2KMFA

Solution structure of psb27 from cyanobacterial photosystem ii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
GPLGSCDSGTGLTGNYSQDTLTVIATLREAIDLPQDAPNRQEVQDTARGQINDYISRYRRKGDAGGLKSFTTMQTALNSLAGYYTSYGARPIPEKLKKRLQLEFTQAERSIERGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II 11 kDa protein
publication title Solution structure of Psb27 from cyanobacterial photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.810 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kmfA01
2KMFA 2KNDA 2Y6XA
chains in the Genus database with same CATH superfamily
1FJGT 4H9SE 2VKJA 3FB2A 5JDGA 5HCMA 4COFA 4ZI3D 4Z91A 5LCYA 4TWHA 4IE7A 1N34T 1J5WA 2D0TA 1T7SA 3QK6A 1BR1A 3EI0A 1LKXA 2J47A 1LVKA 4YLHA 2NR4A 4LMJA 3S4UA 3ZSSA 4A97A 2EHOA 3TLSA 1Z0PA 4H9OC 2DLRA 1FMVA 3CX8B 4LF4T 5CA1E 5TAOA 5ADXL 5JR9C 5FXZA 3ZSTA 1I6ZA 2CEAA 1M62A 3PE0A 3AAIA 2HN2A 1BR4A 1HF8A 3LK2B 3I9YA 3PV0F 4PK5A 5AQFB 4IT4A 4U74A 2VVSA 2QGSA 2VVNA 3LJCA 4GIWA 4U33A 3RKOA 5L3BB 2LKGA 4JI0T 2XQ9A 4YJ2E 1LRZA 4NXNT 3O4XE 3HI2A 1WLXA 3FHNA 2Y8DA 3MACA 3UUMA 4LMLA 5HEHA 1S94A 5FXXA 2XZEA 5CJ5A 4ZI2D 3ZT5A 3PUXF 1NENA 3AVSA 2QRXA 5L4HA 4IDPA 4JYAT 4HFEA 3L3PA 3PU8A 2DNXA 2MOZA 3Q5XA 2WMNA 3LSVA 3ZYKA 1XDOA 4NPPA 1UCUA 2DWKA 2YKSA 4GK0E 4KMCA 2DHRA 1T98A 2DL1A 1WR6A 4IDQA 2WMOA 2MAWA 4TV8E 2LEHA 4NUVA 3N2OA 4M1PA 4CN6A 2LJLA 3PTRB 3ONLC 5F5WA 2FJEA 2OA5A 2UUAT 4UR9A 4PFOA 1YQ3A 4HEAA 5LBQB 4HN9A 5L3DB 2X66A 4X1IE 3FXDB 2B76A 4JEHB 3J9X1 4I50E 4JI1T 4BJMA 4IREA 3UUNA 4DV4T 2L3LA 4X20E 5LA6E 3TLTA 3EAMA 2I59A 3WAKA 1E2AA 5AQNB 4QXHB 3TLVA 2KT9A 4LF6T 1MNDA 5HCJA 5EK4A 2K48A 2E5VA 1UURA 3M65A 5JR9A 4G63A 5AQGB 2W0GA 3N9NA 3TKLB 1HFAA 4KUMB 2Q9QD 3CQCB 2NW9A 4B3TT 2DWGA 4QXBB 5JDNA 1KNZA 1NWMX 1YKHB 2IC9A 3RYFE 2LLYA 3PUZF 5JRCA 1HTJF 3VR9A 2JQQA 4GKJT 5M4YA 5JVDE 1XMQT 1US7B 1SA0E 4YXDA 5CB4E 3AE4A 1MNEA 4HFIA 4U3CA 2WM9A 4G2AA 5LMNT 1WRDA 1WCRA 4EV6A 4BA9A 1VCSA 4H63H 3NZPA 3P4WA 1E1HB 2BS2A 3E0ZA 3RIUC 4IE4A 3PUGA 2KWHA 4DBRA 1UX4A 2KNDA 4CQIA 1QLBA 3ABVA 2BG9C 5AQSB 2XAJB 5L2LA 3N9OA 3M3ZB 3AE1A 2PG8A 1SE7A 2PJQA 2PBIA 4ZEYA 4OK0A 4JBWF 3NWIA 2C0SA 1JNZA 4OHFA 2YN6A 4X62T 3AE3A 3EHZA 2ZMAA 4P1NA 3BQKA 4ERRA 4CI1B 3QUJA 4JI2T 4I43B 3GN5B 4O8SA 3VKHA 2V6YB 5HXSA 1QSDA 2BG9B 2W62A 1IBKT 4L9IA 3N2GE 4LFBT 4HWCA 2V6XA 2N2NA 3UT5E 3ANWA 2LT3A 4MALA 5FYMA 4Z8XA 3SS1A 1G8XA 2V5CA 3ZT6A 2CLYC 4UVBB 4J2CA 2FBWA 4QHOA 2WY2A 4JI3T 4U2YA 5ABEA 5LGNB 2AXDS 4LFCT 4WW0A 4LF9T 3AA6B 3KFWX 2ES0A 4QH4A 5C3JA 2M67A 5F3JA 2E9XC 2WP9A 1VOMA 3RQUA 2KXPB 2CLYB 4H9PC 2P9BA 2WQYA 3CPZA 2MYSA 2KMFA 2J4GA 4PW8A 4GOUA 5CA0E 1N32T 4DV3T 3SFEA 2X0HA 4O4JE 4EZHA 4ILUA 2F4VT 3PDYA 3SFDA 4AKRB 1HG5A 3U3IA 3MA9A 3OPCA 4EXTA 2D0UA 3I0OA 5LYJE 3PUQA 4XBFB 4TX5A 3AVRA 4EIWA 2VWAA 3D0TA 4QX7B 4JI4T 2JQ9A 1X79A 2LOPA 1KNPA 3ZKRA 3VRAA 4QH5A 3N9LA 4DV1T 3I0QA 2X68A 5FY7A 5HEUA 4P0AA 4BAYB 3AEEA 2CCQA 4JI6T 2M6IA 3FZMB 5CGMA 1XWMA 2V7KA 3PUSA 4K0UA 3AEDA 3RIUA 2I0MA 1SHZC 2E8IA 5JQGE 3ZYLA 1X9BA 3VR8A 3ZEFB 3GN5A 4UVCB 2BG9A 2VQFT 2XSAA 2WCAA 4DMVA 3AAEB 5H6RB 2UXBT 4ISSA 4DR6T 3ZYMA 3U78A 4KHPT 1YKEB 3DP7A 4ZZBA 4WNKA 3R6NA 1J5ET 5GONE 5FL1A 4B6XA 3K1SA 3N9QA 4IHJE 3T8OA 3C4XA 4A98A 2VB6A 2BS4A 3LK3B 4L0RA 2WB5A 3RF1A 1UX5A 2X51A 3ZCIA 2DI4A 1E7PA 2E9XD 5HXHA 2D5UA 5BMVE 5ABHA 3P8CD 5JTGA 1XDPA 3T1HT 3HA4A 3R84B 5KMGP 3CVRA 2H7OA 1EZ3A 4P0BA 5DJQC 3UUBA 4MFRA 3RLFF 4OYKA 1KNRA 2UU9T 2HH7A 3C4WA 3ZMSB 5EK2A 4HFBA 4ASKA 2IHR1 3KV6A 2E9XA 2XQAA 2C5JA 4KI0F 3OKQA 3AE6A 3FBLA 1JNRA 2WZHA 4YSZA 3AE5A 2WDVA 3ZJ2A 2YDQA 3AB3B 3C50A 2BBJA 4X1KE 1OEDC 3UULA 3ZCJA 4QH1A 3NVOA 3LG7A 5J2UE 5L3EB 3AE9A 1IBMT 3QOFA 5JR9B 2JQHA 4AKGA 4TWDA 1XMOT 3Q2MA 3OJAA 1FEWA 2Q9QC 3X1DA 2KINB 1UGOA 3HL6A 4YTPA 3A8YC 2UXNB 2MBGA 4X65T 3EVYA 2ZLYA 2UUBT 2UXCT 5JRCB 2JRKA 3WI3A 2A3DA 5LG3A 4AQYT 5AQHB 5LHGB 3CQGB 2CHOA 2VKDA 5AQOB 4H9QC 2X0LB 3JAFA 5KDMC 4WYVA 2Q9QB 4TN7B 3PUVF 4DIDB 2HN1A 4Q25A 3ZLIA 1IJ5A 2BG9E 1MMDA 3IEEA 4K0KT 1KK7A 2CM0A 4HFVA 2E2AA 5L3FB 5AQIB 3FZHB 4GYRA 5L3CB 5HAXA 2IDOB 2BKPA 3W15B 5LGTB 1IJ6A 2V8SV 2NP9A 5J0ZA 1BR0A 4ANJA 5FY0A 4EYYR 5JDLA 2BBHA 4GKKT 3GWHA 1I94T 4GYSA 4Z90A 2IIUA 3V5UA 3ZT7A 1SUMB 3AA1B 5FY1A 2CRBA 5H6QB 4DV5T 4X5TA 3VRBA 3K3QC 2LSKA 