3R6NA

Crystal structure of a rigid four spectrin repeat fragment of the human desmoplakin plakin domain
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
450
structure length
450
Chain Sequence
SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Desmoplakin
publication title Crystal structure of a rigid four-spectrin-repeat fragment of the human desmoplakin plakin domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 171
structure length 450
sequence length 450
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17902 SH3_10 SH3 domain
A PF18373 Spectrin_like Spectrin like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1060 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA02
1.20.58.1940 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3r6nA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3r6nA03
2RQTA 3M0UA 2AZSA 4X1VA 2GGRA 2H8HA 1BK2A 1QKWA 1M3CA 2KE9A 1YWOA 1N5ZA 2EVRA 4AG1C 3O5ZA 1HSQA 1T3SA 2FG0A 1WYXA 2JTEA 2MOXA 2P4RA 3I5SA 1KIKA 3ULRB 2J05A 2CDTA 4J9BA 1YCSB 2ABLA 2BZYA 3EGUA 2LQWA 4HVVA 2HCKA 4JJBA 2YUOA 2OAWA 2KYBA 2DA9A 1K1ZA 3TSZA 2KGTA 4GBQA 1WA7A 2AZVA 2DBMA 3H0HA 2K3BA 2J7IA 2D0NA 2LMJA 2DX1A 1OV3A 2KEAA 4Z88A 3A98A 3M0SA 1X2KA 1V1CA 5ECAA 1MUZA 1U5SA 3QWXX 1AZGB 2VVKA 3PVQA 3GBQA 2KNBB 1WFWA 4RTTA 1M30A 4CC4B 5L23A 2MIOA 4HXJA 1NLPC 2J06A 4CC7A 2ED0A 3KBTA 2CUDA 2RQWA 1B07A 2DL8A 1AEYA 2JM8A 5EC7A 2EQIA 2F2XA 3EG1A 4JZ4A 1SHGA 1ZUKA 3ZL7C 2O9SA 1JU5C 1AZEA 2DBKA 2VWFA 4LNPA 1NM7A 1H3HA 4KRTA 1PKTA 3U23A 1SRLA 2IIMA 2J6KA 1E6HA 5HCKA 1MV0B 1ARKA 1OPKA 2KBTA 1VA7A 2E5KA 1TUCA 3UA7A 3VS1A 1RLPC 2EYYA 2DL7A 1HJDA 2J6OA 1JEGA 2LZ6B 2ESWA 1UUEA 2D1XA 3SEMA 2EPDA 1WXTA 1AWJA 4K11A 2O88A 3RNJA 1GCQC 3LH5A 2K7AA 5J1GA 2RF0A 2EW3A 1AD5A 2O2OA 3EHQA 2LX7A 2DRMA 3EG0A 2CUBA 2V1RA 4Z89A 3PE0A 4FSSA 1ZUUA 2KROA 4RTVA 2O9VA 1VYUA 2J6FA 2OJ2A 1CKAA 4AG2C 4RTZA 2C0OA 2YT6A 1CSKA 1GL5A 2FPEA 2KRMA 2A28A 3REBB 2LNHB 1RUWA 2RNAA 3NHNA 1RI9A 4J9GA 3C0CA 1NEGA 1NEBA 3JV3A 1U06A 2RQVA 1WXBA 1YWPA 4J9CA 2CT4A 2K9GA 1X69A 1WI7A 2EGCA 5GJWB 2JS0A 4QT7A 2KR3A 1PWTA 1W70A 5I11A 2ECZA 2CT3A 2PTKA 3VRYA 1G2BA 1UDLA 3M0RA 2W10A 4IIOA 1G83A 1JXOA 2DRKA 2YDLA 2AKKA 3VS3A 3EHRA 2LCSA 2KXCA 1SSHA 1BBZA 4J9IA 2ROTA 1ZUYA 1J3TA 1NYGA 1UJYA 3M0QA 1K4US 1EFNA 2DM1A 4RTXA 4RTUA 2PZ1A 1WXUA 1UJ0A 2ENMA 1JXMA 5IHIA 1GFDA 1ABOA 2DL4A 2DNUA 1AVZC 3VS5A 2JT4A 2V1QA 2SRCA 4WCIA 1OPLA 1YN8A 1Z9QA 2L3SA 4GLMA 2OI3A 2ROLA 2EYXA 3EG2A 4D8KA 1NG2A 2HBWA 2JM9A 1UFFA 1IO6A 1W6XA 1UE9A 2DMOA 3VS7A 2A08A 4F14A 1QWEA 4J9HA 2CSQA 2KXDA 1QCFA 2LJ1A 3UA6A 4IIMA 4JZ3A 2KRSA 1ABQA 3TSWA 2XMFA 2YUNA 2A36A 1FMKA 1S1NA 1Z9ZA 1VYVA 4DEYA 1Y0MA 1K76A 2M0YA 5IHKA 1I07A 4M4ZA 1X2QA 2K6DA 3VS0A 2HDAA 4OMPA 2FO0A 3M0PA 1A0NB 2K79A 3UATA 2ED1A 2CREA 2RMOA 2EGAA 2BZ8A 2A37A 3TVTA 4LUEA 1UECA 3CQTA 3IQLA 1PRLC 1T3LA 1I0CA 2YSQA 5IXBA 1AWOA 2CH4A 2DVJA 2K2MA 5IHNA 1RLQC 2L2PA 2RPNA 2AK5A 1M8MA 2IAKA 2PNIA 3I5RA 1GBRA 2GNCA 4J9EA 4JPBW 2X3WD 1QWFA 4E6RA 4LN2A 2QDLA 1UTIA 4AFZC 2FPDA 3PDYA 2GBQA 3EG3A 1WDXA 1H92A 3EDUA 1GFCA 2M51A 2RN8A 2JMCA 1UHFA 4CC2A 2HSPA 2VKNA 1E6GA 2L3PA 1XOVA 3H0IA 3VS6A 3NPFA 1OEBA 2X3XD 2JW4A 5I22A 1QKXA 1AWWA 2DLPA 2NWMA 4RTYA 1K0SA 1WIEA 3PVLA 1HD3A 1X6GA 3UF4A 1VYTA 1B3QA 4A63B 2W0ZA 1ZX6A 4JJCA 1M3BA 4ZNXA 2GTJA 4D8DA 2O31A 2EGEA 4RUGA 4J9DA 2NUZA 2LP5A 5IXFA 1BU1A 1WLPB 1K0XA 2AKLA 1CKBA 3I9QA 2KT8A 1PKSA 2B86A 2KT1A 3KFVA 2GTOA 1E7OA 2EKHA 2LQNA 5IH2A 1KSWA 4HCKA 3H0FA 2YUPA 2LJ3A 4F16A 1U3OA 2BTTA 3QWYA 4CC3A 4J9FA 2HEQA 3VRZA 4AFUC 2JMAA 4AFQC 1GCQA 2KYMA 3F57A 3THKA 4DEXA 2JXBA 3NMZC 3R6NA 1Y57A 1W1FA 1JO8A 2MCNA 1LCKA 2FRYA 2SEMA 2LJ0A 1NLOC 4AFSC 4OMOA 2C0TA 2CH4W 2DF6A 2EBPA 2F2WA 2C0IA 1X6BA 1FYNA 4ORZA 4F17A 1M3AA 1KJWA 1JQQA 4OMQA 1ZBJA 5FWBA 4Y92A 1AOJA 3RBBB 3FJ5A 1SHFA 1SRMA 1ZSGA 1H8KA 1OOTA 2DILA 2G6FX 5FWCA 3EDVA 2DYBA 2L0AA 2FEIA 4EIKA 1PHTA 2D8JA 4OMMA 2CSIA 2D8HA 1T0HA 2DL3A 1M27C 4R0KA 2I0NA 1BB9A 1TUDA 2JS2A 1TG0A 1QLYA 3I35A 4RTWA 2FRWA 2F2VA 1SPKA 1T0JA 1YP5A 5FW9A 1KFZA 1NYFA 4LUDA 1SEMA 2BZXA 1GRIA 2GQIA 3M0TA 2FPFA 1I1JA 1AWXA 1X27A 1UGVA 1X43A 1YNZA 2L3QA 2DL5A 4Z8AA 3REAB 1PNJA 1K9AA 4OMNA 3NGPA 1G8XA 2DE0X 1PRMC 1MV3A 4OMLA 1WX6A 2YUQA 3VS4A 2KRNA 1GBQA 4HVUA 3H41A 2RQUA 4LE9A 5GJVB 2EYZA 3SHWA 1ZLMA 1UHCA 2DJQA 4JJDA 3KBUA 2RQRA 3VS2A 4ESRA 4HVWA 1GCPA 2EYWA 1UG1A
chains in the Genus database with same CATH superfamily
2QVAA 4X1VA 2GGRA 4O6JA 3TLSA 1VQPA 1NAFA 5LMNT 5HXSA 1VQ4Q 3F70A 1YWOA 5LP6E 1K8AC 4LF9T 2EVRA 2I6HA 2V26A 1Q86R 4IDPA 5AQPB 4AG1C 2Y8DA 2XAHB 3O5ZA 2HPLA 3OQ5A 3M3ZB 1I94T 1T3SA 2D0QB 2MOXA 3I5SA 5FXXA 2E1HA 1RAGB 3EFOB 2DTHA 3ULRB 5AQLB 4MFRA 4YHHT 1VIFA 4B3ST 2W67A 1YCSB 2RJEA 2OLTA 2QAZA 5JQGE 4DR2T 1PC0A 2GFAA 2I2LA 4HVVA 1OWAA 4C92C 4X34A 2P4TA 4AKHA 2YUOA 1HCIA 2OAWA 4Y91A 1KQSP 8AT1B 3F31A 4M75F 2FB7A 4JI4T 2VUBA 3CXCS 5KYNA 4ME7A 2WSFE 3TSZA 3CMLA 3JCMQ 4NUUA 1GXIE 5AFUL 3UQ4A 2DBMA 3H0HA 5J26A 2K3BA 2LNVA 1YBYA 1B34A 2VXFA 4TN7B 1SA0E 4XU2A 1QW1A 3A98A 3M0SA 3SOLA 2RJFA 3CCVA 4UF0B 5DLQE 4KHZF 1HFAA 4A56A 2KNBB 3HHTB 4M75G 2LQKA 2MIOA 5GAN2 2J06A 4CC7A 5HK3A 4V2SA 1LOJA 5L8RE 2CUDA 4ZTJA 2LDMA 2DL8A 2D0UA 1AEYA 1RAIB 2JM8A 2DI4A 1WPYA 2EQIA 2F2XA 1W0AA 3FXEB 3S6WA 4JZ4A 2LT4A 4MMKA 2H7OA 4TNVA 3A8LB 4OF1A 1KC8R 5FL0A 4HWIB 4LNPA 5AT1B 1NM7A 3I0OA 3AA0B 3HP9A 3FEOA 1E6HA 2FJAA 3G71A 3CCQT 3EGXB 3DJBA 1ARKA 3JCMP 2KBTA 2I59A 3JB9G 2BKPA 1W0BA 2DIGA 3UA7A 4IE7A 2QA7A 3RC8A 1HJDA 2LZ6B 3VHLA 5FMNA 1C6VX 2KSRA 2FZKB 3MEUA 3ZYMA 4G2AA 5GAOp 4II1A 2NWBA 4EOZB 1BYMA 3DP7A 3LH5A 3OW2P 1TH7A 4ZI7E 3FB2A 5GAMh 1YJNT 2DRMA 1B34B 1BCMA 3CCRT 3HSBA 2V1RA 1FEWA 5LJ3g 1N34T 4XZCA 2KROA 4AKLA 1VYUA 2J6FA 4M75A 4AG2C 1CKAA 3NZQA 4WZXA 3QNUA 2VKOA 4U74A 1N27A 2L5QA 2CYZB 2LOPA 5HCMA 2KRMA 2A28A 2V6XA 1QVPA 4J9GA 3SD4A 2CXDA 1SUMB 2WB5A 3C0CA 1D3BB 1QVFS 3AEBA 1CHUA 1U06A 2HKQB 4H9PC 3VJPA 2MYSA 4M7AE 4J9CA 3CCJT 4PFOA 5CK9A 3QSUA 3QC9A 3ZJ2A 3LW5E 3AE5A 3JAME 2BS2A 3JCMd 2JS0A 3HKDE 1UK5A 4N4GA 4KGZB 1YIJA 4JI8T 2O4XB 2BS3A 2CHOA 3RKXA 2D5UA 4E7KA 4DA4A 3EI0A 2CT3A 2RD1A 4QWNB 1T8BA 1S72Q 4UELA 4AQGA 1NBEB 5ABFB 2XQ7A 5LJ3f 5LJ3e 2W10A 3X26B 2LRQA 3A5XA 3AAIA 2RI3A 4LF8T 4FT2A 3CPWP 2L3LA 2YDLA 4IUUA 1VQ5A 3RKYA 3NRXA 1YJWA 4M7AF 4H9QC 1VQOT 1Q7YC 2WU5A 3E22E 5JDHA 1SSHA 5F8PA 4HT8A 1ZV4X 1ZUYA 3QYGB 3OYNA 4QHOA 4JI2T 4H9RC 5LHGB 1ZHIA 2COYA 4AIUA 3PNWC 4UR9A 4GLKA 5GAOl 1US7B 1K4US 4WW0A 3CC7Q 4OYKA 2VASA 2WZHA 5AQOB 4OHFA 1SKUB 1KG1A 5FU6C 1RAHB 2ENMA 3OYLA 4M7AG 2LKHA 4NOYA 4UEMA 3CC4A 2ZPEB 3FZLB 2YRCA 2WM9A 2V6YA 1MHNA 3A8GB 3J7Yq 1YN8A 3CMAQ 1HNZT 3FZFB 2OI3A 2ROLA 2WMNA 1IREB 2DXUA 3L1AA 1WQWA 1OEDA 3U78A 5JDLA 5GMKh 4JI6T 2WQYA 4UV8B 2NTXA 2A08A 3N9LA 3RESA 2RHXA 1BR0A 3CEYA 2W00A 3VR9A 2ZGWA 1QVGP 4IE6A 5HCJA 2V7KA 3Q2MA 3I55Q 3KBGA 4LF5T 3G6ET 4IIMA 5LA6E 3D0TA 3ZC1A 3AVSA 3C94A 4IUVA 4ZZCA 1JB0E 4PJOC 2X4YA 4C8QE 3TSWA 1SSFA 2CZ0B 2XMFA 1HNWT 3WXMB 2FL7A 3OB9A 1Z9ZA 5GANh 1AJ3A 3CK6A 1ZP0A 1N9RA 4IDNA 2JQQA 2DXTA 4QH5A 1I07A 3A8MB 2V5CA 3VR8A 1TOVA 3E0ZA 1X2QA 3M57A 4M4ZA 4Z02A 1WRDA 1TS9A 5FYMA 1VQNT 3N9NA 3CCST 3BQIA 1VQ6Q 2RK1A 2NW9A 5L3BB 4FYXB 1AHJB 3CCMA 4M7AA 2WBLA 3UATA 2CREA 4BI3A 1HX8A 4B3TT 2BZ8A 2A37A 3SFDA 5DJQC 5CGMA 2KI7A 2Q9QA 1UECA 3CMET 5LGTB 2CZ6B 3MO8A 4C8QF 1YI2T 4PKCC 2DVJA 5FP3A 3ESLA 5IHNA 3OSVA 2XQ4A 2V6YB 1RLQC 1U1TA 2UUCT 4ZHQE 1VIEA 2VC8A 2BG9E 4JRIA 5HXRA 2IAKA 2XUEA 4IDOA 4DV6T 4FYYB 2GNCA 2X3WD 4OB2B 5KYXA 4LN2A 1BI3A 1OEDB 3UU6A 3OBYA 4JRQA 3OYDA 2HQHA 2AE9A 2FPDA 1VQMT 2XASB 1RAFB 1BI0A 1H92A 1D09B 3EDUA 1GFCA 2VURA 3IF8B 4C8QG 2NW7A 2JZ2A 5FRNA 2BKOA 2HPJA 1BCOA 4C90A 2QEXA 4JBWF 2HD0A 1YITA 3C50A 4O4LE 5LNKA 2HNIA 1K0SA 3ZC0A 2OV9A 4JRKA 2QA4Q 3RERA 1HD3A 3O1JA 4DUYT 3SFEA 2ZMAA 2W0ZA 1ZX6A 1XNRT 4JJCA 1M3BA 4PLIA 1PD0A 2N2NA 2LE8A 1YD8G 3N2KE 2O31A 1VCSA 2X9YA 3UULA 2DWGA 1RAEB 2LCLA 2LP5A 3K8PC 5IXFA 1Q86C 2KNDA 5C2TA 1WLPB 2M9UA 2AKLA 3N5LA 3FBZA 5FXVA 2KT8A 1NJIC 4U3CA 3VKIA 1KD1C 5M4YA 3PIPA 3KFVA 4ELZC 4GYRA 4HKEA 3S4UA 2EKHA 1WHKA 4HFDA 1D0XA 2KQWA 5A1LA 1OYXA 3TKLB 3KXTA 1KSWA 1WQ7A 5LB7B 1IXDA 4C91A 4F6RC 1YJ9A 2M6BA 1U3OA 2BTTA 2F1LA 1KNRA 2QQ9A 4CC3A 5GAMd 3CC2T 3A1PA 4C92B 1IRXA 4JI5T 4C8QA 1WYCA 3RIFA 4H9SE 2IHR1 1W2BP 2WDVA 4MDWA 2JMAA 3QB5A 2FYKA 4LDWA 4AFQC 1WGSA 2CCQA 3THKA 4HCCA 1VOMA 1IBMT 2P0KA 3R6NA 1WHMA 1Y57A 2F5TX 2X68A 2BE7D 3B13A 3V5SA 1JO8A 3N9MA 3QKJA 3AVRA 1LCKA 2LJ0A 1QSDA 2MF2A 3MXZA 1D0ZA 1I4K1 2C0TA 2CH4W 2EBPA 3PU3A 4B6XA 4M77D 5D6WA 1M1KC 2IC6A 3JCMg 4HFEA 2CWYA 4MALA 3HFNA 5AQNB 2NW8A 4EMKC 3G71T 1JQQA 3OYAA 4EEDA 5BR8T 4JYAT 4A4EA 2W62A 1AOJA 2XSBA 1W4SA 3OYYA 4J8OA 1UX5A 3ZN1B 5AQSB 4JJNK 3QJYA 2BG9A 1OOTA 2CPTA 3PV0F 5FWCA 3EDVA 5F5WA 1RABB 2FEIA 1PHTA 2CP2A 4X1KE 2PFVA 3C4ZA 3QBYA 4PJMA 1D1BA 2XZEA 2VVNA 1YJNA 1WNLA 3CCRA 5LOVE 3PUVF 3Q5WA 2DL3A 1OU8A 1M27C 2JTMA 4AI6A 5ABHA 4R0KA 3MJXA 1OZ2A 4LDYA 1H7CA 4PJOF 1TUDA 4MHCA 2JS2A 3E1SA 1K73C 2Y90A 2F5KA 4DR4T 4IHJE 5DQVA 2K48A 1S94A 1QLYA 3UQ7A 3OTOT 1ZSZC 4RTWA 2VQET 5GAN6 2F2VA 1SPKA 1YP5A 5AQFB 2CE7A 4KT0E 1NYFA 3OKQA 1UX4A 2GQIA 3FRNA 3JCMc 1XMQT 3EH2A 2R6GF 1WCRA 1Y7XA 2VV5A 5JTGA 1AWXA 1ZEEA 5LBQB 3JCMf 3JCMe 3QYHB 2CP0A 4ILAA 3BY7A 5EK4A 1OZ3A 4PJOG 3ZBDA 1X43A 2L3QA 1YJWQ 4M77E 4HWDA 1PNJA 3CCJA 1VQLQ 1J5WA 4ZI3C 2LQ8A 4ZI2D 3NGPA 4HEAA 4H9NC 2H88A 3WAJA 3OYMA 4EIWA 3H6ZA 2JQKA 2FZGB 3ZFJA 2ODVA 2RQUA 4XTZA 4LE9A 4QQGA 1WR0A 3RMSA 4QKUA 3CXCA 3AT1B 1ZLMA 1ZOYA 2CXFA 2WAUA 3KBUA 5LJMA 4YTLA 4JS4A 4EZ4A 2RQRA 1R8IA 2W4XA 3UFEA 4ESRA 3OYFA 4M75C 2EQKA 3ETVA 2NUPA 4F8HA 4CXWA 4H63H 2DO3A 2AZSA 4K0KT 1M1FA 3I9YA 1H3ZA 1B7TA 2QQSA 4AKRB 4M77F 1VQOA 1M3CA 1WHLA 4KBMB 1X9BA 1W9RA 1YQ4A 2E5QA 5FU7C 1M90U 4COFA 1I5OB 1J1JA 2A7YA 2JTEA 1PG5B 3RGLA 2ZPGB 1KIKA 3EAMA 5DQWA 4X66T 2EHOC 1NE8A 2CZ7B 4HT9A 2ABLA 3GWHA 5KYUA 4JJBA 3QUIA 5GANd 4EGWA 2X0LB 5AQJB 2VYTA 5FROA 3FLGA 4YY3T 1PSEA 3RUXA 4B9XA 3ZN0B 4M77G 4LFBT 2VWAA 4L59A 4BI8B 4PJOA 2RI2A 2J7IA 4DV0T 2QGSA 5L3DB 3CCUT 3CQGB 2MAMA 4N4IA 4C5EA 4DBHA 1OX9A 4IT4A 4EMGA 3ZT7A 4Z88A 4XTXA 1VQ9Q 3JC6D 4L6V5 2RI5A 4JEHB 5ECAA 1U5SA 3M58A 5C6SA 5AQUB 3GBQA 4RTTA 4ILBA 4M1PA 1TU0B 3NTIA 4HXJA 1NLPC 5FU6B 3A8YC 5CA1E 1IGQA 