  2QG9 B;  1IJ5 A;  3WAK A;  4OX9 T;  2F5K A;  2DBM A;  4JUV A;  4EMK B;  2DVJ A;  4DOV A;  3SWN A;  1NEN A;  5KX5 E;  2DIG A;  4HN9 A;  4DBR A;  3J81 E;  3Q9D A;  2Q9Q D;  4O2B E;  2FZC B;  3PIO A;  2W66 A;  3IHR A;  1ZOY A;  1NZ9 A;  5J3B A;  2JVV A;  3H41 A;  3QG1 A;  2FPD A;  2FJB A;  2VAS A;  4OGE A;  2LQN A;  5FY1 A;  4PLI A;  1ABO A;  4Q25 A;  1VQM Q;  4MML A;  2Q9Q C;  2UXN B;  2CM0 A;  1PWT A;  5AQF B;  4PJO F;  4BUG A;  4PJO D;  1O75 A;  1OWA A;  3BQK A;  2PBI A;  1VQN A;  2KSR A;  2XY8 B;  4JS4 A;  5LMN T;  2KGT A;  5LJM A;  2XJ7 A;  1M4Z A;  5AQS B;  4RMO A;  5AQH B;  3ZT6 A;  1KFY A;  4JJN K;  4A4G A;  1T72 A;  3OW2 A;  1X6B A;  5LP6 E;  3M0R A;  5GMK e;  4PJN A;  4HCK A;  4PJO C;  1PC0 A;  5IT9 E;  1YJN T;  1R0B G;  1M2O A;  2CXD A;  3FDR A;  3R6N A;  1FMW A;  2WZI A;  1DU2 A;  3ZC1 A;  3CBP A;  2X4J A;  2K2V A;  4C8Q E;  1M90 U;  1Q7Y C;  3JCM c;  1ZP0 A;  4DV5 T;  5HXE A;  3EHQ A;  4HCC A;  2JMK A;  3G4S T;  2EHO B;  2CH4 A;  2LRL A;  2CRE A;  3SWN C;  2DET A;  1H7C A;  3N9N A;  1X6G A;  2ZM2 A;  3E1S A;  1VQL T;  2EKH A;  2JQK A;  2CZ7 B;  1XDO A;  2K6D A;  2F2X A;  2GTJ A;  2CP2 A;  3VS3 A;  2NUZ A;  2LT1 A;  4MZT A;  2QQ9 A;  5ABF B;  2KRN A;  2QEX Q;  4LFB T;  3M4G A;  2FRY A;  4ZGD B;  3KDS E;  1Y0M A;  2CKK A;  4LN2 A;  2DO3 A;  1KQS S;  5CKB A;  3P4W A;  1SEM A;  2XDD A;  4YHH T;  3HRT A;  3HFN A;  2WQY A;  4AQF A;  1D0Y A;  4X62 T;  5LBM A;  1UHC A;  1WXU A;  3OS0 A;  3OPC A;  4B3R T;  4EMK A;  3CCE A;  4GOU A;  2GQI A;  2O4X B;  3OS1 A;  4LD9 K;  3VS4 A;  2K3Y A;  4M78 B;  4HFI A;  1X69 A;  5GON E;  2AZV A;  3RF1 A;  1K4U S;  4ZOL E;  2HMA A;  2L8K A;  2X68 A;  5HEH A;  2ZPB B;  3IF8 B;  3LLR A;  1MIV A;  2K4Y A;  4C92 B;  1PD1 A;  5HCJ A;  2NUT B;  4JI6 T;  3KVB A;  3KBT A;  2DTO A;  2XIC A;  4KGV B;  4JI5 T;  5KYW B;  4CC2 A;  4G2A A;  4IUR A;  3O9X A;  3QKJ A;  1OX9 A;  2HQH A;  5LG4 A;  3JB9 I;  1VQ9 T;  5J2T E;  1Z9Q A;  2VXF A;  2WZH A;  2IC6 A;  4FYY B;  1YIT Q;  4M7A G;  3OYY A;  3OYZ A;  2W4X A;  4HEA A;  4COF A;  1OI1 A;  3PJA A;  4DID B;  3M0Q A;  2VGM A;  5CKH A;  1WDX A;  4NUU A;  2BKP A;  5FNV E;  2E3H A;  1VQ7 Q;  5FXZ A;  1PG5 B;  1D1C A;  3E2U A;  5CCA A;  1FJG T;  2AXD S;  2BG9 B;  1J5W A;  3PTA A;  2BIV A;  2LJ1 A;  3N5B B;  4PK5 A;  2E5L T;  2A36 A;  2OTL A;  4AMC A;  2FJA A;  2J6F A;  