3MKDA 1Z8UA 2ODUA 2ODVA 4IDNA 4IDZA 3N9PA 2JJ9A 2ZM6T 5JH7E 3K3NA 2XY8B 5FXWA 3RYHE 3EDUA 3AA7B 3NRXA 3N9MA 2LRKA 1U4QA 5JREA 3ANWB 2J62A 2A72A 2H89A 4BJNA 3B13A 3O9XA 2X9YA 5EZYE 5FXVA 2XM2A 5AQRB 2W66A 3ETVA 4AKHA 3HKEE 5HXRA 3DJBA 4F6RC 2WAUA 1N33T 5IWAT 3KV9A 3VKGA 4TNVA 4O4IE 1KF6A 2K24A 3L09A 3NZQA 1KFYA 5FL0A 1UUSA 3JCFA 4PJLA 2B1EA 2X67A 1OEDA 1H7CA 2XQ5A 3UU5A 3F2EA 4HWIB 4IL4A 3A7MA 3CIRA 1HG2A 5JDMA 2XPKA 2JQKA 2N1GA 3SWHA 5HXEA 3ZMVB 5LP6E 1MMNA 1V9DA 4EZ4A 2Q9QA 4AKLA 3AECA 3PJAA 3ONJA 4XAXB 4E7SA 4MLKA 3J7Yq 4DR4T 4O4LE 3P50A 2HHHT 2AE9A 4AI6A 3CWZB 2LSGA 5IYZE 2LKHA 3TLUA 3WAJA 4WZXA 1MMGA 3OTOT 2UUCT 4HWFA 3PURA 2CBIA 1YD8G 2QA7A 4UV8B 4YJ3E 4YY3T 1NAFA 5AQUB 3N5LA 4EGWA 1FMWA 2YDSA 4DV6T 3H37A 2XASB 1D0YA 5LXTE 2V7LA 4FI5A 5LGUB 2C5IT 3AXJB 5ABGA 2IAKA 1W0BA 4NIQA 5FMNA 3KV5A 5JDFA 1CHUA 3H3AA 1D1CA 3PJAJ 2BVMA 2X9XA 3F57A 2FJAA 2MPKA 3EABA 2JIWA 4CXWA 2VKOA 4AQFC 4LF5T 4TV9E 4QKNA 3GA8A 2D2SA 2ZM2A 4DMWA 4EB6E 2HPLA 4YFSA 1HR0T 2I6HA 2FUPA 4DVDA 4MBQA 4H9RC 4H9NC 3JAEA 2KLQA 3MXZA 4UEMA 4A56A 4AKIA 4PJNA 4B3RT 4QWNB 3IHRA 3QB5A 3AE8A 1DU2A 4DV2T 3OYXA 5HWXA 5AQMB 4KBMB 3KVAA 3AE2A 2VURA 2XAQB 3QB5K 5J2TE 5HEOA 3UFGA 3UU4A 1WYCA 1VRBA 3PU3A 4PK6A 2XTLA 4UF0A 2W00A 3CX6B 4UXNB 4CZZB 2XHEB 5LBMA 2CWYA 2E9XB 1MIWA 3PUWF 1OEDE 3O1JA 5HWYA 4E7ZA 2YU2A 3ZMUB 2CXLA 1ZP0A 1W0AA 4MHCA 4YTMA 4P09A 2X9HA 3RHWA 3KV4A 4CN1A 2N9DA 3UU8A 2OV9A 5C8YE 2H88A 1D0XA 5LJMA 5E0OA 4EEBA 3IF8B 4C91A 3I1AA 4WBOA 4AQGA 1MIVA 3JC6D 3AXJA 3NBXX 3RIAA 3OVUA 3ZJ1A 2XJ7A 5LJNA 4O4HE 4L5GA 2LHNA 3AEFA 2YDRA 3Q5WA 3DTOA 1YXRA 2LM2A 3P4PA 4HFHA 3O1HA 4O2BE 3LBXA 2WZIA 3AAAB 2R6GF 4TUYE 2V7IA 4X64T 4IE5A 2W61A 5FVLA 2LSYA 2XAHB 4ZXLA 3NRYA 3NKZA 2CXDA 1D0ZA 3AEBA 5KXJA 2A2FX 1KEYA 2HPJA 4NXMT 4H63V 4HKAA 4HWHA 2BVLA 4AQFA 2LRLA 4CN4A 1W9RA 3UQ4A 4ADZA 4YHJA 1XNQT 1HNWT 5AQVB 4I55E 4IGUA 1S35A 3BQIA 1N36T 3RKGA 4YT0A 5LNKA 1OXZA 2EHOD 1IZNB 3MJXA 2IUBA 5HXCA 4KP3C 2CMRA 2MTQA 2VQET 4EOZB 2XQYA 4JI5T 3SOLA 3B57A 2V5DA 4CI2B 3TLWA 4PJMA 2CA5A 5EK3A 2PFVA 3K3OA 2RA1A 4V1Av 4DR5T 5ABFB 3C51A 3KBTA 1IAPA 3UU6A 4IDOA 1XNRT 3I9WA 5LB7B 5AQLB 4I4TE 1YQ4A 4DUZT 4DV7T 2NTYA 3IA3A 3ZMZB 2JMHA 2KSRA 2G0UA 2LM9A 4C90A 2Y6XA 1R8IA 5L4EA 2IC6A 1FIOA 2WU2A 3BK9A 2YINA 3Q9DA 3UQ7A 4YTNA 2VL8A 4PFPA 2WDRA 2C5KT 2VKHA 1OEDB 3RH3A 1U5PA 5FKYA 4ZZCA 4HTEA 3AA0B 2IMLA 3FBZA 3FXEB 4CXXA 2IW5B 3ZN1B 5J1GA 4HFCA 2V7MA 4UVAB 2Y48B 1WFDA 4DR1T 2YK0A 3C4ZA 4LF7T 5CFBA 2LOSA 2NOXA 3BQLA 2J1DG 3H3MA 2M6BA 3UTKA 4DR3T 4EAHA 3KINB 2CE7A 4YSXA 5AQPB 2ACZA 1HS7A 2CWOA 5AFUL 2H3RA 2ACXA 2W67A 3CQXC 3P4QA 3K8PC 3RYIE 5LG4A 2QVAA 4U2ZA 5AQQB 2FJBA 2QYWA 3PUAA 3ESLA 3KBUA 3E22E 3ZC0A 1HX8A 4EEDA 3RPUA 4X1YE 3LDQB 4UV9B 1YW0A 1J1JA 1M7KA 3CKDA 1HNXT 5ETWA 2X0YA 2YEVC 1D1BA 2VASA 2XQ4A 3HKBE 5ABFA 3CK6A 1L0VA 4YSYA 3RRWA 1ZKEA 2W63A 3FZLB 4UELA 1UK5A 2RP4A 2BDEA 3P7IA 2XAFB 2YU1A 5FP3A 3RRCA 4HGAA 2XM1A 5JDHA 5JDQA 3AEAA 1HCIA 1T8BA 2PTFA 3HKCE 4NUUA 2W4XA 3O1IA 3Q5DA 3JADA 4HWDA 2DCFA 1Y64B 2LHRA 3IBPA 4U7IA 3F31A 2XAGB 5IHYA 3FZFB 2RPAA 2D9DA 3AEGA 4U31A 4ILCA 2NW7A 2H7VC 2VL0A 3N2KE 2CXFA 4ZHQE 3L39A 4KX6A 3CMLA 3UU3A 4I0UA 3G06A 4UF0B 4JI8T 4OFZA 1LVFA 3RC3A 5AQTB 4OYJA 4IL9A 3MZKB 2X9WA 3QNUA 4DNDA 3RX6A 1WR0A 5DQWA 2K5BB 2Z6EA 2V26A 2NWBA 4OX9T 4ZI7E 3P4RA 1HX1B 4PJJA 3UFEA 5HEJA 4ILBA 4TZ4C 2GK9A 1QUUA 2XSBA 3OYZA 1HNZT 3JC6C 4IE6A 3B5MA 4U7YA 2XQ6A 3RYCE 1B7TA 3A5XA 3UUXB 2XUEA 2XQ3A 1VCTA 5KX5E 3C64A 3Q5EA 3KVBA 3LK42 2E5LT 2SPCA 4CXYA 3VHLA 3LBXB 3GMIA 1ZV4X 4TNWA 4IE0A 5IUXA 5DQVA 3AE7A 3ETUA 4A5XA 2YOEA 1O3XA 4AIUA 5HYAA 3L8RA 2VK9A 2K9AA 5HEGA 2XQ8A 4AXPA 5L3GB 3ZN0B 3LFMA 3HKDE 4QXCB 3RIFA 1GQEA 2L8KA 5F8PA 5LHIB 2FJDA 2UXXB 1ZEEA 4DR2T 4UIGA 4JLEA 1Y01A 4LMKA 2L9QA 1XZYA 1MIYA 2UXDT 5FVKA 4F8HA 2ZM8A 2NTXA 4U72A 2EHOC 4ZI3C 3HR0A 4PK4A 3ZC1A 4DUYT 5AQJB 5BR8T 4JI7T 4EYUA 2LSIA 2CHNA 2KZ7B 1D1AA 5LOVE 3CX7B 4ZOLE 3RI5A 4LF8T 2WBLA 4QX8B 3P4SA 2K3WA 2EHOB 5AQKB 4ISTA 3FZKB 2CBJA 5DABA 1IBLT 4DR7T 3VU7H 4PNIA 2BKNA 4JUYA 1BR2A 4DV0T 1ZHCA 4HE8A 3RQWA 5LMUT 2V1DB 3EUHA 3V5SA 4B3MT 2ZM0A 1CUNA 4AISA 2CPTA 1WYBA 4ILAA 4IIJE 4DO0A 2JMKA 3ZMTB 3MK7C 5C2TA 4ZS3A 1AJ3A 2KWIB 2NW8A 4LFAT 4O2AE 1T72A 4ZS2A 1NEKA 2V7JA 3KDSE 4N78D 1G73A 4B3ST 3PUYF 4JEUB 2W2UA 4CI3B 2BS3A 2LSJA 3EDVA 4JV5T 2A9UA 2OLTA 4TWFA 3C98B 2LE8A 2V6YA 3ONXA 1ZOYA 4X66T 4YHHT 2XQ7A 2WWVA 4ZI2C 2WWUA 1OWAA 5LHHB 2WU5A 5FNVE 5A1LA 4HFDA 3QC9A 1W09A 2BZBA 5L47A 4GK5E 2WS3A 3RC8A 3T1YT 3RGLA 4DBQA 3E08A 4FJOA 2BKOA 2WSSV 2WDQA 4XZCA 4WBNE 4PAGA 2JPFA 1MMAA 4KHZF 3SRZA 3ZPOA 3OBVE