2RQWA 2KZ7B 1B07A 2NLUA 2E6NA 1JNZA 3C95A 1KHIA 1SHGA 4J6WA 1BR2A 1JJ2P 4UVBB 1OU9A 1KQSS 3RX6A 1JU5C 3G6EA 2KLQA 2WZIA 2FJDA 3RYCE 2PVGB 4KRTA 5L4HA 3ZMVB 3U23A 1SRLA 5KMGP 3CX6B 2X66A 3RIUC 3JB9I 1SE7A 5HCKA 4E7JA 2RH2A 4PK5A 2RHIA 3SB2A 1M2VA 4EB6E 2L8DA 1VA7A 2LSIA 3TREA 3VS1A 1RLPC 1SHZC 3CCSA 2DL7A 1KC8U 3ZMUB 4M7DE 4E7ZA 5KYUB 2J6OA 3V8KA 1M62A 1QVFA 4AT1B 1HR0T 1WXTA 4JLIA 1AWJA 3X20B 1UEBA 2GCXA 3RNJA 1YW0A 4FYWB 5DM7R 1KQ2A 3ASKA 3V8LA 4PJOB 3CMEA 2MK5A 4NIQA 2A72A 3EHQA 5ABEA 2LX7A 2DZCA 4V1Av 3GNGA 2CUBA 4DV7T 4DV1T 2FUPA 4EPCA 1ZUUA 2EQUA 2UU9T 5L4EA 2EWNA 2HQXA 3RC3A 5GAOm 2W63A 2ZPHB 5LCYA 3UT5E 4DV2T 1Z0PA 4WNKA 4RTZA 1M90R 3MEAA 2VK9A 3UDCA 2XQ5A 4UVAB 3TLWA 1NPRA 1GL5A 5HEUA 2V8SV 1VQMA 2FPEA 4G63A 5GAN7 1Q81U 4M7DF 5CQXA 4YJ2E 3OBWA 2RHUA 3NHNA 4DBFA 3GPLA 2CS7A 2OTJA 1GQEA 1NEGA 3NTKA 4XTWA 4PJLA 1KHCA 4AISA 2K5FA 1YWPA 4WYVA 3OW2S 3LK42 3MK7C 4TX5A 2X9HA 2XSAA 4A97A 2BZBA 4EYYR 1C1AA 2CT4A 2HZYA 2K9GA 3D7SB 4M7AC 2K3YA 4A4FA 2EGCA 4Y28E 5GJWB 3ETUA 3UU8A 2CP6A 4M7DG 2Q9QC 1IJ5A 3OPCA 1IHVA 1M8VA 2M67A 5KDMC 3VUZA 4ZGJB 2WDQA 3KV6A 4M78D 4A54A 3TLUA 2ZZDA 2H3EB 3C4WA 4IIOA 2N1GA 1X75C 3M9QA 4H9OC 3EFRA 4BDZA 1I8FA 3ZPOA 3FZKB 2AKKA 3RMQA 4F7UB 2OTLQ 3AA7B 2DTIA 2DVEA 2VKDA 3EHRA 2LCSA 2JPFA 5LJ5h 2W2UA 3LWIA 3GF5A 5GAMf 5GAMe 4R55A 4Z91A 3S3MA 3RF1A 3MA9A 1J3TA 3H3MA 1X6OA 4QVCA 3JCMJ 1IZNB 3P4WA 1UJYA 4LD6A 2WWVA 1M7KA 4DV3T 3CCQQ 5I2MA 3PTAA 2COZA 4BAYB 3I9WA 5FNVE 3N5BB 1OI1A 2YOEA 4JI0T 3FZMB 2ZM2A 4RTXA 4EMKA 3CC2A 4JI1T 2PZ1A 4QX8B 3RRCA 1VQ8A 1YJ9T 1ZKEA 3RKGA 3E19A 3CBOA 4VUBA 2RPAA 1JXMA 2C5KT 3DB4A 5IHIA 3RQWA 1HF8A 2ATCB 2E12A 3AEGA 1ABOA 3CBPA 2DL4A 2DNUA 3CPWS 3GIBA 1WZOA 1AVZC 4HFHA 1RADB 5CFBA 3CPFA 4HCZA 3PTRB 4J6YA 2E8IA 4J7FA 4GLMA 1Z8UA 1VQKT 3CD6Q 2Y4XA 2RM4A 4GY5A 4M78E 4M7DA 3AB3B 3B5MA 2EYXA 3ONXA 1NG2A 5EK3A 2JM9A 4JV5T 5KX5E 1IO6A 2CP3A 2IW5B 1W6XA 1ZSZA 3X28B 4ASKA 4UC4A 4F14A 2WMOA 5FY7A 4JDSA 2EIFA 1K9MC 4ZS3A 2D0TA 2J4GA 2CSQA 3EGDA 2KXDA 3TQ7P 1Q81R 2QGGA 2W61A 5FY1A 3UA6A 2L8KA 3AAAB 3N9QA 3RRWA 1PM3A 3AEEA 1ABQA 2KRSA 3CCLQ 2KXPB 2YK0A 2A36A 2YLCA 3CQCB 4C8QC 2DPPB 1SF9A 2W0GA 5TAOA 4BE0A 2X9XA 3PJAA 4M78F 1Y0MA 1K76A 3K1SA 4ZGEB 1UGSB 1XNQT 3SS1A 2WY2A 5LGUB 2LJLA 3L2UA 4EMKB 1A0NB 1I5LA 1C0MA 3RR6A 4A98A 1IHWA 3HI2A 1BIAA 3LK3B 4YHJA 1QVGS 4E7SA 4NUVA 5HWXA 4M78G 1I0CA 5IXBA 3H3AA 1AWOA 3WI3A 2Z6EA 2R57A 3NWIA 2AK5A 1M8MA 5KXJA 2BG9C 2ZM0A 4JPBW 2EHOA 4C92D 4E7IA 1UTIA 2JTFA 2LOSA 4I4TE 5GMKe 1ZSZB 2GBQA 2H89A 3J9X1 1UGOA 3ZSTA 5HKCA 1QCOA 4HWCA 2J1DG 1PSFA 1BI1A 2HSPA 3AECA 3EGDB 1XOVA 3H0IA 1UGQB 4PW8A 4AQYT 2X3XD 1BKBA 5IHYA 1AWWA 1FXXA 3J7AF 1WIEA 3N9OA 3HRTA 1B3QA 4DR1T 1Q82C 5GANf 4CI1B 5GANe 2WSCE 4ZNXA 2X67A 2YLBA 4D8DA 1YCYA 1QP3A 5GAOq 2YDRA 2Y6XA 4ILCA 4L0RA 2RJCA 3RYHE 1CKBA 3I56Q 4IE0A 3RI5A 2LC4A 3ONJA 2NOXA 1F1BB 4M75B 3MP1A 4UV9B 2CXLA 5KYWA 3V7RA 3GLXA 3R6OA 2MPXC 4OX9T 3CCUA 3RLFF 5IH2A 3RIUA 4RCCA 3S3OA 4ISTA 5DABA 4HCKA 3H37A 5EZYE 5FU7B 2YUPA 3UPUA 4FT4A 1XNIA 3P4RA 5JDNA 3QWYA 2XHEB 2LSGA 1VRBA 2EHOB 3UFGA 2HEQA 2QK0A 3AE1A 1QLBA 1IZ6A 1VQNQ 2J47A 3ZJ1A 4AFUC 2B8AA 2YDSA 4Q5WA 5AQVB 4PNIA 3QOFA 3QJ6A 3QHSA 2E4HA 2GQVA 4DEXA 4QXBB 2P84A 5AQKB 1XWMA 3UU5A 5CR2A 1S72T 3MEVA 3GN5A 3X25B 2MTQA 3QZ9B 3AE4A 3GA8A 3ZT6A 1YI2Q 4ZGDB 2MCNA 2HMAA 1MIVA 3HKEE 1G3YA 2A9UA 2KT9A 5JDMA 1NLOC 3G4SQ 1Y07A 1N9SA 3OS5A 1YHQQ 2XQ9A 4PK6A 2XJ7A 2VGMA 2C0IA 3CCET 4MZTA 1FYNA 1ZA1B 2QYWA 4ORZA 4A4HA 3UUNA 2V8JA 3RIRA 5A0LA 4X65T 1XQHA 2DLRA 4HN9A 3M54A 4TUYE 4X9CA 1ZBJA 2ACXA 3E9GA 4NPPA 2AXDS 2LSKA 1VQMQ 1BI2A 3FJ5A 2UXBT 1ZSGA 1W2BS 2DXCA 2PUOB 4ZOLE 4MZMA 2DYBA 2JQ9A 5LMUT 3PFSA 5LYJE 5KYWB 1NZ9A 5AQIB 4JS5A 4FW1A 1UGPB 2EJ9A 5HEOA 5LXTE 1U1SA 3P4PA 2CSIA 2D9DA 5LJ3h 2ZAEA 3UT1A 1WFDA 3LG7A 2YRVA 4KUDK 1T0HA 4X5TA 2WS3A 2R5MA 4GIWA 5JH7E 5I2SA 1HNXT 1UUSA 4P5NA 3JCMb 5HEGA 5CKHA 2X0YA 2HKNA 2MMPA 4KUIA 2RHZA 3I35A 4QQ6A 1VQPQ 4QXCB 1G5VA 2LHRA 2X4JA 2XHCA 2RHYA 3M5AA 2BZXA 2LSYA 5ADXL 3S3NA 3LSVA 4Z8XA 2KAFA 1I1JA 3CX8B 4RG2A 4AXPA 1T72A 5IAYA 2A3LA 1M90C 3HRUA 1X27A 1LPLA 3GN5B 3IA3A 2A3DA 3EH1A 5L3GB 2DL5A 2LLYA 4GKJT 2O01E 4ISSA 4N4HA 5JDFA 1LJOA 4FU6A 4M77C 1HG5A 2LT3A 3WVDB 2OTJT 5A2QE 2DE0X 5J2UE 1UURA 1PRMC 4PJNA 5AQTB 1MV3A 3P8HA 3CX7B 3O1IA 2G3RA 3FDRA 2KRNA 5AQGB 1H641 4X1YE 2GK9A 1UB4A 2NUTA 3ZKRA 3CC2Q 3SHWA 2RK2A 1M4ZA 3C64A 4JJDA 3CCVQ 3META 3VS2A 2JRKA 3HKCE 4C5GA 1GCPA 5JDGA 4EV6A 1MMAA 1V9DA 5JDQA 4DNDA 2EYWA 2KK4A 1PD1A 1VQ6T 4IUQA 2H8HA 2DEQA 2BDEA 1BK2A 4M7AB 1QKWA 1BIBA 2QXFA 2KE9A 4QKNA 1U8RA 4JRPA 1TSFA 1N5ZA 3R84B 3FJPA 5LJ5j 2RO0A 4PK4A 3ANWA 3A8OB 1HSQA 5IYZE 2Q9QB 2FG0A 2P4RA 2F69A 3P4QA 1IBKT 5AQQB 2CDTA 4XTVA 1HS7A 2LQWA 2HCKA 3SRZA 4ANJA 2HN2A 5FKYA 4IURA 3G71Q 1KQSA 4DVDA 3DLMA 4E7HA 2XQ3A 2QI2A 4LDXA 2MBGA 2M6IA 2DA9A 4J7IA 5KYXB 2DKGA 2KGTA 2HL3A 3BK9A 2V5DA 4ZI2C 2LMJA 2D0NA 3OS0A 1VQ8T 2RA2A 4J6XA 3E08A 5C8YE 3B57A 1OV3A 3EG9A 4DMWA 2XQAA 1X2KA 2JN0A 3M4GA 1VQKA 1V1CA 3X24B 4OMFB 3QWXX 1AZGB 5H6RB 3BDLA 4A5XA 2LTOA 1WFWA 3BE3A 5ETWA 4CC4B 2QA4T 3QDRB 4IDQA 4LMJA 2E9XD 2YDQA 5J2TE 2ED0A 5D6YA 2HH7A 5A0DA 2V7LA 3CVRA 5EC7A 3EG1A 1KC8C 5LG4A 1T7SA 1ZA2B 1NEKA 1YKHB 5IUXA 2O9SA 2XDBA 4J83A 5FXZA 2DBKA 2VWFA 1H3HA 4QX7B 5LGNB 2X4XA 1TUGB 2IIMA 2CHNA 2MWPA 2IC9A 1WHHA 2XIDA 3PGGA 5CKBA 5EK2A 4AKIA 4N78D 2CGHA 2WWUA 1OPKA 3CQXC 3NRYA 2AT1B 2DD5A 4IE5A 1RACB 2JJ9A 2EYYA 4CXYA 4BJMA 3QXEB 1D1AA 6AT1B 1JEGA 3NVOA 1UUEA 2D1XA 4BA9A 4D6WA 2EPDA 1D1CA 4M7DC 4EDUA 3K3QC 3PMTA 4K11A 4DMVA 4HE8A 4LFCT 1YIJQ 1L0VA 2K7AA 3OW2A 5J1GA 3JC6C 2AIRB 2ZLYA 2O2OA 1AD5A 2FJEA 3EG0A 4C8QB 1O75A 1JJ2S 4XU0A 4Z89A 2FBWA 2J62A 5GONE 2KDSA 1V29B 5EG2A 3CPZA 2XQYA 3PUSA 4RTVA 5DY9A 2O9VA 2JUFA 5AQRB 5L2LA 4DV5T 1VQ5Q 2OJ2A 3M53A 2C0OA 2YT6A 2UXNB 3QDFA 4KGVB 3WAKA 3GNFB 2OA5A 3EHZA 1KEYA 3FBLA 3INZA 3REBB 1I81A 1RUWA 1OULA 1RI9A 1FMVA 5HWYA 4YTNA 2YXYA 2YU2A 1Y96A 4BB7A 1CUNA 3DTOA 4JLGA 3M59A 2RQVA 2Y48B 2XKOC 5LJNA 2QRXA 3OYXA 1WI7A 5GAN4 3CCUQ 3QB5K 4IUPA 4HFVA 2BG9B 2HQEA 3MPUB 3OY9A 4F04B 3OYKA 1LRZA 1PWTA 4FM4B 1ACMB 1W70A 3G1JA 3CC4Q 3CWZB 3QPHA 1D0YA 2PTKA 3VRYA 3UTKA 4X1IE 1UGRB 1MMGA 3SDZA 1JXOA 5HY6A 2P0PA 2XAGB 4B9WA 4BACA 3CPWA 3HTRA 3G7ZA 3RQUA 4EMHA 4P09A 2VKJA 3TLTA 5FL1A 2KXCA 3O4XE 3OYJA 4J9IA 2XU8A 3L2VA 2QTXA 3LYIA 4O2BE 4I43B 1NYGA 1MNDA 3A8HB 5FLXE 4RMOA 1XJWB 1EZ3A 4DR6T 1EFNA 2DM1A 4K0UA 2UXXB 3C4XA 3P7IA 5IT9E 4RTUA 1YQ3A 3O1HA 1WXUA 4FW2A 3OYBA 1UJ0A 3AE9A 4KP3C 3RKOA 3BQLA 2EJGA 1E2AA 1EX4A 4OP0A 2H7VC 5FVLA 3LWHA 1FWZA 3VRBA 2RJDA 5C0MA 1Y96B 1S72A 3VS5A 2V1QA 2CZ1B 3ONLC 4J2CA 1X79A 4WCIA 4WF2A 3CCMQ 1Z9QA 3EG2A 3PU8A 3EVYA 4JI7T 2DAQA 4M78C 3EFSA 4D8KA 2YN6A 2E5LT 3JCMh 1UFFA 2NUPB 4PJJA 4XAXB 1KFYA 1OX8A 3CCEA 1IJ6A 5E0OA 3HKSA 2DMOA 3VS7A 4FSXA 2IDOB 4DQ2A 2PTFA 4DR3T 1QVGA 4QW2A 2LRLA 1NJIU 1KD1U 2EAYA 1IGUA 4QVZA 4JZ3A 2JMKA 3CC7A 1IBLT 1VQ7T 2D2SA 4ZI3D 5LG3A 2PVOB 5AYFA 5GAN8 5DLOA 5AQHB 3HPWA 4M77A 1VYVA 4DEYA 4HTEA 1HXDA 1EZZB 4MMLA 9ATCB 5LJ3j 4GKKT 3NFCA 2M0YA 5IHKA 2QEXQ 2HDAA 3PUXF 3OMGA 1UCUA 3VUBA 1HK9A 4OMPA 1YITQ 4MBQA 2BBJA 3K3NA 4U72A 2FO0A 3BDUA 3RYIE 3J81E 2K79A 2RMOA 2EGAA 4M75D 3GMIA 4DIDB 5H6QB 4EEBA 3L2QA 2L3RA 4LUEA 4FJOA 2WSSV 3IQLA 1PRLC 1X01A 2DZ9A 3M56A 5L3CB 2VKHA 1N36T 2K2MA 5GAMg 2A0FB 2WDRA 1Y01A 2XY8B 2L2PA 5HYAA 2RPNA 3I55A 5C3JA 1LKXA 4QH1A 3OA6A 1BR1A 2PNIA 3I5RA 4DR7T 3A7MA 1GBRA 2GF7A 2QDLA 1TTHB 4AFZC 4IGUA 3T9NA 3PDYA 5JREA 1WDXA 4Z90A 4NL3A 3JB9D 2IIUA 2ZPFB 3M65A 4DBRA 4UXNB 2JMCA 2RN8A 4ZS2A 3J80E 2E6ZA 2XK0A 2BKNA 3G06A 4UF0A 1YJ9Q 2VKNA 1M2VB 1E6GA 2L3PA 3SWHA 4IREA 4KMCA 3EAEA 3VS6A 3QUJA 4XU3A 5I22A 1VQ6A 4LF7T 3ZEFB 2M16A 2BE9B 4RTYA 1WJRA 4LMLA 3IEEA 3PVLA 1WR6A 1X6GA 3UF4A 1MMNA 4M77B 2QTVA 2C0SA 3LH0A 4A63B 2RP4A 3W15B 2XQ6A 1K73U 3I1AA 2QASA 2E2AA 2JNGA 2GTJA 3L09A 2EGEA 5KCHA 4J9DA 3LLRA 4KH1B 2CWOA 2X35A 3AA6B 1BU1A 2NR4A 2CRBA 1K0XA 4U2ZA 2PVDB 4DR5T 3C51A 3EGXA 2DERA 3HFOA 2LRKA 3HKBE 4YSZA 4QH4A 3E9FA 1NJIR 2GTOA 1KD1R 4IE4A 1E7OA 4B3MT 2CBJA 2K3XA 3LX7A 3PMIA 4PAGA 3O9XA 4B3RT 2LJ3A 5GAOn 3OYGA 4AQFA 2K57A 4FIBA 3F2EA 4KUMB 2AHJB 4J9FA 2Z0WA 2MOZA 4WBOA 3L2WA 3PUWF 2QA4A 3SFMA 3L8RA 3ZCIA 1YJNQ 3VRZA 2K4YA 3CCRQ 1FMWA 1W09A 5JVDE 4X9DA 1W2BA 2DCFA 4CI2B 3JCMX 3NKZA 1FIOA 1G3WA 2XAQB 1VQ4T 1IAPA 4C0DC 5GAN3 2XG8D 2XQ8A 5LL6S 1W1FA 3MCAB 2F4VT 3AE3A 2OX7A 2FRYA 5CIUA 2SEMA 4I55E 1HX1B 4R56A 3JB9F 2EYQA 2E3HA 2IVWA 4XTYA 2MAWA 2W66A 3EABA 4ERRA 1D3BA 1HG2A 2DF6A 4OMOA 5D6XA 2OTLT 4CRIA 3UU4A 1X6BA 2DYIA 4YSYA 1M3AA 4IKFA 2PU9B 4OB0B 4A4KA 3PUQA 1KJWA 1M1KR 4TZ4C 4OMQA 5FWBA 4RG8A 4Y92A 3CCJQ 3ZSSA 3RBBB 2QDYB 3T1HT 1SHFA 1H8KA 2DILA 3ZYKA 2O4XA 4EYUA 4M7AD 4EIKA 4PNOA 3RKWA 2XAJB 5JR9C 5ABFA 3T1YT 2D8HA 4IUTA 4U7IA 2Q9QD 3OSSC 2PQWA 4DOWA 4XBFB 5GANg 1OEDE 2M0OA 1WYBA 5HXHA 1N8RU 1K73R 1Y64B 2FRWA 2V8KA 3CD6T 1VUBA 5FW9A 1VQOQ 5BMVE 4M7DB 3X1DA 1SEMA 3Q1JA 2NTYA 1IB8A 2XM2A 3M0TA 3BQKA 4E7LA 3PUGA 4NS5A 2E70A 4C0GA 4PFPA 3AA1B 4BY6C 1JNRA 3MHXA 5GMKm 4DO0A 5CB4E 2RA1A 4XK8E 3KUFA 1UGVA 1BR4A 2DEUA 2E64A 1YFNA 2VL8A 3URGA 5KCOA 1K9AA 4AMCA 4OGCA 4OMNA 3KVBA 4OMLA 1WX6A 4QXHB 2YUQA 3CCLT 4YTPA 5I21A 2K9AA 4HKAA 3AAEB 3MACA 5CO7A 5GJVB 3ZMSB 2EYZA 3CXCP 5J39A 1N6AA 4GK0E 3HR0A 4TWHA 3VKGA 1O3XA 3Q9DA 2JQHA 3QIIA 2RQTA 3M0UA 3VKHA 4OB1B 5HAXA 4OK0A 4CI3B 3H8ZA 3KVAA 3JCFA 4XTUA 4I0UA 2K5IA 4MZPA 4M78A 2MPKA 1XDOA 3T8OA 1WYXA 2IG0A 5KH6A 3WVEB 3CKDA 3NZPA 3G6EQ 2LKGA 2J05A 4C92E 4J9BA 3FIFA 5J0ZA 3I0QA 1M9SA 2BZYA 3EGUA 3VYGA 3CCEQ 1VQLA 4L9IA 4U2YA 3BW1A 3HL6A 4JEUB 5HEJA 4CN6A 5CKEA 2KYBA 4IDZA 1K1ZA 2JOYA 4C8QD 4GBQA 4H63V 3FZHB 4DUZT 1WA7A 2AZVA 1LVFA 3V7SA 4KX6A 2VGNA 2ZM8A 3KINB 4BJNA 3AEFA 1EIFA 2DX1A 3CCSQ 1ZHCA 5A0GA 3VRAA 1QCNA 2KEAA 3MEWA 2LSJA 1LNXA 4QVDA 2KWHA 4ZN1A 2V1DB 2HBPA 3L2RA 1MUZA 3PIOA 4E2FB 2VB6A 2YWWA 2VVKA 2SPCA 3OYCA 3PVQA 2KWIB 4P0BA 4C92F 3CMEQ 2P9BA 1M30A 4C5HA 1N33T 2P0QA 5L23A 1ZQ1A 1K8AU 1N8RR 4HFBA 1KQ1A 3OMCA 2D6FA 4LD9K 5L47A 3KBTA 2KVQG 2ES0A 4PFZA 2EQJA 1ZUKA 3ZL7C 4WTOB 4O5VA 1JJ2A 2PJQA 4PL6A 1AZEA 4FYVB 1VQ7A 3MKDA 4LDVA 3OYIA 2ZPBB 1PKTA 2DL1A 2J6KA 3I56T 2UUAT 3VV0A 4C92G 2V7MA 1MV0B 3RDVA 1G73A 3KDSE 1YKEB 4M78B 3CC7T 3OS1A 3SWNC 2OTJQ 2DNXA 1LVKA 4JLEA 