2EHO A;  1Q81 U;  3AHU A;  1YIJ Q;  3H0I A;  4I43 B;  2WSC E;  2PVD B;  4CI2 B;  2DYB A;  1K9M C;  3RMQ A;  3UPU A;  4A97 A;  4ZXL A;  2AT1 B;  4O2A E;  4VUB A;  5GMK h;  3VRY A;  3HL6 A;  3HP9 A;  3QJY A;  4HWF A;  5ABF A;  4DR2 T;  4IDQ A;  3ZEH A;  5AQM B;  4JI0 T;  2JW4 A;  3H0F A;  2MMP A;  3BW1 A;  4EIW A;  5JQG E;  3C50 A;  3HKB E;  3CPF A;  5A0G A;  3T1H T;  1B34 A;  3H6Z A;  4DBF A;  3L2R A;  2K5I A;  1MIY A;  2O4X A;  3PVL A;  4M78 A;  1I6Z A;  2V8J A;  3QOF A;  4KH0 B;  4IIM A;  1JB0 E;  5CKE A;  1QVG S;  2K3X A;  5FYM A;  2ZGW A;  2DM1 A;  2CSI A;  3RBB B;  4BY6 B;  3VR8 A;  3V8K A;  4CI1 B;  3UU3 A;  3ZL7 C;  4AKL A;  2XAF B;  1ZUU A;  2F2W A;  4C0Z A;  2DK3 A;  4C92 A;  2DX1 A;  3P4R A;  2AK5 A;  2HSP A;  5KYX B;  2OTJ A;  3NVO A;  4HFV A;  2NUT A;  4NL3 A;  1KQS A;  2MK5 A;  4J9B A;  2JN0 A;  1MMG A;  1VCT A;  2NTX A;  2M02 A;  4J8O A;  3UDC A;  5KYW A;  2EJG A;  4O4J E;  3PIP A;  1YP5 A;  2J06 A;  2XHC A;  4JI1 T;  4M75 F;  2CP5 A;  1FIO A;  3FRN A;  1YW0 A;  2OV9 A;  2LP5 A;  2WSE E;  4FW1 A;  2LX9 A;  1GFC A;  4U7I A;  5FU7 C;  4E7Z A;  4E6R A;  2H7O A;  1SRL A;  1CKA A;  4M78 D;  2M16 A;  5J2U E;  5GMK l;  2BG9 A;  3JCM d;  5IXF A;  1KF6 A;  2Z6E A;  4N4I A;  2RF0 A;  3GBQ A;  2XK0 A;  2IVW A;  4CC4 B;  3SS1 A;  3G6E T;  2K3B A;  5FVK A;  4WZX A;  4H9Q C;  1WHL A;  4IUU A;  1Q82 C;  1NYF A;  3AE8 A;  4AT1 B;  2WDQ A;  5HXC A;  4RG2 A;  3ZMZ B;  1UTI A;  4NS5 A;  5D6Y A;  1N5Z A;  4HVU A;  1GBR A;  2JTF A;  2IG0 A;  2QA4 Q;  1X27 A;  4EMH A;  1IAP A;  3L2Z A;  1X79 A;  4I0U A;  2DMO A;  2XKO C;  4YSY A;  2LQ8 A;  2Y4X A;  3E0Z A;  4Z89 A;  1TTH B;  4RKU E;  3ZJ1 A;  4HFD A;  2VQF T;  4PJO G;  4B9X A;  2DNX A;  3UWN A;  3RH3 A;  3ZT5 A;  2EVR A;  1BI1 A;  1FWZ A;  4DBQ A;  4F6R C;  3OTO T;  2KXD A;  3GA8 A;  4H9O C;  3VKI A;  5GAO q;  3ZN0 B;  2IHR 1;  1K73 R;  4TWF A;  2K57 A;  1KNR A;  4K11 A;  2NWB A;  1YNZ A;  2KRO A;  3A8L B;  1KC8 R;  3A5X A;  4HVW A;  5KYX A;  3CK6 A;  1N9S A;  3ZFJ A;  4DEX A;  4YXD A;  1ACM B;  2EWN A;  3SD4 A;  3WVE B;  5AQU B;  1GFD A;  1PKS A;  3X28 B;  2RQR A;  4GKK T;  4QVD A;  1YWO A;  4IL9 A;  1QWF A;  5JDM A;  3RYI E;  5AFU L;  3GN5 B;  4TUY E;  2LC4 A;  2LOS A;  1OYX A;  2KYM A;  1Q86 C;  1QVG A;  2MOZ A;  1KG1 A;  3RKO A;  1WZO A;  3L2W A;  1LCK A;  3I56 Q;  3CCR Q;  2KT1 A;  