chains in the Genus database with same CATH topology
2CLYB 4H9SE 4XAXB 4H9PC 4E7SA 2P9BA 2VKJA 2J1DG 3FB2A 4MLKA 3J7Yq 4O4LE 5JDGA 3CPZA 4AI6A 2MYSA 3CWZB 3UTKA 2KMFA 4ZI3D 4PW8A 4EAHA 3KINB 2LSGA 4GOUA 5IYZE 5LCYA 5CA0E 2CE7A 4IE7A 3WAJA 1HS7A 2CWOA 4O4JE 5AFUL 1MMGA 2D0TA 2H3RA 3QK6A 2ACXA 4EZHA 3CQXC 1BR1A 4ILUA 3K8PC 3PURA 3PDYA 3RYIE 5LG4A 4AKRB 1HG5A 3U3IA 3MA9A 1YD8G 4EXTA 2D0UA 2QA7A 3I0OA 3PUAA 4UV8B 4YJ3E 3ESLA 3KBUA 5LYJE 3E22E 1LKXA 1NAFA 3PUQA 3ZC0A 4XBFB 3N5LA 4TX5A 1LVKA 3AVRA 4YLHA 1FMWA 4EIWA 2VWAA 1HX8A 3D0TA 4QX7B 3RPUA 4X1YE 3S4UA 3H37A 2XASB 2EHOA 1Z0PA 1D0YA 5LXTE 2V7LA 4H9OC 4UV9B 1YW0A 1X79A 2LOPA 3CKDA 2DLRA 1FMVA 3CX8B 4FI5A 5ETWA 5CA1E 5LGUB 5TAOA 2C5IT 2YEVC 1D1BA 2VASA 3HKBE 5ADXL 2IAKA 5JR9C 3N9LA 3RRWA 3I0QA 5FXZA 5FMNA 2X68A 5FY7A 3KV5A 2CEAA 4P0AA 1ZKEA 4BAYB 5JDFA 3PE0A 2W63A 4UELA 3AAIA 2CCQA 2RP4A 1BR4A 3H3AA 1D1CA 2BVMA 1HF8A 2BDEA 2X9XA 3F57A 3LK2B 3P7IA 2XAFB 2YU1A 5FP3A 3I9YA 4PK5A 2V7KA 4HGAA 3RRCA 3PUSA 4K0UA 4U74A 5JDHA 5JDQA 2QGSA 1SHZC 4CXWA 2VKOA 1HCIA 2E8IA 3LJCA 5JQGE 3ZYLA 4GIWA 4AQFC 4TV9E 3RKOA 3ZEFB 3GN5A 3HKCE 4NUUA 5L3BB 4QKNA 3GA8A 2D2SA 2ZM2A 4UVCB 4DMWA 3O1IA 4EB6E 2HPLA 4YJ2E 1LRZA 2DCFA 4YFSA 4DMVA 3O4XE 3AAEB 3HI2A 1Y64B 5H6RB 1WLXA 3FHNA 4DVDA 4ISSA 4MBQA 2Y8DA 2LHRA 4H9RC 4H9NC 3MACA 2KLQA 3ZYMA 3U78A 3IBPA 3UUMA 1YKEB 3F31A 2XAGB 3DP7A 3MXZA 1S94A 4UEMA 4WNKA 5FXXA 4A56A 4AKIA 3R6NA 5IHYA 4PJNA 4QWNB 5GONE 3IHRA 4B6XA 4ZI2D 3N9QA 4IHJE 3T8OA 2NW7A 3AVSA 3C4XA 2H7VC 2VB6A 4EZ4A 3N2KE 3OYXA 2CXFA 4ZHQE 3CMLA 3LK3B 5HWXA 3L3PA 4L0RA 3PU8A 1UX5A 2DNXA 4UF0B 4OFZA 4KBMB 3KVAA 2MOZA 2X51A 3Q5XA 2WMNA 3ZCIA 2DI4A 1LVFA 2XAQB 3ZYKA 5J2TE 1UCUA 2DWKA 3RC3A 2E9XD 4GK0E 4KMCA 5HXHA 2D5UA 1WYCA 1VRBA 3PU3A 5BMVE 4OYJA 4PK6A 2XTLA 3P8CD 2DHRA 1T98A 4UF0A 1WR6A 2W00A 3MZKB 2WMOA 3CX6B 2X9WA 3HA4A 3R84B 5KMGP 4DNDA 3RX6A 3CVRA 4UXNB 2H7OA 5DQWA 4CZZB 1EZ3A 4P0BA 2K5BB 2Z6EA 2XHEB 2V26A 2LEHA 2NWBA 2CWYA 4NUVA 2E9XB 1MIWA 3N2OA 4TV8E 5LBMA 4M1PA 4ZI7E 4PJJA 5DJQC 3O1JA 3UFEA 4MFRA 4OYKA 5HWYA 2LJLA 4E7ZA 2YU2A 4TZ4C 2HH7A 3C4WA 3ZMUB 2GK9A 1QUUA 3ZMSB 5EK2A 2CXLA 3PTRB 4ASKA 3OYZA 4MHCA 2OA5A 3JC6C 4P09A 2X9HA 3KV6A 4IE6A 2E9XA 3KV4A 4PFOA 2N9DA 2C5JA 5C8YE 3OKQA 3FBLA 3RYCE 4HEAA 5LBQB 1D0XA 5LJMA 5E0OA 1B7TA 3A5XA 3UUXB 2XUEA 3IF8B 4C91A 4HN9A 5L3DB 3I1AA 2X66A 4X1IE 4WBOA 4AQGA 3ZJ2A 1MIVA 3FXDB 5KX5E 3JC6D 3C64A 3NBXX 3AB3B 3KVBA 3LK42 4JEHB 3C50A 3ZJ1A 3J9X1 2SPCA 4I50E 4CXYA 5LJNA 4O4HE 4X1KE 3UULA 3VHLA 3ZCJA 4L5GA 3LBXB 3GMIA 4BJMA 1ZV4X 2LHNA 3LG7A 3UUNA 2L3LA 4IE0A 5DQVA 3Q5WA 4X20E 3DTOA 5LA6E 5J2UE 3ETUA 5L3EB 5JR9B 2I59A 1O3XA 3WAKA 5HYAA 3O1HA 4O2BE 4AKGA 4QXHB 3Q2MA 3LBXA 2KT9A 2VK9A 3AAAB 2K9AA 1FEWA 3OJAA 2Q9QC 1MNDA 4TUYE 4AXPA 2KINB 2V7IA 5EK4A 5L3GB 2K48A 3HL6A 3ZN0B 3LFMA 3M65A 5JR9A 4G63A 2UXNB 3HKDE 2MBGA 3EVYA 4QXCB 4IE5A 2W0GA 2L8KA 2W61A 2ZLYA 3N9NA 5F8PA 2LSYA 5LHIB 3TKLB 5JRCB 1HFAA 2XAHB 3NRYA 2UXXB 1ZEEA 2JRKA 4KUMB 2Q9QD 3CQCB 3WI3A 3ZPOA 2NW9A 2A3DA 2DWGA 4QXBB 5JDNA 4UIGA 2CXDA 4JLEA 1D0ZA 1KNZA 1NWMX 1YKHB 2IC9A 2L9QA 2A2FX 3RYFE 5LHGB 1MIYA 2VKDA 3CQGB 4H9QC 2ZM8A 2X0LB 2HPJA 5KDMC 2Q9QB 4H63V 5JRCA 4TN7B 1HTJF 4HKAA 2JQQA 2BVLA 4AQFA 5M4YA 2NTXA 4U72A 2EHOC 5JVDE 4ZI3C 3ZLIA 3HR0A 4ADZA 4YHJA 1IJ5A 1US7B 1MMDA 3IEEA 4PK4A 3ZC1A 2Q9QA 1KK7A 2CM0A 1SA0E 4HFVA 4I55E 4IGUA 1S35A 3BQIA 5CB4E 5L3FB 1MNEA 4EYUA 5LNKA 2WM9A 4GYRA 2LSIA 5L3CB 5HAXA 1OXZA 2KZ7B 1D1AA 4G2AA 2EHOD 5LOVE 1IZNB 3MJXA 3W15B 5LGTB 1IJ6A 1WRDA 3CX7B 4ZOLE 4BA9A 5HXCA 2WBLA 4KP3C 2CMRA 2MTQA 4H63H 4EOZB 2NP9A 2XQYA 3NZPA 3SOLA 1E1HB 3B57A 4QX8B 4ANJA 4CI2B 1BR0A 3E0ZA 4PJMA 2EHOB 2CA5A 5EK3A 2PFVA 3K3OA 4IE4A 3PUGA 5FY0A 4EYYR 4ISTA 2KWHA 5JDLA 4DBRA 1UX4A 2RA1A 3GWHA 4V1Av 2KNDA 5DABA 4CQIA 3VU7H 4PNIA 2XAJB 4GYSA 5L2LA 3C51A 3N9OA 3KBTA 1BR2A 4JUYA 1IAPA 2PG8A 3V5UA 3AA1B 5FY1A 1ZHCA 4HE8A 5H6QB 