3KV5A 3QG1A 1KNPA 3RIAA 2CMRA 2XTLA 3TCJA 2E5KA 1TUCA 1XTDA 4N0AA 4FL6A 1U4QA 2E41A 3QZ5B 1QVFP 1VQ9A 2ESWA 3SEMA 3CBMA 1JRIA 2KSSA 3M55A 3OYZA 2O88A 1GCQC 4DBQA 5LJ5d 2FVUA 1FX7A 3OVUA 3FXDB 3CMAT 3O8VA 4JI3T 2JMHA 3PUYF 2CKKA 2EW3A 2RF0A 3ZMZB 1WHGA 3N2GE 3AEDA 4ZN3A 3PE0A 4FSSA 2YINA 4U33A 1KF6A 4TV8E 3LGFA 3PT9A 4LFAT 1R0BG 2E9XC 3QO3A 2EFIA 4FCYA 2XDPA 4RKUE 4FI5A 1CSKA 2C5IT 3MP8A 2ODUA 2V7JA 2FJBA 3I55T 4LDUA 1K9MU 3L42A 4GK5E 2D9TA 2H3JA 4OYJA 2LNHB 3G4ST 1TWBA 1YHQT 5LBMA 2RNAA 4BDYA 1I6ZA 3FC3A 3OJAA 4UIGA 2K5BB 4YT0A 3N9PA 1NEBA 2CLYC 3JV3A 3HRSA 1WXBA 4C92A 4C0ZA 2HL5C 1X69A 3RYFE 4HCBA 1SG5A 1VQ8Q 4KI0F 2CEAA 4IIJE 4QT7A 3L3PA 2KR3A 1KNZA 2IPOB 2DIQA 5I11A 3ZMTB 4ADZA 2ECZA 1G3SA 4TWFA 1G2BA 1UDLA 3M0RA 2C06A 3V5UA 1G83A 1K8AR 4EAHA 4CI0C 2IUBA 2DRKA 1MNEA 1O9SA 3VS3A 3KV9A 3OS2A 1XMOT 1VQPT 2WU2A 2VXEA 2LEHA 3VYHB 1OXZA 2YKSA 1BBZA 3V7CA 2BBHA 1XZYA 1P92A 2ROTA 4BE2A 4PJOD 2LM9A 5JRCA 2BVLA 3HL8A 3M0QA 4ZTFA 4LF4T 2DJZA 3LBXA 5GMKl 2LCCA 4E47A 2RB6A 4BI4A 1MIWA 2E65A 4TNWA 3JCMW 5FVKA 2B76A 2XDDA 3PJAJ 5CQYA 4NL2A 3K3OA 3KV4A 4CZZB 3L39A 5CJ5A 4EXTA 2M1HA 1GFDA 4IL4A 1RL2A 3TU4K 3DKMA 2FHDA 2HAXA 1VQ4A 3PURA 3Q5EA 2JT4A 5JR9A 2NUTB 2LVMA 2SRCA 1QUUA 1E1HB 2CM0A 1MGQA 1OPLA 2JVVA 5GAOr 2L3SA 1HYOA 3CCVT 5IN1A 1Q82U 2PBIA 2H3RA 2HBWA 5D7UA 2QQRA 2OTLA 2A2FX 4YXDA 1Q7YU 1FJGT 1G3TA 1J5ET 1Q95G 1UE9A 2DXBA 2IMLA 1QWEA 3BFMA 4GOUA 4HWFA 1Q81C 5KE2A 3PUAA 4J9HA 3ANWB 5FRMA 1K9MR 1QCFA 4TV9E 4OB3B 2DK3A 4JUVA 5FXWA 4AQFC 2LJ1A 3CCQA 3AE6A 3ZYLA 4PJOE 5M9OA 1M2OA 3MZKB 4C0DB 2YUNA 1FMKA 2CBIA 2NP9A 4YLHA 5HEHA 3A5ZB 5J3BA 4BD3A 4BUGA 1S1NA 4A53A 4CQIA 3JB9J 5JRCB 1M1GA 4X20E 2OAUA 2K6DA 2DWKA 3VS0A 5LHHB 4O4IE 4LF6T 3LBXB 4JUYA 3M0PA 3DLLA 2R58A 3EG9B 3CD6A 2ED1A 1ZBXA 4BE1A 2EKOA 4TVRA 4P0AA 4CN4A 2K2VA 5GAMj 5CCAA 3TVTA 3C98B 4O4HE 3CQTA 1T3LA 2K24A 2NYSA 2V8IA 2DFUA 2YSQA 5GAN5 4HFCA 4HWHA 1R77A 2VQFT 2CH4A 2MI6A 3FB9A 4YJ3E 5JR9B 2WACA 1MMDA 4HGAA 1NENA 3FHNA 3UWNA 4B6MA 4YSXA 2BKDN 2DHRA 1VCTA 5HK0A 1U5PA 3UUXB 3AE7A 2HSEB 2MWOA 4J9EA 1QWFA 3P50A 4E6RA 4CN1A 2ACZA 2YEVC 2X0HA 3JAEA 3CCLA 3ER0A 3AE8A 3EG3A 3AEAA 5LHIB 4OVAA 3V8JA 3Q5DA 3RPUA 1NPPA 4X64T 1YXRA 2M51A 3UUMA 2KMFA 3LJCA 1UHFA 2EQMA 3HA4A 2HHHT 2L89A 4CC2A 4UVCB 3M4YA 4F7UE 2PUKB 4HA8A 1TXQA 2XICA 4BY6B 3GOXA 4RCBA 2VL0A 4I50E 1OEBA 3NPFA 2JW4A 4QQDA 1QKXA 4O8SA 2DLPA 2NWMA 3AXJA 5AQMB 3LFMA 8ATCB 1VYTA 1WHJA 4KHPT 1HTJF 1YIJT 4C5IA 2WP9A 3IHRA 2UUBT 1PCXA 2LT1A 1Q82R 5HXEA 4XQ3A 4RUGA 5HXCA 3MP6A 3C12A 4WBNE 2NUZA 5CAIA 5L3EB 1Q7YR 2DTOA 4L5GA 1RI0A 2XAFB 3AE2A 2XD0A 2ZCFB 3I9QA 1R8OB 1VQ5T 2JIWA 3OBVE 4F7UF 1PKSA 2K3WA 2B86A 2KT1A 3P8BB 1YJWT 3PUZF 2E3IA 4Q25A 5LJ3d 3UUBA 2QQAA 1VQLT 1QQJA 3U3IA 1DJ7B 4EZHA 4KULA 2LQNA 2BVMA 4NXMT 1VQ7Q 5LJ5g 5IWAT 2E10A 3H0FA 3SWNA 3OYEA 3NBXX 3RH3A 2FZCB 4F16A 3E2UA 2QQBA 1WJQA 4ZEYA 3Q5XA 2CP5A 3VU3C 4F7UG 4OGEA 2CP7A 3LK2B 4M7DD 1N32T 1DU2A 5KYYA 3ME9A 2CA5A 5GMKi 1NWMX 4U31A 4HFIA 4TWDA 1GCQA 3F57A 1E7PA 2KYMA 2JXBA 2WSEE 3CC4T 4DOVA 3TLVA 3NMZC 2QYZA 2EJFA 2QG9B 3JRZA 2I0MA 1Q86U 4YTMA 1N8RC 7AT1B 2X51A 3UU3A 3LDQB 3AXJB 5GMKj 3OYHA 1RAAB 3C4SA 3AHUA 3I56A 2E9XA 1QP2A 2XI9A 4AFSC 3EUHA 4CXXA 4ZZBA 2F2WA 2Y4YA 3LGLA 4F17A 2VVSA 3JSCA 5LJ5f 5LJ5e 3JAFA 4IL9A 2BIVA 4LXCA 2KINB 2LM2A 1V76A 2K5LA 2XPKA 3ABVA 4KH0B 2G0UA 5KE3A 1SRMA 4ILUA 1WJSA 4MDXA 2LHNA 2G6FX 5FY0A 2L0AA 2L9QA 4A4GA 5GANj 2D8JA 2X4WA 1QMCA 3ZCJA 3CMAA 2PG8A 2N9DA 1WLXA 4O2AE 4J5YA 4OMMA 5CVIA 1VQ9T 5CA0E 2LX9A 3L2ZA 1VQNA 3ZEHA 3JADA 3P4SA 5L3FB 1Y71A 3N2OA 2I0NA 1S35A 1BB9A 1M5Q1 2YRDA 4C0FA 4AKGA 2YHTA 3SWNB 3GP8A 3EFOA 1OEDC 2COWA 3TEEA 4F7UA 4MLKA 1TG0A 2X9WA 1R0CB 2B1EA 3H9NA 2DETA 3CCMT 1XDPA 4DV4T 2KY9A 5CKFA 1T0JA 2HN1A 2DD4A 5KYYB 1YI2A 2XM1A 1KFZA 2GFUA 2EHOD 3ZLIA 2M02A 4LUDA 1AT1B 3G4SA 1GRIA 1KK7A 2YU1A 4NXNT 4PLLA 1YHQA 4X62T 2FPFA 1M1KU 3VU7H 3IBPA 4ATOA 3NTHA 3JCMV 3QK6A 4O4JE 4YFSA 2ZM6T 2E5VA 4U7YA 2WCAA 4N0AC 2ZPIB 1YNZA 4OFZA 4XU1A 4Z8AA 3DB3A 3REAB 2V7IA 2BS4A 3ZT5A 2QGFB 4P1NA 1G8XA 4LMKA 2C5JA 2E9XB 3P8DA 1MIYA 3KFWX 4GYSA 5ABGA 2UXDT 3CIRA 4ZXLA 3VS4A 4KGXB 1GBQA 2BUDA 4HVUA 1JBMA 3H41A 3RHWA 2KMTA 5CKDA 4ELYC 2DJQA 1UHCA 2UXCT 1VQKQ 4M75E 2QEXT 3JB9H 5F3JA 2R5AA 1OQKA 3P8CD 4HVWA 2CLYB 1T98A 1YITT 1UG1A
chains in the Genus database with same CATH topology
4X1VA 2GGRA 1NAFA 5HXSA 1YWOA 5LP6E 2EVRA 2V26A 4AG1C 2Y8DA 2XAHB 3O5ZA 2HPLA 1T3SA 2MOXA 3I5SA 5FXXA 3ULRB 4MFRA 1YCSB 5JQGE 4HVVA 1OWAA 4AKHA 2YUOA 1HCIA 2OAWA 3F31A 3TSZA 3CMLA 4NUUA 5AFUL 2DBMA 3H0HA 2K3BA 4TN7B 1SA0E 3A98A 3M0SA 3SOLA 4UF0B 1HFAA 4A56A 2KNBB 2MIOA 2J06A 4CC7A 2CUDA 2DL8A 2D0UA 1AEYA 2JM8A 2DI4A 2EQIA 2F2XA 3FXEB 4JZ4A 2H7OA 4LNPA 1NM7A 3I0OA 3AA0B 1E6HA 3DJBA 1ARKA 2KBTA 2I59A 3UA7A 4IE7A 2QA7A 3RC8A 1HJDA 2LZ6B 3VHLA 5FMNA 3ZYMA 4G2AA 2NWBA 4EOZB 3DP7A 3LH5A 4ZI7E 3FB2A 2DRMA 2V1RA 1FEWA 4XZCA 2KROA 4AKLA 1VYUA 2J6FA 4AG2C 1CKAA 3NZQA 2VKOA 4U74A 2LOPA 2KRMA 2A28A 4J9GA 2CXDA 3C0CA 1U06A 4H9PC 2MYSA 4J9CA 4PFOA 3QC9A 3ZJ2A 2JS0A 3HKDE 2D5UA 2CT3A 4QWNB 4UELA 4AQGA 2W10A 3A5XA 3AAIA 2L3LA 2YDLA 3NRXA 4H9QC 3E22E 5JDHA 1SSHA 5F8PA 1ZV4X 1ZUYA 4QHOA 4H9RC 5LHGB 1US7B 1K4US 4WW0A 4OYKA 2VASA 4OHFA 2ENMA 4UEMA 2WM9A 3J7Yq 1YN8A 2OI3A 2ROLA 2WMNA 3U78A 5JDLA 4UV8B 2NTXA 2A08A 3N9LA 1BR0A 2W00A 4IE6A 2V7KA 3Q2MA 4IIMA 5LA6E 3D0TA 3ZC1A 3AVSA 3TSWA 2XMFA 1Z9ZA 1AJ3A 2JQQA 1I07A 4M4ZA 3E0ZA 1X2QA 1WRDA 5FYMA 3N9NA 3BQIA 2NW9A 5L3BB 2WBLA 3UATA 2CREA 1HX8A 2BZ8A 2A37A 5DJQC 2Q9QA 1UECA 5LGTB 2DVJA 5FP3A 3ESLA 5IHNA 1RLQC 4ZHQE 5HXRA 2IAKA 2XUEA 2GNCA 2X3WD 4LN2A 2FPDA 2XASB 1H92A 3EDUA 1GFCA 3IF8B 2NW7A 2HPJA 4C90A 3C50A 4O4LE 5LNKA 1K0SA 3ZC0A 1HD3A 3O1JA 2ZMAA 2W0ZA 1ZX6A 4JJCA 1M3BA 2N2NA 2LE8A 1YD8G 3N2KE 2O31A 2X9YA 3UULA 2DWGA 2LP5A 3K8PC 5IXFA 2KNDA 1WLPB 2AKLA 3N5LA 3FBZA 5FXVA 2KT8A 5M4YA 3KFVA 4GYRA 3S4UA 2EKHA 1D0XA 5A1LA 3TKLB 1KSWA 4C91A 4F6RC 1U3OA 2BTTA 4CC3A 1WYCA 4H9SE 2JMAA 4AFQC 2CCQA 3THKA 1VOMA 3R6NA 1Y57A 2X68A 3B13A 3V5SA 1JO8A 3N9MA 3AVRA 1LCKA 2LJ0A 1QSDA 3MXZA 1D0ZA 2C0TA 2CH4W 2EBPA 3PU3A 4B6XA 2IC6A 2CWYA 4MALA 2NW8A 1JQQA 2W62A 1AOJA 1UX5A 3ZN1B 1OOTA 5FWCA 3EDVA 2FEIA 1PHTA 4X1KE 2PFVA 3C4ZA 4PJMA 1D1BA 5LOVE 3Q5WA 2DL3A 1M27C 4AI6A 4R0KA 3MJXA 1H7CA 1TUDA 4MHCA 2JS2A 4IHJE 5DQVA 2K48A 1S94A 1QLYA 4RTWA 2F2VA 1SPKA 1YP5A 2CE7A 1NYFA 3OKQA 1UX4A 2GQIA 1AWXA 1ZEEA 5LBQB 5EK4A 1X43A 2L3QA 1PNJA 4ZI3C 4ZI2D 3NGPA 4HEAA 4H9NC 3WAJA 4EIWA 2ODVA 2RQUA 4LE9A 1ZLMA 5LJMA 2CXFA 2WAUA 3KBUA 4EZ4A 2RQRA 3UFEA 4ESRA 3ETVA 4CXWA 4H63H 2AZSA 3I9YA 1B7TA 4AKRB 1M3CA 4KBMB 2JTEA 1KIKA 5DQWA 2EHOC 2ABLA 3GWHA 4JJBA 2X0LB 3ZN0B 2VWAA 2J7IA 2QGSA 5L3DB 3CQGB 4Z88A 3JC6D 4JEHB 5ECAA 1U5SA 3GBQA 4RTTA 4M1PA 4HXJA 1NLPC 5CA1E 2RQWA 2KZ7B 1B07A 1SHGA 1BR2A 4UVBB 3RX6A 1JU5C 2KLQA 3RYCE 4KRTA 3ZMVB 3U23A 1SRLA 5KMGP 3CX6B 2X66A 5HCKA 4PK5A 4EB6E 1VA7A 2LSIA 3VS1A 1RLPC 1SHZC 2DL7A 3ZMUB 4E7ZA 2J6OA 1WXTA 1AWJA 3RNJA 1YW0A 2A72A 3EHQA 2LX7A 4V1Av 2CUBA 3RC3A 2W63A 5LCYA 3UT5E 1Z0PA 4WNKA 4RTZA 2VK9A 4UVAB 1GL5A 2FPEA 4G63A 4YJ2E 3NHNA 1NEGA 4PJLA 1YWPA 3LK42 3MK7C 4TX5A 2X9HA 2K9GA 4EYYR 2BZBA 2CT4A 2EGCA 5GJWB 3ETUA 2Q9QC 1IJ5A 2M67A 5KDMC 3KV6A 3C4WA 4IIOA 2N1GA 4H9OC 3ZPOA 2AKKA 3AA7B 2VKDA 3EHRA 2LCSA 2JPFA 3MA9A 1J3TA 1IZNB 1UJYA 4BAYB 3I9WA 5FNVE 4RTXA 2ZM2A 2PZ1A 4QX8B 3RRCA 1ZKEA 1JXMA 2C5KT 5IHIA 1HF8A 1ABOA 2DL4A 2DNUA 1AVZC 3PTRB 2E8IA 4GLMA 3AB3B 2EYXA 3ONXA 1NG2A 5EK3A 2JM9A 5KX5E 1IO6A 2IW5B 1W6XA 4ASKA 4F14A 2WMOA 5FY7A 4ZS3A 2D0TA 2CSQA 2KXDA 2W61A 5FY1A 3UA6A 2L8KA 3AAAB 3N9QA 3RRWA 1ABQA 2KRSA 2KXPB 2YK0A 2A36A 3CQCB 2W0GA 5TAOA 2X9XA 1Y0MA 1K76A 3SS1A 5LGUB 2LJLA 1A0NB 3HI2A 3LK3B 4YHJA 4E7SA 4NUVA 5HWXA 1I0CA 5IXBA 3H3AA 1AWOA 3WI3A 2Z6EA 2AK5A 1M8MA 2ZM0A 4JPBW 2EHOA 1UTIA 2LOSA 4I4TE 2GBQA 3J9X1 2J1DG 2HSPA 1XOVA 3H0IA 4PW8A 2X3XD 5IHYA 1AWWA 1WIEA 3N9OA 1B3QA 4CI1B 4ZNXA 2X67A 4D8DA 2Y6XA 4L0RA 3RYHE 1CKBA 4IE0A 2NOXA 4UV9B 2CXLA 5IH2A 4ISTA 5DABA 4HCKA 3H37A 5EZYE 2YUPA 5JDNA 3QWYA 2XHEB 2LSGA 1VRBA 2EHOB 2HEQA 3ZJ1A 4AFUC 4PNIA 4DEXA 4QXBB 3GN5A 2MTQA 3GA8A 2MCNA 1MIVA 3HKEE 5JDMA 2KT9A 1NLOC 4PK6A 2C0IA 1FYNA 4ORZA 3UUNA 2DLRA 4HN9A 4TUYE 1ZBJA 2ACXA 2LSKA 3FJ5A 1ZSGA 4ZOLE 2DYBA 5LYJE 5LXTE 2CSIA 3LG7A 1T0HA 4GIWA 5JH7E 3I35A 4QXCB 2LHRA 2BZXA 2LSYA 5ADXL 4Z8XA 1I1JA 3CX8B 4AXPA 1X27A 3GN5B 2A3DA 5L3GB 2DL5A 4ISSA 5JDFA 1HG5A 2LT3A 2DE0X 5J2UE 1PRMC 4PJNA 1MV3A 3CX7B 3O1IA 2KRNA 4X1YE 2GK9A 3SHWA 3C64A 4JJDA 3VS2A 2JRKA 3HKCE 1GCPA 5JDGA 2EYWA 1MMAA 1V9DA 5JDQA 4DNDA 2H8HA 2BDEA 1BK2A 1QKWA 2KE9A 4QKNA 1N5ZA 3R84B 4PK4A 3ANWA 1HSQA 5IYZE 2Q9QB 2FG0A 2P4RA 2CDTA 1HS7A 2LQWA 2HCKA 3SRZA 4ANJA 4DVDA 2MBGA 2DA9A 2KGTA 3BK9A 4ZI2C 2LMJA 2D0NA 3E08A 5C8YE 3B57A 1OV3A 4DMWA 1X2KA 1V1CA 3QWXX 1AZGB 5H6RB 1WFWA 5ETWA 4CC4B 2E9XD 5J2TE 2ED0A 2HH7A 2V7LA 3CVRA 5EC7A 3EG1A 5LG4A 1YKHB 2O9SA 5FXZA 2DBKA 2VWFA 1H3HA 4QX7B 5LGNB 2IIMA 2IC9A 5EK2A 4AKIA 4N78D 2WWUA 1OPKA 3CQXC 3NRYA 4IE5A 2JJ9A 2EYYA 4CXYA 4BJMA 1D1AA 1JEGA 1UUEA 2D1XA 4BA9A 2EPDA 1D1CA 3K3QC 4K11A 4DMVA 4HE8A 2K7AA 5J1GA 3JC6C 2ZLYA 2O2OA 1AD5A 3EG0A 4Z89A 5GONE 3CPZA 2XQYA 3PUSA 4RTVA 2O9VA 5L2LA 2OJ2A 2C0OA 2YT6A 2UXNB 3WAKA 2OA5A 3FBLA 3REBB 1RUWA 1RI9A 1FMVA 5HWYA 2YU2A 1CUNA 3DTOA 2RQVA 2Y48B 5LJNA 3OYXA 1WI7A 4HFVA 1LRZA 1PWTA 1W70A 3CWZB 1D0YA 2PTKA 3VRYA 3UTKA 4X1IE 1MMGA 1JXOA 2XAGB 4P09A 2VKJA 2KXCA 3O4XE 4J9IA 4O2BE 4I43B 1NYGA 1MNDA 1EZ3A 1EFNA 2DM1A 4K0UA 2UXXB 3C4XA 3P7IA 4RTUA 3O1HA 1WXUA 1UJ0A 4KP3C 3RKOA 3BQLA 2H7VC 3VS5A 2V1QA 4J2CA 1X79A 4WCIA 1Z9QA 3EG2A 3PU8A 3EVYA 4D8KA 1UFFA 4PJJA 4XAXB 1IJ6A 5E0OA 2DMOA 3VS7A 4JZ3A 2JMKA 2D2SA 4ZI3D 1VYVA 4DEYA 4HTEA 2M0YA 5IHKA 2HDAA 1UCUA 4OMPA 4MBQA 3K3NA 4U72A 2FO0A 3RYIE 2K79A 2RMOA 2EGAA 3GMIA 5H6QB 4LUEA 4FJOA 2WSSV 3IQLA 1PRLC 5L3CB 2VKHA 2K2MA 2L2PA 5HYAA 2RPNA 1LKXA 1BR1A 2PNIA 3I5RA 1GBRA 2QDLA 4AFZC 4IGUA 3PDYA 5JREA 1WDXA 3M65A 4DBRA 4UXNB 2JMCA 2RN8A 4ZS2A 4UF0A 2VKNA 1E6GA 2L3PA 3SWHA 4KMCA 3VS6A 3QUJA 5I22A 3ZEFB 4RTYA 3IEEA 3PVLA 1WR6A 1X6GA 3UF4A 1MMNA 2C0SA 4A63B 2RP4A 3W15B 3I1AA 2GTJA 3L09A 2EGEA 4J9DA 2CWOA 3AA6B 1BU1A 1K0XA 3C51A 3HKBE 2GTOA 4IE4A 1E7OA 1T98A 4PAGA 3O9XA 2LJ3A 4AQFA 3F2EA 4KUMB 4J9FA 2MOZA 