4XZC A;  2PU9 B;  2DXB A;  1XJW B;  4DO0 A;  3TSZ A;  1N8R R;  3LK2 B;  3JB9 H;  2ED1 A;  2Z0W A;  4F7U E;  1BK2 A;  3CQX C;  1XQH A;  3H8Z A;  2HQX A;  1GCP A;  3RIU C;  2RHX A;  1I4K 1;  4E7K A;  2EQU A;  1D1B A;  2V7L A;  2K24 A;  2PJQ A;  5C6S A;  4KUM B;  1MV3 A;  2PVG B;  4LFC T;  3UU5 A;  3RC8 A;  2ATC B;  2D0N A;  2YEV C;  2CS7 A;  2LRQ A;  3NZQ A;  2K9A A;  2I59 A;  2WWV A;  1KIK A;  2EAY A;  3H3A A;  4DV1 T;  4KUD K;  3JCF A;  1HS7 A;  2AHJ B;  4C5E A;  2RO0 A;  2V26 A;  1BI0 A;  2CUD A;  3RKW A;  4LF5 T;  1ZV4 X;  4DV2 T;  2RP4 A;  3EAM A;  4JPB W;  1PCX A;  1S72 Q;  2DZC A;  1FEW A;  1RAB B;  2VXE A;  3CQG B;  3O1I A;  3E9F A;  4E7S A;  5J39 A;  1WR6 A;  2YT6 A;  3OYA A;  1T98 A;  1IGU A;  4LF6 T;  2WDR A;  5FL0 A;  4HWI B;  3TEE A;  1N6A A;  3UFG A;  1UG1 A;  4C91 A;  2DXU A;  3JRZ A;  3KBG A;  4HFC A;  1RL2 A;  3OBY A;  2LJL A;  2CEA A;  4HGA A;  4PJM A;  3FZH B;  2XTL A;  4U7Y A;  1VQ8 T;  2E64 A;  2JOY A;  2FPE A;  3URG A;  4DND A;  4HCZ A;  2E9X D;  3ZYK A;  5HXS A;  1WQ7 A;  2EYW A;  4WYV A;  2WWU A;  3HI2 A;  4PFP A;  5HXR A;  5AQQ B;  2E8I A;  3GN5 A;  2XM1 A;  3P8C D;  1B7T A;  3ESL A;  4PAG A;  1G83 A;  3NHN A;  4M77 F;  3CCV Q;  2E9X C;  1Y64 B;  1F1B B;  3M53 A;  2DLP A;  2DXC A;  3OYK A;  4LMJ A;  4OK0 A;  3J80 E;  2MI6 A;  2DL7 A;  1I5O B;  4J9H A;  2L3S A;  4XTZ A;  3EH2 A;  4XU1 A;  3C4Z A;  2MF2 A;  3M59 A;  5KDM C;  2DL1 A;  1M90 R;  5IH2 A;  3EG2 A;  1QSD A;  1KHC A;  1GRI A;  2FBW A;  2UUB T;  3LDQ B;  3ZJ2 A;  1R0C B;  2W0Z A; 
#chains in the Genus database with same CATH homology
 2DF6 A;  3AAI A;  1UCU A;  2DWK A;  1PRL C;  4RTX A;  1D0X A;  4WBO A;  2H7V C;  1KSW A;  1U06 A;  3UUM A;  4JEH B;  2DL5 A;  3M65 A;  2MTQ A;  2KLQ A;  3CX6 B;  3C98 B;  2ES0 A;  2X9W A;  2BZX A;  4DVD A;  2KBT A;  5E0O A;  4H9S E;  5L3D B;  4GIW A;  4G63 A;  4OMM A;  3OKQ A;  2FG0 A;  2YUO A;  4OMP A;  4GLM A;  3ZMV B;  2QGS A;  3UA6 A;  5BMV E;  4RTU A;  3PVQ A;  2DBK A;  5ADX L;  5HWX A;  1XOV A;  3EGU A;  2K9G A;  3C4X A;  3VS0 A;  5IYZ E;  3PU8 A;  2L0A A;  3EG0 A;  2DA9 A;  2KYB A;  2BZB A;  2N1G A;  2ZM0 A;  1KFZ A;  3PU3 A;  2VVK A;  5L23 A;  4IE4 A;  4UV9 B;  4X1I E;  2ROT A;  4UF0 A;  2XMF A;  4H63 H;  2AKL A;  1QWE A;  1WA7 A;  3PUA A;  4JLE A;  2EGC A;  3CVR A;  1U4Q A;  2AZS A;  3I0Q A;  1AWX A;  4M1P A;  