2N9DA

Structure analysis of the tom1 gat domain reveals distinct ligand-specific conformational states
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Target of Myb protein 1
publication title Structure of the GAT domain of the endosomal adapter protein Tom1.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n9dA00
1O3XA 1OXZA 1X79A 1YD8G 1NWMX 1WR6A 1WRDA 2N2NA 1NAFA 2N9DA
chains in the Genus database with same CATH superfamily
4JI1T 3AE3A 2V7MA 3AEGA 3HKCE 5KXJA 5CJ5A 2MYSA 3KINB 1XDOA 2VKDA 2NW7A 5FXWA 2JIWA 4QH5A 1XMOT 4ILBA 3AECA 1L0VA 3P4WA 2D5UA 3H3AA 3ZSSA 3S4UA 3PUAA 4ZI7E 5L3CB 3RC8A 2NR4A 3O4XE 1X9BA 3ABVA 1YQ4A 4H63V 3L8RA 2V5CA 3ZT7A 4HKAA 2Q9QC 5ABFB 3GA8A 4Z91A 1YQ3A 5ABFA 4H9QC 2WP9A 3PU3A 4KBMB 2WSSV 3PUYF 3C98B 4I55E 2IIUA 3IBPA 4IE7A 4YHHT 3FBZA 3QOFA 2WU5A 3C4WA 2YDRA 3AE5A 3O1JA 5AQMB 3FZLB 2M6BA 5JDMA 5LG3A 3H37A 3VR8A 4UF0B 2BDEA 1HTJF 3I0OA 5AQUB 2ZM6T 4UF0A 1N36T 2RA1A 1YXRA 2J62A 2XQ4A 3N9PA 2NW8A 3ONLC 5LJMA 4C91A 5EZYE 2YEVC 4ILUA 2WWUA 3RF1A 2XM2A 2E5LT 4GIWA 4YXDA 4HFCA 5DABA 3AAEB 2H89A 1FJGT 4DR1T 3OBVE 3UT5E 2XQ3A 2XASB 1IBKT 2VQET 2BG9E 1MMNA 3N2GE 2DWKA 3UU5A 3I1AA 3ZYMA 4A5XA 1QSDA 4UEMA 2N1GA 4ISSA 4EYYR 4YTPA 4O4JE 4HE8A 2VVNA 2E9XD 2KWIB 2BKPA 1OXZA 4DUYT 3VHLA 2W4XA 4UIGA 3VKHA 2E2AA 3ZCIA 1ZEEA 3BK9A 3AVRA 3FBLA 4LF9T 3HR0A 1QUUA 2V6YB 2WDQA 5CB4E 2CRBA 3VRBA 4GOUA 2V5DA 4QHOA 2V6YA 4IE0A 5L3BB 2PBIA 4AKRB 1VCSA 4TNWA 1MMGA 3ZJ1A 3LFMA 4HFDA 1OEDE 4P1NA 3TLVA 3DTOA 4TNVA 5JR9B 5F5WA 4F8HA 5JDFA 5JR9A 3ETVA 4IT4A 3RIAA 2CXDA 3MKDA 2WWVA 2L3LA 3FZFB 1OEDB 4HWIB 3HKBE 3RQWA 1UUSA 1OEDA 1G73A 2E8IA 3F2EA 2W2UA 4ZOLE 3N2KE 3IF8B 5LP6E 2F4VT 1MMDA 3ANWB 5AQQB 2YDQA 3ANWA 4CN4A 1KEYA 3AA7B 5KX5E 5JDNA 4G2AA 1AJ3A 3CK6A 1BR2A 2LHRA 4G63A 1LVKA 5F3JA 4EIWA 4P0BA 4ZZBA 4QWNB 5LB7B 3LG7A 3A8YC 3EDUA 4YJ2E 2X9HA 4CI3B 3K3QC 4KUMB 2WMNA 4AKHA 3R84B 5AQVB 3ZLIA 1S94A 4BJMA 1U4QA 4TX5A 3O9XA 3EVYA 3J7Yq 4LF8T 5H6QB 2BG9C 1I6ZA 3Q2MA 2X0YA 1BR0A 5HXRA 3C50A 2CHNA 3DP7A 4LFBT 2BKOA 4MALA 4PK4A 5A1LA 3FZMB 2B1EA 2WB5A 4UV9B 2ODVA 4IDNA 4A97A 1HNWT 2A72A 2OA5A 2SPCA 1SUMB 4KHPT 3RLFF 5AQFB 4KP3C 3N9QA 2IW5B 2ZM8A 4ZS2A 2XQ5A 5IYZE 5EK2A 2NTYA 5ETWA 4DBQA 2HN1A 2BKNA 5JTGA 2VL0A 5LHIB 3P7IA 2X0HA 4ANJA 2XTLA 3AEDA 2YOEA 4H9NC 1XZYA 3G06A 3W15B 5C8YE 1MIYA 1IBMT 3QB5A 4YHJA 1LVFA 3J9X1 4HEAA 4JI7T 5CGMA 3Q5XA 2H7VC 2WS3A 1HG2A 4U7YA 2BZBA 3LSVA 4IL4A 4BJNA 4F6RC 3QUJA 2LE8A 2UUCT 2VL8A 2CHOA 3C4XA 1JNZA 3FZHB 2CWOA 1IJ6A 2VKOA 2UUAT 3ZJ2A 2G0UA 2Q9QB 2AXDS 3AE7A 3T1HT 2I6HA 3CPZA 1D1AA 4E7SA 2Q9QA 3FHNA 4B3TT 4UVBB 2FUPA 2J47A 4ISTA 5JDQA 3RX6A 2D9DA 2JQKA 3AA0B 4A56A 2LOPA 4E7ZA 4IE6A 4XAXB 3BQLA 4UVAB 2FBWA 2H88A 2QGSA 2CM0A 4CN6A 3QK6A 2ZM0A 4DMVA 5AQSB 4U2ZA 5HXCA 3HA4A 4TWDA 4WBOA 2E5VA 3PV0F 2EHOC 4HN9A 3RYFE 2MPKA 5FYMA 2CCQA 4H63H 3PUVF 1D1CA 3PDYA 4LMJA 2LRKA 4JUYA 4ILCA 1EZ3A 1YKEB 4PK5A 5ADXL 4X62T 1S35A 5AQJB 4ERRA 4X64T 2X0LB 3AE2A 3ZKRA 4CQIA 3UQ7A 4IL9A 4OYKA 2RP4A 2V7KA 2ACZA 3AA1B 2LJLA 5FP3A 1HNXT 3JC6C 2X9WA 3O1HA 2LM2A 4DV5T 1GQEA 2JJ9A 4CXWA 5J0ZA 3JCFA 2IDOB 2PFVA 4ZZCA 1NAFA 3MJXA 4J2CA 5L3GB 4UVCB 1V9DA 3NKZA 3DJBA 2DI4A 3E22E 4HWCA 3L3PA 3M3ZB 2VWAA 4QXCB 3Q5DA 4ILAA 3CX7B 4WW0A 2WZHA 2YINA 4PJJA 2KMFA 4DR2T 4IDOA 1UK5A 3AE8A 3T8OA 4DNDA 5BR8T 3AA6B 2DCFA 2XPKA 5L47A 2XM1A 4YY3T 3PUGA 1Y01A 2Q9QD 4UV8B 3SWHA 5L3EB 3ONJA 4OX9T 3CKDA 4HFBA 3U78A 4ZI3C 4IIJE 3SRZA 4XBFB 4JI5T 2VQFT 2X68A 4O2BE 4C90A 4TUYE 1XNRT 5LBMA 1IJ5A 2HPLA 3CX6B 2XZEA 2X66A 