2KMFA

Solution structure of psb27 from cyanobacterial photosystem ii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
GPLGSCDSGTGLTGNYSQDTLTVIATLREAIDLPQDAPNRQEVQDTARGQINDYISRYRRKGDAGGLKSFTTMQTALNSLAGYYTSYGARPIPEKLKKRLQLEFTQAERSIERGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II 11 kDa protein
publication title Solution structure of Psb27 from cyanobacterial photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.810 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kmfA01
2Y6XA 2KNDA 2KMFA
chains in the Genus database with same CATH superfamily
4JI4T 1V9DA 3CQXC 2ODUA 3ONXA 3T1HT 2KT9A 2KINB 2V26A 1UK5A 5JH7E 3F2EA 3PE0A 3CKDA 3C4XA 3S4UA 3ZYMA 4ILCA 3JCFA 3RIFA 3NRXA 3PTRB 1XNRT 1WRDA 3CWZB 4XAXB 5J2TE 3HA4A 2LM2A 4OHFA 2IHR1 4ZZCA 3CPZA 3HL6A 2V7KA 4MFRA 2IC6A 1QLBA 4PK5A 5LGUB 2IUBA 1UGOA 4Z8XA 4U72A 3X1DA 5LG4A 2DCFA 5L3BB 1MMDA 2A72A 4YTMA 5JDFA 3ZCIA 2ZM2A 2WMOA 2BKOA 1US7B 3ZN1B 3N2KE 1MIWA 2SPCA 1MMGA 2VL0A 4GYSA 2HN2A 2Q9QA 1XDPA 2LKHA 5LP6E 3UU6A 2I6HA 3GA8A 4QX8B 1X9BA 3AAAB 3AE2A 4HWDA 2JMHA 2XASB 3PUGA 2VWAA 1X79A 4PK4A 2CA5A 5IYZE 4H63V 1FEWA 2YK0A 4QXBB 3CX8B 4OK0A 3RQWA 1HX8A 4ZOLE 5HEJA 5L3DB 3AEDA 5FYMA 2ODVA 2X67A 1ZEEA 4UVBB 2WZHA 3ZT6A 5FXXA 4P1NA 4ZI7E 2N2NA 3ZPOA 5HXCA 2MAWA 2FJEA 5CFBA 2YU1A 2J47A 2JJ9A 3EVYA 2VB6A 3SRZA 2H7OA 3FZMB 3DP7A 5J1GA 3ANWA 3CMLA 4TV8E 1AJ3A 3L8RA 1IBMT 4ZI3C 4LF7T 3MACA 4GK5E 2K48A 2L8KA 3N9OA 2EHOA 2CBIA 2M6IA 2FJAA 4HN9A 3KINB 4DIDB 3AE6A 1LVFA 3RIUA 4IT4A 2BKPA 4DV7T 3EAMA 4EEDA 2YOEA 4L5GA 3IEEA 4F8HA 2K9AA 4MLKA 5JR9B 4HFCA 5FXZA 2LHNA 2OV9A 2WU5A 3VKHA 3QC9A 4GYRA 1W9RA 1OEDB 4HEAA 3FB2A 5HEGA 2EHOD 3VU7H 3E0ZA 5FY7A 2W2UA 1Y01A 3ESLA 5C2TA 1I6ZA 4U7YA 4KBMB 2XAQB 5LGTB 2F4VT 5LJNA 2L3LA 2LOPA 3H3AA 1BR0A 4O4IE 4EIWA 1ZV4X 3GN5A 2NTYA 2C5JA 1VCSA 3ZLIA 4ISTA 3ZYLA 5HWYA 2AE9A 4PNIA 2LKGA 5EK3A 4V1Av 3BQKA 5JREA 5HWXA 2W62A 4LF6T 2WM9A 2LM9A 5LHIB 5CB4E 3LK3B 5KMGP 2XM1A 1ZOYA 4DV5T 2BDEA 4EOZB 2Z6EA 4PJNA 4AKIA 4UEMA 4CQIA 5DABA 3PUYF 4YJ3E 3M3ZB 1LVKA 4KMCA 4IIJE 4UIGA 2W67A 3NBXX 4C90A 5HYAA 2WWVA 4YTNA 1ZKEA 3TLTA 4CN1A 3HKBE 1IZNB 2W66A 1DU2A 2WCAA 5FL1A 2JQQA 3ZT7A 2HPJA 3NZQA 5JDQA 4NXNT 3TLUA 3UUBA 1E7PA 4HWIB 4LF8T 3AA1B 3J9X1 5AQRB 1KFYA 2X0HA 2OLTA 2PJQA 3V5SA 2CWYA 4MBQA 2EHOB 1U5PA 4QHOA 3K3NA 1UURA 1M62A 1HTJF 4NPPA 2CBJA 4AQFC 2HH7A 2JMKA 4DNDA 2PTFA 3LK42 1FMVA 4U2ZA 4YHJA 1HNZT 3D0TA 5FY1A 4I4TE 3N9PA 2WS3A 4TN7B 5L3CB 3HKEE 3P8CD 2KLQA 3L09A 2V6XA 3T8OA 1QSDA 4AQGA 4L9IA 3ZMUB 3AVSA 5CGMA 3UQ7A 3AVRA 4H63H 3TLVA 2H3RA 4HWCA 2X9YA 3KV5A 5EK4A 5L4HA 2XPKA 1O3XA 4TWDA 4NXMT 4DR6T 5AQLB 1Z8UA 4NUUA 4CI3B 3RF1A 2YDRA 3H37A 2XQ6A 4X1KE 4AISA 4U74A 2DWGA 4DMWA 4DV0T 4DV2T 1FJGT 2ZMAA 5LGNB 3QNUA 3UU4A 3GN5B 5AQUB 3UU3A 3AEEA 5AQQB 3UU8A 3AA6B 4O2AE 2BG9E 2LJLA 5JDGA 3VKGA 5AFUL 3AE9A 1M7KA 2BS3A 1MMAA 3C98B 2FUPA 1KNPA 2NWBA 2PFVA 3OYXA 3VR9A 2XAFB 4B3RT 2VQET 4A98A 2M6BA 5CA1E 4B3TT 4LMKA 5AQIB 2WU2A 3RPUA 2JPFA 4FI5A 3C64A 3K8PC 4IGUA 3UUNA 5E0OA 5JQGE 3V5UA 1IJ5A 2XZEA 3KDSE 1NEKA 1W0BA 1WR6A 1OXZA 3PU3A 2E9XA 4TNWA 4JEUB 5KXJA 3N9LA 2XTLA 3I0OA 3Q5XA 3RHWA 2UXBT 2CM0A 4LF4T 4U31A 2CHNA 1J1JA 1WYBA 5HXRA 3ZMZB 2KWIB 4BJNA 4X5TA 4H9OC 2W61A 2BG9C 4H9PC 3ZMVB 4HFDA 4PJJA 4DV1T 3QOFA 2CLYC 3EI0A 4ERRA 3SOLA 2VKJA 3N2GE 4EZ4A 4QH5A 4ILBA 4YLHA 4IE5A 2XUEA 3KV4A 5BR8T 4WZXA 3RC3A 1HCIA 5F8PA 3EUHA 3PUSA 2G0UA 2ZM0A 5JR9A 2E9XD 4TNVA 2QGSA 3C51A 1IJ6A 3CX6B 3NZPA 5ADXL 2YINA 4ZI3D 3N9MA 4KHPT 4DV6T 3OPCA 4HWHA 4EV6A 1XMOT 3RX6A 3VR8A 1D1CA 3Q2MA 5JDNA 1OEDA 2VASA 1H7CA 4OYJA 3RYIE 3FBLA 5JVDE 4EAHA 4QKNA 2D0TA 4EEBA 3I0QA 4JYAT 5JRCB 2PBIA 5LYJE 5JDMA 1S94A 2H88A 2CMRA 4UXNB 3OYZA 3MKDA 2LSYA 1UCUA 1N36T 5F3JA 3AE4A 5L2LA 5ETWA 2VVNA 5JDHA 4ILUA 1OWAA 5FVKA 4U3CA 4AQYT 4BA9A 4DO0A 2W00A 4JV5T 3C4WA 3DJBA 5AQPB 1GQEA 3AE5A 4AKGA 3QK6A 2WDVA 5ABGA 1WLXA 3K1SA 3PUXF 4P0BA 3MXZA 4ZI2D 1MIYA 2YDQA 4UR9A 4GIWA 4TV9E 4YT0A 2CHOA 2LRKA 4I43B 3KVBA 3B57A 4X1IE 2BS4A 4IL9A 3OVUA 5TAOA 3LSVA 2V7MA 1WYCA 2V7IA 2E9XB 2WDQA 5H6QB 3PUZF 4AIUA 3ETVA 4I50E 4MHCA 4TUYE 4H9RC 4HFHA 3LG7A 3QB5A 4U7IA 4IE6A 3W15B 2DWKA 3P4RA 4ZS3A 4OX9T 5AQSB 3BQLA 4WBNE 3AEGA 1T98A 4J2CA 2LT3A 3A7MA 4F6RC 4HFEA 2RA1A 3ZSSA 