4MFR A;  3PUS A;  4X20 E;  4PFO A;  4EYU A;  2CSQ A;  5JR9 B;  2SPC A;  4PW8 A;  3CPZ A;  2KWI B;  4BJN A;  3RNJ A;  2V7J A;  4H9N C;  1AWO A;  1SSH A;  2J7I A;  1WLX A;  5JDG A;  3I5R A;  1S94 A;  2DE0 X;  5EC7 A;  3R84 B;  1UJ0 A;  4F16 A;  4FI5 A;  1TUC A;  1Z0P A;  2LEH A;  2KR3 A;  1VYV A;  1D0Z A;  3QC9 A;  3P7I A;  1K76 A;  3VS5 A;  5LHH B;  5J1G A;  3NRX A;  5L3C B;  3MA9 A;  1T3L A;  4IIJ E;  5IHI A;  1US7 B;  3VHL A;  3L09 A;  2X66 A;  2N9D A;  1UDL A;  4YJ2 E;  1U5S A;  2RA1 A;  1CUN A;  4HKA A;  3CX8 B;  1SA0 E;  1H8K A;  4J2C A;  3N2G E;  1O3X A;  1S1N A;  1HG5 A;  2JQQ A;  4QXB B;  2OI3 A;  5JR9 A;  5FMN A;  1TUD A;  1NM7 A;  2V1D B;  2O9V A;  3OBV E;  3U23 A;  4RTZ A;  2MCN A;  2W61 A;  5EZY E;  5JRC B;  5LHG B;  2DWG A;  3AA0 B;  1QCF A;  4XAX B;  2PTK A;  3FJ5 A;  1UJY A;  3K3N A;  4AKH A;  3ZMT B;  4MBQ A;  4AFS C;  2VKO A;  1K9A A;  1AZG B;  3AVS A;  2O9S A;  3E08 A;  1RI9 A;  3B13 A;  2X9H A;  2D1X A;  3QWY A;  5JDQ A;  2D2S A;  4ZI3 D;  1NLO C;  2EGE A;  1HD3 A;  5JVD E;  4BJM A;  3ZCI A;  5FWC A;  3V5S A;  2GTO A;  3NMZ C;  4ZI3 C;  3N9O A;  4OMQ A;  5HAX A;  4I50 E;  3I9Q A;  2CLY B;  2XAH B;  2BVM A;  1MMD A;  1PRM C;  4R0K A;  4EZH A;  5A1L A;  5M4Y A;  3A98 A;  3VS2 A;  2XAG B;  2KT9 A;  3ONX A;  2CDT A;  2LZ6 B;  3PTR B;  4AQG A;  1SHG A;  5C8Y E;  2EBP A;  2CXF A;  5L3G B;  2A08 A;  1H3H A;  5LGN B;  4BA9 A;  4MHC A;  4EYY R;  2DL3 A;  4DMW A;  2XUE A;  3TSW A;  4JUY A;  1QUU A;  2WAU A;  4H63 V;  4HVV A;  3HKC E;  1CKB A;  2P4R A;  1OXZ A;  2KRM A;  4RTY A;  4CI3 B;  1JXO A;  4QWN B;  4EOZ B;  2EGA A;  4WW0 A;  1JO8 A;  2DHR A;  2JMH A;  2W10 A;  4O8S A;  1PNJ A;  4CC3 A;  1U3O A;  1UFF A;  3KVA A;  5CA0 E;  1YKH B;  4AQF C;  3VS7 A;  3KV5 A;  2NTY A;  2EYY A;  3UAT A;  1UUE A;  1ARK A;  5IHK A;  3N9P A;  2CMR A;  4X1Y E;  4AFU C;  2JRK A;  2CH4 W;  3ULR B;  3SOL A;  3NGP A;  4AFQ C;  3MKD A;  2H3R A;  2DL8 A;  1BR1 A;  2QDL A;  1W70 A;  2A2F X;  2SEM A;  2HDA A;  4UEL A;  3U3I A;  1NEB A;  3MZK B;  3ANW B;  2L2P A;  2EHO D;  2C0S A;  5DJQ C;  2CLY C;  3ETU A;  4L5G A;  2W0G A;  2L3L A;  4HTE A;  2EHO C;  2IAK A;  1M27 C;  3C0C A;  2KNB B;  5LYJ E;  3SRZ A;  3C64 A;  3ZPO A;  1OPK A;  2RQV A;  2JMC A;  1UX5 A;  5KMG P;  2J6O A;  4ZS3 A;  4ERR A;  5FY0 A;  3M0S A;  2BZ8 A;  3N2K E;  4ESR A;  1Z9Z A;  