2PJQA 2PBIA 3K3QC 3I9WA 2LSKA 3MKDA 2ODUA 4OK0A 2ODVA 2V1DB 3EUHA 3V5SA 2C0SA 4OHFA 4I4TE 4IDZA 2ZM0A 2ZMAA 1CUNA 3N9PA 2JJ9A 5JH7E 1WYBA 3K3NA 4IIJE 2NTYA 5FXWA 3BQKA 3RYHE 4DO0A 3EDUA 3ZMZB 4ERRA 4CI1B 2JMHA 3AA7B 3NRXA 3QUJA 3N9MA 2JMKA 3ZMTB 3MK7C 1U4QA 2G0UA 2LM9A 5JREA 3ANWB 4ZS3A 4I43B 2A72A 2KWIB 2NW8A 2Y6XA 3B13A 3GN5B 4BJNA 4O8SA 4C90A 1AJ3A 2IC6A 3VKHA 5HXSA 1FIOA 1QSDA 2W62A 3O9XA 4O2AE 2X9YA 5EZYE 3BK9A 4L9IA 4ZS2A 3N2GE 5FXVA 2V7JA 3KDSE 4N78D 1G73A 3ETVA 4AKHA 3HKEE 4JEUB 2N2NA 5HXRA 3UT5E 2YINA 3DJBA 4CI3B 4F6RC 3Q9DA 2LSJA 3ANWA 2LT3A 3EDVA 2WAUA 4MALA 5FYMA 3KV9A 3C98B 2LE8A 4Z8XA 3VKGA 2VL8A 4PFPA 2C5KT 2VKHA 3ONXA 4O4IE 3SS1A 1G8XA 3RH3A 1U5PA 2K24A 4ZI2C 2WWUA 2CLYC 3L09A 4UVBB 3NZQA 4J2CA 1OWAA 4HTEA 5LHHB 3AA0B 4QHOA 3FBZA 5FNVE 4PJLA 2B1EA 5A1LA 2X67A 1H7CA 5LGNB 3FXEB 3QC9A 4CXXA 2IW5B 3ZN1B 4WW0A 2BZBA 3F2EA 5J1GA 4GK5E 3RC8A 3AA6B 4DBQA 3KFWX 3E08A 2V7MA 4FJOA 2ES0A 2WSSV 4UVAB 1HG2A 5JDMA 2Y48B 2M67A 4XZCA 2YK0A 4WBNE 3C4ZA 5F3JA 2E9XC 4PAGA 2N1GA 3SWHA 2JPFA 5HXEA 3ZMVB 1MMAA 1VOMA 1MMNA 1V9DA 3SRZA 5LP6E 2LOSA 2NOXA 3BQLA 3OBVE 4AKLA 2KXPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMF A;  2KND A;  2Y6X A; 
#chains in the Genus database with same CATH topology
 1FJG T;  4H9S E;  2VKJ A;  3FB2 A;  5JDG A;  5HCM A;  4COF A;  4ZI3 D;  4Z91 A;  5LCY A;  4TWH A;  4IE7 A;  1N34 T;  1J5W A;  2D0T A;  1T7S A;  3QK6 A;  1BR1 A;  3EI0 A;  1LKX A;  2J47 A;  1LVK A;  4YLH A;  2NR4 A;  4LMJ A;  3S4U A;  3ZSS A;  4A97 A;  2EHO A;  3TLS A;  1Z0P A;  4H9O C;  2DLR A;  1FMV A;  3CX8 B;  4LF4 T;  5CA1 E;  5TAO A;  5ADX L;  5JR9 C;  5FXZ A;  3ZST A;  1I6Z A;  2CEA A;  1M62 A;  3PE0 A;  3AAI A;  2HN2 A;  1BR4 A;  1HF8 A;  3LK2 B;  3I9Y A;  3PV0 F;  4PK5 A;  5AQF B;  4IT4 A;  4U74 A;  2VVS A;  2QGS A;  2VVN A;  3LJC A;  4GIW A;  4U33 A;  3RKO A;  5L3B B;  2LKG A;  4JI0 T;  2XQ9 A;  4YJ2 E;  1LRZ A;  4NXN T;  3O4X E;  3HI2 A;  1WLX A;  3FHN A;  2Y8D A;  3MAC A;  3UUM A;  4LML A;  5HEH A;  1S94 A;  5FXX A;  2XZE A;  5CJ5 A;  4ZI2 D;  3ZT5 A;  3PUX F;  1NEN A;  3AVS A;  2QRX A;  5L4H A;  4IDP A;  4JYA T;  4HFE A;  3L3P A;  3PU8 A;  2DNX A;  2MOZ A;  3Q5X A;  2WMN A;  3LSV A;  3ZYK A;  1XDO A;  4NPP A;  1UCU A;  2DWK A;  2YKS A;  4GK0 E;  4KMC A;  2DHR A;  1T98 A;  2DL1 A;  1WR6 A;  4IDQ A;  2WMO A;  2MAW A;  4TV8 E;  2LEH A;  4NUV A;  3N2O A;  4M1P A;  4CN6 A;  2LJL A;  3PTR B;  3ONL C;  5F5W A;  2FJE A;  2OA5 A;  2UUA T;  4UR9 A;  4PFO A;  1YQ3 A;  4HEA A;  5LBQ B;  4HN9 A;  5L3D B;  2X66 A;  4X1I E;  3FXD B;  2B76 A;  4JEH B;  3J9X 1;  4I50 E;  4JI1 T;  4BJM A;  4IRE A;  3UUN A;  4DV4 T;  2L3L A;  4X20 E;  5LA6 E;  3TLT A;  3EAM A;  2I59 A;  3WAK A;  1E2A A;  5AQN B;  4QXH B;  3TLV A;  2KT9 A;  4LF6 T;  1MND A;  5HCJ A;  5EK4 A;  2K48 A;  2E5V A;  1UUR A;  3M65 A;  5JR9 A;  4G63 A;  5AQG B;  2W0G A;  3N9N A;  3TKL B;  1HFA A;  4KUM B;  2Q9Q D;  3CQC B;  2NW9 A;  4B3T T;  2DWG A;  4QXB B;  5JDN A;  1KNZ A;  1NWM X;  1YKH B;  2IC9 A;  3RYF E;  2LLY A;  3PUZ F;  5JRC A;  1HTJ F;  3VR9 A;  2JQQ A;  4GKJ T;  5M4Y A;  5JVD E;  1XMQ T;  1US7 B;  1SA0 E;  4YXD A;  5CB4 E;  3AE4 A;  1MNE A;  4HFI A;  4U3C A;  2WM9 A;  4G2A A;  5LMN T;  1WRD A;  1WCR A;  4EV6 A;  4BA9 A;  1VCS A;  4H63 H;  3NZP A;  3P4W A;  1E1H B;  2BS2 A;  3E0Z A;  3RIU C;  4IE4 A;  3PUG A;  2KWH A;  4DBR A;  1UX4 A;  2KND A;  4CQI A;  1QLB A;  3ABV A;  2BG9 C;  5AQS B;  2XAJ B;  5L2L A;  3N9O A;  3M3Z B;  3AE1 A;  2PG8 A;  1SE7 A;  2PJQ A;  2PBI A;  4ZEY A;  4OK0 A;  4JBW F;  3NWI A;  2C0S A;  1JNZ A;  4OHF A;  2YN6 A;  4X62 T;  3AE3 A;  3EHZ A;  2ZMA A;  4P1N A;  3BQK A;  4ERR A;  4CI1 B;  3QUJ A;  4JI2 T;  4I43 B;  3GN5 B;  4O8S A;  3VKH A;  2V6Y B;  5HXS A;  1QSD A;  2BG9 B;  2W62 A;  1IBK T;  4L9I A;  3N2G E;  4LFB T;  4HWC A;  2V6X A;  2N2N A;  3UT5 E;  3ANW A;  2LT3 A;  4MAL A;  5FYM A;  4Z8X A;  3SS1 A;  1G8X A;  2V5C A;  3ZT6 A;  2CLY C;  4UVB B;  4J2C A;  2FBW A;  4QHO A;  2WY2 A;  4JI3 T;  4U2Y A;  5ABE A;  5LGN B;  2AXD S;  4LFC T;  4WW0 A;  4LF9 T;  3AA6 B;  3KFW X;  2ES0 A;  4QH4 A;  5C3J A;  2M67 A;  5F3J A;  2E9X C;  2WP9 A;  1VOM A;  3RQU A;  2KXP B;  2CLY B;  4H9P C;  2P9B A;  