3KVAA 3ZT5A 2MTQA 2OA5A 2ZM6T 2UXDT 3SFEA 3SWHA 1MNDA 2V7JA 4LFAT 4X65T 2LEHA 4MALA 4AKRB 3UTKA 3SS1A 1LRZA 2IMLA 4U2YA 1UX5A 5LNKA 3L3PA 4DR5T 2XQ3A 2YEVC 2I0MA 4ASKA 1HNWT 5BMVE 4PFPA 2XQ7A 2W0GA 4IE4A 3WI3A 4KI0F 3AE8A 3K3QC 2JRKA 5HAXA 4DR2T 1J5WA 3PU8A 4JI3T 3VRBA 4ISSA 2ZLYA 4HFBA 2WBLA 2UUAT 4UV8B 2YKSA 3N9QA 3A5XA 1IBLT 1CUNA 3M65A 3GWHA 4ADZA 3T1YT 4QH4A 4LF9T 2WY2A 4TZ4C 4I0UA 5FNVE 3RRWA 2W63A 3ZEFB 3AECA 1HG5A 4IREA 5AQFB 1D0ZA 3LK2B 2B1EA 2CXDA 2X0YA 2RPAA 2VQFT 3ZJ2A 4ILAA 3ZC0A 2V5CA 2XQ4A 4YXDA 1NENA 4YSYA 2Q9QC 2XJ7A 3P4SA 1KF6A 4GKKT 3AEFA 2PG8A 3RKGA 4UF0A 1T72A 4GK0E 3ZC1A 1Y64B 3RI5A 4IHJE 2CCQA 2V6YB 2D5UA 5DJQC 1HG2A 3PUAA 1HNXT 3KFWX 1JNZA 5LA6E 5H6RB 3ZMTB 4ZHQE 3UFEA 4IE0A 4O4HE 3BQIA 1UX4A 3VHLA 4QWNB 1UUSA 2E8IA 1BR4A 3E08A 2X66A 3FZKB 2WZIA 2ZM8A 3Q9DA 3PUVF 5HXHA 4WW0A 5EK2A 4CXWA 2IAKA 3HI2A 3FZLB 4IDPA 5EZYE 4XBFB 5KDMC 2EHOC 3F31A 2MBGA 5FXVA 4KHZF 2LSJA 3RIUC 4PAGA 5IWAT 2LOSA 5L47A 2CXLA 3I9WA 3CK6A 3PV0F 2GK9A 2QRXA 5LBMA 1FIOA 2K3WA 3P4PA 5M4YA 4EYUA 3AXJA 5JRCA 1XNQT 4YTPA 2DLRA 1MIVA 3AB3B 2NW8A 5LCYA 5J0ZA 3KBTA 3TKLB 4EYYR 3AEBA 2BBJA 3KV6A 5LHGB 3HKCE 4PFOA 4BAYB 4AKHA 2H89A 1R8IA 5AQTB 3VRAA 2E5LT 1HR0T 2KXPB 2D2SA 3IBPA 4O8SA 5HXSA 5HXEA 2H7VC 4HWFA 5LHHB 1HFAA 4G2AA 1G8XA 2CRBA 3AE3A 3CQGB 3HR0A 4KP3C 2X68A 4UF0B 4CI1B 5C3JA 3EDVA 2M67A 4JI2T 4QX7B 5L3EB 2AXDS 5AQJB 4NUVA 1BR1A 2Y48B 3P4QA 4DUZT 3FZHB 4LMJA 3J7Yq 4B3ST 2IC9A 4PW8A 2R6GF 4JI6T 3K3OA 2X51A 3N9NA 2QA7A 4H9NC 1N33T 3UUXB 1FMWA 3HKDE 2K24A 2LRLA 4X1YE 4YFSA 2WMNA 3RGLA 2LLYA 2C5IT 3TLSA 3N5LA 4HGAA 2UU9T 4KUMB 3OTOT 2CLYB 4B3MT 3PJAA 2DI4A 4XZCA 4CI2B 5L3FB 4GKJT 2VKHA 4A97A 3O4XE 3Q5DA 1MMNA 2D9DA 3G06A 3CIRA 4EZHA 1D0XA 3UQ4A 5DQWA 2JQHA 3E22E 4CZZB 3U78A 3ABVA 2X0LB 2C0SA 1YKEB 4Z91A 1SHZC 2XQYA 3ZN0B 4JI7T 5A1LA 1ZP0A 1IBKT 4M1PA 2BBHA 3UULA 4JI1T 3AXJB 3ONJA 5IUXA 4ZXLA 3F57A 3JADA 1NWMX 3FHNA 1WR0A 3P4WA 2VK9A 4LFBT 4N78D 5ABFA 3EHZA 1S35A 1HX1B 5FKYA 5LJMA 2QYWA 3LFMA 4FJOA 4WBOA 5FL0A 5FP3A 5CA0E 4IL4A 3UUMA 4O4JE 2CWOA 4TWHA 4YJ2E 2BS2A 2NTXA 1IAPA 3UU5A 3AAEB 2E5VA 3LJCA 2XQAA 2KWHA 2KZ7B 3JC6C 2KNDA 3RRCA 2FJBA 2LHRA 5GONE 4ZZBA 4CXYA 4PJLA 4DR3T 5FXWA 2ACXA 2MYSA 4JBWF 5FY0A 2IW5B 3B13A 2CE7A 3LBXA 1D1AA 1VRBA 1W0AA 2N1GA 3PDYA 3OJAA 3JAEA 4Q25A 2YU2A 5ABEA 3ZSTA 3QUJA 2X9WA 2VVSA 4HE8A 3B5MA 2RP4A 4UV9B 3DTOA 2V6YA 4HTEA 2A2FX 1LKXA 2E2AA 2CEAA 4JUYA 2Q9QD 1YQ4A 3IA3A 1YQ3A 2BKNA 4NIQA 5HEHA 4CXXA 1OEDE 5AQOB 4AQFA 3I9YA 2YN6A 2BVMA 2DL1A 2E9XC 1YD8G 2XY8B 4WYVA 3C4ZA 3FXEB 4JI0T 1N34T 1KNRA 5FMNA 2BVLA 5AQGB 3SFDA 1D1BA 2C5KT 3NVOA 4WNKA 1E2AA 3EDUA 4COFA 1YKHB 2JQ9A 4H9SE 2XSAA 4K0KT 4G63A 5F5WA 4OYKA 1VOMA 2KSRA 4I55E 2JIWA 2XQ9A 3IHRA 1VCTA 2J62A 4X62T 4E7ZA 1HS7A 1D0YA 1EZ3A 2XQ5A 2A9UA 3AAIA 3AA0B 4AI6A 5JR9C 2UUCT 5FVLA 3O9XA 3PJAJ 2IDOB 1J5ET 4HKAA 2HN1A 4DBRA 4IDZA 2WAUA 4P09A 5ABFB 3ZCJA 1HF8A 5CJ5A 4X20E 3Q5WA 3IF8B 1OEDC 2K5BB 3JAFA 1SUMB 3QB5K 4JI5T 3ETUA 3Q5EA 2IIUA 5HCJA 2WP9A 4DV3T 2Y8DA 1T7SA 3C50A 3TLWA 4L0RA 4ZI2C 2XM2A 5KX5E 4CN6A 4DR4T 2UXCT 2Q9QB 2UXXB 3RYHE 4O2BE 2NOXA 5JDLA 4IDOA 2LE8A 5HCMA 5LG3A 3OBVE 3ZMSB 1L0VA 2NP9A 3BK9A 3LBXB 2KMFA 1T8BA 3AE7A 4PK6A 3RKOA 3ONLC 3AA7B 2DNXA 2DHRA 4UVAB 1BR2A 5L4EA 3ZJ1A 4A5XA 4DR1T 5L3GB 5HEOA 2FBWA 1QUUA 3P50A 5LB7B 2I59A 2BZBA 2V1DB 2UUBT 2XAJB 3CQCB 5LBQB 3FZFB 1ZHCA 2J4GA 3PUQA 4YY3T 2XQ8A 4X66T 2FJDA 4DBQA 2BG9A 4EXTA 4JI8T 4OFZA 1I94T 3RIAA 5IHYA 3ANWB 2A3DA 1N32T 5AQKB 1MNEA 2W4XA 2MOZA 2ACZA 1Z0PA 3CX7B 4JEHB 4Z90A 2WDRA 4TWFA 5LMUT 4X64T 4LFCT 1E1HB 3RLFF 4DUYT 3L39A 4P0AA 4IDQA 1KEYA 3PURA 4KX6A 2NR4A 3EABA 4TX5A 5AQNB 3AE1A 3R6NA 2NW9A 4DV4T 2HHHT 3NRYA 4DR7T 4IDNA 4H9QC 3O1IA 3ZKRA 4DVDA 2VURA 2J1DG 1KNZA 1KK7A 4QXHB 3MZKB 1YW0A 5AQMB 2XAGB 3RYFE 4JLEA 3R84B 3UFGA 2V5DA 2VL8A 3RC8A 2CPTA 5J2UE 4CN4A 2X9HA 2B76A 2HPLA 4K0UA 3P7IA 2D0UA 2L9QA 4PJMA 5LOVE 5DQVA 2ES0A 4B6XA 3UT5E 3WAJA 2LSGA 1XMQT 3PUWF 1G73A 4AXPA 3O1HA 5ABHA 1SE7A 2P9BA 2XHEB 5HEUA 4QXCB 4EB6E 4C91A 2Y6XA 1CHUA 4E7SA 3NWIA 3O1JA 2JQKA 3N2OA 3KV9A 4O4LE 3GMIA 2VKDA 4UVCB 2WSSV 2MPKA 3WAKA 3MK7C 4ZS2A 2N9DA 2UXNB 2XSBA 1WFDA 2LSIA 4HFVA 3NKZA 4ZEYA 4QH1A 2XAHB 1XZYA 3MJXA 4HFIA 3LDQB 2WB5A 2V8SV 1XWMA 4IE7A 1NAFA 3RQUA 3ZYKA 4ANJA 4BJMA 1U4QA 1WCRA 3OKQA 3I1AA 4YSXA 2X9XA 4GOUA 1XDOA 3JC6D 5LXTE 4LF5T 2BG9B 2YDSA 3MA9A 1SA0E 3A8YC 3KBUA 5C8YE 3AEAA 3RYCE 1JNRA 4UELA 2WQYA 4DMVA 4U33A 2LSKA 3CVRA 1YXRA 4LMLA 2VKOA 3FXDB 4AKLA 5AQHB 2CXFA 2NW7A 2QVAA 3FBZA 3H3MA 3U3IA 5LMNT 4YHHT 2V7LA 1W09A 4EGWA 4YSZA 3RH3A 1B7TA 2WWUA 5AQVB 5JTGA 4A56A