2WCAA 3NBXX 2WMOA 5M4YA 4LF4T 1UURA 5HEGA 4B6XA 2BS3A 3ZMZB 3PUSA 1I94T 2XSBA 2JMHA 4GYRA 4JEUB 4AKGA 1FEWA 4AKLA 2CLYC 4YTNA 2LLYA 1HFAA 4PFPA 3MXZA 2X9YA 4O2AE 2C5JA 4H9RC 2C0SA 2V7JA 1SA0E 4NIQA 3ZN1B 2J4GA 4EYUA 2JPFA 2XUEA 5LCYA 4DO0A 2C5IT 4EEBA 4HFVA 3CIRA 5JH7E 4AQFC 2ODUA 3CQGB 5HEJA 3RC3A 2DHRA 4MHCA 3TLWA 3I0QA 4GKJT 1J1JA 4JV5T 3RI5A 4YFSA 2WQYA 2E9XC 5J2TE 1W0AA 3P50A 2HN2A 4I50E 3H3MA 3ZT5A 2BG9B 4LFAT 2ZMAA 5LJNA 3AE1A 3RPUA 3ZT6A 2BG9A 4HTEA 1W0BA 4DV3T 3X1DA 1KF6A 1HR0T 3TLSA 3OYZA 1E2AA 3PURA 3FB2A 4DV4T 4TN7B 4DR7T 4U33A 2CBIA 1J5ET 1XDPA 4EV6A 4IGUA 3SOLA 3BQIA 2ZLYA 4DR6T 4EXTA 2LT3A 5FXVA 3I9YA 2KWHA 3L09A 4U72A 1D0YA 2W61A 3ZMUB 5HEHA 3UU4A 4EAHA 1VCTA 2LHNA 3N9MA 4ASKA 2WDRA 1D0ZA 4PW8A 4UXNB 2CXLA 5J1GA 3OPCA 3F57A 5L4EA 2M67A 3HKDE 3QB5K 5HCJA 4DV7T 2XAFB 2MOZA 4H9OC 4H9SE 4O4LE 4MBQA 1U5PA 4IDZA 3I9WA 4TWFA 5HWYA 1M7KA 5FVKA 3LK42 3K3OA 2BS2A 3RH3A 3RYIE 5AQHB 2WDVA 3K8PC 4YJ3E 4MLKA 3KBTA 1WRDA 3AEBA 2BBHA 2PTFA 2XQ9A 1E1HB 4NUUA 2IC6A 1NWMX 2IAKA 3RRCA 3NVOA 3MA9A 1WYCA 2XY8B 3PE0A 5C2TA 4IREA 3D0TA 2NW9A 1VOMA 3HI2A 4CN1A 3KVBA 3HKEE 3OTOT 2NWBA 4WZXA 1N34T 4AQYT 5JDHA 3A5XA 3IA3A 2OLTA 2YDSA 3AXJB 5GONE 2LKGA 4YT0A 2D2SA 1Y64B 5AQKB 1IAPA 3AXJA 3O1IA 1YD8G 2P9BA 3CQCB 4M1PA 4IHJE 5LXTE 1X79A 3TLUA 1ZP0A 3N5LA 3MK7C 1J5WA 1HCIA 3FXEB 2V1DB 2LM9A 5HEOA 3NRXA 5CA0E 2EHOB 3AB3B 3NWIA 2GK9A 2UU9T 2EHOA 4LMKA 5EK4A 3CMLA 3N2OA 4QXHB 4QH4A 4LMLA 4DUZT 3RIFA 1ZKEA 2ACXA 3IEEA 2H7OA 3PJAA 3RQUA 3UUXB 4DV2T 2CXFA 4ZI2C 3P4SA 1MNEA 1DU2A 4DV1T 1WR0A 1D0XA 5DQWA 3Q5EA 5FL1A 5IUXA 4L5GA 2X51A 3N9LA 3NRYA 2V8SV 5FL0A 4CXXA 2JRKA 3EABA 5HCMA 5L2LA 2BBJA 4OFZA 3NZQA 5L3DB 2WM9A 3ONXA 5LA6E 1KNPA 3P8CD 2NTXA 3OVUA 4X66T 3EI0A 2PG8A 4KMCA 4JBWF 3UTKA 2NOXA 4Q25A 3RIUC 2N2NA 1NEKA 4CI2B 3LDQB 3UUMA 4JI0T 4K0KT 3JAFA 2W0GA 4AQGA 2V7LA 2KNDA 3VR9A 2CWYA 3RYCE 1US7B 4L0RA 2CMRA 4B3ST 4Z90A 2WZIA 4B3RT 5C3JA 1UX4A 1HF8A 3ZEFB 4KI0F 3V5SA 2A2FX 5CA1E 3MZKB 3PU8A 1Z8UA 1XMQT 4JI3T 2UXXB 2AE9A 2M6IA 5LNKA 3HL6A 4PJMA 2V26A 4TV9E 2XQ8A 1UX5A 4FI5A 1HG5A 1YW0A 5FNVE 4O8SA 3UU3A 5JDLA 1MNDA 4I4TE 4GYSA 3K3NA 1Z0PA 2LRLA 3WAKA 1IZNB 2IUBA 3CWZB 2EHOD 4YSZA 5HAXA 2MAWA 2UXDT 2QA7A 4IDQA 2CBJA 3P4QA 2N9DA 4QXBB 2Y6XA 1T98A 2JQQA 5HXEA 2LKHA 2VKJA 3TLTA 1BR1A 3L39A 1UCUA 2HH7A 4DR5T 5FY7A 5E0OA 2QVAA 2CLYB 3C64A 3GWHA 2KLQA 3RKGA 3UU6A 3VU7H 3RRWA 3ZPOA 3P4RA 4DV6T 2W66A 5LHGB 3V5UA 4IE5A 4WBNE 2OV9A 4B3MT 3JC6D 2CA5A 1KNZA 2UUBT 2K48A 5CFBA 4GK0E 2I59A 3A7MA 3R6NA 3IHRA 5FMNA 1CHUA 1QLBA 5FXXA 2I0MA 2CEAA 5AQGB 2YN6A 2KXPB 5AQRB 4DVDA 5ABGA 4O4IE 4AQFA 1SE7A 4I43B 1N33T 4DR4T 4U3CA 2E9XB 2K3WA 5BMVE 5LGTB 3PJAJ 5AQIB 2E9XA 1YKHB 3P4PA 3ESLA 2YKSA 2WY2A 4EOZB 2ZM2A 3FZKB 4NXNT 2A3DA 4HFEA 1HX1B 3B57A 5HXSA 3B5MA 3OKQA 4JI2T 3UQ4A 1WFDA 3AE6A 3UUBA 2JQHA 4PNIA 2R6GF 4BA9A 3K1SA 4ZI3D 4ZXLA 1ZHCA 5J2UE 3MACA 5AQTB 3JAEA 2D0TA 3EDVA 2XSAA 2XJ7A 4HWDA 2VB6A 2X9XA 2L9QA 5KDMC 3E08A 2QRXA 4PK6A 4WNKA 4IDPA 3KDSE 3PUXF 4N78D 2DL1A 5FXZA 3KFWX 1XWMA 1JNRA 1KK7A 2DNXA 3EHZA 4CZZB 1VRBA 1T8BA 2XQYA 4AISA 2LSYA 5LGNB 1FMWA 2K5BB 4HGAA 2VVSA 4JI8T 1HX8A 1MIVA 3RKOA 2IMLA 5IHYA 4NUVA 3WI3A 2JQ9A 5FY0A 3FXDB 1W9RA 5F8PA 2MBGA 4CXYA 3SS1A 3RGLA 2HHHT 4UELA 4X5TA 4L9IA 3KBUA 2NP9A 3SFEA 5HEUA 4LF6T 4DR3T 4EB6E 4JLEA 2XAGB 5L3FB 2BVLA 4PJLA 2FJEA 4GK5E 4X1KE 4MFRA 3ZC1A 5LBQB 3U3IA 5FVLA 3ZYLA 2VURA 2W00A 5LMNT 4I0UA 4PFOA 5TAOA 2LSKA 3PUZF 1WR6A 4AI6A 4A98A 3B13A 3C4ZA 4LFCT 4P0AA 5LG4A 3AE9A 3ZCJA 3QNUA 4OK0A 4COFA 