2WQY A;  3CPZ A;  2MYS A;  2KMF A;  2J4G A;  4PW8 A;  4GOU A;  5CA0 E;  1N32 T;  4DV3 T;  3SFE A;  2X0H A;  4O4J E;  4EZH A;  4ILU A;  2F4V T;  3PDY A;  3SFD A;  4AKR B;  1HG5 A;  3U3I A;  3MA9 A;  3OPC A;  4EXT A;  2D0U A;  3I0O A;  5LYJ E;  3PUQ A;  4XBF B;  4TX5 A;  3AVR A;  4EIW A;  2VWA A;  3D0T A;  4QX7 B;  4JI4 T;  2JQ9 A;  1X79 A;  2LOP A;  1KNP A;  3ZKR A;  3VRA A;  4QH5 A;  3N9L A;  4DV1 T;  3I0Q A;  2X68 A;  5FY7 A;  5HEU A;  4P0A A;  4BAY B;  3AEE A;  2CCQ A;  4JI6 T;  2M6I A;  3FZM B;  5CGM A;  1XWM A;  2V7K A;  3PUS A;  4K0U A;  3AED A;  3RIU A;  2I0M A;  1SHZ C;  2E8I A;  5JQG E;  3ZYL A;  1X9B A;  3VR8 A;  3ZEF B;  3GN5 A;  4UVC B;  2BG9 A;  2VQF T;  2XSA A;  2WCA A;  4DMV A;  3AAE B;  5H6R B;  2UXB T;  4ISS A;  4DR6 T;  3ZYM A;  3U78 A;  4KHP T;  1YKE B;  3DP7 A;  4ZZB A;  4WNK A;  3R6N A;  1J5E T;  5GON E;  5FL1 A;  4B6X A;  3K1S A;  3N9Q A;  4IHJ E;  3T8O A;  3C4X A;  4A98 A;  2VB6 A;  2BS4 A;  3LK3 B;  4L0R A;  2WB5 A;  3RF1 A;  1UX5 A;  2X51 A;  3ZCI A;  2DI4 A;  1E7P A;  2E9X D;  5HXH A;  2D5U A;  5BMV E;  5ABH A;  3P8C D;  5JTG A;  1XDP A;  3T1H T;  3HA4 A;  3R84 B;  5KMG P;  3CVR A;  2H7O A;  1EZ3 A;  4P0B A;  5DJQ C;  3UUB A;  4MFR A;  3RLF F;  4OYK A;  1KNR A;  2UU9 T;  2HH7 A;  3C4W A;  3ZMS B;  5EK2 A;  4HFB A;  4ASK A;  2IHR 1;  3KV6 A;  2E9X A;  2XQA A;  2C5J A;  4KI0 F;  3OKQ A;  3AE6 A;  3FBL A;  1JNR A;  2WZH A;  4YSZ A;  3AE5 A;  2WDV A;  3ZJ2 A;  2YDQ A;  3AB3 B;  3C50 A;  2BBJ A;  4X1K E;  1OED C;  3UUL A;  3ZCJ A;  4QH1 A;  3NVO A;  3LG7 A;  5J2U E;  5L3E B;  3AE9 A;  1IBM T;  3QOF A;  5JR9 B;  2JQH A;  4AKG A;  4TWD A;  1XMO T;  3Q2M A;  3OJA A;  1FEW A;  2Q9Q C;  3X1D A;  2KIN B;  1UGO A;  3HL6 A;  4YTP A;  3A8Y C;  2UXN B;  2MBG A;  4X65 T;  3EVY A;  2ZLY A;  2UUB T;  2UXC T;  5JRC B;  2JRK A;  3WI3 A;  2A3D A;  5LG3 A;  4AQY T;  5AQH B;  5LHG B;  3CQG B;  2CHO A;  2VKD A;  5AQO B;  4H9Q C;  2X0L B;  3JAF A;  5KDM C;  4WYV A;  2Q9Q B;  4TN7 B;  3PUV F;  4DID B;  2HN1 A;  4Q25 A;  3ZLI A;  1IJ5 A;  2BG9 E;  1MMD A;  3IEE A;  4K0K T;  1KK7 A;  2CM0 A;  4HFV A;  2E2A A;  5L3F B;  5AQI B;  3FZH B;  4GYR A;  5L3C B;  5HAX A;  2IDO B;  2BKP A;  3W15 B;  5LGT B;  1IJ6 A;  2V8S V;  2NP9 A;  5J0Z A;  1BR0 A;  4ANJ A;  5FY0 A;  4EYY R;  5JDL A;  2BBH A;  4GKK T;  3GWH A;  1I94 T;  4GYS A;  4Z90 A;  2IIU A;  3V5U A;  3ZT7 A;  1SUM B;  3AA1 B;  5FY1 A;  2CRB A;  5H6Q B;  4DV5 T;  4X5T A;  3VRB A;  3K3Q C;  2LSK A;  3MKD A;  1Z8U A;  2ODU A;  2ODV A;  4IDN A;  4IDZ A;  3N9P A;  2JJ9 A;  2ZM6 T;  5JH7 E;  3K3N A;  2XY8 B;  5FXW A;  3RYH E;  3EDU A;  3AA7 B;  3NRX A;  3N9M A;  2LRK A;  1U4Q A;  5JRE A;  3ANW B;  2J62 A;  2A72 A;  2H89 A;  4BJN A;  3B13 A;  3O9X A;  2X9Y A;  5EZY E;  5FXV A;  2XM2 A;  5AQR B;  2W66 A;  3ETV A;  4AKH A;  3HKE E;  5HXR A;  3DJB A;  4F6R C;  2WAU A;  1N33 T;  5IWA T;  3KV9 A;  3VKG A;  4TNV A;  4O4I E;  1KF6 A;  2K24 A;  3L09 A;  3NZQ A;  1KFY A;  5FL0 A;  1UUS A;  3JCF A;  4PJL A;  2B1E A;  2X67 A;  1OED A;  1H7C A;  2XQ5 A;  3UU5 A;  3F2E A;  4HWI B;  4IL4 A;  3A7M A;  3CIR A;  1HG2 A;  5JDM A;  2XPK A;  2JQK A;  2N1G A;  3SWH A;  5HXE A;  3ZMV B;  5LP6 E;  1MMN A;  1V9D A;  4EZ4 A;  2Q9Q A;  4AKL A;  3AEC A;  3PJA A;  3ONJ A;  4XAX B;  4E7S A;  4MLK A;  3J7Y q;  4DR4 T;  4O4L E;  3P50 A;  2HHH T;  2AE9 A;  4AI6 A;  3CWZ B;  2LSG A;  5IYZ E;  2LKH A;  3TLU A;  3WAJ A;  4WZX A;  1MMG A;  3OTO T;  2UUC T;  4HWF A;  3PUR A;  2CBI A;  1YD8 G;  2QA7 A;  4UV8 B;  4YJ3 E;  4YY3 T;  1NAF A;  5AQU B;  3N5L A;  4EGW A;  1FMW A;  2YDS A;  4DV6 T;  3H37 A;  2XAS B;  1D0Y A;  5LXT E;  2V7L A;  4FI5 A;  5LGU B;  2C5I T;  3AXJ B;  5ABG A;  2IAK A;  1W0B A;  4NIQ A;  5FMN A;  3KV5 A;  5JDF A;  1CHU A;  3H3A A;  1D1C A;  3PJA J;  2BVM A;  2X9X A;  3F57 A;  2FJA A;  2MPK A;  3EAB A;  2JIW A;  4CXW A;  2VKO A;  4AQF C;  4LF5 T;  4TV9 E;  4QKN A;  3GA8 A;  2D2S A;  2ZM2 A;  4DMW A;  4EB6 E;  2HPL A;  4YFS A;  1HR0 T;  2I6H A;  2FUP A;  4DVD A;  4MBQ A;  4H9R C;  4H9N C;  3JAE A;  2KLQ A;  3MXZ A;  4UEM A;  4A56 A;  4AKI A;  4PJN A;  4B3R T;  4QWN B;  3IHR A;  3QB5 A;  3AE8 A;  1DU2 A;  4DV2 T;  3OYX A;  5HWX A;  5AQM B;  4KBM B;  