chains in the Genus database with same CATH topology
2B1EA 2CXDA 1LKXA 1V9DA 3CQXC 2ODUA 3ONXA 4NUUA 4CI3B 2CEAA 2KT9A 3ZJ2A 2KINB 3ZC0A 3H37A 2V26A 4JUYA 2Q9QD 5JH7E 3F2EA 2Q9QC 3PE0A 4X1KE 4U74A 2DWGA 3CKDA 3C4XA 4CXXA 3S4UA 4DMWA 3ZYMA 2ZMAA 5LGNB 3LK2B 3GN5B 3NRXA 4AQFA 3PTRB 2PG8A 3I9YA 1WRDA 3CWZB 2BVMA 4UF0A 4XAXB 4GK0E 2E9XC 5J2TE 1YD8G 3HA4A 3ZC1A 1Y64B 3AA6B 4OHFA 3C4ZA 3FXEB 4IHJE 3CPZA 3HL6A 4O2AE 2CCQA 2V7KA 5FMNA 2D5UA 4MFRA 5DJQC 2BVLA 1HG2A 2LJLA 3PUAA 2IC6A 4PK5A 5LGUB 1D1BA 2C5KT 3KFWX 5JDGA 4WNKA 5LA6E 5H6RB 4Z8XA 3ZMTB 3VKGA 4ZHQE 3UFEA 4U72A 3EDUA 5AFUL 5LG4A 4IE0A 1MMAA 4O4HE 1YKHB 2DCFA 3BQIA 3C98B 5L3BB 4H9SE 1MMDA 2A72A 1UX4A 2NWBA 5JDFA 3ZCIA 2ZM2A 2PFVA 3OYXA 2WMOA 3VHLA 4G63A 4QWNB 4OYKA 2XAFB 1US7B 1VOMA 2E8IA 1BR4A 3E08A 4I55E 2X66A 3ZN1B 5CA1E 3IHRA 3N2KE 4E7ZA 1HS7A 1D0YA 1MIWA 2ZM8A 1EZ3A 2SPCA 3RPUA 1MMGA 2JPFA 4GYSA 3AAIA 3AA0B 4FI5A 2Q9QA 4AI6A 3Q9DA 5JR9C 3C64A 5LP6E 3K8PC 4IGUA 3UUNA 3O9XA 3GA8A 5HXHA 4WW0A 4QX8B 5E0OA 5JQGE 3AAAB 3V5UA 1IJ5A 4HKAA 5EK2A 4CXWA 4DBRA 4IDZA 2WAUA 4P09A 3KDSE 2IAKA 2JMHA 3ZCJA 1OXZA 1WR6A 3HI2A 3PU3A 5EZYE 2E9XA 4XBFB 5KDMC 2XASB 1HF8A 4JEUB 3N9LA 2XTLA 3I0OA 3PUGA 2VWAA 2EHOC 3Q5XA 1X79A 4PK4A 2CA5A 4X20E 3F31A 2MBGA 2CM0A 3Q5WA 5FXVA 3IF8B 5IYZE 2K5BB 2LSJA 4H63V 1FEWA 3ETUA 2YK0A 1WYBA 4QXBB 5HXRA 3CX8B 4OK0A 4PAGA 3ZMZB 2KWIB 2Y8DA 1HX8A 4ZOLE 5L3DB 5FYMA 3C50A 2LOSA 2ODVA 4BJNA 2X67A 4L0RA 1ZEEA 4ZI2C 4UVBB 5KX5E 4H9OC 2W61A 2Q9QB 4H9PC 3ZMVB 2UXXB 3RYHE 4O2BE 2CXLA 3I9WA 2NOXA 4PJJA 5FXXA 4ZI7E 5JDLA 2LE8A 2CLYC 2GK9A 3OBVE 4ERRA 3SOLA 3ZMSB 2N2NA 2VKJA 3N2GE 4EZ4A 3ZPOA 5HXCA 5LBMA 1FIOA 2NP9A 3BK9A 2YU1A 4YLHA 4IE5A 2XUEA 3KV4A 3LBXB 2KMFA 2JJ9A 3EVYA 2VB6A 5M4YA 3RC3A 4EYUA 1HCIA 3SRZA 5JRCA 2H7OA 5F8PA 3EUHA 4PK6A 3RKOA 2DLRA 3PUSA 1MIVA 3DP7A 3AB3B 2NW8A 5LCYA 2G0UA 3KBTA 5J1GA 3TKLB 3AA7B 2DNXA 4EYYR 2DHRA 3KV6A 2ZM0A 5JR9A 2E9XD 5LHGB 3ANWA 2QGSA 3CMLA 3C51A 1IJ6A 3CX6B 3HKCE 4PFOA 4TV8E 3NZPA 4BAYB 1AJ3A 4AKHA 5ADXL 2YINA 4ZI3D 4UVAB 1BR2A 3N9MA 4ZI3C 3MACA 3ZJ1A 4GK5E 2KXPB 5L3GB 2K48A 2L8KA 2D2SA 3RX6A 3N9OA 3IBPA 2EHOA 4O8SA 5HXSA 1D1CA 3Q2MA 1QUUA 5HXEA 5JDNA 2H7VC 4HN9A 2VASA 2I59A 3KINB 2BZBA 1LVFA 2V1DB 1H7CA 4OYJA 3RYIE 3FBLA 5LHHB 5JVDE 2XAJB 1HFAA 4QKNA 3CQCB 2D0TA 5LBQB 4EAHA 3I0QA 5JRCB 2PBIA 5LYJE 1ZHCA 4G2AA 1G8XA 3PUQA 5JDMA 1S94A 4L5GA 3CQGB 4DBQA 4EXTA 2CMRA 4OFZA 3HR0A 4UXNB 4KP3C 3IEEA 2K9AA 4MLKA 2X68A 5IHYA 4UF0B 3ANWB 3OYZA 4CI1B 5JR9B 3EDVA 2A3DA 5FXZA 3MKDA 2M67A 2LHNA 2LSYA 1UCUA 4QX7B 5L3EB 1MNEA 5F3JA 2MOZA 4NUVA 1Z0PA 3CX7B 1BR1A 2Y48B 4JEHB 3VKHA 3QC9A 3J7Yq 5L2LA 5ETWA 4GYRA 2IC9A 4PW8A 1E1HB 4P0AA 3K3OA 2X51A 3PURA 5JDHA 4ILUA 3N9NA 1OWAA 2QA7A 4H9NC 4HEAA 4TX5A 3FB2A 4BA9A 3R6NA 3UUXB 1FMWA 2W00A 4DO0A 3HKDE 2K24A 3C4WA 3DJBA 2EHOD 3VU7H 2NW9A 4X1YE 3E0ZA 3NRYA 5FY7A 4AKGA 3QK6A 4H9QC 2WMNA 4YFSA 3ESLA 2C5IT 3O1IA 4KBMB 2XAQB 3N5LA 5LGTB 1WLXA 4HGAA 4DVDA 4KUMB 2J1DG 1KNZA 4P0BA 2CLYB 1KK7A 4QXHB 5LJNA 2L3LA 2LOPA 3MZKB 3H3AA 3MXZA 1YW0A 4ZI2D 2DI4A 1MIYA 1BR0A 4XZCA 4A56A 2XAGB 4CI2B 5L3FB 3RYFE 2VKHA 4JLEA 4GIWA 4O4IE 4EIWA 3O4XE 3R84B 4TV9E 2VL8A 1ZV4X 3RC8A 3GN5A 2NTYA 2C5JA 1MMNA 4I43B 3ZLIA 3KVBA 4EZHA 1D0XA 3B57A 4X1IE 4ISTA 3ZYLA 5J2UE 2X9HA 5DQWA 2HPLA 5HWYA 4PNIA 5EK3A 4K0UA 3E22E 5TAOA 3P7IA 2D0UA 4V1Av 3U78A 3BQKA 4CZZB 5JREA 5HWXA 2W62A 2WM9A 1WYCA 2LM9A 2L9QA 2V7IA 2E9XB 2V7MA 4PJMA 5CB4E 5LHIB 5H6QB 5LOVE 3LK3B 5KMGP 5DQVA 2ES0A 4B6XA 3UT5E 2BDEA 3ETVA 4EOZB 3WAJA 4I50E 2LSGA 4MHCA 2Z6EA 4H9RC 4PJNA 1G73A 4TUYE 4UEMA 4CQIA 4AKIA 5DABA 2X0LB 3LG7A 4AXPA 3O1HA 2C0SA 1YKEB 2P9BA 1SHZC 2XHEB 4YJ3E 4IE6A 3W15B 2XQYA 4QXCB 2DWKA 4ZS3A 4EB6E 1LVKA 4C91A 2Y6XA 4KMCA 4E7SA 3ZN0B 4IIJE 4UIGA 3O1JA 3BQLA 4WBNE 3NBXX 1T98A 4J2CA 2LT3A 4C90A 4F6RC 5A1LA 5HYAA 3N2OA 3KV9A 4M1PA 4O4LE 2RA1A 3UULA 1ZKEA 3GMIA 3KVAA 2VKDA 2MTQA 4UVCB 