4JZ3 A;  4QXC B;  2IC9 A;  2YU2 A;  1IO6 A;  4JEU B;  3UA7 A;  5F3J A;  3VU7 H;  1G73 A;  2JS2 A;  3N9M A;  2YUQ A;  4AI6 A;  5L3F B;  4EB6 E;  3EVY A;  4U72 A;  1AWW A;  2AKK A;  1ZSG A;  1AWJ A;  4P09 A;  3ANW A;  1BBZ A;  2ECZ A;  4K0U A;  2LJ0 A;  3NZP A;  4CZZ B;  3O5Z A;  3ZC0 A;  2WMO A;  2VWF A;  2RPN A;  1HG2 A;  3PE0 A;  1YWP A;  4OMO A;  1YD8 G;  2CWY A;  1B3Q A;  4FSS A;  1UGV A;  2VL8 A;  1FYN A;  4J9F A;  4V1A v;  1VYT A;  4HXJ A;  3C4W A;  2KRS A;  4ISS A;  1SHF A;  2W00 A;  3SWH A;  2CT4 A;  4JJC A;  1JQQ A;  2SRC A;  3DP7 A;  1U5P A;  5JRE A;  5LA6 E;  4QXH B;  4WCI A;  4EXT A;  1I07 A;  4GBQ A;  2NW9 A;  4TZ4 C;  1FMK A;  3KV6 A;  4PJJ A;  3NRY A;  1ZEE A;  1K0X A;  3O1J A;  4YFS A;  4J9C A;  4MAL A;  1M3A A;  4CC7 A;  4CXW A;  2ODV A;  2ESW A;  4J9G A;  1W6X A;  1IZN B;  2YIN A;  2NWM A;  4DEY A;  3JV3 A;  3PUR A;  2X3W D;  4KBM B;  4TV9 E;  4J9I A;  1EFN A;  2HCK A;  3OJA A;  2J05 A;  3N9Q A;  2HPJ A;  4Z88 A;  4BAY B;  2DI4 A;  5HXH A;  4RUG A;  2ABL A;  2JJ9 A;  1WFW A;  4I55 E;  3I35 A;  3MK7 C;  4QX7 B;  3W15 B;  2VKJ A;  1NG2 A;  3BQL A;  1BU1 A;  2DRM A;  3AA1 B;  3QK6 A;  2C0O A;  4ILU A;  2BZY A;  1SRM A;  3TVT A;  1J3T A;  4CQI A;  2X67 A;  2K7A A;  1LKX A;  1AVZ C;  1E6H A;  1HTJ F;  4ZHQ E;  3CWZ B;  2K79 A;  2YK0 A;  2O31 A;  2O2O A;  3U78 A;  2JTE A;  3K8P C;  3FXD B;  3FHN A;  3OYX A;  2RQW A;  3ZEF B;  2D8H A;  4PK6 A;  2CE7 A;  2WM9 A;  1G2B A;  2ENM A;  1X43 A;  2NOX A;  2J6K A;  1K1Z A;  1BR2 A;  4D8K A;  4IE7 A;  2V1Q A;  1ZKE A;  3ETV A;  1UEC A;  4FJO A;  3S4U A;  3MAC A;  2LSG A;  3F57 A;  5LGT B;  2C5I T;  2KND A;  3IEE A;  4LUE A;  2JPF A;  1QLY A;  2WSS V;  2YDL A;  2D0U A;  1OOT A;  4O4L E;  4A63 B;  4GK5 E;  3TKL B;  1E1H B;  3J9X 1;  3JC6 D;  3ZYL A;  4RTT A;  4UEM A;  3KV9 A;  3VRZ A;  2Q9Q B;  2ZLY A;  3JC6 C;  3RPU A;  1ZLM A;  3PUQ A;  2IW5 B;  1ZHC A;  1ZBJ A;  5LJN A;  2KXP B;  1RLP C;  3KBU A;  2YUP A;  3KIN B;  2X9X A;  2LCS A;  3EDV A;  2VWA A;  1CSK A;  1QKX A;  2GGR A;  3WI3 A;  4IE6 A;  4IDZ A;  1Y57 A;  2M0Y A;  2LSY A;  2LSJ A;  4UVB B;  4LE9 A;  3RX6 A;  3UF4 A;  1T3S A;  4NUV A;  4YHJ A;  1AJ3 A;  4ZI7 E;  4OYK A;  5ETW A;  2XAJ B;  2RQU A;  5JH7 E;  3L3P A;  5EK3 A;  4ZNX A;  3LH5 A;  2JS0 A;  1S35 A;  3ZMS B;  2L3P A;  2Q9Q A;  5DQW A;  4RTW A;  4F17 A;  2UXX B;  