3KV9A 1H7CA 1O3XA 4ADZA 4AIUA 3BQKA 2FJBA 3CX8B 2W67A 5KMGP 2KZ7B 1ZV4X 4TV8E 2ES0A 1OWAA 3KV5A 2FJAA 4HFIA 2HPJA 3M65A 3ZSTA 5L4HA 1T72A 5AQNB 2WAUA 4YTMA 2LSJA 4FJOA 1W09A 3RHWA 2XQ7A 1WCRA 1NENA 3ZMSB 4OYJA 4Z8XA 4LF7T 5JRCB 3ZC0A 3KVAA 3RIUA 1SHZC 5JRCA 4X20E 1ZOYA 3AE4A 2BVMA 3AEAA 2XAJB 2V7IA 5FY1A 4HWHA 4X65T 3KV4A 3CQXC 4K0UA 3F31A 4O4HE 3OJAA 4NPPA 1BR4A 5DQVA 2YU1A 3PTRB 3UULA 1N32T 5ABEA 1FIOA 2W62A 2K24A 3UFGA 2KSRA 3UU8A 4EZ4A 4YSYA 3ZMTB 2IC9A 3AAAB 4ZS3A 1UGOA 3VRAA 1R8IA 2XAQB 4NXMT 4PJNA 5LOVE 2BS4A 2FJDA 5AQPB 3LK3B 4JYAT 1D1BA 1KFYA 1M62A 3E0ZA 2LSIA 1T7SA 2C5KT 2KINB 3OYXA 4V1Av 2CPTA 2V6XA 3N9OA 4EZHA 4TZ4C 3AVSA 5HXHA 4U31A 5AQLB 5AQOB 1G8XA 1HS7A 3ZMVB 4ZEYA 4YSXA 4P09A 4U7IA 1MIWA 3PUQA 4ZI2D 4AXPA 2LEHA 1HNZT 5JREA 1B7TA 4DV0T 2WU2A 2W63A 4DMWA 2A9UA 3EAMA 3WAJA 5JVDE 5AFUL 3LBXB 5JR9C 1XNQT 4QH1A 2XQ6A 5IWAT 2CE7A 2UXBT 3LBXA 3KV6A 4HFHA 3T1YT 2LOSA 2DWGA 4CI1B 1LKXA 5LGUB 1OEDC 4LF5T 3NZPA 3GN5B 4X1YE 5JQGE 1E7PA 3RYHE 3LK2B 4KX6A 4YLHA 2Y48B 3GN5A 2H3RA 3AEEA 3AAIA 4AKIA 4WYVA 4HWFA 2X67A 5JDGA 3UUNA 5LYJE 4H9PC 4PAGA 3JADA 1WLXA 4JI6T 5EK3A 3N9NA 4KHZF 5HWXA 4QX7B 4QX8B 5LMUT 3AEFA 3EUHA 2VASA 4EEDA 3ETUA 5DJQC 1WYBA 4EGWA 4ZHQE 3CVRA 1KNRA 2RPAA 3Q5WA 2YK0A 2UXNB 2Z6EA 3QC9A 4U2YA 2XHEB 1LRZA 3TKLB 4XZCA 2QYWA 3VKGA 2DLRA 2J1DG 2KT9A 3PUWF 5LHHB 4QKNA 2D0UA 4JEHB 4DBRA 4X1IE 5FKYA 4BAYB 1CUNA 2PJQA 1FMVA 2B76A 4IE4A 2VK9A 2YU2A 4UR9A 3SFDA 4GKKT 3LJCA 2XQAA 2LSGA 3ZN0B 2XAHB 2Y8DA 2L8KA 3Q9DA 4OHFA 2K9AA 3C51A 4U74A 1IBLT 3ZYKA 2VKHA 4TWHA 2WBLA 2IHR1 3UFEA 1MMAA 3GMIA 2JMKA 5ABHA 2UXCT 5H6RB 2MTQA 4JI4T 4DIDB 5HYAA
chains in the Genus database with same CATH topology
5FY0A 4HEAA 3J9X1 3FXDB 3RH3A 3RYIE 5F8PA 2MBGA 2V7MA 3Q5XA 3K8PC 4YJ3E 2H7VC 3HKCE 3KBTA 4MLKA 4CXYA 1WRDA 3SS1A 1HG2A 4UELA 2MYSA 2BZBA 3KINB 1E1HB 4NUUA 4L9IA 3KBUA 2IC6A 2NP9A 1NWMX 2VKDA 2IAKA 4BJNA 2NW7A 3RRCA 3QUJA 4F6RC 3MA9A 5FXWA 1WYCA 4EB6E 2LE8A 4JLEA 2XAGB 5L3FB 2BVLA 4PJLA 3PE0A 4GK5E 2NW9A 3D0TA 1VOMA 2VL8A 3C4XA 3HI2A 2D5UA 3H3AA 4X1KE 3KVBA 4MFRA 3HKEE 3ZC1A 3S4UA 2NWBA 2CWOA 3PUAA 4ZI7E 1IJ6A 5LBQB 2VKOA 3U3IA 3ZYLA 3ZJ2A 5L3CB 2G0UA 3RC8A 2W00A 5JDHA 3O4XE 4PFOA 3A5XA 2Q9QB 5GONE 5TAOA 3CPZA 1D1AA 2LSKA 4E7SA 4H63V 2D2SA 2Q9QA 1Y64B 3FHNA 1IAPA 3O1IA 4UVBB 1YD8G 2P9BA 4HKAA 1WR6A 4ISTA 5JDQA 4AI6A 2Q9QC 3B13A 3CQCB 4M1PA 4IHJE 5LXTE 3RX6A 1X79A 3GA8A 3C4ZA 3N5LA 3AA0B 3MK7C 5LG4A 4P0AA 4A56A 2LOPA 1HCIA 4E7ZA 4H9QC 3FXEB 2V1DB 4IE6A 3PU3A 3ZCJA 4XAXB 2LM9A 3BQLA 4UVAB 4KBMB 2QGSA 2WSSV 2CM0A 4OK0A 3C98B 3NRXA 3QK6A 3KV9A 4I55E 2ZM0A 4DMVA 1H7CA 5CA0E 3IBPA 2EHOB 3AB3B 4IE7A 2GK9A 5HXCA 3HA4A 1O3XA 2EHOA 4ADZA 4WBOA 3BQKA 3CMLA 3N2OA 4QXHB 5EK4A 3CX8B 3FBZA 5KMGP 3C4WA 1ZKEA 2EHOC 4HN9A 2ACXA 2KZ7B 1ZV4X 3IEEA 3RYFE 2H7OA 4TV8E 3O1JA 2ES0A 5FYMA 3UUXB 2CCQA 1OWAA 2CXFA 3KV5A 4H63H 4ZI2C 1MNEA 5JDMA 3H37A 2HPJA 3M65A 1D1CA 1D0XA 3PDYA 2BDEA 4UF0B 2WAUA 4YHJA 5DQWA 1HTJF 2LSJA 3I0OA 4L5GA 4JUYA 2X51A 4UF0A 3N9LA 1EZ3A 3NRYA 1YKEB 4FJOA 2RA1A 4PK5A 4CXXA 2JRKA 5ADXL 5L2LA 3N9PA 4OFZA 3NZQA 3ZMSB 2NW8A 5LJMA 1S35A 5L3DB 4C91A 5EZYE 2WM9A 3ONXA 4ERRA 2YEVC 2X0LB 4OYJA 4Z8XA 4ILUA 2WWUA 4CQIA 5LA6E 5JRCB 3P8CD 4OYKA 3ZC0A 3KVAA 2RP4A 2V7KA 3AA1B 1SHZC 2NTXA 2LJLA 4X20E 5FP3A 2PG8A 4KMCA 5JRCA 3JC6C 3UTKA 2X9WA 4GIWA 2NOXA 3O1HA 2BVMA 2N2NA 4CI2B 2XAJB 3UUMA 2V7IA 2JJ9A 5DABA 4CXWA 3AAEB 5FY1A 3KV4A 3OBVE 3CQXC 3UT5E 2W0GA 4K0UA 3F31A 2XASB 2PFVA 4O4HE 1NAFA 3MJXA 4AQGA 4J2CA 3OJAA 1MMNA 2V7LA 