3HKBE 2OA5A 2WSSV 1IZNB 3WAKA 3MK7C 4ZS2A 3SWHA 3F57A 2JQQA 2N9DA 2UXNB 1MNDA 1NWMX 2HPJA 2V7JA 3NZQA 5JDQA 3FHNA 2LSIA 4HFVA 2VK9A 2LEHA 4N78D 4MALA 4AKRB 3UTKA 3SS1A 2XAHB 1LRZA 3AA1B 3MJXA 1S35A 1UX5A 3J9X1 5LJMA 5LNKA 3L3PA 3LFMA 2PJQA 4FJOA 4WBOA 2YEVC 5FP3A 3V5SA 5CA0E 4ASKA 2CWYA 4MBQA 2EHOB 3UUMA 5BMVE 1U5PA 4QHOA 3K3NA 4PFPA 2W0GA 4O4JE 2CWOA 4IE4A 4YJ2E 4IE7A 1NAFA 3WI3A 3K3QC 2NTXA 1IAPA 3ZYKA 4ANJA 3AAEB 2JRKA 3LJCA 5HAXA 2KWHA 4BJMA 1U4QA 1HTJF 2KZ7B 3OKQA 3I1AA 3PU8A 2X9XA 4GOUA 4AQFC 3JC6D 2HH7A 2JMKA 4DNDA 3JC6C 2KNDA 3RRCA 3LK42 5LXTE 2LHRA 5GONE 4CXYA 4ISSA 4PJLA 3MA9A 1SA0E 2ZLYA 1FMVA 4YHJA 5FXWA 3KBUA 3D0TA 5C8YE 5FY1A 2ACXA 2MYSA 4I4TE 5FY0A 2IW5B 2WBLA 3N9PA 3B13A 4UV8B 2CE7A 4TN7B 3RYCE 5L3CB 3LBXA 4UELA 1D1AA 3HKEE 1VRBA 3P8CD 4DMVA 2KLQA 2LSKA 3CVRA 2N1GA 3L09A 3A5XA 1QSDA 3N9QA 3T8OA 3PDYA 1CUNA 4AQGA 2VKOA 3OJAA 3FXDB 4AKLA 4L9IA 2CXFA 2NW7A 3M65A 3GWHA 4ADZA 3FBZA 3ZMUB 2YU2A 3U3IA 3AVSA 3AVRA 4H63H 2V7LA 3QUJA 2H3RA 2X9WA 4TZ4C 5FNVE 4HE8A 2X9YA 3KV5A 5EK4A 3RRWA 2W63A 3ZEFB 1O3XA 3RH3A 2RP4A 1B7TA 1HG5A 4UV9B 2WWUA 3DTOA 4HTEA 1D0ZA 2A2FX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y6X A;  2KND A;  2KMF A; 
#chains in the Genus database with same CATH topology
 4JI4 T;  1V9D A;  3CQX C;  2ODU A;  3ONX A;  3T1H T;  2KT9 A;  2KIN B;  2V26 A;  1UK5 A;  5JH7 E;  3F2E A;  3PE0 A;  3CKD A;  3C4X A;  3S4U A;  3ZYM A;  4ILC A;  3JCF A;  3RIF A;  3NRX A;  3PTR B;  1XNR T;  1WRD A;  3CWZ B;  4XAX B;  5J2T E;  3HA4 A;  2LM2 A;  4OHF A;  2IHR 1;  4ZZC A;  3CPZ A;  3HL6 A;  2V7K A;  4MFR A;  2IC6 A;  1QLB A;  4PK5 A;  5LGU B;  2IUB A;  1UGO A;  4Z8X A;  4U72 A;  3X1D A;  5LG4 A;  2DCF A;  5L3B B;  1MMD A;  2A72 A;  4YTM A;  5JDF A;  3ZCI A;  2ZM2 A;  2WMO A;  2BKO A;  1US7 B;  3ZN1 B;  3N2K E;  1MIW A;  2SPC A;  1MMG A;  2VL0 A;  4GYS A;  2HN2 A;  2Q9Q A;  1XDP A;  2LKH A;  5LP6 E;  3UU6 A;  2I6H A;  3GA8 A;  4QX8 B;  1X9B A;  3AAA B;  3AE2 A;  4HWD A;  2JMH A;  2XAS B;  3PUG A;  2VWA A;  1X79 A;  4PK4 A;  2CA5 A;  5IYZ E;  4H63 V;  1FEW A;  2YK0 A;  4QXB B;  3CX8 B;  4OK0 A;  3RQW A;  1HX8 A;  4ZOL E;  5HEJ A;  5L3D B;  3AED A;  5FYM A;  2ODV A;  2X67 A;  1ZEE A;  4UVB B;  2WZH A;  3ZT6 A;  5FXX A;  4P1N A;  4ZI7 E;  2N2N A;  3ZPO A;  5HXC A;  2MAW A;  2FJE A;  5CFB A;  2YU1 A;  2J47 A;  2JJ9 A;  3EVY A;  2VB6 A;  3SRZ A;  2H7O A;  3FZM B;  3DP7 A;  5J1G A;  3ANW A;  3CML A;  4TV8 E;  1AJ3 A;  3L8R A;  1IBM T;  4ZI3 C;  4LF7 T;  3MAC A;  4GK5 E;  2K48 A;  2L8K A;  3N9O A;  2EHO A;  2CBI A;  2M6I A;  2FJA A;  4HN9 A;  3KIN B;  4DID B;  3AE6 A;  1LVF A;  3RIU A;  4IT4 A;  2BKP A;  4DV7 T;  3EAM A;  4EED A;  2YOE A;  4L5G A;  3IEE A;  4F8H A;  2K9A A;  4MLK A;  5JR9 B;  4HFC A;  5FXZ A;  2LHN A;  2OV9 A;  2WU5 A;  3VKH A;  3QC9 A;  4GYR A;  1W9R A;  1OED B;  4HEA A;  3FB2 A;  5HEG A;  2EHO D;  3VU7 H;  3E0Z A;  5FY7 A;  2W2U A;  1Y01 A;  3ESL A;  5C2T A;  1I6Z A;  4U7Y A;  4KBM B;  2XAQ B;  5LGT B;  2F4V T;  5LJN A;  2L3L A;  2LOP A;  3H3A A;  1BR0 A;  4O4I E;  4EIW A;  1ZV4 X;  3GN5 A;  2NTY A;  2C5J A;  1VCS A;  3ZLI A;  4IST A;  3ZYL A;  5HWY A;  2AE9 A;  4PNI A;  2LKG A;  5EK3 A;  4V1A v;  3BQK A;  5JRE A;  5HWX A;  2W62 A;  4LF6 T;  2WM9 A;  2LM9 A;  5LHI B;  5CB4 E;  3LK3 B;  5KMG P;  2XM1 A;  1ZOY A;  4DV5 T;  2BDE A;  4EOZ B;  2Z6E A;  4PJN A;  4AKI A;  4UEM A;  4CQI A;  5DAB A;  3PUY F;  4YJ3 E;  3M3Z B;  1LVK A;  4KMC A;  4IIJ E;  4UIG A;  2W67 A;  3NBX X;  4C90 A;  5HYA A;  2WWV A;  4YTN A;  1ZKE A;  3TLT A;  4CN1 A;  3HKB E;  1IZN B;  2W66 A;  1DU2 A;  2WCA A;  5FL1 A;  2JQQ A;  3ZT7 A;  2HPJ A;  3NZQ A;  5JDQ A;  4NXN T;  3TLU A;  3UUB A;  1E7P A;  4HWI B;  4LF8 T;  3AA1 B;  3J9X 1;  5AQR B;  1KFY A;  2X0H A;  2OLT A;  2PJQ A;  3V5S A;  2CWY A;  4MBQ A;  2EHO B;  1U5P A;  4QHO A;  3K3N A;  1UUR A;  1M62 A;  1HTJ F;  4NPP A;  2CBJ A;  4AQF C;  2HH7 A;  2JMK A;  4DND A;  2PTF A;  3LK4 2;  1FMV A;  4U2Z A;  4YHJ A;  1HNZ T;  3D0T A;  5FY1 A;  4I4T E;  3N9P A;  2WS3 A;  4TN7 B;  5L3C B;  3HKE E;  3P8C D;  2KLQ A;  3L09 A;  2V6X A;  3T8O A;  1QSD A;  4AQG A;  4L9I A;  3ZMU B;  3AVS A;  5CGM A;  3UQ7 A;  3AVR A;  4H63 H;  3TLV A;  2H3R A;  