4WBOA 3ZCIA 3VRZA 1FMWA 5JVDE 2DCFA 4CI2B 1FIOA 2XAQB 1IAPA 1W1FA 2FRYA 2SEMA 4I55E 4ERRA 4OMOA 1HG2A 2DF6A 1X6BA 1M3AA 3PUQA 1KJWA 4TZ4C 4OMQA 5FWBA 4Y92A 3RBBB 1SHFA 1H8KA 2DILA 3ZYKA 4EYUA 4EIKA 2XAJB 5JR9C 2D8HA 2Q9QD 4XBFB 1WYBA 5HXHA 1Y64B 2FRWA 5FW9A 5BMVE 1SEMA 2NTYA 3M0TA 3BQKA 3PUGA 4PFPA 3AA1B 4DO0A 5CB4E 2RA1A 1UGVA 1BR4A 2VL8A 1K9AA 4OMNA 3KVBA 4OMLA 1WX6A 4QXHB 2YUQA 2K9AA 4HKAA 3AAEB 3MACA 5GJVB 3ZMSB 2EYZA 4GK0E 3HR0A 3VKGA 1O3XA 3Q9DA 2RQTA 3M0UA 3VKHA 5HAXA 4OK0A 4CI3B 3KVAA 3T8OA 1WYXA 3CKDA 3NZPA 2J05A 4J9BA 2BZYA 3I0QA 3EGUA 4L9IA 3HL6A 4JEUB 2KYBA 4IDZA 1K1ZA 4GBQA 4H63V 1WA7A 2AZVA 1LVFA 2ZM8A 3KINB 4BJNA 2DX1A 1ZHCA 2KEAA 2LSJA 2KWHA 2V1DB 1MUZA 2VB6A 2VVKA 2SPCA 3PVQA 2KWIB 4P0BA 2P9BA 1M30A 5L23A 3KBTA 2ES0A 1ZUKA 3ZL7C 2PJQA 1AZEA 3MKDA 1PKTA 2J6KA 2V7MA 1MV0B 1G73A 3KDSE 1YKEB 2DNXA 1LVKA 4JLEA 3KV5A 2CMRA 2XTLA 2E5KA 1TUCA 1U4QA 2ESWA 3SEMA 2O88A 3OYZA 1GCQC 4DBQA 3FXDB 2JMHA 2RF0A 2EW3A 3ZMZB 3N2GE 3PE0A 4FSSA 2YINA 4TV8E 2E9XC 4FI5A 1CSKA 2C5IT 2ODUA 2V7JA 4GK5E 4OYJA 2LNHB 5LBMA 2RNAA 3OJAA 4UIGA 2K5BB 3N9PA 1NEBA 2CLYC 3JV3A 1WXBA 1X69A 3RYFE 2CEAA 4IIJE 4QT7A 3L3PA 2KR3A 1KNZA 5I11A 3ZMTB 4ADZA 2ECZA 1G2BA 1UDLA 3M0RA 3V5UA 1G83A 4EAHA 2DRKA 1MNEA 3VS3A 3KV9A 2LEHA 1OXZA 1BBZA 2ROTA 2LM9A 5JRCA 2BVLA 3M0QA 3LBXA 1MIWA 3K3OA 3KV4A 4CZZB 4EXTA 1GFDA 3PURA 2JT4A 5JR9A 2SRCA 1QUUA 1E1HB 2CM0A 1OPLA 2L3SA 2PBIA 2H3RA 2HBWA 2A2FX 1UE9A 1QWEA 4GOUA 3PUAA 4J9HA 3ANWB 1QCFA 4TV9E 5FXWA 4AQFC 2LJ1A 3ZYLA 3MZKB 2YUNA 1FMKA 2NP9A 4YLHA 1S1NA 4CQIA 5JRCB 4X20E 2K6DA 2DWKA 3VS0A 5LHHB 4O4IE 3LBXB 4JUYA 3M0PA 2ED1A 4P0AA 3TVTA 3C98B 4O4HE 3CQTA 1T3LA 2K24A 2YSQA 2CH4A 4YJ3E 5JR9B 1MMDA 4HGAA 3FHNA 2DHRA 1U5PA 3UUXB 4J9EA 1QWFA 4E6RA 2YEVC 3EG3A 5LHIB 3RPUA 2M51A 3UUMA 2KMFA 3LJCA 1UHFA 4CC2A 3HA4A 4UVCB 4I50E 1OEBA 3NPFA 2JW4A 1QKXA 4O8SA 2DLPA 2NWMA 3LFMA 1VYTA 1HTJF 3IHRA 5HXEA 4RUGA 5HXCA 4WBNE 2NUZA 5L3EB 4L5GA 2XAFB 3I9QA 3OBVE 1PKSA 2B86A 2KT1A 3U3IA 4EZHA 2LQNA 2BVMA 3H0FA 3NBXX 3RH3A 4F16A 3Q5XA 3LK2B 2CA5A 1NWMX 1GCQA 2KYMA 3F57A 2JXBA 3NMZC 2X51A 2E9XA 4AFSC 3EUHA 4CXXA 2F2WA 4F17A 2KINB 2G0UA 1SRMA 4ILUA 2LHNA 2G6FX 5FY0A 2L0AA 2L9QA 2D8JA 3ZCJA 2PG8A 4OMMA 2N9DA 1WLXA 4O2AE 5CA0E 5L3FB 3N2OA 2I0NA 1S35A 1BB9A 4AKGA 4MLKA 1TG0A 2X9WA 2B1EA 1T0JA 1KFZA 4LUDA 2EHOD 3ZLIA 1GRIA 1KK7A 2YU1A 2FPFA 3VU7H 3IBPA 3QK6A 4O4JE 4YFSA 1YNZA 4OFZA 4Z8AA 3REAB 2V7IA 1G8XA 2C5JA 2E9XB 1MIYA 3KFWX 4GYSA 3VS4A 1GBQA 4HVUA 3H41A 2DJQA 1UHCA 5F3JA 3P8CD 4HVWA 2CLYB 1ZUUA 1UG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQT A;  3M0U A;  2AZS A;  4X1V A;  2GGR A;  2H8H A;  1BK2 A;  1QKW A;  1M3C A;  2KE9 A;  1YWO A;  1N5Z A;  2EVR A;  4AG1 C;  3O5Z A;  1HSQ A;  1T3S A;  2FG0 A;  1WYX A;  2JTE A;  2MOX A;  2P4R A;  3I5S A;  1KIK A;  3ULR B;  2J05 A;  2CDT A;  4J9B A;  1YCS B;  2ABL A;  2BZY A;  3EGU A;  2LQW A;  4HVV A;  2HCK A;  4JJB A;  2YUO A;  2OAW A;  2KYB A;  2DA9 A;  1K1Z A;  3TSZ A;  2KGT A;  4GBQ A;  1WA7 A;  2AZV A;  2DBM A;  3H0H A;  2K3B A;  2J7I A;  2D0N A;  2LMJ A;  2DX1 A;  1OV3 A;  2KEA A;  4Z88 A;  3A98 A;  3M0S A;  1X2K A;  1V1C A;  5ECA A;  1MUZ A;  1U5S A;  3QWX X;  1AZG B;  2VVK A;  3PVQ A;  3GBQ A;  2KNB B;  1WFW A;  4RTT A;  1M30 A;  4CC4 B;  5L23 A;  2MIO A;  4HXJ A;  1NLP C;  2J06 A;  4CC7 A;  2ED0 A;  3KBT A;  2CUD A;  2RQW A;  1B07 A;  2DL8 A;  1AEY A;  2JM8 A;  5EC7 A;  2EQI A;  2F2X A;  3EG1 A;  4JZ4 A;  1SHG A;  1ZUK A;  3ZL7 C;  2O9S A;  1JU5 C;  1AZE A;  2DBK A;  2VWF A;  4LNP A;  1NM7 A;  1H3H A;  4KRT A;  1PKT A;  3U23 A;  1SRL A;  2IIM A;  2J6K A;  1E6H A;  5HCK A;  1MV0 B;  1ARK A;  1OPK A;  2KBT A;  1VA7 A;  2E5K A;  1TUC A;  3UA7 A;  3VS1 A;  1RLP C;  2EYY A;  2DL7 A;  1HJD A;  2J6O A;  1JEG A;  2LZ6 B;  2ESW A;  1UUE A;  2D1X A;  3SEM A;  2EPD A;  1WXT A;  1AWJ A;  4K11 A;  2O88 A;  3RNJ A;  1GCQ C;  3LH5 A;  2K7A A;  5J1G A;  2RF0 A;  2EW3 A;  1AD5 A;  2O2O A;  3EHQ A;  2LX7 A;  2DRM A;  3EG0 A;  2CUB A;  2V1R A;  4Z89 A;  3PE0 A;  4FSS A;  1ZUU A;  2KRO A;  4RTV A;  2O9V A;  1VYU A;  2J6F A;  2OJ2 A;  1CKA A;  4AG2 C;  4RTZ A;  2C0O A;  2YT6 A;  1CSK A;  1GL5 A;  2FPE A;  2KRM A;  2A28 A;  3REB B;  2LNH B;  1RUW A;  2RNA A;  3NHN A;  1RI9 A;  4J9G A;  3C0C A;  1NEG A;  1NEB A;  3JV3 A;  1U06 A;  2RQV A;  1WXB A;  1YWP A;  4J9C A;  2CT4 A;  2K9G A;  1X69 A;  1WI7 A;  2EGC A;  5GJW B;  2JS0 A;  4QT7 A;  2KR3 A;  1PWT A;  1W70 A;  5I11 A;  2ECZ A;  2CT3 A;  2PTK A;  3VRY A;  1G2B A;  1UDL A;  3M0R A;  2W10 A;  4IIO A;  1G83 A;  1JXO A;  2DRK A;  2YDL A;  2AKK A;  3VS3 A;  3EHR A;  2LCS A;  2KXC A;  1SSH A;  1BBZ A;  4J9I A;  2ROT A;  1ZUY A;  1J3T A;  1NYG A;  1UJY A;  3M0Q A;  1K4U S;  1EFN A;  2DM1 A;  4RTX A;  4RTU A;  2PZ1 A;  1WXU A;  1UJ0 A;  2ENM A;  1JXM A;  5IHI A;  1GFD A;  1ABO A;  2DL4 A;  2DNU A;  1AVZ C;  3VS5 A;  2JT4 A;  2V1Q A;  2SRC A;  4WCI A;  1OPL A;  1YN8 A;  1Z9Q A;  2L3S A;  4GLM A;  2OI3 A;  2ROL A;  2EYX A;  3EG2 A;  4D8K A;  1NG2 A;  2HBW A;  2JM9 A;  1UFF A;  1IO6 A;  1W6X A;  1UE9 A;  2DMO A;  3VS7 A;  2A08 A;  4F14 A;  1QWE A;  4J9H A;  2CSQ A;  2KXD A;  1QCF A;  2LJ1 A;  3UA6 A;  4IIM A;  4JZ3 A;  2KRS A;  1ABQ A;  3TSW A;  2XMF A;  2YUN A;  2A36 A;  1FMK A;  1S1N A;  1Z9Z A;  1VYV A;  4DEY A;  1Y0M A;  1K76 A;  2M0Y A;  5IHK A;  1I07 A;  4M4Z A;  1X2Q A;  2K6D A;  3VS0 A;  2HDA A;  4OMP A;  2FO0 A;  3M0P A;  1A0N B;  2K79 A;  3UAT A;  2ED1 A;  2CRE A;  2RMO A;  2EGA A;  2BZ8 A;  2A37 A;  3TVT A;  4LUE A;  1UEC A;  3CQT A;  3IQL A;  1PRL C;  1T3L A;  1I0C A;  2YSQ A;  5IXB A;  1AWO A;  2CH4 A;  2DVJ A;  2K2M A;  5IHN A;  1RLQ C;  2L2P A;  2RPN A;  2AK5 A;  1M8M A;  2IAK A;  2PNI A;  3I5R A;  1GBR A;  2GNC A;  4J9E A;  4JPB W;  2X3W D;  1QWF A;  4E6R A;  4LN2 A;  2QDL A;  1UTI A;  4AFZ C;  2FPD A;  3PDY A;  2GBQ A;  3EG3 A;  1WDX A;  1H92 A;  3EDU A;  1GFC A;  2M51 A;  2RN8 A;  2JMC A;  1UHF A;  4CC2 A;  2HSP A;  2VKN A;  1E6G A;  2L3P A;  1XOV A;  3H0I A;  3VS6 A;  3NPF A;  1OEB A;  2X3X D;  2JW4 A;  5I22 A;  1QKX A;  1AWW A;  2DLP A;  2NWM A;  4RTY A;  1K0S A;  1WIE A;  3PVL A;  1HD3 A;  1X6G A;  3UF4 A;  1VYT A;  1B3Q A;  4A63 B;  2W0Z A;  1ZX6 A;  4JJC A;  1M3B A;  4ZNX A;  2GTJ A;  4D8D A;  2O31 A;  2EGE A;  4RUG A;  4J9D A;  2NUZ A;  2LP5 A;  5IXF A;  1BU1 A;  1WLP B;  1K0X A;  2AKL A;  1CKB A;  3I9Q A;  2KT8 A;  1PKS A;  2B86 A;  2KT1 A;  3KFV A;  2GTO A;  1E7O A;  2EKH A;  2LQN A;  5IH2 A;  1KSW A;  4HCK A;  3H0F A;  2YUP A;  2LJ3 A;  4F16 A;  1U3O A;  2BTT A;  3QWY A;  4CC3 A;  4J9F A;  2HEQ A;  3VRZ A;  4AFU C;  2JMA A;  4AFQ C;  1GCQ A;  2KYM A;  3F57 A;  3THK A;  4DEX A;  2JXB A;  3NMZ C;  3R6N A;  1Y57 A;  1W1F A;  1JO8 A;  2MCN A;  1LCK A;  2FRY A;  2SEM A;  2LJ0 A;  1NLO C;  4AFS C;  4OMO A;  2C0T A;  2CH4 W;  2DF6 A;  2EBP A;  2F2W A;  2C0I A;  1X6B A;  1FYN A;  4ORZ A;  4F17 A;  1M3A A;  1KJW A;  1JQQ A;  4OMQ A;  1ZBJ A;  5FWB A;  4Y92 A;  1AOJ A;  3RBB B;  3FJ5 A;  1SHF A;  1SRM A;  1ZSG A;  1H8K A;  1OOT A;  2DIL A;  2G6F X;  5FWC A;  3EDV A;  2DYB A;  2L0A A;  2FEI A;  4EIK A;  1PHT A;  2D8J A;  4OMM A;  2CSI A;  2D8H A;  1T0H A;  2DL3 A;  1M27 C;  4R0K A;  2I0N A;  1BB9 A;  1TUD A;  2JS2 A;  1TG0 A;  1QLY A;  3I35 A;  4RTW A;  2FRW A;  2F2V A;  1SPK A;  1T0J A;  1YP5 A;  5FW9 A;  1KFZ A;  1NYF A;  4LUD A;  1SEM A;  2BZX A;  1GRI A;  2GQI A;  3M0T A;  2FPF A;  1I1J A;  1AWX A;  1X27 A;  1UGV A;  1X43 A;  1YNZ A;  2L3Q A;  2DL5 A;  4Z8A A;  3REA B;  1PNJ A;  1K9A A;  4OMN A;  3NGP A;  1G8X A;  2DE0 X;  1PRM C;  1MV3 A;  4OML A;  1WX6 A;  2YUQ A;  3VS4 A;  2KRN A;  1GBQ A;  4HVU A;  3H41 A;  2RQU A;  4LE9 A;  5GJV B;  2EYZ A;  3SHW A;  1ZLM A;  1UHC A;  2DJQ A;  4JJD A;  3KBU A;  2RQR A;  3VS2 A;  4ESR A;  4HVW A;  1GCP A;  2EYW A;  1UG1 A; 
#chains in the Genus database with same CATH topology
 2QVA A;  4X1V A;  2GGR A;  4O6J A;  3TLS A;  1VQP A;  1NAF A;  5LMN T;  5HXS A;  1VQ4 Q;  3F70 A;  1YWO A;  5LP6 E;  1K8A C;  4LF9 T;  2EVR A;  2I6H A;  2V26 A;  1Q86 R;  4IDP A;  5AQP B;  4AG1 C;  2Y8D A;  2XAH B;  3O5Z A;  2HPL A;  3OQ5 A;  3M3Z B;  1I94 T;  1T3S A;  2D0Q B;  2MOX A;  3I5S A;  5FXX A;  2E1H A;  1RAG B;  3EFO B;  2DTH A;  3ULR B;  5AQL B;  4MFR A;  4YHH T;  1VIF A;  4B3S T;  2W67 A;  1YCS B;  2RJE A;  2OLT A;  2QAZ A;  5JQG E;  4DR2 T;  1PC0 A;  2GFA A;  2I2L A;  4HVV A;  1OWA A;  4C92 C;  4X34 A;  2P4T A;  4AKH A;  2YUO A;  1HCI A;  2OAW A;  4Y91 A;  1KQS P;  8AT1 B;  3F31 A;  4M75 F;  2FB7 A;  4JI4 T;  2VUB A;  3CXC S;  5KYN A;  4ME7 A;  2WSF E;  3TSZ A;  3CML A;  3JCM Q;  4NUU A;  1GXI E;  5AFU L;  3UQ4 A;  2DBM A;  3H0H A;  5J26 A;  2K3B A;  2LNV A;  1YBY A;  1B34 A;  2VXF A;  4TN7 B;  1SA0 E;  4XU2 A;  1QW1 A;  3A98 A;  3M0S A;  3SOL A;  2RJF A;  3CCV A;  4UF0 B;  5DLQ E;  4KHZ F;  1HFA A;  4A56 A;  2KNB B;  3HHT B;  4M75 G;  2LQK A;  2MIO A;  5GAN 2;  2J06 A;  4CC7 A;  5HK3 A;  4V2S A;  1LOJ A;  5L8R E;  2CUD A;  4ZTJ A;  2LDM A;  2DL8 A;  2D0U A;  1AEY A;  1RAI B;  2JM8 A;  2DI4 A;  1WPY A;  2EQI A;  2F2X A;  1W0A A;  3FXE B;  3S6W A;  4JZ4 A;  2LT4 A;  4MMK A;  2H7O A;  4TNV A;  3A8L B;  4OF1 A;  1KC8 R;  5FL0 A;  4HWI B;  4LNP A;  5AT1 B;  1NM7 A;  3I0O A;  3AA0 B;  3HP9 A;  3FEO A;  1E6H A;  2FJA A;  3G71 A;  3CCQ T;  3EGX B;  3DJB A;  1ARK A;  3JCM P;  2KBT A;  2I59 A;  3JB9 G;  2BKP A;  1W0B A;  2DIG A;  3UA7 A;  4IE7 A;  2QA7 A;  3RC8 A;  1HJD A;  2LZ6 B;  3VHL A;  5FMN A;  1C6V X;  2KSR A;  2FZK B;  3MEU A;  3ZYM A;  4G2A A;  5GAO p;  4II1 A;  2NWB A;  4EOZ B;  1BYM A;  3DP7 A;  3LH5 A;  3OW2 P;  1TH7 A;  4ZI7 E;  3FB2 A;  5GAM h;  1YJN T;  2DRM A;  1B34 B;  1BCM A;  3CCR T;  3HSB A;  2V1R A;  1FEW A;  5LJ3 g;  1N34 T;  4XZC A;  2KRO A;  4AKL A;  1VYU A;  2J6F A;  4M75 A;  4AG2 C;  1CKA A;  3NZQ A;  4WZX A;  3QNU A;  2VKO A;  4U74 A;  1N27 A;  2L5Q A;  2CYZ B;  2LOP A;  5HCM A;  2KRM A;  2A28 A;  2V6X A;  1QVP A;  4J9G A;  3SD4 A;  2CXD A;  1SUM B;  2WB5 A;  3C0C A;  1D3B B;  1QVF S;  3AEB A;  1CHU A;  1U06 A;  2HKQ B;  4H9P C;  3VJP A;  2MYS A;  4M7A E;  4J9C A;  3CCJ T;  4PFO A;  5CK9 A;  3QSU A;  3QC9 A;  3ZJ2 