3KVA A;  3AE2 A;  2VUR A;  2XAQ B;  3QB5 K;  5J2T E;  5HEO A;  3UFG A;  3UU4 A;  1WYC A;  1VRB A;  3PU3 A;  4PK6 A;  2XTL A;  4UF0 A;  2W00 A;  3CX6 B;  4UXN B;  4CZZ B;  2XHE B;  5LBM A;  2CWY A;  2E9X B;  1MIW A;  3PUW F;  1OED E;  3O1J A;  5HWY A;  4E7Z A;  2YU2 A;  3ZMU B;  2CXL A;  1ZP0 A;  1W0A A;  4MHC A;  4YTM A;  4P09 A;  2X9H A;  3RHW A;  3KV4 A;  4CN1 A;  2N9D A;  3UU8 A;  2OV9 A;  5C8Y E;  2H88 A;  1D0X A;  5LJM A;  5E0O A;  4EEB A;  3IF8 B;  4C91 A;  3I1A A;  4WBO A;  4AQG A;  1MIV A;  3JC6 D;  3AXJ A;  3NBX X;  3RIA A;  3OVU A;  3ZJ1 A;  2XJ7 A;  5LJN A;  4O4H E;  4L5G A;  2LHN A;  3AEF A;  2YDR A;  3Q5W A;  3DTO A;  1YXR A;  2LM2 A;  3P4P A;  4HFH A;  3O1H A;  4O2B E;  3LBX A;  2WZI A;  3AAA B;  2R6G F;  4TUY E;  2V7I A;  4X64 T;  4IE5 A;  2W61 A;  5FVL A;  2LSY A;  2XAH B;  4ZXL A;  3NRY A;  3NKZ A;  2CXD A;  1D0Z A;  3AEB A;  5KXJ A;  2A2F X;  1KEY A;  2HPJ A;  4NXM T;  4H63 V;  4HKA A;  4HWH A;  2BVL A;  4AQF A;  2LRL A;  4CN4 A;  1W9R A;  3UQ4 A;  4ADZ A;  4YHJ A;  1XNQ T;  1HNW T;  5AQV B;  4I55 E;  4IGU A;  1S35 A;  3BQI A;  1N36 T;  3RKG A;  4YT0 A;  5LNK A;  1OXZ A;  2EHO D;  1IZN B;  3MJX A;  2IUB A;  5HXC A;  4KP3 C;  2CMR A;  2MTQ A;  2VQE T;  4EOZ B;  2XQY A;  4JI5 T;  3SOL A;  3B57 A;  2V5D A;  4CI2 B;  3TLW A;  4PJM A;  2CA5 A;  5EK3 A;  2PFV A;  3K3O A;  2RA1 A;  4V1A v;  4DR5 T;  5ABF B;  3C51 A;  3KBT A;  1IAP A;  3UU6 A;  4IDO A;  1XNR T;  3I9W A;  5LB7 B;  5AQL B;  4I4T E;  1YQ4 A;  4DUZ T;  4DV7 T;  2NTY A;  3IA3 A;  3ZMZ B;  2JMH A;  2KSR A;  2G0U A;  2LM9 A;  4C90 A;  2Y6X A;  1R8I A;  5L4E A;  2IC6 A;  1FIO A;  2WU2 A;  3BK9 A;  2YIN A;  3Q9D A;  3UQ7 A;  4YTN A;  2VL8 A;  4PFP A;  2WDR A;  2C5K T;  2VKH A;  1OED B;  3RH3 A;  1U5P A;  5FKY A;  4ZZC A;  4HTE A;  3AA0 B;  2IML A;  3FBZ A;  3FXE B;  4CXX A;  2IW5 B;  3ZN1 B;  5J1G A;  4HFC A;  2V7M A;  4UVA B;  2Y48 B;  1WFD A;  4DR1 T;  2YK0 A;  3C4Z A;  4LF7 T;  5CFB A;  2LOS A;  2NOX A;  3BQL A;  2J1D G;  3H3M A;  2M6B A;  3UTK A;  4DR3 T;  4EAH A;  3KIN B;  2CE7 A;  4YSX A;  5AQP B;  2ACZ A;  1HS7 A;  2CWO A;  5AFU L;  2H3R A;  2ACX A;  2W67 A;  3CQX C;  3P4Q A;  3K8P C;  3RYI E;  5LG4 A;  2QVA A;  4U2Z A;  5AQQ B;  2FJB A;  2QYW A;  3PUA A;  3ESL A;  3KBU A;  3E22 E;  3ZC0 A;  1HX8 A;  4EED A;  3RPU A;  4X1Y E;  3LDQ B;  4UV9 B;  1YW0 A;  1J1J A;  1M7K A;  3CKD A;  1HNX T;  5ETW A;  2X0Y A;  2YEV C;  1D1B A;  2VAS A;  2XQ4 A;  3HKB E;  5ABF A;  3CK6 A;  1L0V A;  4YSY A;  3RRW A;  1ZKE A;  2W63 A;  3FZL B;  4UEL A;  1UK5 A;  2RP4 A;  2BDE A;  3P7I A;  2XAF B;  2YU1 A;  5FP3 A;  3RRC A;  4HGA A;  2XM1 A;  5JDH A;  5JDQ A;  3AEA A;  1HCI A;  1T8B A;  2PTF A;  3HKC E;  4NUU A;  2W4X A;  3O1I A;  3Q5D A;  3JAD A;  4HWD A;  2DCF A;  1Y64 B;  2LHR A;  3IBP A;  4U7I A;  3F31 A;  2XAG B;  5IHY A;  3FZF B;  2RPA A;  2D9D A;  3AEG A;  4U31 A;  4ILC A;  2NW7 A;  2H7V C;  2VL0 A;  3N2K E;  2CXF A;  4ZHQ E;  3L39 A;  4KX6 A;  3CML A;  3UU3 A;  4I0U A;  3G06 A;  4UF0 B;  4JI8 T;  4OFZ A;  1LVF A;  3RC3 A;  5AQT B;  4OYJ A;  4IL9 A;  3MZK B;  2X9W A;  3QNU A;  4DND A;  3RX6 A;  1WR0 A;  5DQW A;  2K5B B;  2Z6E A;  2V26 A;  2NWB A;  4OX9 T;  4ZI7 E;  3P4R A;  1HX1 B;  4PJJ A;  3UFE A;  5HEJ A;  4ILB A;  4TZ4 C;  2GK9 A;  1QUU A;  2XSB A;  3OYZ A;  1HNZ T;  3JC6 C;  4IE6 A;  3B5M A;  4U7Y A;  2XQ6 A;  3RYC E;  1B7T A;  3A5X A;  3UUX B;  2XUE A;  2XQ3 A;  1VCT A;  5KX5 E;  3C64 A;  3Q5E A;  3KVB A;  3LK4 2;  2E5L T;  2SPC A;  4CXY A;  3VHL A;  3LBX B;  3GMI A;  1ZV4 X;  4TNW A;  4IE0 A;  5IUX A;  5DQV A;  3AE7 A;  3ETU A;  4A5X A;  2YOE A;  1O3X A;  4AIU A;  5HYA A;  3L8R A;  2VK9 A;  2K9A A;  5HEG A;  2XQ8 A;  4AXP A;  5L3G B;  3ZN0 B;  3LFM A;  3HKD E;  4QXC B;  3RIF A;  1GQE A;  2L8K A;  5F8P A;  5LHI B;  2FJD A;  2UXX B;  1ZEE A;  4DR2 T;  4UIG A;  4JLE A;  1Y01 A;  4LMK A;  2L9Q A;  1XZY A;  1MIY A;  2UXD T;  5FVK A;  4F8H A;  2ZM8 A;  2NTX A;  4U72 A;  2EHO C;  4ZI3 C;  3HR0 A;  4PK4 A;  3ZC1 A;  4DUY T;  5AQJ B;  5BR8 T;  4JI7 T;  4EYU A;  2LSI A;  2CHN A;  2KZ7 B;  1D1A A;  5LOV E;  3CX7 B;  4ZOL E;  3RI5 A;  4LF8 T;  2WBL A;  4QX8 B;  3P4S A;  2K3W A;  2EHO B;  5AQK B;  4IST A;  3FZK B;  2CBJ A;  5DAB A;  1IBL T;  4DR7 T;  3VU7 H;  4PNI A;  2BKN A;  4JUY A;  1BR2 A;  4DV0 T;  1ZHC A;  4HE8 A;  3RQW A;  5LMU T;  2V1D B;  3EUH A;  3V5S A;  4B3M T;  2ZM0 A;  1CUN A;  4AIS A;  2CPT A;  1WYB A;  4ILA A;  4IIJ E;  4DO0 A;  2JMK A;  3ZMT B;  3MK7 C;  5C2T A;  4ZS3 A;  1AJ3 A;  2KWI B;  2NW8 A;  4LFA T;  4O2A E;  1T72 A;  4ZS2 A;  1NEK A;  2V7J A;  3KDS E;  4N78 D;  1G73 A;  4B3S T;  3PUY F;  4JEU B;  2W2U A;  4CI3 B;  2BS3 A;  2LSJ A;  3EDV A;  4JV5 T;  2A9U A;  2OLT A;  4TWF A;  3C98 B;  2LE8 A;  2V6Y A;  3ONX A;  1ZOY A;  4X66 T;  4YHH T;  2XQ7 A;  2WWV A;  4ZI2 C;  2WWU A;  1OWA A;  5LHH B;  2WU5 A;  5FNV E;  5A1L A;  4HFD A;  3QC9 A;  1W09 A;  2BZB A;  5L47 A;  4GK5 E;  2WS3 A;  3RC8 A;  3T1Y T;  3RGL A;  4DBQ A;  3E08 A;  4FJO A;  2BKO A;  2WSS V;  2WDQ A;  4XZC A;  4WBN E;  4PAG A;  2JPF A;  1MMA A;  4KHZ F;  3SRZ A;  3ZPO A;  3OBV E; 
#chains in the Genus database with same CATH homology
 2CLY B;  4H9S E;  4XAX B;  4H9P C;  4E7S A;  2P9B A;  2VKJ A;  2J1D G;  3FB2 A;  4MLK A;  3J7Y q;  4O4L E;  5JDG A;  3CPZ A;  4AI6 A;  2MYS A;  3CWZ B;  3UTK A;  2KMF A;  4ZI3 D;  4PW8 A;  4EAH A;  3KIN B;  2LSG A;  4GOU A;  5IYZ E;  5LCY A;  5CA0 E;  2CE7 A;  4IE7 A;  3WAJ A;  1HS7 A;  2CWO A;  4O4J E;  5AFU L;  1MMG A;  2D0T A;  2H3R A;  3QK6 A;  2ACX A;  4EZH A;  3CQX C;  1BR1 A;  4ILU A;  3K8P C;  3PUR A;  3PDY A;  3RYI E;  5LG4 A;  4AKR B;  1HG5 A;  3U3I A;  3MA9 A;  1YD8 G;  4EXT A;  2D0U A;  2QA7 A;  3I0O A;  3PUA A;  4UV8 B;  4YJ3 E;  3ESL A;  3KBU A;  5LYJ E;  3E22 E;  1LKX A;  1NAF A;  3PUQ A;  3ZC0 A;  4XBF B;  3N5L A;  4TX5 A;  1LVK A;  3AVR A;  4YLH A;  1FMW A;  4EIW A;  2VWA A;  1HX8 A;  3D0T A;  4QX7 B;  3RPU A;  4X1Y E;  3S4U A;  3H37 A;  2XAS B;  2EHO A;  1Z0P A;  1D0Y A;  5LXT E;  2V7L A;  4H9O C;  4UV9 B;  1YW0 A;  1X79 A;  2LOP A;  3CKD A;  2DLR A;  1FMV A;  3CX8 B;  4FI5 A;  5ETW A;  5CA1 E;  5LGU B;  5TAO A;  2C5I T;  2YEV C;  1D1B A;  2VAS A;  3HKB E;  5ADX L;  2IAK A;  5JR9 C;  3N9L A;  3RRW A;  3I0Q A;  5FXZ A;  5FMN A;  2X68 A;  5FY7 A;  3KV5 A;  2CEA A;  4P0A A;  1ZKE A;  4BAY B;  5JDF A;  3PE0 A;  2W63 A;  4UEL A;  3AAI A;  2CCQ A;  2RP4 A;  1BR4 A;  3H3A A;  1D1C A;  2BVM A;  1HF8 A;  2BDE A;  2X9X A;  3F57 A;  3LK2 B;  3P7I A;  2XAF B;  2YU1 A;  5FP3 A;  3I9Y A;  4PK5 A;  2V7K A;  4HGA A;  3RRC A;  3PUS A;  4K0U A;  4U74 A;  5JDH A;  5JDQ A;  2QGS A;  1SHZ C;  4CXW A;  2VKO A;  1HCI A;  2E8I A;  3LJC A;  5JQG E;  3ZYL A;  4GIW A;  4AQF C;  4TV9 E;  3RKO A;  3ZEF B;  3GN5 A;  3HKC E;  4NUU A;  5L3B B;  4QKN A;  3GA8 A;  2D2S A;  2ZM2 A;  4UVC B;  4DMW A;  3O1I A;  4EB6 E;  2HPL A;  4YJ2 E;  1LRZ A;  2DCF A;  4YFS A;  4DMV A;  3O4X E;  3AAE B;  3HI2 A;  1Y64 B;  5H6R B;  1WLX A;  3FHN A;  4DVD A;  4ISS A;  4MBQ A;  2Y8D A;  2LHR A;  4H9R C;  4H9N C;  3MAC A;  2KLQ A;  3ZYM A;  3U78 A;  3IBP A;  3UUM A;  1YKE B;  3F31 A;  2XAG B;  3DP7 A;  3MXZ A;  1S94 A;  4UEM A;  4WNK A;  5FXX A;  4A56 A;  4AKI A;  3R6N A;  5IHY A;  4PJN A;  4QWN B;  5GON E;  3IHR A;  4B6X A;  4ZI2 D;  3N9Q A;  4IHJ E;  3T8O A;  2NW7 A;  3AVS A;  3C4X A;  2H7V C;  2VB6 A;  4EZ4 A;  3N2K E;  3OYX A;  2CXF A;  4ZHQ E;  3CML A;  3LK3 B;  5HWX A;  3L3P A;  4L0R A;  3PU8 A;  1UX5 A;  2DNX A;  4UF0 B;  4OFZ A;  4KBM B;  3KVA A;  2MOZ A;  2X51 A;  3Q5X A;  2WMN A;  3ZCI A;  2DI4 A;  1LVF A;  2XAQ B;  3ZYK A;  5J2T E;  1UCU A;  2DWK A;  3RC3 A;  2E9X D;  4GK0 E;  4KMC A;  5HXH A;  2D5U A;  1WYC A;  1VRB A;  3PU3 A;  5BMV E;  4OYJ A;  4PK6 A;  2XTL A;  3P8C D;  2DHR A;  1T98 A;  4UF0 A;  1WR6 A;  2W00 A;  3MZK B;  2WMO A;  3CX6 B;  2X9W A;  3HA4 A;  3R84 B;  5KMG P;  4DND A;  3RX6 A;  3CVR A;  4UXN B;  2H7O A;  5DQW A;  4CZZ B;  1EZ3 A;  4P0B A;  2K5B B;  2Z6E A;  2XHE B;  2V26 A;  2LEH A;  2NWB A;  2CWY A;  4NUV A;  2E9X B;  1MIW A;  3N2O A;  4TV8 E;  5LBM A;  4M1P A;  4ZI7 E;  4PJJ A;  5DJQ C;  3O1J A;  3UFE A;  4MFR A;  4OYK A;  5HWY A;  2LJL A;  4E7Z A;  2YU2 A;  4TZ4 C;  2HH7 A;  3C4W A;  3ZMU B;  2GK9 A;  1QUU A;  3ZMS B;  5EK2 A;  2CXL A;  3PTR B;  4ASK A;  3OYZ A;  4MHC A;  2OA5 A;  3JC6 C;  4P09 A;  2X9H A;  3KV6 A;  4IE6 A;  2E9X A;  3KV4 A;  4PFO A;  2N9D A;  2C5J A;  5C8Y