4HWC A;  2X9Y A;  3KV5 A;  5EK4 A;  5L4H A;  2XPK A;  1O3X A;  4TWD A;  4NXM T;  4DR6 T;  5AQL B;  1Z8U A;  4NUU A;  4CI3 B;  3RF1 A;  2YDR A;  3H37 A;  2XQ6 A;  4X1K E;  4AIS A;  4U74 A;  2DWG A;  4DMW A;  4DV0 T;  4DV2 T;  1FJG T;  2ZMA A;  5LGN B;  3QNU A;  3UU4 A;  3GN5 B;  5AQU B;  3UU3 A;  3AEE A;  5AQQ B;  3UU8 A;  3AA6 B;  4O2A E;  2BG9 E;  2LJL A;  5JDG A;  3VKG A;  5AFU L;  3AE9 A;  1M7K A;  2BS3 A;  1MMA A;  3C98 B;  2FUP A;  1KNP A;  2NWB A;  2PFV A;  3OYX A;  3VR9 A;  2XAF B;  4B3R T;  2VQE T;  4A98 A;  2M6B A;  5CA1 E;  4B3T T;  4LMK A;  5AQI B;  2WU2 A;  3RPU A;  2JPF A;  4FI5 A;  3C64 A;  3K8P C;  4IGU A;  3UUN A;  5E0O A;  5JQG E;  3V5U A;  1IJ5 A;  2XZE A;  3KDS E;  1NEK A;  1W0B A;  1WR6 A;  1OXZ A;  3PU3 A;  2E9X A;  4TNW A;  4JEU B;  5KXJ A;  3N9L A;  2XTL A;  3I0O A;  3Q5X A;  3RHW A;  2UXB T;  2CM0 A;  4LF4 T;  4U31 A;  2CHN A;  1J1J A;  1WYB A;  5HXR A;  3ZMZ B;  2KWI B;  4BJN A;  4X5T A;  4H9O C;  2W61 A;  2BG9 C;  4H9P C;  3ZMV B;  4HFD A;  4PJJ A;  4DV1 T;  3QOF A;  2CLY C;  3EI0 A;  4ERR A;  3SOL A;  2VKJ A;  3N2G E;  4EZ4 A;  4QH5 A;  4ILB A;  4YLH A;  4IE5 A;  2XUE A;  3KV4 A;  5BR8 T;  4WZX A;  3RC3 A;  1HCI A;  5F8P A;  3EUH A;  3PUS A;  2G0U A;  2ZM0 A;  5JR9 A;  2E9X D;  4TNV A;  2QGS A;  3C51 A;  1IJ6 A;  3CX6 B;  3NZP A;  5ADX L;  2YIN A;  4ZI3 D;  3N9M A;  4KHP T;  4DV6 T;  3OPC A;  4HWH A;  4EV6 A;  1XMO T;  3RX6 A;  3VR8 A;  1D1C A;  3Q2M A;  5JDN A;  1OED A;  2VAS A;  1H7C A;  4OYJ A;  3RYI E;  3FBL A;  5JVD E;  4EAH A;  4QKN A;  2D0T A;  4EEB A;  3I0Q A;  4JYA T;  5JRC B;  2PBI A;  5LYJ E;  5JDM A;  1S94 A;  2H88 A;  2CMR A;  4UXN B;  3OYZ A;  3MKD A;  2LSY A;  1UCU A;  1N36 T;  5F3J A;  3AE4 A;  5L2L A;  5ETW A;  2VVN A;  5JDH A;  4ILU A;  1OWA A;  5FVK A;  4U3C A;  4AQY T;  4BA9 A;  4DO0 A;  2W00 A;  4JV5 T;  3C4W A;  3DJB A;  5AQP B;  1GQE A;  3AE5 A;  4AKG A;  3QK6 A;  2WDV A;  5ABG A;  1WLX A;  3K1S A;  3PUX F;  4P0B A;  3MXZ A;  4ZI2 D;  1MIY A;  2YDQ A;  4UR9 A;  4GIW A;  4TV9 E;  4YT0 A;  2CHO A;  2LRK A;  4I43 B;  3KVB A;  3B57 A;  4X1I E;  2BS4 A;  4IL9 A;  3OVU A;  5TAO A;  3LSV A;  2V7M A;  1WYC A;  2V7I A;  2E9X B;  2WDQ A;  5H6Q B;  3PUZ F;  4AIU A;  3ETV A;  4I50 E;  4MHC A;  4TUY E;  4H9R C;  4HFH A;  3LG7 A;  3QB5 A;  4U7I A;  4IE6 A;  3W15 B;  2DWK A;  3P4R A;  4ZS3 A;  4OX9 T;  5AQS B;  3BQL A;  4WBN E;  3AEG A;  1T98 A;  4J2C A;  2LT3 A;  3A7M A;  4F6R C;  4HFE A;  2RA1 A;  3ZSS A;  3KVA A;  3ZT5 A;  2MTQ A;  2OA5 A;  2ZM6 T;  2UXD T;  3SFE A;  3SWH A;  1MND A;  2V7J A;  4LFA T;  4X65 T;  2LEH A;  4MAL A;  4AKR B;  3UTK A;  3SS1 A;  1LRZ A;  2IML A;  4U2Y A;  1UX5 A;  5LNK A;  3L3P A;  4DR5 T;  2XQ3 A;  2YEV C;  2I0M A;  4ASK A;  1HNW T;  5BMV E;  4PFP A;  2XQ7 A;  2W0G A;  4IE4 A;  3WI3 A;  4KI0 F;  3AE8 A;  3K3Q C;  2JRK A;  5HAX A;  4DR2 T;  1J5W A;  3PU8 A;  4JI3 T;  3VRB A;  4ISS A;  2ZLY A;  4HFB A;  2WBL A;  2UUA T;  4UV8 B;  2YKS A;  3N9Q A;  3A5X A;  1IBL T;  1CUN A;  3M65 A;  3GWH A;  4ADZ A;  3T1Y T;  4QH4 A;  4LF9 T;  2WY2 A;  4TZ4 C;  4I0U A;  5FNV E;  3RRW A;  2W63 A;  3ZEF B;  3AEC A;  1HG5 A;  4IRE A;  5AQF B;  1D0Z A;  3LK2 B;  2B1E A;  2CXD A;  2X0Y A;  2RPA A;  2VQF T;  3ZJ2 A;  4ILA A;  3ZC0 A;  2V5C A;  2XQ4 A;  4YXD A;  1NEN A;  4YSY A;  2Q9Q C;  2XJ7 A;  3P4S A;  1KF6 A;  4GKK T;  3AEF A;  2PG8 A;  3RKG A;  4UF0 A;  1T72 A;  4GK0 E;  3ZC1 A;  1Y64 B;  3RI5 A;  4IHJ E;  2CCQ A;  2V6Y B;  2D5U A;  5DJQ C;  1HG2 A;  3PUA A;  1HNX T;  3KFW X;  1JNZ A;  5LA6 E;  5H6R B;  3ZMT B;  4ZHQ E;  3UFE A;  4IE0 A;  4O4H E;  3BQI A;  1UX4 A;  3VHL A;  4QWN B;  1UUS A;  2E8I A;  1BR4 A;  3E08 A;  2X66 A;  3FZK B;  2WZI A;  2ZM8 A;  3Q9D A;  3PUV F;  5HXH A;  4WW0 A;  5EK2 A;  4CXW A;  2IAK A;  3HI2 A;  3FZL B;  4IDP A;  5EZY E;  4XBF B;  5KDM C;  2EHO C;  3F31 A;  2MBG A;  5FXV A;  4KHZ F;  2LSJ A;  3RIU C;  4PAG A;  5IWA T;  2LOS A;  5L47 A;  2CXL A;  3I9W A;  3CK6 A;  3PV0 F;  2GK9 A;  2QRX A;  5LBM A;  1FIO A;  2K3W A;  3P4P A;  5M4Y A;  4EYU A;  3AXJ A;  5JRC A;  1XNQ T;  4YTP A;  2DLR A;  1MIV A;  3AB3 B;  2NW8 A;  5LCY A;  5J0Z A;  3KBT A;  3TKL B;  4EYY R;  3AEB A;  2BBJ A;  3KV6 A;  5LHG B;  