5L3GB 2KNDA 3N2GE 1V9DA 4UVCB 2CWYA 1BR4A 2DWKA 3I1AA 3ZYMA 1QSDA 3DJBA 2DI4A 4UEMA 2N1GA 4ISSA 4EYYR 3RYCE 3E22E 5DQVA 1US7B 4L0RA 2YU1A 3L3PA 2CMRA 3PTRB 4O4JE 4HE8A 2VWAA 3UULA 4QXCB 1FIOA 3CX7B 1UX4A 4WW0A 2E9XD 2KWIB 2W62A 2YINA 4PJJA 2KMFA 2K24A 1OXZA 1HF8A 4EZ4A 3ZEFB 3ZMTB 3VHLA 3V5SA 2A2FX 2IC9A 3AAAB 4ZS3A 4UIGA 3T8OA 4DNDA 3VKHA 5CA1E 3AA6B 3ZCIA 2DCFA 3MZKB 1ZEEA 3PU8A 2XAQB 2UXXB 4PJNA 5LOVE 3BK9A 3PUGA 5LNKA 3HL6A 4PJMA 2Q9QD 3AVRA 2V26A 3FBLA 4TV9E 3HR0A 3LK3B 1UX5A 4FI5A 1HG5A 4UV8B 3SWHA 1D1BA 5L3EB 1QUUA 3E0ZA 2LSIA 5CB4E 3CKDA 5HYAA 1YW0A 2C5KT 2KINB 4GOUA 4QHOA 3OYXA 4IIJE 4IE0A 4V1Av 4ZI3C 3U78A 2PBIA 4O8SA 5FNVE 5L3BB 4AKRB 5JDLA 1MNDA 3SRZA 3N9OA 4I4TE 1MMGA 4GYSA 4EZHA 4TZ4C 3ZJ1A 4XBFB 3AVSA 1Z0PA 3K3NA 5HXHA 3LFMA 3WAKA 1G8XA 1IZNB 1HS7A 3ZMVB 2X68A 4O2BE 3CWZB 2EHOD 4C90A 4P09A 1MIWA 5HAXA 4TUYE 3DTOA 3PUQA 4ZI2D 4AXPA 2LEHA 2QA7A 5JREA 1B7TA 5LBMA 1IJ5A 2HPLA 5JR9B 2N9DA 3CX6B 4QXBB 2Y6XA 2X66A 5JDFA 1T98A 2W63A 2JQQA 5HXEA 4DMWA 3NBXX 3ETVA 5JR9A 2WMOA 3WAJA 5JVDE 2VKJA 2CXDA 5M4YA 3MKDA 5AFUL 1BR1A 3LBXB 2L3LA 5JR9C 4B6XA 1UCUA 3ZMZB 2HH7A 3PUSA 2CE7A 5FY7A 5E0OA 3LBXA 2CLYB 2JMHA 3C64A 3KV6A 4GYRA 3GWHA 4JEUB 4AKGA 2KLQA 2LOSA 3VU7H 2DWGA 3HKBE 1FEWA 3RRWA 4CI1B 3ZPOA 1G73A 1LKXA 2E8IA 3F2EA 4AKLA 2CLYC 4ZOLE 5LGUB 3N2KE 3IF8B 1HFAA 5LP6E 5LHGB 3V5UA 1MMDA 4IE5A 3NZPA 4PFPA 3ANWB 4WBNE 3JC6D 3MXZA 2CA5A 3GN5B 1KNZA 2X9YA 4O2AE 4X1YE 5JQGE 3ANWA 2K48A 2C5JA 4H9RC 3RYHE 2C0SA 2V7JA 3LK2B 4GK0E 4YLHA 2Y48B 2I59A 1SA0E 3GN5A 3AA7B 5KX5E 5JDNA 4G2AA 3R6NA 1AJ3A 1BR2A 3IHRA 2LHRA 4G63A 5FMNA 5FXXA 1LVKA 3ZN1B 2CEAA 2H3RA 5F3JA 3AAIA 4AKIA 4EYUA 5JDGA 2X67A 2KXPB 3UUNA 4EIWA 4P0BA 2JPFA 5LYJE 4DVDA 2XUEA 4QWNB 4O4IE 4H9PC 4PAGA 5LCYA 4AQFA 4DO0A 3LG7A 1WLXA 2C5IT 4HFVA 3EDUA 2E9XB 5JH7E 5EK3A 4AQFC 4YJ2E 2ODUA 2X9HA 3N9NA 5BMVE 3CQGB 5LGTB 3RC3A 2E9XA 5HWXA 4QX7B 4CI3B 1YKHB 2DHRA 4QX8B 4MHCA 3I0QA 3EUHA 3ESLA 3K3QC 4KUMB 2WMNA 4YFSA 3R84B 4EOZB 2ZM2A 4AKHA 2E9XC 5J2TE 2A3DA 2VASA 4I50E 3ETUA 5DJQC 3ZLIA 3B57A 1S94A 1WYBA 5HXSA 2ZMAA 5LJNA 4ZHQE 3OKQA 3RPUA 3CVRA 4BJMA 1U4QA 3LK42 4HTEA 4TX5A 3O9XA 3EVYA 3Q5WA 2YK0A 3J7Yq 2UXNB 2Z6EA 3QC9A 5H6QB 4PNIA 4BA9A 3Q2MA 4ZI3D 2XHEB 3OYZA 1BR0A 5HXRA 3WI3A 1ZHCA 3C50A 1LRZA 3PURA 3FB2A 3DP7A 4PK4A 4MALA 4TN7B 5A1LA 5J2UE 3MACA 4IGUA 2B1EA 3SOLA 2D0TA 3TKLB 4XZCA 3BQIA 3EDVA 3VKGA 4UV9B 2DLRA 2ODVA 2VB6A 2ZLYA 2J1DG 2X9XA 2KT9A 2L9QA 4EXTA 5KDMC 5LHHB 2LT3A 4QKNA 5FXVA 3I9YA 2KWHA 2A72A 2OA5A 3E08A 3L09A 4U72A 4PK6A 2D0UA 4WNKA 1D0YA 3KDSE 2SPCA 2W61A 4JEHB 3ZMUB 4X1IE 4DBRA 4BAYB 4N78D 4KP3C 5FXZA 1CUNA 3N9QA 3KFWX 2PJQA 1FMVA 4IE4A 2IW5B 4EAHA 2ZM8A 2LHNA 3N9MA 4ZS2A 2VK9A 4ASKA 2YU2A 5IYZE 1D0ZA 5EK2A 2NTYA 4PW8A 5ETWA 4DBQA 1KK7A 3LJCA 4UXNB 2CXLA 5J1GA 2LSGA 3ZN0B 2DNXA 2XAHB 2Y8DA 2L8KA 3F57A 3Q9DA 5LHIB 4CZZB 1VRBA 4OHFA 2M67A 3HKDE 2XQYA 3P7IA 2K9AA 3C51A 2LSYA 5LGNB 4ANJA 4U74A 2XTLA 1FMWA 3ZYKA 2XAFB 2VKHA 2MOZA 4H9OC 4H9SE 2WBLA 4H9NC 2K5BB 4HGAA 4O4LE 3UFEA 1MMAA 3W15B 3GMIA 2JMKA 4MBQA 1HX8A 5C8YE 1MIVA 3RKOA 1U5PA 1MIYA 4IDZA 3I9WA 5HWYA 5H6RB 1LVFA 2MTQA 5IHYA 4NUVA 3K3OA 4I43B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O3X A;  1OXZ A;  1X79 A;  1YD8 G;  1NWM X;  1WR6 A;  1WRD A;  2N2N A;  1NAF A;  2N9D A; 
#chains in the Genus database with same CATH topology