A;  3LW5 E;  3AE5 A;  3JAM E;  2BS2 A;  3JCM d;  2JS0 A;  3HKD E;  1UK5 A;  4N4G A;  4KGZ B;  1YIJ A;  4JI8 T;  2O4X B;  2BS3 A;  2CHO A;  3RKX A;  2D5U A;  4E7K A;  4DA4 A;  3EI0 A;  2CT3 A;  2RD1 A;  4QWN B;  1T8B A;  1S72 Q;  4UEL A;  4AQG A;  1NBE B;  5ABF B;  2XQ7 A;  5LJ3 f;  5LJ3 e;  2W10 A;  3X26 B;  2LRQ A;  3A5X A;  3AAI A;  2RI3 A;  4LF8 T;  4FT2 A;  3CPW P;  2L3L A;  2YDL A;  4IUU A;  1VQ5 A;  3RKY A;  3NRX A;  1YJW A;  4M7A F;  4H9Q C;  1VQO T;  1Q7Y C;  2WU5 A;  3E22 E;  5JDH A;  1SSH A;  5F8P A;  4HT8 A;  1ZV4 X;  1ZUY A;  3QYG B;  3OYN A;  4QHO A;  4JI2 T;  4H9R C;  5LHG B;  1ZHI A;  2COY A;  4AIU A;  3PNW C;  4UR9 A;  4GLK A;  5GAO l;  1US7 B;  1K4U S;  4WW0 A;  3CC7 Q;  4OYK A;  2VAS A;  2WZH A;  5AQO B;  4OHF A;  1SKU B;  1KG1 A;  5FU6 C;  1RAH B;  2ENM A;  3OYL A;  4M7A G;  2LKH A;  4NOY A;  4UEM A;  3CC4 A;  2ZPE B;  3FZL B;  2YRC A;  2WM9 A;  2V6Y A;  1MHN A;  3A8G B;  3J7Y q;  1YN8 A;  3CMA Q;  1HNZ T;  3FZF B;  2OI3 A;  2ROL A;  2WMN A;  1IRE B;  2DXU A;  3L1A A;  1WQW A;  1OED A;  3U78 A;  5JDL A;  5GMK h;  4JI6 T;  2WQY A;  4UV8 B;  2NTX A;  2A08 A;  3N9L A;  3RES A;  2RHX A;  1BR0 A;  3CEY A;  2W00 A;  3VR9 A;  2ZGW A;  1QVG P;  4IE6 A;  5HCJ A;  2V7K A;  3Q2M A;  3I55 Q;  3KBG A;  4LF5 T;  3G6E T;  4IIM A;  5LA6 E;  3D0T A;  3ZC1 A;  3AVS A;  3C94 A;  4IUV A;  4ZZC A;  1JB0 E;  4PJO C;  2X4Y A;  4C8Q E;  3TSW A;  1SSF A;  2CZ0 B;  2XMF A;  1HNW T;  3WXM B;  2FL7 A;  3OB9 A;  1Z9Z A;  5GAN h;  1AJ3 A;  3CK6 A;  1ZP0 A;  1N9R A;  4IDN A;  2JQQ A;  2DXT A;  4QH5 A;  1I07 A;  3A8M B;  2V5C A;  3VR8 A;  1TOV A;  3E0Z A;  1X2Q A;  3M57 A;  4M4Z A;  4Z02 A;  1WRD A;  1TS9 A;  5FYM A;  1VQN T;  3N9N A;  3CCS T;  3BQI A;  1VQ6 Q;  2RK1 A;  2NW9 A;  5L3B B;  4FYX B;  1AHJ B;  3CCM A;  4M7A A;  2WBL A;  3UAT A;  2CRE A;  4BI3 A;  1HX8 A;  4B3T T;  2BZ8 A;  2A37 A;  3SFD A;  5DJQ C;  5CGM A;  2KI7 A;  2Q9Q A;  1UEC A;  3CME T;  5LGT B;  2CZ6 B;  3MO8 A;  4C8Q F;  1YI2 T;  4PKC C;  2DVJ A;  5FP3 A;  3ESL A;  5IHN A;  3OSV A;  2XQ4 A;  2V6Y B;  1RLQ C;  1U1T A;  2UUC T;  4ZHQ E;  1VIE A;  2VC8 A;  2BG9 E;  4JRI A;  5HXR A;  2IAK A;  2XUE A;  4IDO A;  4DV6 T;  4FYY B;  2GNC A;  2X3W D;  4OB2 B;  5KYX A;  4LN2 A;  1BI3 A;  1OED B;  3UU6 A;  3OBY A;  4JRQ A;  3OYD A;  2HQH A;  2AE9 A;  2FPD A;  1VQM T;  2XAS B;  1RAF B;  1BI0 A;  1H92 A;  1D09 B;  3EDU A;  1GFC A;  2VUR A;  3IF8 B;  4C8Q G;  2NW7 A;  2JZ2 A;  5FRN A;  2BKO A;  2HPJ A;  1BCO A;  4C90 A;  2QEX A;  4JBW F;  2HD0 A;  1YIT A;  3C50 A;  4O4L E;  5LNK A;  2HNI A;  1K0S A;  3ZC0 A;  2OV9 A;  4JRK A;  2QA4 Q;  3RER A;  1HD3 A;  3O1J A;  4DUY T;  3SFE A;  2ZMA A;  2W0Z A;  1ZX6 A;  1XNR T;  4JJC A;  1M3B A;  4PLI A;  1PD0 A;  2N2N A;  2LE8 A;  1YD8 G;  3N2K E;  2O31 A;  1VCS A;  2X9Y A;  3UUL A;  2DWG A;  1RAE B;  2LCL A;  2LP5 A;  3K8P C;  5IXF A;  1Q86 C;  2KND A;  5C2T A;  1WLP B;  2M9U A;  2AKL A;  3N5L A;  3FBZ A;  5FXV A;  2KT8 A;  1NJI C;  4U3C A;  3VKI A;  1KD1 C;  5M4Y A;  3PIP A;  3KFV A;  4ELZ C;  4GYR A;  4HKE A;  3S4U A;  2EKH A;  1WHK A;  4HFD A;  1D0X A;  2KQW A;  5A1L A;  1OYX A;  3TKL B;  3KXT A;  1KSW A;  1WQ7 A;  5LB7 B;  1IXD A;  4C91 A;  4F6R C;  1YJ9 A;  2M6B A;  1U3O A;  2BTT A;  2F1L A;  1KNR A;  2QQ9 A;  4CC3 A;  5GAM d;  3CC2 T;  3A1P A;  4C92 B;  1IRX A;  4JI5 T;  4C8Q A;  1WYC A;  3RIF A;  4H9S E;  2IHR 1;  1W2B P;  2WDV A;  4MDW A;  2JMA A;  3QB5 A;  2FYK A;  4LDW A;  4AFQ C;  1WGS A;  2CCQ A;  3THK A;  4HCC A;  1VOM A;  1IBM T;  2P0K A;  3R6N A;  1WHM A;  1Y57 A;  2F5T X;  2X68 A;  2BE7 D;  3B13 A;  3V5S A;  1JO8 A;  3N9M A;  3QKJ A;  3AVR A;  1LCK A;  2LJ0 A;  1QSD A;  2MF2 A;  3MXZ A;  1D0Z A;  1I4K 1;  2C0T A;  2CH4 W;  2EBP A;  3PU3 A;  4B6X A;  4M77 D;  5D6W A;  1M1K C;  2IC6 A;  3JCM g;  4HFE A;  2CWY A;  4MAL A;  3HFN A;  5AQN B;  2NW8 A;  4EMK C;  3G71 T;  1JQQ A;  3OYA A;  4EED A;  5BR8 T;  4JYA T;  4A4E A;  2W62 A;  1AOJ A;  2XSB A;  1W4S A;  3OYY A;  4J8O A;  1UX5 A;  3ZN1 B;  5AQS B;  4JJN K;  3QJY A;  2BG9 A;  1OOT A;  2CPT A;  3PV0 F;  5FWC A;  3EDV A;  5F5W A;  1RAB B;  2FEI A;  1PHT A;  2CP2 A;  4X1K E;  2PFV A;  3C4Z A;  3QBY A;  4PJM A;  1D1B A;  2XZE A;  2VVN A;  1YJN A;  1WNL A;  3CCR A;  5LOV E;  3PUV F;  3Q5W A;  2DL3 A;  1OU8 A;  1M27 C;  2JTM A;  4AI6 A;  5ABH A;  4R0K A;  3MJX A;  1OZ2 A;  4LDY A;  1H7C A;  4PJO F;  1TUD A;  4MHC A;  2JS2 A;  3E1S A;  1K73 C;  2Y90 A;  2F5K A;  4DR4 T;  4IHJ E;  5DQV A;  2K48 A;  1S94 A;  1QLY A;  3UQ7 A;  3OTO T;  1ZSZ C;  4RTW A;  2VQE T;  5GAN 6;  2F2V A;  1SPK A;  1YP5 A;  5AQF B;  2CE7 A;  4KT0 E;  1NYF A;  3OKQ A;  1UX4 A;  2GQI A;  3FRN A;  3JCM c;  1XMQ T;  3EH2 A;  2R6G F;  1WCR A;  1Y7X A;  2VV5 A;  5JTG A;  1AWX A;  1ZEE A;  5LBQ B;  3JCM f;  3JCM e;  3QYH B;  2CP0 A;  4ILA A;  3BY7 A;  5EK4 A;  1OZ3 A;  4PJO G;  3ZBD A;  1X43 A;  2L3Q A;  1YJW Q;  4M77 E;  4HWD A;  1PNJ A;  3CCJ A;  1VQL Q;  1J5W A;  4ZI3 C;  2LQ8 A;  4ZI2 D;  3NGP A;  4HEA A;  4H9N C;  2H88 A;  3WAJ A;  3OYM A;  4EIW A;  3H6Z A;  2JQK A;  2FZG B;  3ZFJ A;  2ODV A;  2RQU A;  4XTZ A;  4LE9 A;  4QQG A;  1WR0 A;  3RMS A;  4QKU A;  3CXC A;  3AT1 B;  1ZLM A;  1ZOY A;  2CXF A;  2WAU A;  3KBU A;  5LJM A;  4YTL A;  4JS4 A;  4EZ4 A;  2RQR A;  1R8I A;  2W4X A;  3UFE A;  4ESR A;  3OYF A;  4M75 C;  2EQK A;  3ETV A;  2NUP A;  4F8H A;  4CXW A;  4H63 H;  2DO3 A;  2AZS A;  4K0K T;  1M1F A;  3I9Y A;  1H3Z A;  1B7T A;  2QQS A;  4AKR B;  4M77 F;  1VQO A;  1M3C A;  1WHL A;  4KBM B;  1X9B A;  1W9R A;  1YQ4 A;  2E5Q A;  5FU7 C;  1M90 U;  4COF A;  1I5O B;  1J1J A;  2A7Y A;  2JTE A;  1PG5 B;  3RGL A;  2ZPG B;  1KIK A;  3EAM A;  5DQW A;  4X66 T;  2EHO C;  1NE8 A;  2CZ7 B;  4HT9 A;  2ABL A;  3GWH A;  5KYU A;  4JJB A;  3QUI A;  5GAN d;  4EGW A;  2X0L B;  5AQJ B;  2VYT A;  5FRO A;  3FLG A;  4YY3 T;  1PSE A;  3RUX A;  4B9X A;  3ZN0 B;  4M77 G;  4LFB T;  2VWA A;  4L59 A;  4BI8 B;  4PJO A;  2RI2 A;  2J7I A;  4DV0 T;  2QGS A;  5L3D B;  3CCU T;  3CQG B;  2MAM A;  4N4I A;  4C5E A;  4DBH A;  1OX9 A;  4IT4 A;  4EMG A;  3ZT7 A;  4Z88 A;  4XTX A;  1VQ9 Q;  3JC6 D;  4L6V 5;  2RI5 A;  4JEH B;  5ECA A;  1U5S A;  3M58 A;  5C6S A;  5AQU B;  3GBQ A;  4RTT A;  4ILB A;  4M1P A;  1TU0 B;  3NTI A;  4HXJ A;  1NLP C;  5FU6 B;  3A8Y C;  5CA1 E;  1IGQ A;  2RQW A;  2KZ7 B;  1B07 A;  2NLU A;  2E6N A;  1JNZ A;  3C95 A;  1KHI A;  1SHG A;  4J6W A;  1BR2 A;  1JJ2 P;  4UVB B;  1OU9 A;  1KQS S;  3RX6 A;  1JU5 C;  3G6E A;  2KLQ A;  2WZI A;  2FJD A;  3RYC E;  2PVG B;  4KRT A;  5L4H A;  3ZMV B;  3U23 A;  1SRL A;  5KMG P;  3CX6 B;  2X66 A;  3RIU C;  3JB9 I;  1SE7 A;  5HCK A;  4E7J A;  2RH2 A;  4PK5 A;  2RHI A;  3SB2 A;  1M2V A;  4EB6 E;  2L8D A;  1VA7 A;  2LSI A;  3TRE A;  3VS1 A;  1RLP C;  1SHZ C;  3CCS A;  2DL7 A;  1KC8 U;  3ZMU B;  4M7D E;  4E7Z A;  5KYU B;  2J6O A;  3V8K A;  1M62 A;  1QVF A;  4AT1 B;  1HR0 T;  1WXT A;  4JLI A;  1AWJ A;  3X20 B;  1UEB A;  2GCX A;  3RNJ A;  1YW0 A;  4FYW B;  5DM7 R;  1KQ2 A;  3ASK A;  3V8L A;  4PJO B;  3CME A;  2MK5 A;  4NIQ A;  2A72 A;  3EHQ A;  5ABE A;  2LX7 A;  2DZC A;  4V1A v;  3GNG A;  2CUB A;  4DV7 T;  4DV1 T;  2FUP A;  4EPC A;  1ZUU A;  2EQU A;  2UU9 T;  5L4E A;  2EWN A;  2HQX A;  3RC3 A;  5GAO m;  2W63 A;  2ZPH B;  5LCY A;  3UT5 E;  4DV2 T;  1Z0P A;  4WNK A;  4RTZ A;  1M90 R;  3MEA A;  2VK9 A;  3UDC A;  2XQ5 A;  4UVA B;  3TLW A;  1NPR A;  1GL5 A;  5HEU A;  2V8S V;  1VQM A;  2FPE A;  4G63 A;  5GAN 7;  1Q81 U;  4M7D F;  5CQX A;  4YJ2 E;  3OBW A;  2RHU A;  3NHN A;  4DBF A;  3GPL A;  2CS7 A;  2OTJ A;  1GQE A;  1NEG A;  3NTK A;  4XTW A;  4PJL A;  1KHC A;  4AIS A;  2K5F A;  1YWP A;  4WYV A;  3OW2 S;  3LK4 2;  3MK7 C;  4TX5 A;  2X9H A;  2XSA A;  4A97 A;  2BZB A;  4EYY R;  1C1A A;  2CT4 A;  2HZY A;  2K9G A;  3D7S B;  4M7A C;  2K3Y A;  4A4F A;  2EGC A;  4Y28 E;  5GJW B;  3ETU A;  3UU8 A;  2CP6 A;  4M7D G;  2Q9Q C;  1IJ5 A;  3OPC A;  1IHV A;  1M8V A;  2M67 A;  5KDM C;  3VUZ A;  4ZGJ B;  2WDQ A;  3KV6 A;  4M78 D;  4A54 A;  3TLU A;  2ZZD A;  2H3E B;  3C4W A;  4IIO A;  2N1G A;  1X75 C;  3M9Q A;  4H9O C;  3EFR A;  4BDZ A;  1I8F A;  3ZPO A;  3FZK B;  2AKK A;  3RMQ A;  4F7U B;  2OTL Q;  3AA7 B;  2DTI A;  2DVE A;  2VKD A;  3EHR A;  2LCS A;  2JPF A;  5LJ5 h;  2W2U A;  3LWI A;  3GF5 A;  5GAM f;  5GAM e;  4R55 A;  4Z91 A;  3S3M A;  3RF1 A;  3MA9 A;  1J3T A;  3H3M A;  1X6O A;  4QVC A;  3JCM J;  1IZN B;  3P4W A;  1UJY A;  4LD6 A;  2WWV A;  1M7K A;  4DV3 T;  3CCQ Q;  5I2M A;  3PTA A;  2COZ A;  4BAY B;  3I9W A;  5FNV E;  3N5B B;  1OI1 A;  2YOE A;  4JI0 T;  3FZM B;  2ZM2 A;  4RTX A;  4EMK A;  3CC2 A;  4JI1 T;  2PZ1 A;  4QX8 B;  3RRC A;  1VQ8 A;  1YJ9 T;  1ZKE A;  3RKG A;  3E19 A;  3CBO A;  4VUB A;  2RPA A;  1JXM A;  2C5K T;  3DB4 A;  5IHI A;  3RQW A;  1HF8 A;  2ATC B;  2E12 A;  3AEG A;  1ABO A;  3CBP A;  2DL4 A;  2DNU A;  3CPW S;  3GIB A;  1WZO A;  1AVZ C;  4HFH A;  1RAD B;  5CFB A;  3CPF A;  4HCZ A;  3PTR B;  4J6Y A;  2E8I A;  4J7F A;  4GLM A;  1Z8U A;  1VQK T;  3CD6 Q;  2Y4X A;  2RM4 A;  4GY5 A;  4M78 E;  4M7D A;  3AB3 B;  3B5M A;  2EYX A;  3ONX A;  1NG2 A;  5EK3 A;  2JM9 A;  4JV5 T;  5KX5 E;  1IO6 A;  2CP3 A;  2IW5 B;  1W6X A;  1ZSZ A;  3X28 B;  4ASK A;  4UC4 A;  4F14 A;  2WMO A;  5FY7 A;  4JDS A;  2EIF A;  1K9M C;  4ZS3 A;  2D0T A;  2J4G A;  2CSQ A;  3EGD A;  2KXD A;  3TQ7 P;  1Q81 R;  2QGG A;  2W61 A;  5FY1 A;  3UA6 A;  2L8K A;  3AAA B;  3N9Q A;  3RRW A;  1PM3 A;  3AEE A;  1ABQ A;  2KRS A;  3CCL Q;  2KXP B;  2YK0 A;  2A36 A;  2YLC A;  3CQC B;  4C8Q C;  2DPP B;  1SF9 A;  2W0G A;  5TAO A;  4BE0 A;  2X9X A;  3PJA A;  4M78 F;  1Y0M A;  1K76 A;  3K1S A;  4ZGE B;  1UGS B;  1XNQ T;  3SS1 A;  2WY2 A;  5LGU B;  2LJL A;  3L2U A;  4EMK B;  1A0N B;  1I5L A;  1C0M A;  3RR6 A;  4A98 A;  1IHW A;  3HI2 A;  1BIA A;  3LK3 B;  4YHJ A;  1QVG S;  4E7S A;  4NUV A;  5HWX A;  4M78 G;  1I0C A;  5IXB A;  3H3A A;  1AWO A;  3WI3 A;  2Z6E A;  2R57 A;  3NWI A;  2AK5 A;  1M8M A;  5KXJ A;  2BG9 C;  2ZM0 A;  4JPB W;  2EHO A;  4C92 D;  4E7I A;  1UTI A;  2JTF A;  2LOS A;  4I4T E;  5GMK e;  1ZSZ B;  2GBQ A;  2H89 A;  3J9X 1;  1UGO A;  3ZST A;  5HKC A;  1QCO A;  4HWC A;  2J1D