3HKC E;  4PFO A;  4BAY B;  4AKH A;  2H89 A;  1R8I A;  5AQT B;  3VRA A;  2E5L T;  1HR0 T;  2KXP B;  2D2S A;  3IBP A;  4O8S A;  5HXS A;  5HXE A;  2H7V C;  4HWF A;  5LHH B;  1HFA A;  4G2A A;  1G8X A;  2CRB A;  3AE3 A;  3CQG B;  3HR0 A;  4KP3 C;  2X68 A;  4UF0 B;  4CI1 B;  5C3J A;  3EDV A;  2M67 A;  4JI2 T;  4QX7 B;  5L3E B;  2AXD S;  5AQJ B;  4NUV A;  1BR1 A;  2Y48 B;  3P4Q A;  4DUZ T;  3FZH B;  4LMJ A;  3J7Y q;  4B3S T;  2IC9 A;  4PW8 A;  2R6G F;  4JI6 T;  3K3O A;  2X51 A;  3N9N A;  2QA7 A;  4H9N C;  1N33 T;  3UUX B;  1FMW A;  3HKD E;  2K24 A;  2LRL A;  4X1Y E;  4YFS A;  2WMN A;  3RGL A;  2LLY A;  2C5I T;  3TLS A;  3N5L A;  4HGA A;  2UU9 T;  4KUM B;  3OTO T;  2CLY B;  4B3M T;  3PJA A;  2DI4 A;  4XZC A;  4CI2 B;  5L3F B;  4GKJ T;  2VKH A;  4A97 A;  3O4X E;  3Q5D A;  1MMN A;  2D9D A;  3G06 A;  3CIR A;  4EZH A;  1D0X A;  3UQ4 A;  5DQW A;  2JQH A;  3E22 E;  4CZZ B;  3U78 A;  3ABV A;  2X0L B;  2C0S A;  1YKE B;  4Z91 A;  1SHZ C;  2XQY A;  3ZN0 B;  4JI7 T;  5A1L A;  1ZP0 A;  1IBK T;  4M1P A;  2BBH A;  3UUL A;  4JI1 T;  3AXJ B;  3ONJ A;  5IUX A;  4ZXL A;  3F57 A;  3JAD A;  1NWM X;  3FHN A;  1WR0 A;  3P4W A;  2VK9 A;  4LFB T;  4N78 D;  5ABF A;  3EHZ A;  1S35 A;  1HX1 B;  5FKY A;  5LJM A;  2QYW A;  3LFM A;  4FJO A;  4WBO A;  5FL0 A;  5FP3 A;  5CA0 E;  4IL4 A;  3UUM A;  4O4J E;  2CWO A;  4TWH A;  4YJ2 E;  2BS2 A;  2NTX A;  1IAP A;  3UU5 A;  3AAE B;  2E5V A;  3LJC A;  2XQA A;  2KWH A;  2KZ7 B;  3JC6 C;  2KND A;  3RRC A;  2FJB A;  2LHR A;  5GON E;  4ZZB A;  4CXY A;  4PJL A;  4DR3 T;  5FXW A;  2ACX A;  2MYS A;  4JBW F;  5FY0 A;  2IW5 B;  3B13 A;  2CE7 A;  3LBX A;  1D1A A;  1VRB A;  1W0A A;  2N1G A;  3PDY A;  3OJA A;  3JAE A;  4Q25 A;  2YU2 A;  5ABE A;  3ZST A;  3QUJ A;  2X9W A;  2VVS A;  4HE8 A;  3B5M A;  2RP4 A;  4UV9 B;  3DTO A;  2V6Y A;  4HTE A;  2A2F X;  1LKX A;  2E2A A;  2CEA A;  4JUY A;  2Q9Q D;  1YQ4 A;  3IA3 A;  1YQ3 A;  2BKN A;  4NIQ A;  5HEH A;  4CXX A;  1OED E;  5AQO B;  4AQF A;  3I9Y A;  2YN6 A;  2BVM A;  2DL1 A;  2E9X C;  1YD8 G;  2XY8 B;  4WYV A;  3C4Z A;  3FXE B;  4JI0 T;  1N34 T;  1KNR A;  5FMN A;  2BVL A;  5AQG B;  3SFD A;  1D1B A;  2C5K T;  3NVO A;  4WNK A;  1E2A A;  3EDU A;  4COF A;  1YKH B;  2JQ9 A;  4H9S E;  2XSA A;  4K0K T;  4G63 A;  5F5W A;  4OYK A;  1VOM A;  2KSR A;  4I55 E;  2JIW A;  2XQ9 A;  3IHR A;  1VCT A;  2J62 A;  4X62 T;  4E7Z A;  1HS7 A;  1D0Y A;  1EZ3 A;  2XQ5 A;  2A9U A;  3AAI A;  3AA0 B;  4AI6 A;  5JR9 C;  2UUC T;  5FVL A;  3O9X A;  3PJA J;  2IDO B;  1J5E T;  4HKA A;  2HN1 A;  4DBR A;  4IDZ A;  2WAU A;  4P09 A;  5ABF B;  3ZCJ A;  1HF8 A;  5CJ5 A;  4X20 E;  3Q5W A;  3IF8 B;  1OED C;  2K5B B;  3JAF A;  1SUM B;  3QB5 K;  4JI5 T;  3ETU A;  3Q5E A;  2IIU A;  5HCJ A;  2WP9 A;  4DV3 T;  2Y8D A;  1T7S A;  3C50 A;  3TLW A;  4L0R A;  4ZI2 C;  2XM2 A;  5KX5 E;  4CN6 A;  4DR4 T;  2UXC T;  2Q9Q B;  2UXX B;  3RYH E;  4O2B E;  2NOX A;  5JDL A;  4IDO A;  2LE8 A;  5HCM A;  5LG3 A;  3OBV E;  3ZMS B;  1L0V A;  2NP9 A;  3BK9 A;  3LBX B;  2KMF A;  1T8B A;  3AE7 A;  4PK6 A;  3RKO A;  3ONL C;  3AA7 B;  2DNX A;  2DHR A;  4UVA B;  1BR2 A;  5L4E A;  3ZJ1 A;  4A5X A;  4DR1 T;  5L3G B;  5HEO A;  2FBW A;  1QUU A;  3P50 A;  5LB7 B;  2I59 A;  2BZB A;  2V1D B;  2UUB T;  2XAJ B;  3CQC B;  5LBQ B;  3FZF B;  1ZHC A;  2J4G A;  3PUQ A;  4YY3 T;  2XQ8 A;  4X66 T;  2FJD A;  4DBQ A;  2BG9 A;  4EXT A;  4JI8 T;  4OFZ A;  1I94 T;  3RIA A;  5IHY A;  3ANW B;  2A3D A;  1N32 T;  5AQK B;  1MNE A;  2W4X A;  2MOZ A;  2ACZ A;  1Z0P A;  3CX7 B;  4JEH B;  4Z90 A;  2WDR A;  4TWF A;  5LMU T;  4X64 T;  4LFC T;  1E1H B;  3RLF F;  4DUY T;  3L39 A;  4P0A A;  4IDQ A;  1KEY A;  3PUR A;  4KX6 A;  2NR4 A;  3EAB A;  4TX5 A;  5AQN B;  3AE1 A;  3R6N A;  2NW9 A;  4DV4 T;  2HHH T;  3NRY A;  4DR7 T;  4IDN A;  4H9Q C;  3O1I A;  3ZKR A;  4DVD A;  2VUR A;  2J1D G;  1KNZ A;  1KK7 A;  4QXH B;  3MZK B;  1YW0 A;  5AQM B;  2XAG B;  3RYF E;  4JLE A;  3R84 B;  3UFG A;  2V5D A;  2VL8 A;  3RC8 A;  2CPT A;  5J2U E;  4CN4 A;  2X9H A;  2B76 A;  2HPL A;  4K0U A;  3P7I A;  2D0U A;  2L9Q A;  4PJM A;  5LOV E;  5DQV A;  2ES0 A;  4B6X A;  3UT5 E;  3WAJ A;  2LSG A;  1XMQ T;  3PUW F;  1G73 A;  4AXP A;  3O1H A;  5ABH A;  1SE7 A;  2P9B A;  2XHE