 4JI1 T;  3AE3 A;  2V7M A;  3AEG A;  3HKC E;  5KXJ A;  5CJ5 A;  2MYS A;  3KIN B;  1XDO A;  2VKD A;  2NW7 A;  5FXW A;  2JIW A;  4QH5 A;  1XMO T;  4ILB A;  3AEC A;  1L0V A;  3P4W A;  2D5U A;  3H3A A;  3ZSS A;  3S4U A;  3PUA A;  4ZI7 E;  5L3C B;  3RC8 A;  2NR4 A;  3O4X E;  1X9B A;  3ABV A;  1YQ4 A;  4H63 V;  3L8R A;  2V5C A;  3ZT7 A;  4HKA A;  2Q9Q C;  5ABF B;  3GA8 A;  4Z91 A;  1YQ3 A;  5ABF A;  4H9Q C;  2WP9 A;  3PU3 A;  4KBM B;  2WSS V;  3PUY F;  3C98 B;  4I55 E;  2IIU A;  3IBP A;  4IE7 A;  4YHH T;  3FBZ A;  3QOF A;  2WU5 A;  3C4W A;  2YDR A;  3AE5 A;  3O1J A;  5AQM B;  3FZL B;  2M6B A;  5JDM A;  5LG3 A;  3H37 A;  3VR8 A;  4UF0 B;  2BDE A;  1HTJ F;  3I0O A;  5AQU B;  2ZM6 T;  4UF0 A;  1N36 T;  2RA1 A;  1YXR A;  2J62 A;  2XQ4 A;  3N9P A;  2NW8 A;  3ONL C;  5LJM A;  4C91 A;  5EZY E;  2YEV C;  4ILU A;  2WWU A;  3RF1 A;  2XM2 A;  2E5L T;  4GIW A;  4YXD A;  4HFC A;  5DAB A;  3AAE B;  2H89 A;  1FJG T;  4DR1 T;  3OBV E;  3UT5 E;  2XQ3 A;  2XAS B;  1IBK T;  2VQE T;  2BG9 E;  1MMN A;  3N2G E;  2DWK A;  3UU5 A;  3I1A A;  3ZYM A;  4A5X A;  1QSD A;  4UEM A;  2N1G A;  4ISS A;  4EYY R;  4YTP A;  4O4J E;  4HE8 A;  2VVN A;  2E9X D;  2KWI B;  2BKP A;  1OXZ A;  4DUY T;  3VHL A;  2W4X A;  4UIG A;  3VKH A;  2E2A A;  3ZCI A;  1ZEE A;  3BK9 A;  3AVR A;  3FBL A;  4LF9 T;  3HR0 A;  1QUU A;  2V6Y B;  2WDQ A;  5CB4 E;  2CRB A;  3VRB A;  4GOU A;  2V5D A;  4QHO A;  2V6Y A;  4IE0 A;  5L3B B;  2PBI A;  4AKR B;  1VCS A;  4TNW A;  1MMG A;  3ZJ1 A;  3LFM A;  4HFD A;  1OED E;  4P1N A;  3TLV A;  3DTO A;  4TNV A;  5JR9 B;  5F5W A;  4F8H A;  5JDF A;  5JR9 A;  3ETV A;  4IT4 A;  3RIA A;  2CXD A;  3MKD A;  2WWV A;  2L3L A;  3FZF B;  1OED B;  4HWI B;  3HKB E;  3RQW A;  1UUS A;  1OED A;  1G73 A;  2E8I A;  3F2E A;  2W2U A;  4ZOL E;  3N2K E;  3IF8 B;  5LP6 E;  2F4V T;  1MMD A;  3ANW B;  5AQQ B;  2YDQ A;  3ANW A;  4CN4 A;  1KEY A;  3AA7 B;  5KX5 E;  5JDN A;  4G2A A;  1AJ3 A;  3CK6 A;  1BR2 A;  2LHR A;  4G63 A;  1LVK A;  5F3J A;  4EIW A;  4P0B A;  4ZZB A;  4QWN B;  5LB7 B;  3LG7 A;  3A8Y C;  3EDU A;  4YJ2 E;  2X9H A;  4CI3 B;  3K3Q C;  4KUM B;  2WMN A;  4AKH A;  3R84 B;  5AQV B;  3ZLI A;  1S94 A;  4BJM A;  1U4Q A;  4TX5 A;  3O9X A;  3EVY A;  3J7Y q;  4LF8 T;  5H6Q B;  2BG9 C;  1I6Z A;  3Q2M A;  2X0Y A;  1BR0 A;  5HXR A;  3C50 A;  2CHN A;  3DP7 A;  4LFB T;  2BKO A;  4MAL A;  4PK4 A;  5A1L A;  3FZM B;  2B1E A;  2WB5 A;  4UV9 B;  2ODV A;  4IDN A;  4A97 A;  1HNW T;  2A72 A;  2OA5 A;  2SPC A;  1SUM B;  4KHP T;  3RLF F;  5AQF B;  4KP3 C;  3N9Q A;  2IW5 B;  2ZM8 A;  4ZS2 A;  2XQ5 A;  5IYZ E;  5EK2 A;  2NTY A;  5ETW A;  4DBQ A;  2HN1 A;  2BKN A;  5JTG A;  2VL0 A;  5LHI B;  3P7I A;  2X0H A;  4ANJ A;  2XTL A;  3AED A;  2YOE A;  4H9N C;  1XZY A;  3G06 A;  3W15 B;  5C8Y E;  1MIY A;  1IBM T;  3QB5 A;  4YHJ A;  1LVF A;  3J9X 1;  4HEA A;  4JI7 T;  5CGM A;  3Q5X A;  2H7V C;  2WS3 A;  1HG2 A;  4U7Y A;  2BZB A;  3LSV A;  4IL4 A;  4BJN A;  4F6R C;  3QUJ A;  2LE8 A;  2UUC T;  2VL8 A;  2CHO A;  3C4X A;  1JNZ A;  3FZH B;  2CWO A;  1IJ6 A;  2VKO A;  2UUA T;  3ZJ2 A;  2G0U A;  2Q9Q B;  2AXD S;  3AE7 A;  3T1H T;  2I6H A;  3CPZ A;  1D1A A;  4E7S A;  2Q9Q A;  3FHN A;  4B3T T;  4UVB B;  2FUP A;  2J47 A;  4IST A;  5JDQ A;  3RX6 A;  2D9D A;  2JQK A;  3AA0 B;  4A56 A;  2LOP A;  4E7Z A;  4IE6 A;  4XAX B;  3BQL A;  4UVA B;  2FBW A;  2H88 A;  2QGS A;  2CM0 A;  4CN6 A;  3QK6 A;  2ZM0 A;  4DMV A;  5AQS B;  4U2Z A;  5HXC A;  3HA4 A;  4TWD A;  4WBO A;  2E5V A;  3PV0 F;  2EHO C;  4HN9 A;  3RYF E;  2MPK A;  5FYM A;  2CCQ A;  4H63 H;  3PUV F;  1D1C A;  3PDY A;  4LMJ A;  2LRK A;  4JUY A;  4ILC A;  1EZ3 A;  1YKE B;  4PK5 A;  5ADX L;  4X62 T;  1S35 A;  5AQJ B;  4ERR A;  4X64 T;  2X0L B;  3AE2 A;  3ZKR A;  4CQI A;  3UQ7 A;  4IL9 A;  4OYK A;  2RP4 A;  2V7K A;  2ACZ A;  3AA1 B;  2LJL A;  5FP3 A;  1HNX T;  3JC6 C;  2X9W A;  3O1H A;  2LM2 A;  4DV5 T;  1GQE A;  2JJ9 A;  4CXW A;  5J0Z A;  3JCF A;  2IDO B;  2PFV A;  4ZZC A;  1NAF A;  3MJX A;  4J2C A;  5L3G B;  4UVC B;  1V9D A;  3NKZ A;  3DJB A;  2DI4 A;  3E22 E;  4HWC A;  3L3P A;  3M3Z B;  2VWA A;  4QXC B;  3Q5D A;  4ILA A;  3CX7 B;  4WW0 A;  2WZH A;  2YIN A;  4PJJ A;  2KMF A;  4DR2 T;  4IDO A;  1UK5 A;  3AE8 A;  3T8O A;  4DND A;  5BR8 T;  3AA6 B;  2DCF A;  2XPK A;  5L47 A;  2XM1 A;  4YY3 T;  3PUG A;  1Y01 A;  2Q9Q D;  4UV8 B;  3SWH A;  5L3E B;  3ONJ A;  4OX9 T;  3CKD A;  4HFB A;  3U78 A;  4ZI3 C;  4IIJ E;  3SRZ A;  4XBF B;  4JI5 T;  2VQF T;  2X68 A;  4O2B E;  4C90 A;  4TUY E;  1XNR T;  5LBM A;  1IJ5 A;  2HPL A;  3CX6 B;  2XZE A;  2X66 A;  2WCA A;  3NBX X;  2WMO A;  5M4Y A;  4LF4 T;  1UUR A;  5HEG A;  4B6X A;  2BS3 A;  3ZMZ B;  3PUS A;  1I94 T;  2XSB A;  2JMH A;  4GYR A;  4JEU B;  4AKG A;  1FEW A;  4AKL A;  2CLY C;  4YTN A;  2LLY A;  1HFA A;  4PFP A;  3MXZ A;  2X9Y A;  4O2A E;  2C5J A;  4H9R C;  2C0S A;  2V7J A;  1SA0 E;  4NIQ A;  3ZN1 B;  2J4G A;  4EYU A;  2JPF A;  2XUE A;  5LCY A;  4DO0 A;  2C5I T;  4EEB A;  4HFV A;  3CIR A;  5JH7 E;  4AQF C;  2ODU A;  3CQG B;  5HEJ A;  3RC3 A;  2DHR A;  4MHC A;  3TLW A;  3I0Q A;  4GKJ T;  1J1J A;  4JV5 T;  3RI5 A;  4YFS A;  2WQY A;  2E9X C;  5J2T E;  1W0A A;  3P50 A;  2HN2 A;  4I50 E;  3H3M A;  3ZT5 A;  2BG9 B;  4LFA T;  2ZMA A;  5LJN A;  3AE1 A;  3RPU A;  3ZT6 A;  2BG9 A;  4HTE A;  1W0B A;  4DV3 T;  3X1D A;  1KF6 A;  1HR0 T;  3TLS A;  3OYZ A;  1E2A A;  3PUR A;  3FB2 A;  4DV4 T;  4TN7 B;  4DR7 T;  4U33 A;  2CBI A;  1J5E T;  1XDP A;  4EV6 A;  4IGU A;  3SOL A;  3BQI A;  2ZLY A;  4DR6 T;  4EXT A;  2LT3 A;  5FXV A;  3I9Y A;  2KWH A;  3L09 A;  4U72 A;  1D0Y A;  2W61 A;  3ZMU B;  5HEH A;  3UU4 A;  4EAH A;  1VCT A;  2LHN A;  3N9M A;  4ASK A;  2WDR A;  1D0Z A;  4PW8 A;  4UXN B;  2CXL A;  5J1G A;  3OPC A;  3F57 A;  5L4E A;  2M67 A;  3HKD E;  3QB5 K;  5HCJ A;  4DV7 T;  2XAF B;  2MOZ A;  4H9O C;  4H9S E;  4O4L E;  4MBQ A;  1U5P A;  4IDZ A;  3I9W A;  4TWF A;  5HWY A;  1M7K A;  5FVK A;  3LK4 2;  3K3O A;  2BS2 A;  3RH3 A;  3RYI E;  5AQH B;  2WDV A;  3K8P C;  4YJ3 E;  4MLK A;  3KBT A;  1WRD A;  3AEB A;  2BBH A;  2PTF A;  2XQ9 A;  1E1H B;  4NUU A;  2IC6 A;  1NWM X;  2IAK A;  3RRC A;  3NVO A;  3MA9 A;  1WYC A;  2XY8 B;  3PE0 A;  5C2T A;  4IRE A;  3D0T A;  2NW9 A;  1VOM A;  3HI2 A;  4CN1 A;  3KVB A;  3HKE E;  3OTO T;  2NWB A;  4WZX A;  1N34 T;  4AQY T;  5JDH A;  3A5X A;  3IA3 A;  2OLT A;  2YDS A;  3AXJ B;  5GON E;  2LKG A;  4YT0 A;  2D2S A;  1Y64 B;  5AQK B;  1IAP A;  3AXJ A;  3O1I A;  1YD8 G;  2P9B A;  3CQC B;  4M1P A;  4IHJ E;  5LXT E;  1X79 A;  3TLU A;  1ZP0 A;  3N5L A;  3MK7 C;  1J5W A;  1HCI A;  3FXE B;  2V1D B;  2LM9 A;  5HEO A;  3NRX A;  5CA0 E;  2EHO B;  3AB3 B;  3NWI A;  2GK9 A;  2UU9 T;  2EHO A;  4LMK A;  5EK4 A;  3CML A;  3N2O A;  4QXH B;  4QH4 A;  4LML A;  4DUZ T;  3RIF A;  1ZKE A;  2ACX A;  3IEE A;  2H7O A;  3PJA A;  3RQU A;  3UUX B;  4DV2 T;  2CXF A;  4ZI2 C;  3P4S A;  1MNE A;  1DU2 A;  4DV1 T;  1WR0 A;  1D0X A;  5DQW A;  3Q5E A;  5FL1 A;  5IUX A;  4L5G A;  2X51 A;  3N9L A;  3NRY A;  2V8S V;  5FL0 A;  4CXX A;  2JRK A;  3EAB A;  5HCM A;  5L2L A;  2BBJ A;  4OFZ A;  3NZQ A;  5L3D B;  2WM9 A;  3ONX A;  5LA6 E;  1KNP A;  3P8C D;  2NTX A;  3OVU A;  4X66 T;  