G;  1PSF A;  1BI1 A;  2HSP A;  3AEC A;  3EGD B;  1XOV A;  3H0I A;  1UGQ B;  4PW8 A;  4AQY T;  2X3X D;  1BKB A;  5IHY A;  1AWW A;  1FXX A;  3J7A F;  1WIE A;  3N9O A;  3HRT A;  1B3Q A;  4DR1 T;  1Q82 C;  5GAN f;  4CI1 B;  5GAN e;  2WSC E;  4ZNX A;  2X67 A;  2YLB A;  4D8D A;  1YCY A;  1QP3 A;  5GAO q;  2YDR A;  2Y6X A;  4ILC A;  4L0R A;  2RJC A;  3RYH E;  1CKB A;  3I56 Q;  4IE0 A;  3RI5 A;  2LC4 A;  3ONJ A;  2NOX A;  1F1B B;  4M75 B;  3MP1 A;  4UV9 B;  2CXL A;  5KYW A;  3V7R A;  3GLX A;  3R6O A;  2MPX C;  4OX9 T;  3CCU A;  3RLF F;  5IH2 A;  3RIU A;  4RCC A;  3S3O A;  4IST A;  5DAB A;  4HCK A;  3H37 A;  5EZY E;  5FU7 B;  2YUP A;  3UPU A;  4FT4 A;  1XNI A;  3P4R A;  5JDN A;  3QWY A;  2XHE B;  2LSG A;  1VRB A;  2EHO B;  3UFG A;  2HEQ A;  2QK0 A;  3AE1 A;  1QLB A;  1IZ6 A;  1VQN Q;  2J47 A;  3ZJ1 A;  4AFU C;  2B8A A;  2YDS A;  4Q5W A;  5AQV B;  4PNI A;  3QOF A;  3QJ6 A;  3QHS A;  2E4H A;  2GQV A;  4DEX A;  4QXB B;  2P84 A;  5AQK B;  1XWM A;  3UU5 A;  5CR2 A;  1S72 T;  3MEV A;  3GN5 A;  3X25 B;  2MTQ A;  3QZ9 B;  3AE4 A;  3GA8 A;  3ZT6 A;  1YI2 Q;  4ZGD B;  2MCN A;  2HMA A;  1MIV A;  3HKE E;  1G3Y A;  2A9U A;  2KT9 A;  5JDM A;  1NLO C;  3G4S Q;  1Y07 A;  1N9S A;  3OS5 A;  1YHQ Q;  2XQ9 A;  4PK6 A;  2XJ7 A;  2VGM A;  2C0I A;  3CCE T;  4MZT A;  1FYN A;  1ZA1 B;  2QYW A;  4ORZ A;  4A4H A;  3UUN A;  2V8J A;  3RIR A;  5A0L A;  4X65 T;  1XQH A;  2DLR A;  4HN9 A;  3M54 A;  4TUY E;  4X9C A;  1ZBJ A;  2ACX A;  3E9G A;  4NPP A;  2AXD S;  2LSK A;  1VQM Q;  1BI2 A;  3FJ5 A;  2UXB T;  1ZSG A;  1W2B S;  2DXC A;  2PUO B;  4ZOL E;  4MZM A;  2DYB A;  2JQ9 A;  5LMU T;  3PFS A;  5LYJ E;  5KYW B;  1NZ9 A;  5AQI B;  4JS5 A;  4FW1 A;  1UGP B;  2EJ9 A;  5HEO A;  5LXT E;  1U1S A;  3P4P A;  2CSI A;  2D9D A;  5LJ3 h;  2ZAE A;  3UT1 A;  1WFD A;  3LG7 A;  2YRV A;  4KUD K;  1T0H A;  4X5T A;  2WS3 A;  2R5M A;  4GIW A;  5JH7 E;  5I2S A;  1HNX T;  1UUS A;  4P5N A;  3JCM b;  5HEG A;  5CKH A;  2X0Y A;  2HKN A;  2MMP A;  4KUI A;  2RHZ A;  3I35 A;  4QQ6 A;  1VQP Q;  4QXC B;  1G5V A;  2LHR A;  2X4J A;  2XHC A;  2RHY A;  3M5A A;  2BZX A;  2LSY A;  5ADX L;  3S3N A;  3LSV A;  4Z8X A;  2KAF A;  1I1J A;  3CX8 B;  4RG2 A;  4AXP A;  1T72 A;  5IAY A;  2A3L A;  1M90 C;  3HRU A;  1X27 A;  1LPL A;  3GN5 B;  3IA3 A;  2A3D A;  3EH1 A;  5L3G B;  2DL5 A;  2LLY A;  4GKJ T;  2O01 E;  4ISS A;  4N4H A;  5JDF A;  1LJO A;  4FU6 A;  4M77 C;  1HG5 A;  2LT3 A;  3WVD B;  2OTJ T;  5A2Q E;  2DE0 X;  5J2U E;  1UUR A;  1PRM C;  4PJN A;  5AQT B;  1MV3 A;  3P8H A;  3CX7 B;  3O1I A;  2G3R A;  3FDR A;  2KRN A;  5AQG B;  1H64 1;  4X1Y E;  2GK9 A;  1UB4 A;  2NUT A;  3ZKR A;  3CC2 Q;  3SHW A;  2RK2 A;  1M4Z A;  3C64 A;  4JJD A;  3CCV Q;  3MET A;  3VS2 A;  2JRK A;  3HKC E;  4C5G A;  1GCP A;  5JDG A;  4EV6 A;  1MMA A;  1V9D A;  5JDQ A;  4DND A;  2EYW A;  2KK4 A;  1PD1 A;  1VQ6 T;  4IUQ A;  2H8H A;  2DEQ A;  2BDE A;  1BK2 A;  4M7A B;  1QKW A;  1BIB A;  2QXF A;  2KE9 A;  4QKN A;  1U8R A;  4JRP A;  1TSF A;  1N5Z A;  3R84 B;  3FJP A;  5LJ5 j;  2RO0 A;  4PK4 A;  3ANW A;  3A8O B;  1HSQ A;  5IYZ E;  2Q9Q B;  2FG0 A;  2P4R A;  2F69 A;  3P4Q A;  1IBK T;  5AQQ B;  2CDT A;  4XTV A;  1HS7 A;  2LQW A;  2HCK A;  3SRZ A;  4ANJ A;  2HN2 A;  5FKY A;  4IUR A;  3G71 Q;  1KQS A;  4DVD A;  3DLM A;  4E7H A;  2XQ3 A;  2QI2 A;  4LDX A;  2MBG A;  2M6I A;  2DA9 A;  4J7I A;  5KYX B;  2DKG A;  2KGT A;  2HL3 A;  3BK9 A;  2V5D A;  4ZI2 C;  2LMJ A;  2D0N A;  3OS0 A;  1VQ8 T;  2RA2 A;  4J6X A;  3E08 A;  5C8Y E;  3B57 A;  1OV3 A;  3EG9 A;  4DMW A;  2XQA A;  1X2K A;  2JN0 A;  3M4G A;  1VQK A;  1V1C A;  3X24 B;  4OMF B;  3QWX X;  1AZG B;  5H6R B;  3BDL A;  4A5X A;  2LTO A;  1WFW A;  3BE3 A;  5ETW A;  4CC4 B;  2QA4 T;  3QDR B;  4IDQ A;  4LMJ A;  2E9X D;  2YDQ A;  5J2T E;  2ED0 A;  5D6Y A;  2HH7 A;  5A0D A;  2V7L A;  3CVR A;  5EC7 A;  3EG1 A;  1KC8 C;  5LG4 A;  1T7S A;  1ZA2 B;  1NEK A;  1YKH B;  5IUX A;  2O9S A;  2XDB A;  4J83 A;  5FXZ A;  2DBK A;  2VWF A;  1H3H A;  4QX7 B;  5LGN B;  2X4X A;  1TUG B;  2IIM A;  2CHN A;  2MWP A;  2IC9 A;  1WHH A;  2XID A;  3PGG A;  5CKB A;  5EK2 A;  4AKI A;  4N78 D;  2CGH A;  2WWU A;  1OPK A;  3CQX C;  3NRY A;  2AT1 B;  2DD5 A;  4IE5 A;  1RAC B;  2JJ9 A;  2EYY A;  4CXY A;  4BJM A;  3QXE B;  1D1A A;  6AT1 B;  1JEG A;  3NVO A;  1UUE A;  2D1X A;  4BA9 A;  4D6W A;  2EPD A;  1D1C A;  4M7D C;  4EDU A;  3K3Q C;  3PMT A;  4K11 A;  4DMV A;  4HE8 A;  4LFC T;  1YIJ Q;  1L0V A;  2K7A A;  3OW2 A;  5J1G A;  3JC6 C;  2AIR B;  2ZLY A;  2O2O A;  1AD5 A;  2FJE A;  3EG0 A;  4C8Q B;  1O75 A;  1JJ2 S;  4XU0 A;  4Z89 A;  2FBW A;  2J62 A;  5GON E;  2KDS A;  1V29 B;  5EG2 A;  3CPZ A;  2XQY A;  3PUS A;  4RTV A;  5DY9 A;  2O9V A;  2JUF A;  5AQR B;  5L2L A;  4DV5 T;  1VQ5 Q;  2OJ2 A;  3M53 A;  2C0O A;  2YT6 A;  2UXN B;  3QDF A;  4KGV B;  3WAK A;  3GNF B;  2OA5 A;  3EHZ A;  1KEY A;  3FBL A;  3INZ A;  3REB B;  1I81 A;  1RUW A;  1OUL A;  1RI9 A;  1FMV A;  5HWY A;  4YTN A;  2YXY A;  2YU2 A;  1Y96 A;  4BB7 A;  1CUN A;  3DTO A;  4JLG A;  3M59 A;  2RQV A;  2Y48 B;  2XKO C;  5LJN A;  2QRX A;  3OYX A;  1WI7 A;  5GAN 4;  3CCU Q;  3QB5 K;  4IUP A;  4HFV A;  2BG9 B;  2HQE A;  3MPU B;  3OY9 A;  4F04 B;  3OYK A;  1LRZ A;  1PWT A;  4FM4 B;  1ACM B;  1W70 A;  3G1J A;  3CC4 Q;  3CWZ B;  3QPH A;  1D0Y A;  2PTK A;  3VRY A;  3UTK A;  4X1I E;  1UGR B;  1MMG A;  3SDZ A;  1JXO A;  5HY6 A;  2P0P A;  2XAG B;  4B9W A;  4BAC A;  3CPW A;  3HTR A;  3G7Z A;  3RQU A;  4EMH A;  4P09 A;  2VKJ A;  3TLT A;  5FL1 A;  2KXC A;  3O4X E;  3OYJ A;  4J9I A;  2XU8 A;  3L2V A;  2QTX A;  3LYI A;  4O2B E;  4I43 B;  1NYG A;  1MND A;  3A8H B;  5FLX E;  4RMO A;  1XJW B;  1EZ3 A;  4DR6 T;  1EFN A;  2DM1 A;  4K0U A;  2UXX B;  3C4X A;  3P7I A;  5IT9 E;  4RTU A;  1YQ3 A;  3O1H A;  1WXU A;  4FW2 A;  3OYB A;  1UJ0 A;  3AE9 A;  4KP3 C;  3RKO A;  3BQL A;  2EJG A;  1E2A A;  1EX4 A;  4OP0 A;  2H7V C;  5FVL A;  3LWH A;  1FWZ A;  3VRB A;  2RJD A;  5C0M A;  1Y96 B;  1S72 A;  3VS5 A;  2V1Q A;  2CZ1 B;  3ONL C;  4J2C A;  1X79 A;  4WCI A;  4WF2 A;  3CCM Q;  1Z9Q A;  3EG2 A;  3PU8 A;  3EVY A;  4JI7 T;  2DAQ A;  4M78 C;  3EFS A;  4D8K A;  2YN6 A;  2E5L T;  3JCM h;  1UFF A;  2NUP B;  4PJJ A;  4XAX B;  1KFY A;  1OX8 A;  3CCE A;  1IJ6 A;  5E0O A;  3HKS A;  2DMO A;  3VS7 A;  4FSX A;  2IDO B;  4DQ2 A;  2PTF A;  4DR3 T;  1QVG A;  4QW2 A;  2LRL A;  1NJI U;  1KD1 U;  2EAY A;  1IGU A;  4QVZ A;  4JZ3 A;  2JMK A;  3CC7 A;  1IBL T;  1VQ7 T;  2D2S A;  4ZI3 D;  5LG3 A;  2PVO B;  5AYF A;  5GAN 8;  5DLO A;  5AQH B;  3HPW A;  4M77 A;  1VYV A;  4DEY A;  4HTE A;  1HXD A;  1EZZ B;  4MML A;  9ATC B;  5LJ3 j;  4GKK T;  3NFC A;  2M0Y A;  5IHK A;  2QEX Q;  2HDA A;  3PUX F;  3OMG A;  1UCU A;  3VUB A;  1HK9 A;  4OMP A;  1YIT Q;  4MBQ A;  2BBJ A;  3K3N A;  4U72 A;  2FO0 A;  3BDU A;  3RYI E;  3J81 E;  2K79 A;  2RMO A;  2EGA A;  4M75 D;  3GMI A;  4DID B;  5H6Q B;  4EEB A;  3L2Q A;  2L3R A;  4LUE A;  4FJO A;  2WSS V;  3IQL A;  1PRL C;  1X01 A;  2DZ9 A;  3M56 A;  5L3C B;  2VKH A;  1N36 T;  2K2M A;  5GAM g;  2A0F B;  2WDR A;  1Y01 A;  2XY8 B;  2L2P A;  5HYA A;  2RPN A;  3I55 A;  5C3J A;  1LKX A;  4QH1 A;  3OA6 A;  1BR1 A;  2PNI A;  3I5R A;  4DR7 T;  3A7M A;  1GBR A;  2GF7 A;  2QDL A;  1TTH B;  4AFZ C;  4IGU A;  3T9N A;  3PDY A;  5JRE A;  1WDX A;  4Z90 A;  4NL3 A;  3JB9 D;  2IIU A;  2ZPF B;  3M65 A;  4DBR A;  4UXN B;  2JMC A;  2RN8 A;  4ZS2 A;  3J80 E;  2E6Z A;  2XK0 A;  2BKN A;  3G06 A;  4UF0 A;  1YJ9 Q;  2VKN A;  1M2V B;  1E6G A;  2L3P A;  3SWH A;  4IRE A;  4KMC A;  3EAE A;  3VS6 A;  3QUJ A;  4XU3 A;  5I22 A;  1VQ6 A;  4LF7 T;  3ZEF B;  2M16 A;  2BE9 B;  4RTY A;  1WJR A;  4LML A;  3IEE A;  3PVL A;  1WR6 A;  1X6G A;  3UF4 A;  1MMN A;  4M77 B;  2QTV A;  2C0S A;  3LH0 A;  4A63 B;  2RP4 A;  3W15 B;  2XQ6 A;  1K73 U;  3I1A A;  2QAS A;  2E2A A;  2JNG A;  2GTJ A;  3L09 A;  2EGE A;  5KCH A;  4J9D A;  3LLR A;  4KH1 B;  2CWO A;  2X35 A;  3AA6 B;  1BU1 A;  2NR4 A;  2CRB A;  1K0X A;  4U2Z A;  2PVD B;  4DR5 T;  3C51 A;  3EGX A;  2DER A;  3HFO A;  2LRK A;  3HKB E;  4YSZ A;  4QH4 A;  3E9F A;  1NJI R;  2GTO A;  1KD1 R;  4IE4 A;  1E7O A;  4B3M T;  2CBJ A;  2K3X A;  3LX7 A;  3PMI A;  4PAG A;  3O9X A;  4B3R T;  2LJ3 A;  5GAO n;  3OYG A;  4AQF A;  2K57 A;  4FIB A;  3F2E A;  4KUM B;  2AHJ B;  4J9F A;  2Z0W A;  2MOZ A;  4WBO A;  3L2W A;  3PUW F;  2QA4 A;  3SFM A;  3L8R A;  3ZCI A;  1YJN Q;  3VRZ A;  2K4Y A;  3CCR Q;  1FMW A;  1W09 A;  5JVD E;  4X9D A;  1W2B A;  2DCF A;  4CI2 B;  3JCM X;  3NKZ A;  1FIO A;  1G3W A;  2XAQ B;  1VQ4 T;  1IAP A;  4C0D C;  5GAN 3;  2XG8 D;  2XQ8 A;  5LL6 S;  1W1F A;  3MCA B;  2F4V T;  3AE3 A;  2OX7 A;  2FRY A;  5CIU A;  2SEM A;  4I55 E;  1HX1 B;  4R56 A;  3JB9 F;  2EYQ A;  2E3H A;  2IVW A;  4XTY A;  2MAW A;  2W66 A;  3EAB A;  4ERR A;  1D3B A;  1HG2 A;  2DF6 A;  4OMO A;  5D6X A;  2OTL T;  4CRI A;  3UU4 A;  1X6B A;  2DYI A;  4YSY A;  1M3A A;  4IKF A;  2PU9 B;  4OB0 B;  4A4K A;  3PUQ A;  1KJW A;  1M1K R;  4TZ4 C;  4OMQ A;  5FWB A;  4RG8 A;  4Y92 A;  3CCJ Q;  3ZSS A;  3RBB B;  2QDY B;  3T1H T;  1SHF A;  1H8K A;  2DIL A;  3ZYK A;  2O4X A;  4EYU A;  4M7A D;  4EIK A;  4PNO A;  3RKW A;  2XAJ B;  5JR9 C;  5ABF A;  3T1Y T;  2D8H A;  4IUT A;  4U7I A;  2Q9Q D;  3OSS C;  2PQW A;  4DOW A;  4XBF B;  5GAN g;  1OED E;  2M0O A;  1WYB A;  5HXH A;  1N8R U;  1K73 R;  1Y64 B;  2FRW A;  2V8K A;  3CD6 T;  1VUB A;  5FW9 A;  1VQO Q;  5BMV E;  4M7D B;  3X1D A;  1SEM A;  3Q1J A;  2NTY A;  1IB8 A;  2XM2 A;  3M0T A;  3BQK A;  4E7L A;  3PUG A;  4NS5 A;  2E70 A;  4C0G A;  4PFP A;  3AA1 B;  4BY6 C;  1JNR A;  3MHX A;  5GMK m;  4DO0 A;  5CB4 E;  2RA1 A;  4XK8 E;  3KUF A;  1UGV A;  1BR4 A;  2DEU A;  2E64 A;  1YFN A;  2VL8 A;  3URG A;  5KCO A;  1K9A A;  4AMC A;  4OGC A;  4OMN A;  3KVB A;  4OML A;  1WX6 A;  4QXH B;  2YUQ A;  3CCL T;  4YTP A;  5I21 A;  2K9A A;  4HKA A;  3AAE B;  3MAC A;  5CO7 A;  5GJV B;  3ZMS B;  2EYZ A;  3CXC P;  5J39 A;  1N6A A;  4GK0 E;  3HR0 A;  4TWH A;  3VKG A;  1O3X A;  3Q9D A;  2JQH A;  3QII A;  2RQT A;  3M0U A;  3VKH A;  4OB1 B;  5HAX A;  4OK0 A;  4CI3 B;  3H8Z A;  3KVA A;  3JCF A;  4XTU A;  4I0U A;  2K5I A;  4MZP A;  4M78 A;  2MPK A;  1XDO A;  3T8O A;  1WYX A;  2IG0 A;  5KH6 A;  3WVE B;  3CKD A;  3NZP A;  3G6E Q;  2LKG A;  2J05 A;  4C92 E;  4J9B A;  3FIF A;  5J0Z A;  3I0Q A;  1M9S A;  2BZY A;  3EGU A;  3VYG A;  3CCE Q;  1VQL A;  4L9I A;  4U2Y A;  3BW1 A;  3HL6 A;  4JEU B;  5HEJ A;  4CN6 A;  5CKE A;  2KYB A;  4IDZ A;  1K1Z A;  2JOY A;  4C8Q D;  4GBQ A;  4H63 V;  3FZH B;  4DUZ T;  1WA7 A;  2AZV A;  1LVF A;  3V7S A;  4KX6 A;  2VGN A;  2ZM8 A;  3KIN B;  4BJN A;  3AEF A;  1EIF A;  2DX1 A;  3CCS Q;  1ZHC A;  5A0G A;  3VRA A;  1QCN A;  2KEA A;  3MEW A;  2LSJ A;  1LNX A;  4QVD A;  2KWH A;  4ZN1 A;  2V1D B;  2HBP A;  3L2R A;  1MUZ A;  3PIO A;  4E2F B;  2VB6 A;  2YWW A;  2VVK A;  2SPC A;  3OYC A;  3PVQ A;  2KWI B;  4P0B A;  4C92 F;  3CME Q;  2P9B A;  1M30 A;  4C5H A;  1N33 T;  2P0Q A;  5L23 A;  1ZQ1 A;  1K8A U;  1N8R R;  4HFB A;  1KQ1 A;  3OMC A;  2D6F A;  4LD9 K;  5L47 A;  3KBT A;  2KVQ G;  2ES0 A;  4PFZ A;  2EQJ A;  1ZUK A;  3ZL7 C;  4WTO B;  4O5V A;  1JJ2 A;  2PJQ A;  4PL6 A;  1AZE A;  4FYV B;  1VQ7 A;  3MKD A;  4LDV A;  3OYI A;  2ZPB B;  1PKT A;  2DL1 A;  2J6K A;  3I56 T;  2UUA T;  3VV0 A;  4C92 G;  2V7M A;  1MV0 B;  3RDV A;  1G73 A;  3KDS E;  1YKE B;  4M78 B;  3CC7 T;  3OS1 A;  3SWN C;  2OTJ Q;  2DNX A;  1LVK A;  4JLE A;  3KV5 A;  3QG1 A;  1KNP A;  3RIA A;  2CMR A;  2XTL A;  3TCJ A;  2E5K A;  1TUC A;  1XTD A;  4N0A A;  4FL6 A;  1U4Q A;  2E41 A;  3QZ5 B;  1QVF P;  1VQ9 A;  2ESW A;  3SEM A;  3CBM A;  1JRI A;  2KSS A;  3M55 A;  3OYZ A;  2O88 A;  1GCQ C;  4DBQ A;  5LJ5 d;  2FVU A;  1FX7 A;  3OVU A;  3FXD B;  3CMA T;  3O8V A;  4JI3 T;  2JMH A;  3PUY F;  2CKK A;  2EW3 A;  2RF0 A;  3ZMZ B;  1WHG A;  3N2G E;  3AED A;  4ZN3 A;  3PE0 A;  4FSS A;  2YIN A;  4U33 A;  1KF6 A;  4TV8 E;  3LGF A;  3PT9 A;  4LFA T;  1R0B G;  2E9X C;  3QO3 A;  2EFI A;  4FCY A;  2XDP A;  4RKU E;  4FI5 A;  1CSK A;  2C5I T;  3MP8 A;  2ODU A;  2V7J A;  2FJB A;  3I55 T;  4LDU A;  1K9M U;  3L42 A;  4GK5 E;  2D9T A;  2H3J A;  4OYJ A;  2LNH B;  3G4S T;  1TWB A;  1YHQ T;  5LBM A;  2RNA A;  4BDY A;  1I6Z A;  3FC3 A;  3OJA A;  4UIG A;  2K5B B;  4YT0 A;  3N9P A;  1NEB A;  2CLY C;  3JV3 A;  3HRS A;  1WXB A;  4C92 A;  4C0Z A;  2HL5 C;  1X69 A;  3RYF E;  4HCB A;  1SG5 A;  1VQ8 Q;  4KI0 F;  2CEA A;  4IIJ E;  4QT7 A;  3L3P A;  2KR3 A;  1KNZ A;  2IPO B;  2DIQ A;  5I11 A;  3ZMT B;  4ADZ A;  2ECZ A;  1G3S A;  4TWF A;  1G2B A;  1UDL A;  3M0R A;  2C06 A;  3V5U A;  1G83 A;  1K8A R;  4EAH A;  4CI0 C;  2IUB A;  2DRK A;  1MNE A;  1O9S A;  3VS3 A;  3KV9 A;  3OS2 A;  1XMO T;  1VQP T;  2WU2 A;  2VXE A;  2LEH A;  3VYH B;  1OXZ A;  2YKS A;  1BBZ A;  3V7C A;  2BBH A;  1XZY A;  1P92 A;  2ROT A;  4BE2 A;  4PJO D;  2LM9 A;  5JRC A;  2BVL A;  3HL8 A;  3M0Q A;  4ZTF A;  4LF4 T;  2DJZ A;  3LBX A;  5GMK l;  2LCC A;  4E47 A;  2RB6 A;  4BI4 A;  1MIW A;  2E65 A;  4TNW A;  3JCM W;  5FVK A;  2B76 A;  2XDD A;  3PJA J;  5CQY A;  4NL2 A;  3K3O A;  3KV4 A;  4CZZ B;  3L39 A;  5CJ5 A;  4EXT A;  2M1H A;  1GFD A;  4IL4 A;  1RL2 A;  3TU4 K;  3DKM A;  2FHD A;  2HAX A;  1VQ4 A;  3PUR A;  3Q5E A;  2JT4 A;  5JR9 A;  2NUT B;  2LVM A;  2SRC A;  1QUU A;  1E1H B;  2CM0 A;  1MGQ A;  1OPL A;  2JVV A;  5GAO r;  2L3S A;  1HYO A;  3CCV T;  5IN1 A;  1Q82 U;  2PBI A;  2H3R A;  2HBW A;  5D7U A;  2QQR A;  2OTL A;  2A2F X;  4YXD A;  1Q7Y U;  1FJG T;  1G3T A;  1J5E T;  1Q95 G;  1UE9 A;  2DXB A;  2IML A;  1QWE A;  3BFM A;  4GOU A;  4HWF A;  1Q81 C;  5KE2 A;  3PUA A;  4J9H A;  3ANW B;  5FRM A;  1K9M R;  1QCF A;  4TV9 E;  4OB3 B;  2DK3 A;  4JUV A;  5FXW A;  4AQF C;  2LJ1 A;  3CCQ A;  3AE6 A;  3ZYL A;  4PJO E;  5M9O A;  1M2O A;  3MZK B;  4C0D B;  2YUN A;  1FMK A;  2CBI A;  2NP9 A;  4YLH A;  5HEH A;  3A5Z B;  5J3B A;  4BD3 A;  4BUG A;  1S1N A;  4A53 A;  4CQI A;  3JB9 J;  5JRC B;  1M1G A;  4X20 E;  2OAU A;  2K6D A;  2DWK A;  3VS0 A;  5LHH B;  4O4I E;  4LF6 T;  3LBX B;  4JUY A;  3M0P A;  3DLL A;  2R58 A;  3EG9 B;  3CD6 A;  2ED1 A;  1ZBX A;  4BE1 A;  2EKO A;  4TVR A;  4P0A A;  4CN4 A;  2K2V A;  5GAM j;  5CCA A;  3TVT A;  3C98 B;  4O4H E;  3CQT A;  1T3L A;  2K24 A;  2NYS A;  2V8I A;  2DFU A;  2YSQ A;  5GAN 5;  4HFC A;  4HWH A;  1R77 A;  2VQF T;  2CH4 A;  2MI6 A;  3FB9 A;  4YJ3 E;  5JR9 B;  2WAC A;  1MMD A;  4HGA A;  1NEN A;  3FHN A;  3UWN A;  4B6M A;  4YSX A;  2BKD N;  2DHR A;  1VCT A;  5HK0 A;  1U5P A;  3UUX B;  3AE7 A;  2HSE B;  2MWO A;  4J9E A;  1QWF A;  3P50 A;  4E6R A;  4CN1 A;  2ACZ A;  2YEV C;  2X0H A;  3JAE A;  3CCL A;  3ER0 A;  3AE8 A;  3EG3 A;  3AEA A;  5LHI B;  4OVA A;  3V8J A;  3Q5D A;  3RPU A;  1NPP A;  4X64 T;  1YXR A;  2M51 A;  3UUM A;  2KMF A;  3LJC A;  1UHF A;  2EQM A;  3HA4 A;  2HHH T;  2L89 A;  4CC2 A;  4UVC B;  3M4Y A;  4F7U E;  2PUK B;  4HA8 A;  1TXQ A;  2XIC A;  4BY6 B;  3GOX A;  4RCB A;  2VL0 A;  4I50 E;  1OEB A;  3NPF A;  2JW4 A;  4QQD A;  1QKX A;  4O8S A;  2DLP A;  2NWM A;  3AXJ A;  5AQM B;  3LFM A;  8ATC B;  1VYT A;  1WHJ A;  4KHP T;  1HTJ F;  1YIJ T;  4C5I A;  2WP9 A;  3IHR A;  2UUB T;  1PCX A;  2LT1 A;  1Q82 R;  5HXE A;  4XQ3 A;  4RUG A;  5HXC A;  3MP6 A;  3C12 A;  4WBN E;  2NUZ A;  5CAI A;  5L3E B;  1Q7Y R;  2DTO A;  4L5G A;  1RI0 A;  2XAF B;  3AE2 A;  2XD0 A;  2ZCF B;  3I9Q A;  1R8O B;  1VQ5 T;  2JIW A;  3OBV E;  4F7U F;  1PKS A;  2K3W A;  2B86 A;  2KT1 A;  3P8B B;  1YJW T;  3PUZ F;  2E3I A;  4Q25 A;  5LJ3 d;  3UUB A;  2QQA A;  1VQL T;  1QQJ A;  3U3I A;  1DJ7 B;  4EZH A;  4KUL A;  2LQN A;  2BVM A;  4NXM T;  1VQ7 Q;  5LJ5 g;  5IWA T;  2E10 A;  3H0F A;  3SWN A;  3OYE A;  3NBX X;  3RH3 A;  2FZC B;  4F16 A;  3E2U A;  2QQB A;  1WJQ A;  4ZEY A;  3Q5X A;  2CP5 A;  3VU3 C;  4F7U G;  4OGE A;  2CP7 A;  3LK2 B;  4M7D D;  1N32 T;  1DU2 A;  5KYY A;  3ME9 A;  2CA5 A;  5GMK i;  1NWM X;  4U31 A;  4HFI A;  4TWD A;  1GCQ A;  3F57 A;  1E7P A;  2KYM A;  2JXB A;  2WSE E;  3CC4 T;  4DOV A;  3TLV A;  3NMZ C;  2QYZ A;  2EJF A;  2QG9 B;  3JRZ A;  2I0M A;  1Q86 U;  4YTM A;  1N8R C;  7AT1 B;  2X51 A;  3UU3 A;  3LDQ B;  3AXJ B;  5GMK j;  3OYH A;  1RAA B;  3C4S A;  3AHU A;  3I56 A;  2E9X A;  1QP2 A;  2XI9 A;  4AFS C;  3EUH A;  4CXX A;  4ZZB A;  2F2W A;  2Y4Y A;  3LGL A;  4F17 A;  2VVS A;  3JSC A;  5LJ5 f;  5LJ5 e;  3JAF A;  4IL9 A;  2BIV A;  4LXC A;  2KIN B;  2LM2 A;  1V76 A;  2K5L A;  2XPK A;  3ABV A;  4KH0 B;  2G0U A;  5KE3 A;  1SRM A;  4ILU A;  1WJS A;  4MDX A;  2LHN A;  2G6F X;  5FY0 A;  2L0A A;  2L9Q A;  4A4G A;  5GAN j;  2D8J A;  2X4W A;  1QMC A;  3ZCJ A;  3CMA A;  2PG8 A;  2N9D A;  1WLX A;  4O2A E;  4J5Y A;  4OMM A;  5CVI A;  1VQ9 T;  5CA0 E;  2LX9 A;  3L2Z A;  1VQN A;  3ZEH A;  3JAD A;  3P4S A;  5L3F B;  1Y71 A;  3N2O A;  2I0N A;  1S35 A;  1BB9 A;  1M5Q 1;  2YRD A;  4C0F A;  4AKG A;  2YHT A;  3SWN B;  3GP8 A;  3EFO A;  1OED C;  2COW A;  3TEE A;  4F7U A;  4MLK A;  1TG0 A;  2X9W A;  1R0C B;  2B1E A;  3H9N A;  2DET A;  3CCM T;  1XDP A;  4DV4 T;  2KY9 A;  5CKF A;  1T0J A;  2HN1 A;  2DD4 A;  5KYY B;  1YI2 A;  2XM1 A;  1KFZ A;  2GFU A;  2EHO D;  3ZLI A;  2M02 A;  4LUD A;  1AT1 B;  3G4S A;  1GRI A;  1KK7 A;  2YU1 A;  4NXN T;  4PLL A;  1YHQ A;  4X62 T;  2FPF A;  1M1K U;  3VU7 H;  3IBP A;  4ATO A;  3NTH A;  3JCM V;  3QK6 A;  4O4J E;  4YFS A;  2ZM6 T;  2E5V A;  4U7Y A;  2WCA A;  4N0A C;  2ZPI B;  1YNZ A;  4OFZ A;  4XU1 A;  4Z8A A;  3DB3 A;  3REA B;  2V7I A;  2BS4 A;  3ZT5 A;  2QGF B;  4P1N A;  1G8X A;  4LMK A;  2C5J A;  2E9X B;  3P8D A;  1MIY A;  3KFW X;  4GYS A;  5ABG A;  2UXD T;  3CIR A;  4ZXL A;  3VS4 A;  4KGX B;  1GBQ A;  2BUD A;  4HVU A;  1JBM A;  3H41 A;  3RHW A;  2KMT A;  5CKD A;  4ELY C;  2DJQ A;  1UHC A;  2UXC T;  1VQK Q;  4M75 E;  2QEX T;  3JB9 H;  5F3J A;  2R5A A;  1OQK A;  3P8C D;  4HVW A;  2CLY B;  1T98 A;  1YIT T;  1UG1 A; 
#chains in the Genus database with same CATH homology
 4X1V A;  2GGR A;  1NAF A;  5HXS A;  1YWO A;  5LP6 E;  2EVR A;  2V26 A;  4AG1 C;  2Y8D A;  2XAH B;  3O5Z A;  2HPL A;  1T3S A;  2MOX A;  3I5S A;  5FXX A;  3ULR B;  4MFR A;  1YCS B;  5JQG E;  4HVV A;  1OWA A;  4AKH A;  2YUO A;  1HCI A;  2OAW A;  3F31 A;  3TSZ A;  3CML A;  4NUU A;  5AFU L;  2DBM A;  3H0H A;  2K3B A;  4TN7 B;  1SA0 E;  3A98 A;  3M0S A;  3SOL A;  4UF0 B;  1HFA A;  4A56 A;  2KNB B;  2MIO A;  2J06 A;  4CC7 A;  2CUD A;  2DL8 A;  2D0U A;  1AEY A;  2JM8 A;  2DI4 A;  2EQI A;  2F2X A;  3FXE B;  4JZ4 A;  2H7O A;  4LNP A;  1NM7 A;  3I0O A;  3AA0 B;  1E6H A;  3DJB A;  1ARK A;  2KBT A;  2I59 A;  3UA7 A;  4IE7 A;  2QA7 A;  3RC8 A;  1HJD A;  2LZ6 B;  3VHL A;  5FMN A;  3ZYM A;  4G2A A;  2NWB A;  4EOZ B;  3DP7 A;  3LH5 A;  4ZI7 E;  3FB2 A;  2DRM A;  2V1R A;  1FEW A;  4XZC A;  2KRO A;  4AKL A;  1VYU A;  2J6F A;  4AG2 C;  1CKA A;  3NZQ A;  2VKO A;  4U74 A;  2LOP A;  2KRM A;  2A28 A;  4J9G A;  2CXD A;  3C0C A;  1U06 A;  4H9P C;  2MYS A;  4J9C A;  4PFO A;  3QC9 A;  3ZJ2 A;  2JS0 A;  3HKD E;  2D5U A;  2CT3 A;  4QWN B;  4UEL A;  4AQG A;  2W10 A;  3A5X A;  3AAI A;  2L3L A;  2YDL A;  3NRX A;  4H9Q C;  3E22 E;  5JDH A;  1SSH A;  5F8P A;  1ZV4 X;  1ZUY A;  4QHO A;  4H9R C;  5LHG B;  1US7 B;  1K4U S;  4WW0 A;  4OYK A;  2VAS A;  4OHF A;  2ENM A;  4UEM A;  2WM9 A;  3J7Y q;  1YN8 A;  2OI3 A;  2ROL A;  2WMN A;  3U78 A;  5JDL A;  4UV8 B;  2NTX A;  2A08 A;  3N9L A;  1BR0 A;  2W00 A;  4IE6 A;  2V7K A;  3Q2M A;  4IIM A;  5LA6 E;  3D0T A;  3ZC1 A;  3AVS A;  3TSW A;  2XMF A;  1Z9Z A;  1AJ3 A;  2JQQ A;  1I07 A;  4M4Z A;  3E0Z A;  1X2Q A;  1WRD A;  5FYM A;  3N9N A;  3BQI A;  2NW9 A;  5L3B B;  2WBL A;  3UAT A;  2CRE A;  1HX8 A;  2BZ8 A;  2A37 A;  5DJQ C;  2Q9Q A;  1UEC A;  5LGT B;  2DVJ A;  5FP3 A;  3ESL A;  5IHN A;  1RLQ C;  4ZHQ E;  5HXR A;  2IAK A;  2XUE A;  2GNC A;  2X3W D;  4LN2 A;  2FPD A;  2XAS B;  1H92 A;  3EDU A;  1GFC A;  3IF8 B;  2NW7 A;  2HPJ A;  4C90 A;  3C50 A;  4O4L E;  5LNK A;  1K0S A;  3ZC0 A;  1HD3 A;  3O1J A;  2ZMA A;  2W0Z A;  1ZX6 A;  4JJC A;  1M3B A;  2N2N A;  2LE8 A;  1YD8 G;  3N2K E;  2O31 A;  2X9Y A;  3UUL A;  2DWG A;  2LP5 A;  3K8P C;  5IXF A;  2KND A;  1WLP B;  2AKL A;  3N5L A;  3FBZ A;  5FXV A;  2KT8 A;  5M4Y A;  3KFV A;  4GYR A;  3S4U A;  2EKH A;  1D0X A;  5A1L A;  3TKL B;  1KSW A;  4C91 A;  4F6R C;  1U3O A;  2BTT A;  4CC3 A;  1WYC A;  4H9S E;  2JMA A;  4AFQ C;  2CCQ A;  3THK A;  1VOM A;  3R6N A;  1Y57 A;  2X68 