3UTK A;  1W1F A;  2DIL A;  2X0L B;  3VKH A;  2MYS A;  4X1V A;  3I5S A;  2C0T A;  3M0T A;  5L2L A;  4ZI2 D;  4OYJ A;  4GYR A;  2MIO A;  3FBL A;  2Y48 B;  2FRW A;  3Q5W A;  2ED0 A;  3RYH E;  5H6R B;  3QWX X;  2DRK A;  5JR9 C;  4ZI2 C;  2G0U A;  2PZ1 A;  3HKD E;  1G8X A;  3BK9 A;  3HKE E;  5FW9 A;  2ODU A;  1WYB A;  5JDN A;  2BDE A;  2M67 A;  1JXM A;  4F14 A;  1RLQ C;  1YN8 A;  2ZM8 A;  5I22 A;  4U74 A;  3CKD A;  2G6F X;  1MMA A;  3O1H A;  4JJD A;  2YU1 A;  3DTO A;  2XAS B;  4IGU A;  3IBP A;  5JRC A;  2LSI A;  3MJX A;  4N78 D;  2YSQ A;  2DCF A;  1ZUK A;  5DQV A;  1X2Q A;  4IST A;  3EUH A;  5JDF A;  2OJ2 A;  5FXW A;  1I1J A;  4OFZ A;  3NBX X;  5EK2 A;  2OAW A;  3SHW A;  2LQW A;  1OV3 A;  3FBZ A;  1HF8 A;  2WMN A;  3FB2 A;  2PG8 A;  3N9L A;  1D1A A;  3VKG A;  2BTT A;  1SHZ C;  1AZE A;  3D0T A;  2VB6 A;  1HSQ A;  3HA4 A;  2LJ3 A;  3REA B;  3AA7 B;  3PUG A;  2WBL A;  3RRW A;  1T0H A;  2DJQ A;  2F2V A;  3B57 A;  3AA6 B;  2LHR A;  1V9D A;  1WX6 A;  3F2E A;  1AEY A;  3IQL A;  4UVC B;  1JU5 C;  2CWO A;  5F8P A;  2KT8 A;  2HEQ A;  4UVA B;  2JM9 A;  2EW3 A;  2C5K T;  3LJC A;  2KEA A;  1WYX A;  2D8J A;  2DLR A;  4ANJ A;  2DNU A;  5ECA A;  4IIO A;  3FXE B;  2XQY A;  3LK3 B;  2A72 A;  3AAA B;  4EAH A;  3THK A;  4O4I E;  2KIN B;  3ZN1 B;  4GK0 E;  1RUW A;  1TG0 A;  4YLH A;  1GL5 A;  4YJ3 E;  3WAJ A;  2CT3 A;  2EQI A;  4PNI A;  3V5U A;  1QKW A;  4KRT A;  3SEM A;  1M3B A;  2GNC A;  1NLP C;  1GBQ A;  5I11 A;  4GYS A;  2CUB A;  2JM8 A;  1GCQ A;  5HWY A;  2CCQ A;  3EDU A;  1WYC A;  1E6G A;  4WNK A;  2MBG A;  2A37 A;  5IXB A;  2A28 A;  2ROL A;  4Z8X A;  4IE0 A;  4CXX A;  2J1D G;  2KWH A;  1BR4 A;  2NW7 A;  1HFA A;  4ZS2 A;  3VS6 A;  1V1C A;  4UV8 B;  4P0B A;  2HPL A;  4A56 A;  4WBN E;  4IE5 A;  3UUL A;  3Q5X A;  2L3Q A;  4QX8 B;  3PDY A;  1HCI A;  1ABQ A;  2BVL A;  2E9X B;  3UUX B;  2E5K A;  2W63 A;  2V7I A;  1OEB A;  2L9Q A;  2DL4 A;  2XAQ B;  3K3Q C;  4MLK A;  4LNP A;  4O4H E;  4B6X A;  1GCQ C;  1KNZ A;  3F31 A;  3I9W A;  1NAF A;  4I4T E;  2W62 A;  4UIG A;  2ACX A;  2KZ7 B;  2VK9 A;  2LM9 A;  1VOM A;  5TAO A;  1NEG A;  3I0O A;  1BR0 A;  2X3X D;  2Y6X A;  2KXC A;  1M8M A;  5FXX A;  4J9D A;  3REB B;  3GMI A;  4JJB A;  2GBQ A;  3KFV A;  1YCS B;  4ASK A;  1PHT A;  3T8O A;  1T0J A;  2B86 A;  4L0R A;  5LOV E;  4OHF A;  3M0P A;  5LXT E;  2B1E A;  4HE8 A;  2E9X