3EI0 A;  2PG8 A;  4KMC A;  4JBW F;  3UTK A;  2NOX A;  4Q25 A;  3RIU C;  2N2N A;  1NEK A;  4CI2 B;  3LDQ B;  3UUM A;  4JI0 T;  4K0K T;  3JAF A;  2W0G A;  4AQG A;  2V7L A;  2KND A;  3VR9 A;  2CWY A;  3RYC E;  1US7 B;  4L0R A;  2CMR A;  4B3S T;  4Z90 A;  2WZI A;  4B3R T;  5C3J A;  1UX4 A;  1HF8 A;  3ZEF B;  4KI0 F;  3V5S A;  2A2F X;  5CA1 E;  3MZK B;  3PU8 A;  1Z8U A;  1XMQ T;  4JI3 T;  2UXX B;  2AE9 A;  2M6I A;  5LNK A;  3HL6 A;  4PJM A;  2V26 A;  4TV9 E;  2XQ8 A;  1UX5 A;  4FI5 A;  1HG5 A;  1YW0 A;  5FNV E;  4O8S A;  3UU3 A;  5JDL A;  1MND A;  4I4T E;  4GYS A;  3K3N A;  1Z0P A;  2LRL A;  3WAK A;  1IZN B;  2IUB A;  3CWZ B;  2EHO D;  4YSZ A;  5HAX A;  2MAW A;  2UXD T;  2QA7 A;  4IDQ A;  2CBJ A;  3P4Q A;  2N9D A;  4QXB B;  2Y6X A;  1T98 A;  2JQQ A;  5HXE A;  2LKH A;  2VKJ A;  3TLT A;  1BR1 A;  3L39 A;  1UCU A;  2HH7 A;  4DR5 T;  5FY7 A;  5E0O A;  2QVA A;  2CLY B;  3C64 A;  3GWH A;  2KLQ A;  3RKG A;  3UU6 A;  3VU7 H;  3RRW A;  3ZPO A;  3P4R A;  4DV6 T;  2W66 A;  5LHG B;  3V5U A;  4IE5 A;  4WBN E;  2OV9 A;  4B3M T;  3JC6 D;  2CA5 A;  1KNZ A;  2UUB T;  2K48 A;  5CFB A;  4GK0 E;  2I59 A;  3A7M A;  3R6N A;  3IHR A;  5FMN A;  1CHU A;  1QLB A;  5FXX A;  2I0M A;  2CEA A;  5AQG B;  2YN6 A;  2KXP B;  5AQR B;  4DVD A;  5ABG A;  4O4I E;  4AQF A;  1SE7 A;  4I43 B;  1N33 T;  4DR4 T;  4U3C A;  2E9X B;  2K3W A;  5BMV E;  5LGT B;  3PJA J;  5AQI B;  2E9X A;  1YKH B;  3P4P A;  3ESL A;  2YKS A;  2WY2 A;  4EOZ B;  2ZM2 A;  3FZK B;  4NXN T;  2A3D A;  4HFE A;  1HX1 B;  3B57 A;  5HXS A;  3B5M A;  3OKQ A;  4JI2 T;  3UQ4 A;  1WFD A;  3AE6 A;  3UUB A;  2JQH A;  4PNI A;  2R6G F;  4BA9 A;  3K1S A;  4ZI3 D;  4ZXL A;  1ZHC A;  5J2U E;  3MAC A;  5AQT B;  3JAE A;  2D0T A;  3EDV A;  2XSA A;  2XJ7 A;  4HWD A;  2VB6 A;  2X9X A;  2L9Q A;  5KDM C;  3E08 A;  2QRX A;  4PK6 A;  4WNK A;  4IDP A;  3KDS E;  3PUX F;  4N78 D;  2DL1 A;  5FXZ A;  3KFW X;  1XWM A;  1JNR A;  1KK7 A;  2DNX A;  3EHZ A;  4CZZ B;  1VRB A;  1T8B A;  2XQY A;  4AIS A;  2LSY A;  5LGN B;  1FMW A;  2K5B B;  4HGA A;  2VVS A;  4JI8 T;  1HX8 A;  1MIV A;  3RKO A;  2IML A;  5IHY A;  4NUV A;  3WI3 A;  2JQ9 A;  5FY0 A;  3FXD B;  1W9R A;  5F8P A;  2MBG A;  4CXY A;  3SS1 A;  3RGL A;  2HHH T;  4UEL A;  4X5T A;  4L9I A;  3KBU A;  2NP9 A;  3SFE A;  5HEU A;  4LF6 T;  4DR3 T;  4EB6 E;  4JLE A;  2XAG B;  5L3F B;  2BVL A;  4PJL A;  2FJE A;  4GK5 E;  4X1K E;  4MFR A;  3ZC1 A;  5LBQ B;  3U3I A;  5FVL A;  3ZYL A;  2VUR A;  2W00 A;  5LMN T;  4I0U A;  4PFO A;  5TAO A;  2LSK A;  3PUZ F;  1WR6 A;  4AI6 A;  4A98 A;  3B13 A;  3C4Z A;  4LFC T;  4P0A A;  5LG4 A;  3AE9 A;  3ZCJ A;  3QNU A;  4OK0 A;  4COF A;  3KV9 A;  1H7C A;  1O3X A;  4ADZ A;  4AIU A;  3BQK A;  2FJB A;  3CX8 B;  2W67 A;  5KMG P;  2KZ7 B;  1ZV4 X;  4TV8 E;  2ES0 A;  1OWA A;  3KV5 A;  2FJA A;  4HFI A;  2HPJ A;  3M65 A;  3ZST A;  5L4H A;  1T72 A;  5AQN B;  2WAU A;  4YTM A;  2LSJ A;  4FJO A;  1W09 A;  3RHW A;  2XQ7 A;  1WCR A;  1NEN A;  3ZMS B;  4OYJ A;  4Z8X A;  4LF7 T;  5JRC B;  3ZC0 A;  3KVA A;  3RIU A;  1SHZ C;  5JRC A;  4X20 E;  1ZOY A;  3AE4 A;  2BVM A;  3AEA A;  2XAJ B;  2V7I A;  5FY1 A;  4HWH A;  4X65 T;  3KV4 A;  3CQX C;  4K0U A;  3F31 A;  4O4H E;  3OJA A;  4NPP A;  1BR4 A;  5DQV A;  2YU1 A;  3PTR B;  3UUL A;  1N32 T;  5ABE A;  1FIO A;  2W62 A;  2K24 A;  3UFG A;  2KSR A;  3UU8 A;  4EZ4 A;  4YSY A;  3ZMT B;  2IC9 A;  3AAA B;  4ZS3 A;  1UGO A;  3VRA A;  1R8I A;  2XAQ B;  4NXM T;  4PJN A;  5LOV E;  2BS4 A;  2FJD A;  5AQP B;  3LK3 B;  