A;  3B13 A;  3V5S A;  1JO8 A;  3N9M A;  3AVR A;  1LCK A;  2LJ0 A;  1QSD A;  3MXZ A;  1D0Z A;  2C0T A;  2CH4 W;  2EBP A;  3PU3 A;  4B6X A;  2IC6 A;  2CWY A;  4MAL A;  2NW8 A;  1JQQ A;  2W62 A;  1AOJ A;  1UX5 A;  3ZN1 B;  1OOT A;  5FWC A;  3EDV A;  2FEI A;  1PHT A;  4X1K E;  2PFV A;  3C4Z A;  4PJM A;  1D1B A;  5LOV E;  3Q5W A;  2DL3 A;  1M27 C;  4AI6 A;  4R0K A;  3MJX A;  1H7C A;  1TUD A;  4MHC A;  2JS2 A;  4IHJ E;  5DQV A;  2K48 A;  1S94 A;  1QLY A;  4RTW A;  2F2V A;  1SPK A;  1YP5 A;  2CE7 A;  1NYF A;  3OKQ A;  1UX4 A;  2GQI A;  1AWX A;  1ZEE A;  5LBQ B;  5EK4 A;  1X43 A;  2L3Q A;  1PNJ A;  4ZI3 C;  4ZI2 D;  3NGP A;  4HEA A;  4H9N C;  3WAJ A;  4EIW A;  2ODV A;  2RQU A;  4LE9 A;  1ZLM A;  5LJM A;  2CXF A;  2WAU A;  3KBU A;  4EZ4 A;  2RQR A;  3UFE A;  4ESR A;  3ETV A;  4CXW A;  4H63 H;  2AZS A;  3I9Y A;  1B7T A;  4AKR B;  1M3C A;  4KBM B;  2JTE A;  1KIK A;  5DQW A;  2EHO C;  2ABL A;  3GWH A;  4JJB A;  2X0L B;  3ZN0 B;  2VWA A;  2J7I A;  2QGS A;  5L3D B;  3CQG B;  4Z88 A;  3JC6 D;  4JEH B;  5ECA A;  1U5S A;  3GBQ A;  4RTT A;  4M1P A;  4HXJ A;  1NLP C;  5CA1 E;  2RQW A;  2KZ7 B;  1B07 A;  1SHG A;  1BR2 A;  4UVB B;  3RX6 A;  1JU5 C;  2KLQ A;  3RYC E;  4KRT A;  3ZMV B;  3U23 A;  1SRL A;  5KMG P;  3CX6 B;  2X66 A;  5HCK A;  4PK5 A;  4EB6 E;  1VA7 A;  2LSI A;  3VS1 A;  1RLP C;  1SHZ C;  2DL7 A;  3ZMU B;  4E7Z A;  2J6O A;  1WXT A;  1AWJ A;  3RNJ A;  1YW0 A;  2A72 A;  3EHQ A;  2LX7 A;  4V1A v;  2CUB A;  3RC3 A;  2W63 A;  5LCY A;  3UT5 E;  1Z0P A;  4WNK A;  4RTZ A;  2VK9 A;  4UVA B;  1GL5 A;  2FPE A;  4G63 A;  4YJ2 E;  3NHN A;  1NEG A;  4PJL A;  1YWP A;  3LK4 2;  3MK7 C;  4TX5 A;  2X9H A;  2K9G A;  4EYY R;  2BZB A;  2CT4 A;  2EGC A;  5GJW B;  3ETU A;  2Q9Q C;  1IJ5 A;  2M67 A;  5KDM C;  3KV6 A;  3C4W A;  4IIO A;  2N1G A;  4H9O C;  3ZPO A;  2AKK A;  3AA7 B;  2VKD A;  3EHR A;  2LCS A;  2JPF A;  3MA9 A;  1J3T A;  1IZN B;  1UJY A;  4BAY B;  3I9W A;  5FNV E;  4RTX A;  2ZM2 A;  2PZ1 A;  4QX8 B;  3RRC A;  1ZKE A;  1JXM A;  2C5K T;  5IHI A;  1HF8 A;  1ABO A;  2DL4 A;  2DNU A;  1AVZ C;  3PTR B;  2E8I A;  4GLM A;  3AB3 B;  2EYX A;  3ONX A;  1NG2 A;  5EK3 A;  2JM9 A;  5KX5 E;  1IO6 A;  2IW5 B;  1W6X A;  4ASK A;  4F14 A;  2WMO A;  5FY7 A;  4ZS3 A;  2D0T A;  2CSQ A;  2KXD A;  2W61 A;  5FY1 A;  3UA6 A;  2L8K A;  3AAA B;  3N9Q A;  3RRW A;  1ABQ A;  2KRS A;  2KXP B;  2YK0 A;  2A36 A;  3CQC B;  2W0G A;  5TAO A;  2X9X A;  1Y0M A;  1K76 A;  3SS1 A;  5LGU B;  2LJL A;  1A0N B;  3HI2 A;  3LK3 B;  4YHJ A;  4E7S A;  4NUV A;  5HWX A;  1I0C A;  5IXB A;  3H3A A;  1AWO A;  3WI3 A;  2Z6E A;  2AK5 A;  1M8M A;  2ZM0 A;  4JPB W;  2EHO A;  1UTI A;  2LOS A;  4I4T E;  2GBQ A;  3J9X 1;  2J1D G;  2HSP A;  1XOV A;  3H0I A;  4PW8 A;  2X3X D;  5IHY A;  1AWW A;  1WIE A;  3N9O A;  1B3Q A;  4CI1 B;  4ZNX A;  2X67 A;  4D8D A;  2Y6X A;  4L0R A;  3RYH E;  1CKB A;  4IE0 A;  2NOX A;  4UV9 B;  2CXL A;  5IH2 A;  4IST A;  5DAB A;  4HCK A;  3H37 A;  5EZY E;  2YUP A;  5JDN A;  3QWY A;  2XHE B;  2LSG A;  1VRB A;  2EHO B;  2HEQ A;  3ZJ1 A;  4AFU C;  4PNI A;  4DEX A;  4QXB B;  3GN5 A;  2MTQ A;  3GA8 A;  2MCN A;  1MIV A;  3HKE E;  5JDM A;  2KT9 A;  1NLO C;  4PK6 A;  2C0I A;  1FYN A;  4ORZ A;  3UUN A;  2DLR A;  4HN9 A;  4TUY E;  1ZBJ A;  2ACX A;  2LSK A;  3FJ5 A;  1ZSG A;  4ZOL E;  2DYB A;  5LYJ E;  5LXT E;  2CSI A;  3LG7 A;  1T0H A;  4GIW A;  5JH7 E;  3I35 A;  4QXC B;  2LHR A;  2BZX A;  2LSY A;  5ADX L;  4Z8X A;  1I1J A;  3CX8 B;  4AXP A;  1X27 A;  3GN5 B;  2A3D A;  5L3G B;  2DL5 A;  4ISS A;  5JDF A;  1HG5 A;  2LT3 A;  2DE0 X;  5J2U E;  1PRM C;  4PJN A;  1MV3 A;  3CX7 B;  3O1I A;  2KRN A;  4X1Y E;  2GK9 A;  3SHW A;  3C64 A;  4JJD A;  3VS2 A;  2JRK A;  3HKC E;  1GCP A;  5JDG A;  2EYW A;  1MMA A;  1V9D A;  5JDQ A;  4DND A;  2H8H A;  2BDE A;  1BK2 A;  1QKW A;  2KE9 A;  4QKN A;  1N5Z A;  3R84 B;  4PK4 A;  3ANW A;  1HSQ A;  5IYZ E;  2Q9Q B;  2FG0 A;  2P4R A;  2CDT A;  1HS7 A;  2LQW A;  2HCK A;  3SRZ A;  4ANJ A;  4DVD A;  2MBG A;  2DA9 A;  2KGT A;  3BK9 A;  4ZI2 C;  2LMJ A;  2D0N A;  3E08 A;  5C8Y E;  3B57 A;  1OV3 A;  4DMW A;  1X2K A;  1V1C A;  3QWX X;  1AZG B;  5H6R B;  1WFW A;  5ETW A;  4CC4 B;  2E9X D;  5J2T E;  2ED0 A;  2HH7 A;  2V7L A;  3CVR A;  5EC7 A;  3EG1 A;  5LG4 A;  1YKH B;  2O9S A;  5FXZ A;  2DBK A;  2VWF A;  1H3H A;  4QX7 B;  5LGN B;  2IIM A;  2IC9 A;  5EK2 A;  4AKI A;  4N78 D;  2WWU A;  1OPK A;  3CQX C;  3NRY A;  4IE5 A;  2JJ9 A;  2EYY A;  4CXY A;  4BJM A;  1D1A A;  1JEG A;  1UUE A;  2D1X A;  4BA9 A;  2EPD A;  1D1C A;  3K3Q C;  4K11 A;  4DMV A;  4HE8 A;  2K7A A;  5J1G A;  3JC6 C;  2ZLY A;  2O2O A;  1AD5 A;  3EG0 A;  4Z89 A;  5GON E;  3CPZ A;  2XQY A;  3PUS A;  4RTV A;  2O9V A;  5L2L A;  2OJ2 A;  2C0O A;  2YT6 A;  2UXN B;  3WAK A;  2OA5 A;  3FBL A;  3REB B;  1RUW A;  1RI9 A;  1FMV A;  5HWY A;  2YU2 A;  1CUN A;  3DTO A;  2RQV A;  2Y48 B;  5LJN A;  3OYX A;  1WI7 A;  4HFV A;  1LRZ A;  1PWT A;  1W70 A;  3CWZ B;  1D0Y A;  2PTK A;  3VRY A;  3UTK A;  4X1I E;  1MMG A;  1JXO A;  2XAG B;  4P09 A;  2VKJ A;  2KXC A;  3O4X E;  4J9I A;  4O2B E;  4I43 B;  1NYG A;  1MND A;  1EZ3 A;  1EFN A;  2DM1 A;  4K0U A;  2UXX B;  3C4X A;  3P7I A;  4RTU A;  3O1H A;  1WXU A;  1UJ0 A;  4KP3 C;  3RKO A;  3BQL A;  2H7V C;  3VS5 A;  2V1Q A;  4J2C A;  1X79 A;  4WCI A;  1Z9Q A;  3EG2 A;  3PU8 A;  3EVY A;  4D8K A;  1UFF A;  4PJJ A;  4XAX B;  1IJ6 A;  5E0O A;  2DMO A;  3VS7 A;  4JZ3 A;  2JMK A;  2D2S A;  4ZI3 D;  1VYV A;  4DEY A;  4HTE A;  2M0Y A;  5IHK A;  2HDA A;  1UCU A;  4OMP A;  4MBQ A;  3K3N A;  4U72 A;  2FO0 A;  3RYI E;  2K79 A;  2RMO A;  2EGA A;  3GMI A;  5H6Q B;  4LUE A;  4FJO A;  2WSS V;  3IQL A;  1PRL C;  5L3C B;  2VKH A;  2K2M A;  2L2P A;  5HYA A;  2RPN A;  1LKX A;  1BR1 A;  2PNI A;  3I5R A;  1GBR A;  2QDL A;  4AFZ C;  4IGU A;  3PDY A;  5JRE A;  1WDX A;  3M65 A;  4DBR A;  4UXN B;  2JMC A;  2RN8 A;  4ZS2 A;  4UF0 A;  2VKN A;  1E6G A;  2L3P A;  3SWH A;  4KMC A;  3VS6 A;  3QUJ A;  5I22 A;  3ZEF B;  4RTY A;  3IEE A;  3PVL A;  1WR6 A;  1X6G A;  3UF4 A;  1MMN A;  2C0S A;  4A63 B;  2RP4 A;  3W15 B;  3I1A A;  2GTJ A;  3L09 A;  2EGE A;  4J9D A;  2CWO A;  3AA6 B;  1BU1 A;  1K0X A;  3C51 A;  3HKB E;  2GTO A;  4IE4 A;  1E7O A;  1T98 A;  4PAG A;  3O9X A;  2LJ3 A;  4AQF A;  3F2E A;  4KUM B;  4J9F A;  2MOZ A;  4WBO A;  3ZCI A;  3VRZ A;  1FMW A;  5JVD E;  2DCF A;  4CI2 B;  1FIO A;  2XAQ B;  1IAP A;  1W1F A;  2FRY A;  2SEM A;  4I55 E;  4ERR A;  4OMO A;  1HG2 A;  2DF6 A;  1X6B A;  1M3A A;  3PUQ A;  1KJW A;  4TZ4 C;  4OMQ A;  5FWB A;  4Y92 A;  3RBB B;  1SHF A;  1H8K A;  2DIL A;  3ZYK A;  4EYU A;  4EIK A;  2XAJ B;  5JR9 C;  2D8H A;  2Q9Q D;  4XBF B;  1WYB A;  5HXH A;  1Y64 B;  2FRW A;  5FW9 A;  5BMV E;  1SEM A;  2NTY A;  3M0T A;  3BQK A;  3PUG A;  4PFP A;  3AA1 B;  4DO0 A;  5CB4 E;  2RA1 A;  1UGV A;  1BR4 A;  2VL8 A;  1K9A A;  4OMN A;  3KVB A;  4OML A;  1WX6 A;  4QXH B;  2YUQ A;  2K9A A;  4HKA A;  3AAE B;  3MAC A;  5GJV B;  3ZMS B;  2EYZ A;  4GK0 E;  3HR0 A;  3VKG A;  1O3X A;  3Q9D A;  2RQT A;  3M0U A;  3VKH A;  5HAX A;  4OK0 A;  4CI3 B;  3KVA A;  3T8O A;  1WYX A;  3CKD A;  3NZP A;  2J05 A;  4J9B A;  2BZY A;  3I0Q A;  3EGU A;  4L9I A;  3HL6 A;  4JEU B;  2KYB A;  4IDZ A;  1K1Z A;  4GBQ A;  4H63 V;  1WA7 A;  2AZV A;  1LVF A;  2ZM8 A;  3KIN B;  4BJN A;  2DX1 A;  1ZHC A;  2KEA A;  2LSJ A;  2KWH A;  2V1D B;  1MUZ A;  2VB6 A;  2VVK A;  2SPC A;  3PVQ A;  2KWI B;  4P0B A;  2P9B A;  1M30 A;  5L23 A;  3KBT A;  2ES0 A;  1ZUK A;  3ZL7 C;  2PJQ A;  1AZE A;  3MKD A;  1PKT A;  2J6K A;  2V7M A;  1MV0 B;  1G73 A;  3KDS E;  1YKE B;  2DNX A;  1LVK A;  4JLE A;  3KV5 A;  2CMR A;  2XTL A;  2E5K A;  1TUC A;  1U4Q A;  2ESW A;  3SEM A;  2O88 A;  3OYZ A;  1GCQ C;  4DBQ A;  3FXD B;  2JMH A;  2RF0 A;  2EW3 A;  3ZMZ B;  3N2G E;  3PE0 A;  4FSS A;  2YIN A;  4TV8 E;  2E9X C;  4FI5 A;  1CSK A;  2C5I T;  2ODU A;  2V7J A;  4GK5 E;  4OYJ A;  2LNH B;  5LBM A;  2RNA A;  3OJA A;  4UIG A;  2K5B B;  3N9P A;  1NEB A;  2CLY C;  3JV3 A;  1WXB A;  1X69 A;  3RYF E;  2CEA A;  4IIJ E;  4QT7 A;  3L3P A;  2KR3 A;  1KNZ A;  5I11 A;  3ZMT B;  4ADZ A;  2ECZ A;  1G2B A;  1UDL A;  3M0R A;  3V5U A;  1G83 A;  4EAH A;  2DRK A;  1MNE A;  3VS3 A;  3KV9 A;  2LEH A;  1OXZ A;  1BBZ A;  2ROT A;  2LM9 A;  5JRC A;  2BVL A;  3M0Q A;  3LBX A;  1MIW A;  3K3O A;  3KV4 A;  4CZZ B;  4EXT A;  1GFD A;  3PUR A;  2JT4 A;  5JR9 A;  2SRC A;  1QUU A;  1E1H B;  2CM0 A;  1OPL A;  2L3S A;  2PBI A;  2H3R A;  2HBW A;  2A2F X;  1UE9 A;  1QWE A;  4GOU A;  3PUA A;  4J9H A;  3ANW B;  1QCF A;  4TV9 E;  5FXW A;  4AQF C;  2LJ1 A;  3ZYL A;  3MZK B;  2YUN A;  1FMK A;  2NP9 A;  4YLH A;  1S1N A;  4CQI A;  5JRC B;  4X20 E;  2K6D A;  2DWK A;  3VS0 A;  5LHH B;  4O4I E;  3LBX B;  4JUY A;  3M0P A;  2ED1 A;  4P0A A;  3TVT A;  3C98 B;  4O4H E;  3CQT A;  1T3L A;  2K24 A;  2YSQ A;  2CH4 A;  4YJ3 E;  5JR9 B;  1MMD A;  4HGA A;  3FHN A;  2DHR A;  1U5P A;  3UUX B;  4J9E A;  1QWF A;  4E6R A;  2YEV C;  3EG3 A;  5LHI B;  3RPU A;  2M51 A;  3UUM A;  2KMF A;  3LJC A;  1UHF A;  4CC2 A;  3HA4 A;  4UVC B;  4I50 E;  1OEB A;  3NPF A;  2JW4 A;  1QKX A;  4O8S A;  2DLP A;  2NWM A;  3LFM A;  1VYT A;  1HTJ F;  3IHR A;  5HXE A;  4RUG A;  5HXC A;  4WBN E;  2NUZ A;  5L3E B;  4L5G A;  2XAF B;  3I9Q A;  3OBV E;  1PKS A;  2B86 A;  2KT1 A;  3U3I A;  4EZH A;  2LQN A;  2BVM A;  3H0F A;  3NBX X;  3RH3 A;  4F16 A;  3Q5X A;  3LK2 B;  2CA5 A;  1NWM X;  1GCQ A;  2KYM A;  3F57 A;  2JXB A;  3NMZ C;  2X51 A;  2E9X A;  4AFS C;  3EUH A;  4CXX A;  2F2W A;  4F17 A;  2KIN B;  2G0U A;  1SRM A;  4ILU A;  2LHN A;  2G6F X;  5FY0 A;  2L0A A;  2L9Q A;  2D8J A;  3ZCJ A;  2PG8 A;  4OMM A;  2N9D A;  1WLX A;  4O2A E;  5CA0 E;  5L3F B;  3N2O A;  2I0N A;  1S35 A;  1BB9 A;  4AKG A;  4MLK A;  1TG0 A;  2X9W A;  2B1E A;  1T0J A;  1KFZ A;  4LUD A;  2EHO D;  3ZLI A;  1GRI A;  1KK7 A;  2YU1 A;  2FPF A;  3VU7 H;  3IBP A;  3QK6 A;  4O4J E;  4YFS A;  1YNZ A;  4OFZ A;  4Z8A A;  3REA B;  2V7I A;  1G8X A;  2C5J A;  2E9X B;  1MIY A;  3KFW X;  4GYS A;  3VS4 A;  1GBQ A;  4HVU A;  3H41 A;  2DJQ A;  1UHC A;  5F3J A;  3P8C D;  4HVW A;  2CLY B;  1ZUU A;  1UG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...