A;  2LMJ A;  2XHE B;  1KJW A;  1PKT A;  2Y8D A;  4P0A A;  4Y92 A;  4UXN B;  2FO0 A;  3O4X E;  5HYA A;  2N2N A;  3BQI A;  1IJ6 A;  3CML A;  1A0N B;  3ZMU B;  2C5J A;  1LVF A;  2QA7 A;  1AOJ A;  2KE9 A;  5FP3 A;  1WXT A;  2I0N A;  4EIK A;  4XBF B;  5GJW B;  2RQT A;  5JDL A;  4ADZ A;  3K3O A;  2KMF A;  5IHY A;  2FPF A;  1WIE A;  4M4Z A;  3QUJ A;  4QT7 A;  4D8D A;  2OA5 A;  2IIM A;  1YKE B;  4AG1 C;  4OML A;  4C90 A;  3CQT A;  3UT5 E;  1M3C A;  2LE8 A;  1WI7 A;  3H37 A;  3N5L A;  3DJB A;  1KK7 A;  4UF0 B;  2RN8 A;  2NP9 A;  5H6Q B;  4IHJ E;  3LK4 2;  4EZ4 A;  4X1K E;  1BB9 A;  1LVK A;  1OPL A;  3HR0 A;  2JT4 A;  3I1A A;  4TN7 B;  4OMN A;  3C51 A;  4AXP A;  4J9E A;  1UX4 A;  1WLP B;  2ZMA A;  2EYX A;  2K2M A;  2K5B B;  2VKN A;  4DMV A;  3KFW X;  2H8H A;  2LT3 A;  4PJL A;  5LBQ B;  3J7Y q;  3CQC B;  2MOX A;  2V7M A;  4AKI A;  5GJV B;  3E22 E;  3EHR A;  3CX7 B;  2VKH A;  2C0I A;  4TX5 A;  3VS1 A;  1WRD A;  3ZYM A;  1H92 A;  3RRC A;  2LOP A;  1NYG A;  4H9P C;  1MND A;  2M51 A;  2RMO A;  4KMC A;  2GK9 A;  3LBX B;  4AKG A;  2FEI A;  4LUD A;  3H0H A;  2O88 A;  3AVR A;  3GWH A;  5LGU B;  2HBW A;  2CXL A;  4H9R C;  2V7K A;  1SPK A;  2NW8 A;  3LFM A;  1HX8 A;  5CB4 E;  3KV4 A;  3M0U A;  4AFZ C;  5FWB A;  2LHN A;  2HH7 A;  3RYC E;  3NPF A;  2JMA A;  3UFE A;  3ZLI A;  1X2K A;  5DAB A;  1MV0 B;  2X51 A;  4RTV A;  3ZCJ A;  3EG1 A;  3Q2M A;  1FMV A;  4PK4 A;  4QKN A;  5FXV A;  4KP3 C;  2LNH B;  1UE9 A;  5L3B B;  4L9I A;  1MMN A;  2A3D A;  3N2O A;  1VYU A;  4QHO A;  4JZ4 A;  2RNA A;  2X9Y A;  2VKD A;  5HCK A;  1I0C A;  1JEG A;  3AB3 B;  3LG7 A;  3UUN A;  3LBX A;  5L3E B;  3EG3 A;  2D5U A;  2PNI A;  1LRZ A;  1WXB A;  1MNE A;  5CA1 E;  3RC3 A;  2JXB A;  4TV8 E;  2V1R A;  2D0T A;  1MIW A;  1K0S A;  4AKR B;  1AD5 A;  1HJD A;  5LHI B;  2LX7 A;  3AAE B;  1MUZ A;  2EYZ A;  5JDH A;  3I9Y A;  1VA7 A;  1VRB A;  1ZUY A;  1NWM X;  2CA5 A;  2K48 A;  1ZX6 A;  1M30 A;  2PFV A;  1EZ3 A;  5IHN A;  2EPD A;  3MXZ A;  1UHF A;  1E7O A;  4ORZ A;  2YUN A;  5EK4 A;  3RYF E;  5LNK A;  5LCY A;  4CXY A;  4Z8A A;  4AG2 C;  2LSK A;  1B07 A;  2P9B A;  5FY7 A;  1IJ5 A;  3WAK A;  2DBM A;  2DVJ A;  5KX5 E;  4HN9 A;  4DBR A;  3Q9D A;  2Q9Q D;  4O2B E;  3IHR A;  3H41 A;  2FPD A;  2VAS A;  2LQN A;  5FY1 A;  1ABO A;  2Q9Q C;  2UXN B;  2CM0 A;  1PWT A;  1OWA A;  3BQK A;  2PBI A;  2KGT