B;  5HEU A;  4QXC B;  4EB6 E;  4C91 A;  2Y6X A;  1CHU A;  4E7S A;  3NWI A;  3O1J A;  2JQK A;  3N2O A;  3KV9 A;  4O4L E;  3GMI A;  2VKD A;  4UVC B;  2WSS V;  2MPK A;  3WAK A;  3MK7 C;  4ZS2 A;  2N9D A;  2UXN B;  2XSB A;  1WFD A;  2LSI A;  4HFV A;  3NKZ A;  4ZEY A;  4QH1 A;  2XAH B;  1XZY A;  3MJX A;  4HFI A;  3LDQ B;  2WB5 A;  2V8S V;  1XWM A;  4IE7 A;  1NAF A;  3RQU A;  3ZYK A;  4ANJ A;  4BJM A;  1U4Q A;  1WCR A;  3OKQ A;  3I1A A;  4YSX A;  2X9X A;  4GOU A;  1XDO A;  3JC6 D;  5LXT E;  4LF5 T;  2BG9 B;  2YDS A;  3MA9 A;  1SA0 E;  3A8Y C;  3KBU A;  5C8Y E;  3AEA A;  3RYC E;  1JNR A;  4UEL A;  2WQY A;  4DMV A;  4U33 A;  2LSK A;  3CVR A;  1YXR A;  4LML A;  2VKO A;  3FXD B;  4AKL A;  5AQH B;  2CXF A;  2NW7 A;  2QVA A;  3FBZ A;  3H3M A;  3U3I A;  5LMN T;  4YHH T;  2V7L A;  1W09 A;  4EGW A;  4YSZ A;  3RH3 A;  1B7T A;  2WWU A;  5AQV B;  5JTG A;  4A56 A; 
#chains in the Genus database with same CATH homology
 2B1E A;  2CXD A;  1LKX A;  1V9D A;  3CQX C;  2ODU A;  3ONX A;  4NUU A;  4CI3 B;  2CEA A;  2KT9 A;  3ZJ2 A;  2KIN B;  3ZC0 A;  3H37 A;  2V26 A;  4JUY A;  2Q9Q D;  5JH7 E;  3F2E A;  2Q9Q C;  3PE0 A;  4X1K E;  4U74 A;  2DWG A;  3CKD A;  3C4X A;  4CXX A;  3S4U A;  4DMW A;  3ZYM A;  2ZMA A;  5LGN B;  3LK2 B;  3GN5 B;  3NRX A;  4AQF A;  3PTR B;  2PG8 A;  3I9Y A;  1WRD A;  3CWZ B;  2BVM A;  4UF0 A;  4XAX B;  4GK0 E;  2E9X C;  5J2T E;  1YD8 G;  3HA4 A;  3ZC1 A;  1Y64 B;  3AA6 B;  4OHF A;  3C4Z A;  3FXE B;  4IHJ E;  3CPZ A;  3HL6 A;  4O2A E;  2CCQ A;  2V7K A;  5FMN A;  2D5U A;  4MFR A;  5DJQ C;  2BVL A;  1HG2 A;  2LJL A;  3PUA A;  2IC6 A;  4PK5 A;  5LGU B;  1D1B A;  2C5K T;  3KFW X;  5JDG A;  4WNK A;  5LA6 E;  5H6R B;  4Z8X A;  3ZMT B;  3VKG A;  4ZHQ E;  3UFE A;  4U72 A;  3EDU A;  5AFU L;  5LG4 A;  4IE0 A;  1MMA A;  4O4H E;  1YKH B;  2DCF A;  3BQI A;  3C98 B;  5L3B B;  4H9S E;  1MMD A;  2A72 A;  1UX4 A;  2NWB A;  5JDF A;  3ZCI A;  2ZM2 A;  2PFV A;  3OYX A;  2WMO A;  3VHL A;  4G63 A;  4QWN B;  4OYK A;  2XAF B;  1US7 B;  1VOM A;  2E8I A;  1BR4 A;  3E08 A;  4I55 E;  2X66 A;  3ZN1 B;  5CA1 E;  3IHR A;  3N2K E;  4E7Z A;  1HS7 A;  1D0Y A;  1MIW A;  2ZM8 A;  1EZ3 A;  2SPC A;  3RPU A;  1MMG A;  2JPF A;  4GYS A;  3AAI A;  3AA0 B;  4FI5 A;  2Q9Q A;  4AI6 A;  3Q9D A;  5JR9 C;  3C64 A;  5LP6 E;  3K8P C;  4IGU A;  3UUN A;  3O9X A;  3GA8 A;  5HXH A;  4WW0 A;  4QX8 B;  5E0O A;  5JQG E;  3AAA B;  3V5U A;  1IJ5 A;  4HKA A;  5EK2 A;  4CXW A;  4DBR A;  4IDZ A;  2WAU A;  4P09 A;  3KDS E;  2IAK A;  2JMH A;  3ZCJ A;  1OXZ A;  1WR6 A;  3HI2 A;  3PU3 A;  5EZY E;  2E9X A;  4XBF B;  5KDM C;  2XAS B;  1HF8 A;  4JEU B;  3N9L A;  2XTL A;  3I0O A;  3PUG A;  2VWA A;  2EHO C;  3Q5X A;  1X79 A;  4PK4 A;  2CA5 A;  4X20 E;  3F31 A;  2MBG A;  2CM0 A;  3Q5W A;  5FXV A;  3IF8 B;  5IYZ E;  2K5B B;  2LSJ A;  4H63 V;  1FEW A;  3ETU A;  2YK0 A;  1WYB A;  4QXB B;  5HXR A;  3CX8 B;  4OK0 A;  4PAG A;  3ZMZ B;  2KWI B;  2Y8D A;  1HX8 A;  4ZOL E;  5L3D B;  5FYM A;  3C50 A;  2LOS A;  2ODV A;  4BJN A;  2X67 A;  4L0R A;  1ZEE A;  4ZI2 C;  4UVB B;  5KX5 E;  4H9O C;  2W61 A;  2Q9Q B;  4H9P C;  3ZMV B;  2UXX B;  3RYH E;  4O2B E;  2CXL A;  3I9W A;  2NOX A;  4PJJ A;  5FXX A;  4ZI7 E;  5JDL A;  2LE8 A;  2CLY C;  2GK9 A;  3OBV E;  4ERR A;  3SOL A;  3ZMS B;  2N2N A;  2VKJ A;  3N2G E;  4EZ4 A;  3ZPO A;  5HXC A;  5LBM A;  1FIO A;  2NP9 A;  3BK9 A;  2YU1 A;  4YLH A;  4IE5 A;  2XUE A;  3KV4 A;  3LBX B;  2KMF A;  2JJ9 A;  3EVY A;  2VB6 A;  5M4Y A;  3RC3 A;  4EYU A;  1HCI A;  3SRZ A;  5JRC A;  2H7O A;  5F8P A;  3EUH A;  4PK6 A;  3RKO A;  2DLR A;  3PUS A;  1MIV A;  3DP7 A;  3AB3 B;  2NW8 A;  5LCY A;  2G0U A;  3KBT A;  5J1G A;  3TKL B;  3AA7 B;  2DNX A;  4EYY R;  2DHR A;  3KV6 A;  2ZM0 A;  5JR9 A;  2E9X D;  5LHG B;  3ANW A;  2QGS A;  3CML A;  3C51 A;  1IJ6 A;  3CX6 B;  3HKC E;  4PFO A;  4TV8 E;  3NZP A;  4BAY B;  1AJ3 A;  4AKH A;  5ADX L;  2YIN A;  4ZI3 D;  4UVA B;  1BR2 A;  3N9M A;  4ZI3 C;  3MAC A;  3ZJ1 A;  4GK5 E;  2KXP B;  5L3G B;  2K48 A;  2L8K A;  2D2S A;  3RX6 A;  3N9O A;  3IBP A;  2EHO A;  4O8S A;  5HXS A;  1D1C A;  3Q2M A;  1QUU A;  5HXE A;  5JDN A;  2H7V C;  4HN9 A;  2VAS A;  2I59 A;  3KIN B;  2BZB A;  1LVF A;  2V1D B;  1H7C A;  4OYJ A;  3RYI E;  3FBL A;  5LHH B;  5JVD E;  2XAJ B;  1HFA A;  4QKN A;  3CQC B;  2D0T A;  5LBQ B;  4EAH A;  3I0Q A;  5JRC B;  2PBI A;  5LYJ E;  1ZHC A;  4G2A A;  1G8X A;  3PUQ A;  5JDM A;  1S94 A;  4L5G A;  3CQG B;  4DBQ A;  4EXT A;  2CMR A;  4OFZ A;  3HR0 A;  4UXN B;  4KP3 C;  3IEE A;  2K9A A;  4MLK A;  2X68 A;  5IHY A;  4UF0 B;  3ANW B;  3OYZ A;  4CI1 B;  5JR9 B;  3EDV A;  2A3D A;  5FXZ A;  3MKD A;  2M67 A;  2LHN A;  2LSY A;  1UCU A;  4QX7 B;  5L3E B;  1MNE A;  5F3J A;  2MOZ A;  4NUV A;  1Z0P A;  3CX7 B;  1BR1 A;  2Y48 B;  4JEH B;  3VKH A;  3QC9 A;  3J7Y q;  5L2L A;  5ETW A;  4GYR A;  2IC9 A;  4PW8 A;  1E1H B;  4P0A A;  3K3O A;  2X51 A;  3PUR A;  5JDH A;  4ILU A;  3N9N A;  1OWA A;  2QA7 A;  4H9N C;  4HEA A;  4TX5 A;  3FB2 A;  4BA9 A;  3R6N A;  3UUX B;  1FMW A;  2W00 A;  4DO0 A;  3HKD E;  2K24 A;  3C4W A;  3DJB A;  2EHO D;  3VU7 H;  2NW9 A;  4X1Y E;  3E0Z A;  3NRY A;  5FY7 A;  4AKG A;  3QK6 A;  4H9Q C;  2WMN A;  4YFS A;  3ESL A;  2C5I T;  3O1I A;  4KBM B;  2XAQ B;  3N5L A;  5LGT B;  1WLX A;  4HGA A;  4DVD A;  4KUM B;  2J1D G;  1KNZ A;  4P0B A;  2CLY B;  1KK7 A;  4QXH B;  5LJN A;  2L3L A;  2LOP A;  3MZK B;  3H3A A;  3MXZ A;  1YW0 A;  4ZI2 D;  2DI4 A;  1MIY A;  1BR0 A;  4XZC A;  4A56 A;  2XAG B;  4CI2 B;  5L3F B;  3RYF E;  2VKH A;  4JLE A;  4GIW A;  4O4I E;  4EIW A;  3O4X E;  3R84 B;  4TV9 E;  2VL8 A;  1ZV4 X;  3RC8 A;  3GN5 A;  2NTY A;  2C5J A;  1MMN A;  4I43 B;  3ZLI A;  3KVB A;  4EZH A;  1D0X A;  3B57 A;  4X1I E;  4IST A;  3ZYL A;  5J2U E;  2X9H A;  5DQW A;  2HPL A;  5HWY A;  4PNI A;  5EK3 A;  4K0U A;  3E22 E;  5TAO A;  3P7I A;  2D0U A;  4V1A v;  3U78 A;  3BQK A;  4CZZ B;  5JRE A;  5HWX A;  2W62 A;  2WM9 A;  1WYC A;  2LM9 A;  2L9Q A;  2V7I A;  2E9X B;  2V7M A;  4PJM A;  5CB4 E;  5LHI B;  5H6Q B;  5LOV E;  3LK3 B;  5KMG P;  5DQV A;  2ES0 A;  4B6X A;  3UT5 E;  2BDE A;  3ETV A;  4EOZ B;  3WAJ A;  4I50 E;  2LSG A;  4MHC A;  2Z6E A;  4H9R C;  4PJN A;  1G73 A;  4TUY E;  4UEM A;  4CQI A;  4AKI A;  5DAB A;  2X0L B;  3LG7 A;  4AXP A;  3O1H A;  2C0S A;  1YKE B;  2P9B A;  1SHZ C;  2XHE B;  4YJ3 E;  4IE6 A;  3W15 B;  2XQY A;  4QXC B;  2DWK A;  4ZS3 A;  4EB6 E;  1LVK A;  4C91 A;  2Y6X A;  4KMC A;  4E7S A;  3ZN0 B;  4IIJ E;  4UIG A;  3O1J A;  3BQL A;  4WBN E;  3NBX X;  1T98 A;  4J2C A;  2LT3 A;  4C90 A;  4F6R C;  5A1L A;  5HYA A;  3N2O A;  3KV9 A;  4M1P A;  4O4L E;  2RA1 A;  3UUL A;  1ZKE A;  3GMI A;  3KVA A;  2VKD A;  2MTQ A;  4UVC B;  3HKB E;  2OA5 A;  2WSS V;  1IZN B;  3WAK A;  3MK7 C;  4ZS2 A;  3SWH A;  3F57 A;  2JQQ A;  2N9D A;  2UXN B;  1MND A;  1NWM X;  2HPJ A;  2V7J A;  3NZQ A;  5JDQ A;  3FHN A;  2LSI A;  4HFV A;  2VK9 A;  2LEH A;  4N78 D;  4MAL A;  4AKR B;  3UTK A;  3SS1 A;  2XAH B;  1LRZ A;  3AA1 B;  3MJX A;  1S35 A;  1UX5 A;  3J9X 1;  5LJM A;  5LNK A;  3L3P A;  3LFM A;  2PJQ A;  4FJO A;  4WBO A;  2YEV C;  5FP3 A;  3V5S A;  5CA0 E;  4ASK A;  2CWY A;  4MBQ A;  2EHO B;  3UUM A;  5BMV E;  1U5P A;  4QHO A;  3K3N A;  4PFP A;  2W0G A;  4O4J E;  2CWO A;  4IE4 A;  4YJ2 E;  4IE7 A;  1NAF A;  3WI3 A;  3K3Q C;  2NTX A;  1IAP A;  3ZYK A;  4ANJ A;  3AAE B;  2JRK A;  3LJC A;  5HAX A;  2KWH A;  4BJM A;  1U4Q A;  1HTJ F;  2KZ7 B;  3OKQ A;  3I1A A;  3PU8 A;  2X9X A;  4GOU A;  4AQF C;  3JC6 D;  2HH7 A;  2JMK A;  4DND A;  3JC6 C;  2KND A;  3RRC A;  3LK4 2;  5LXT E;  2LHR A;  5GON E;  4CXY A;  4ISS A;  4PJL A;  3MA9 A;  1SA0 E;  2ZLY A;  1FMV A;  4YHJ A;  5FXW A;  3KBU A;  3D0T A;  5C8Y E;  5FY1 A;  2ACX A;  2MYS A;  4I4T E;  5FY0 A;  2IW5 B;  2WBL A;  3N9P A;  3B13 A;  4UV8 B;  2CE7 A;  4TN7 B;  3RYC E;  5L3C B;  3LBX A;  4UEL A;  1D1A A;  3HKE E;  1VRB A;  3P8C D;  4DMV A;  2KLQ A;  2LSK A;  3CVR A;  2N1G A;  3L09 A;  3A5X A;  1QSD A;  3N9Q A;  3T8O A;  3PDY A;  1CUN A;  4AQG A;  2VKO A;  3OJA A;  3FXD B;  4AKL A;  4L9I A;  2CXF A;  2NW7 A;  3M65 A;  3GWH A;  4ADZ A;  3FBZ A;  3ZMU B;  2YU2 A;  3U3I A;  3AVS A;  3AVR A;  4H63 H;  2V7L A;  3QUJ A;  2H3R A;  2X9W A;  4TZ4 C;  5FNV E;  4HE8 A;  2X9Y A;  3KV5 A;  5EK4 A;  3RRW A;  2W63 A;  3ZEF B;  1O3X A;  3RH3 A;  2RP4 A;  1B7T A;  1HG5 A;  4UV9 B;  2WWU A;  3DTO A;  4HTE A;  1D0Z A;  2A2F X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...