E;  3OKQ A;  3FBL A;  3RYC E;  4HEA A;  5LBQ B;  1D0X A;  5LJM A;  5E0O A;  1B7T A;  3A5X A;  3UUX B;  2XUE A;  3IF8 B;  4C91 A;  4HN9 A;  5L3D B;  3I1A A;  2X66 A;  4X1I E;  4WBO A;  4AQG A;  3ZJ2 A;  1MIV A;  3FXD B;  5KX5 E;  3JC6 D;  3C64 A;  3NBX X;  3AB3 B;  3KVB A;  3LK4 2;  4JEH B;  3C50 A;  3ZJ1 A;  3J9X 1;  2SPC A;  4I50 E;  4CXY A;  5LJN A;  4O4H E;  4X1K E;  3UUL A;  3VHL A;  3ZCJ A;  4L5G A;  3LBX B;  3GMI A;  4BJM A;  1ZV4 X;  2LHN A;  3LG7 A;  3UUN A;  2L3L A;  4IE0 A;  5DQV A;  3Q5W A;  4X20 E;  3DTO A;  5LA6 E;  5J2U E;  3ETU A;  5L3E B;  5JR9 B;  2I59 A;  1O3X A;  3WAK A;  5HYA A;  3O1H A;  4O2B E;  4AKG A;  4QXH B;  3Q2M A;  3LBX A;  2KT9 A;  2VK9 A;  3AAA B;  2K9A A;  1FEW A;  3OJA A;  2Q9Q C;  1MND A;  4TUY E;  4AXP A;  2KIN B;  2V7I A;  5EK4 A;  5L3G B;  2K48 A;  3HL6 A;  3ZN0 B;  3LFM A;  3M65 A;  5JR9 A;  4G63 A;  2UXN B;  3HKD E;  2MBG A;  3EVY A;  4QXC B;  4IE5 A;  2W0G A;  2L8K A;  2W61 A;  2ZLY A;  3N9N A;  5F8P A;  2LSY A;  5LHI B;  3TKL B;  5JRC B;  1HFA A;  2XAH B;  3NRY A;  2UXX B;  1ZEE A;  2JRK A;  4KUM B;  2Q9Q D;  3CQC B;  3WI3 A;  3ZPO A;  2NW9 A;  2A3D A;  2DWG A;  4QXB B;  5JDN A;  4UIG A;  2CXD A;  4JLE A;  1D0Z A;  1KNZ A;  1NWM X;  1YKH B;  2IC9 A;  2L9Q A;  2A2F X;  3RYF E;  5LHG B;  1MIY A;  2VKD A;  3CQG B;  4H9Q C;  2ZM8 A;  2X0L B;  2HPJ A;  5KDM C;  2Q9Q B;  4H63 V;  5JRC A;  4TN7 B;  1HTJ F;  4HKA A;  2JQQ A;  2BVL A;  4AQF A;  5M4Y A;  2NTX A;  4U72 A;  2EHO C;  5JVD E;  4ZI3 C;  3ZLI A;  3HR0 A;  4ADZ A;  4YHJ A;  1IJ5 A;  1US7 B;  1MMD A;  3IEE A;  4PK4 A;  3ZC1 A;  2Q9Q A;  1KK7 A;  2CM0 A;  1SA0 E;  4HFV A;  4I55 E;  4IGU A;  1S35 A;  3BQI A;  5CB4 E;  5L3F B;  1MNE A;  4EYU A;  5LNK A;  2WM9 A;  4GYR A;  2LSI A;  5L3C B;  5HAX A;  1OXZ A;  2KZ7 B;  1D1A A;  4G2A A;  2EHO D;  5LOV E;  1IZN B;  3MJX A;  3W15 B;  5LGT B;  1IJ6 A;  1WRD A;  3CX7 B;  4ZOL E;  4BA9 A;  5HXC A;  2WBL A;  4KP3 C;  2CMR A;  2MTQ A;  4H63 H;  4EOZ B;  2NP9 A;  2XQY A;  3NZP A;  3SOL A;  1E1H B;  3B57 A;  4QX8 B;  4ANJ A;  4CI2 B;  1BR0 A;  3E0Z A;  4PJM A;  2EHO B;  2CA5 A;  5EK3 A;  2PFV A;  3K3O A;  4IE4 A;  3PUG A;  5FY0 A;  4EYY R;  4IST A;  2KWH A;  5JDL A;  4DBR A;  1UX4 A;  2RA1 A;  3GWH A;  4V1A v;  2KND A;  5DAB A;  4CQI A;  3VU7 H;  4PNI A;  2XAJ B;  4GYS A;  5L2L A;  3C51 A;  3N9O A;  3KBT A;  1BR2 A;  4JUY A;  1IAP A;  2PG8 A;  3V5U A;  3AA1 B;  5FY1 A;  1ZHC A;  4HE8 A;  5H6Q B;  2PJQ A;  2PBI A;  3K3Q C;  3I9W A;  2LSK A;  3MKD A;  2ODU A;  4OK0 A;  2ODV A;  2V1D B;  3EUH A;  3V5S A;  2C0S A;  4OHF A;  4I4T E;  4IDZ A;  2ZM0 A;  2ZMA A;  1CUN A;  3N9P A;  2JJ9 A;  5JH7 E;  1WYB A;  3K3N A;  4IIJ E;  2NTY A;  5FXW A;  3BQK A;  3RYH E;  4DO0 A;  3EDU A;  3ZMZ B;  4ERR A;  4CI1 B;  2JMH A;  3AA7 B;  3NRX A;  3QUJ A;  3N9M A;  2JMK A;  3ZMT B;  3MK7 C;  1U4Q A;  2G0U A;  2LM9 A;  5JRE A;  3ANW B;  4ZS3 A;  4I43 B;  2A72 A;  2KWI B;  2NW8 A;  2Y6X A;  3B13 A;  3GN5 B;  4BJN A;  4O8S A;  4C90 A;  1AJ3 A;  2IC6 A;  3VKH A;  5HXS A;  1FIO A;  1QSD A;  2W62 A;  3O9X A;  4O2A E;  2X9Y A;  5EZY E;  3BK9 A;  4L9I A;  4ZS2 A;  3N2G E;  5FXV A;  2V7J A;  3KDS E;  4N78 D;  1G73 A;  3ETV A;  4AKH A;  3HKE E;  4JEU B;  2N2N A;  5HXR A;  3UT5 E;  2YIN A;  3DJB A;  4CI3 B;  4F6R C;  3Q9D A;  2LSJ A;  3ANW A;  2LT3 A;  3EDV A;  2WAU A;  4MAL A;  5FYM A;  3KV9 A;  3C98 B;  2LE8 A;  4Z8X A;  3VKG A;  2VL8 A;  4PFP A;  2C5K T;  2VKH A;  3ONX A;  4O4I E;  3SS1 A;  1G8X A;  3RH3 A;  1U5P A;  2K24 A;  4ZI2 C;  2WWU A;  2CLY C;  3L09 A;  4UVB B;  3NZQ A;  4J2C A;  1OWA A;  4HTE A;  5LHH B;  3AA0 B;  4QHO A;  3FBZ A;  5FNV E;  4PJL A;  2B1E A;  5A1L A;  2X67 A;  1H7C A;  5LGN B;  3FXE B;  3QC9 A;  4CXX A;  2IW5 B;  3ZN1 B;  4WW0 A;  2BZB A;  3F2E A;  5J1G A;  4GK5 E;  3RC8 A;  3AA6 B;  4DBQ A;  3KFW X;  3E08 A;  2V7M A;  4FJO A;  2ES0 A;  2WSS V;  4UVA B;  1HG2 A;  5JDM A;  2Y48 B;  2M67 A;  4XZC A;  2YK0 A;  4WBN E;  3C4Z A;  5F3J A;  2E9X C;  4PAG A;  2N1G A;  3SWH A;  2JPF A;  5HXE A;  3ZMV B;  1MMA A;  1VOM A;  1MMN A;  1V9D A;  3SRZ A;  5LP6 E;  2LOS A;  2NOX A;  3BQL A;  3OBV E;  4AKL A;  2KXP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...