A;  5LJM A;  1X6B A;  5LP6 E;  3M0R A;  4PJN A;  4HCK A;  2CXD A;  3R6N A;  1FMW A;  3ZC1 A;  5HXE A;  3EHQ A;  2JMK A;  2EHO B;  2CH4 A;  2CRE A;  1H7C A;  3N9N A;  1X6G A;  2ZM2 A;  2EKH A;  2K6D A;  2F2X A;  2GTJ A;  3VS3 A;  2NUZ A;  2KRN A;  2FRY A;  3KDS E;  1Y0M A;  4LN2 A;  1SEM A;  4AQF A;  1D0Y A;  1UHC A;  5LBM A;  1WXU A;  4GOU A;  2GQI A;  3VS4 A;  1X69 A;  5GON E;  2AZV A;  1K4U S;  4ZOL E;  2L8K A;  2X68 A;  3IF8 B;  1MIV A;  3KVB A;  3KBT A;  4CC2 A;  4G2A A;  3O9X A;  5LG4 A;  5J2T E;  1Z9Q A;  2IC6 A;  3OYZ A;  4HEA A;  3M0Q A;  1WDX A;  4NUU A;  5FNV E;  5FXZ A;  1D1C A;  2LJ1 A;  4PK5 A;  2A36 A;  2J6F A;  2EHO A;  3H0I A;  4I43 B;  4CI2 B;  2DYB A;  4O2A E;  3VRY A;  3HL6 A;  2JW4 A;  3H0F A;  4EIW A;  5JQG E;  3C50 A;  3HKB E;  1MIY A;  3PVL A;  4IIM A;  5FYM A;  2DM1 A;  2CSI A;  3RBB B;  4CI1 B;  3ZL7 C;  4AKL A;  2XAF B;  1ZUU A;  2F2W A;  2DX1 A;  2HSP A;  2AK5 A;  4HFV A;  4J9B A;  1MMG A;  2NTX A;  4O4J E;  1YP5 A;  2J06 A;  1FIO A;  1YW0 A;  2LP5 A;  1GFC A;  4E7Z A;  4E6R A;  2H7O A;  1SRL A;  1CKA A;  5J2U E;  5IXF A;  2Z6E A;  2RF0 A;  3GBQ A;  4CC4 B;  3SS1 A;  2K3B A;  4H9Q C;  1NYF A;  5HXC A;  3ZMZ B;  1UTI A;  1N5Z A;  4HVU A;  1GBR A;  1X27 A;  1IAP A;  1X79 A;  2DMO A;  3E0Z A;  4Z89 A;  3ZJ1 A;  2DNX A;  3RH3 A;  2EVR A;  4DBQ A;  4F6R C;  2KXD A;  3GA8 A;  4H9O C;  3ZN0 B;  4K11 A;  2NWB A;  1YNZ A;  2KRO A;  3A5X A;  4HVW A;  4DEX A;  1GFD A;  1PKS A;  2RQR A;  1YWO A;  1QWF A;  5JDM A;  3RYI E;  5AFU L;  3GN5 B;  4TUY E;  2LOS A;  2KYM A;  2MOZ A;  3RKO A;  1LCK A;  2KT1 A;  4XZC A;  4DO0 A;  3TSZ A;  3LK2 B;  2ED1 A;  1BK2 A;  3CQX C;  1GCP A;  1D1B A;  2V7L A;  2K24 A;  2PJQ A;  4KUM B;  1MV3 A;  3RC8 A;  2D0N A;  2YEV C;  3NZQ A;  2K9A A;  2I59 A;  1KIK A;  3H3A A;  1HS7 A;  2V26 A;  2CUD A;  1ZV4 X;  2RP4 A;  4JPB W;  1FEW A;  3CQG B;  3O1I A;  4E7S A;  1WR6 A;  2YT6 A;  1T98 A;  1UG1 A;  4C91 A;  2LJL A;  2CEA A;  4HGA A;  4PJM A;  2XTL A;  2FPE A;  4DND A;  2E9X D;  2EYW A;  3ZYK A;  5HXS A;  2WWU A;  3HI2 A;  4PFP A;  5HXR A;  2E8I A;  3GN5 A;  3P8C D;  3NHN A;  1B7T A;  3ESL A;  4PAG A;  1G83 A;  2E9X C;  1Y64 B;  2DLP A;  4OK0 A;  2DL7 A;  4J9H A;  2L3S A;  3C4Z A;  5KDM C;  5IH2 A;  3EG2 A;  1QSD A;  1GRI A;  3ZJ2 A;  2W0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...