4JYA T;  1D1B A;  1KFY A;  1M62 A;  3E0Z A;  2LSI A;  1T7S A;  2C5K T;  2KIN B;  3OYX A;  4V1A v;  2CPT A;  2V6X A;  3N9O A;  4EZH A;  4TZ4 C;  3AVS A;  5HXH A;  4U31 A;  5AQL B;  5AQO B;  1G8X A;  1HS7 A;  3ZMV B;  4ZEY A;  4YSX A;  4P09 A;  4U7I A;  1MIW A;  3PUQ A;  4ZI2 D;  4AXP A;  2LEH A;  1HNZ T;  5JRE A;  1B7T A;  4DV0 T;  2WU2 A;  2W63 A;  4DMW A;  2A9U A;  3EAM A;  3WAJ A;  5JVD E;  5AFU L;  3LBX B;  5JR9 C;  1XNQ T;  4QH1 A;  2XQ6 A;  5IWA T;  2CE7 A;  2UXB T;  3LBX A;  3KV6 A;  4HFH A;  3T1Y T;  2LOS A;  2DWG A;  4CI1 B;  1LKX A;  5LGU B;  1OED C;  4LF5 T;  3NZP A;  3GN5 B;  4X1Y E;  5JQG E;  1E7P A;  3RYH E;  3LK2 B;  4KX6 A;  4YLH A;  2Y48 B;  3GN5 A;  2H3R A;  3AEE A;  3AAI A;  4AKI A;  4WYV A;  4HWF A;  2X67 A;  5JDG A;  3UUN A;  5LYJ E;  4H9P C;  4PAG A;  3JAD A;  1WLX A;  4JI6 T;  5EK3 A;  3N9N A;  4KHZ F;  5HWX A;  4QX7 B;  4QX8 B;  5LMU T;  3AEF A;  3EUH A;  2VAS A;  4EED A;  3ETU A;  5DJQ C;  1WYB A;  4EGW A;  4ZHQ E;  3CVR A;  1KNR A;  2RPA A;  3Q5W A;  2YK0 A;  2UXN B;  2Z6E A;  3QC9 A;  4U2Y A;  2XHE B;  1LRZ A;  3TKL B;  4XZC A;  2QYW A;  3VKG A;  2DLR A;  2J1D G;  2KT9 A;  3PUW F;  5LHH B;  4QKN A;  2D0U A;  4JEH B;  4DBR A;  4X1I E;  5FKY A;  4BAY B;  1CUN A;  2PJQ A;  1FMV A;  2B76 A;  4IE4 A;  2VK9 A;  2YU2 A;  4UR9 A;  3SFD A;  4GKK T;  3LJC A;  2XQA A;  2LSG A;  3ZN0 B;  2XAH B;  2Y8D A;  2L8K A;  3Q9D A;  4OHF A;  2K9A A;  3C51 A;  4U74 A;  1IBL T;  3ZYK A;  2VKH A;  4TWH A;  2WBL A;  2IHR 1;  3UFE A;  1MMA A;  3GMI A;  2JMK A;  5ABH A;  2UXC T;  5H6R B;  2MTQ A;  4JI4 T;  4DID B;  5HYA A; 
#chains in the Genus database with same CATH homology
 5FY0 A;  4HEA A;  3J9X 1;  3FXD B;  3RH3 A;  3RYI E;  5F8P A;  2MBG A;  2V7M A;  3Q5X A;  3K8P C;  4YJ3 E;  2H7V C;  3HKC E;  3KBT A;  4MLK A;  4CXY A;  1WRD A;  3SS1 A;  1HG2 A;  4UEL A;  2MYS A;  2BZB A;  3KIN B;  1E1H B;  4NUU A;  4L9I A;  3KBU A;  2IC6 A;  2NP9 A;  1NWM X;  2VKD A;  2IAK A;  4BJN A;  2NW7 A;  3RRC A;  3QUJ A;  4F6R C;  3MA9 A;  5FXW A;  1WYC A;  4EB6 E;  2LE8 A;  4JLE A;  2XAG B;  5L3F B;  2BVL A;  4PJL A;  3PE0 A;  4GK5 E;  2NW9 A;  3D0T A;  1VOM A;  2VL8 A;  3C4X A;  3HI2 A;  2D5U A;  3H3A A;  4X1K E;  3KVB A;  4MFR A;  3HKE E;  3ZC1 A;  3S4U A;  2NWB A;  2CWO A;  3PUA A;  4ZI7 E;  1IJ6 A;  5LBQ B;  2VKO A;  3U3I A;  3ZYL A;  3ZJ2 A;  5L3C B;  2G0U A;  3RC8 A;  2W00 A;  5JDH A;  3O4X E;  4PFO A;  3A5X A;  2Q9Q B;  5GON E;  5TAO A;  3CPZ A;  1D1A A;  2LSK A;  4E7S A;  4H63 V;  2D2S A;  2Q9Q A;  1Y64 B;  3FHN A;  1IAP A;  3O1I A;  4UVB B;  1YD8 G;  2P9B A;  4HKA A;  1WR6 A;  4IST A;  5JDQ A;  4AI6 A;  2Q9Q C;  3B13 A;  3CQC B;  4M1P A;  4IHJ E;  5LXT E;  3RX6 A;  1X79 A;  3GA8 A;  3C4Z A;  3N5L A;  3AA0 B;  3MK7 C;  5LG4 A;  4P0A A;  4A56 A;  2LOP A;  1HCI A;  4E7Z A;  4H9Q C;  3FXE B;  2V1D B;  4IE6 A;  3PU3 A;  3ZCJ A;  4XAX B;  2LM9 A;  3BQL A;  4UVA B;  4KBM B;  2QGS A;  2WSS V;  2CM0 A;  4OK0 A;  3C98 B;  3NRX A;  3QK6 A;  3KV9 A;  4I55 E;  2ZM0 A;  4DMV A;  1H7C A;  5CA0 E;  3IBP A;  2EHO B;  3AB3 B;  4IE7 A;  2GK9 A;  5HXC A;  3HA4 A;  1O3X A;  2EHO A;  4ADZ A;  4WBO A;  3BQK A;  3CML A;  3N2O A;  4QXH B;  5EK4 A;  3CX8 B;  3FBZ A;  5KMG P;  3C4W A;  1ZKE A;  2EHO C;  4HN9 A;  2ACX A;  2KZ7 B;  1ZV4 X;  3IEE A;  3RYF E;  2H7O A;  4TV8 E;  3O1J A;  2ES0 A;  5FYM A;  3UUX B;  2CCQ A;  1OWA A;  2CXF A;  3KV5 A;  4H63 H;  4ZI2 C;  1MNE A;  5JDM A;  3H37 A;  2HPJ A;  3M65 A;  1D1C A;  1D0X A;  3PDY A;  2BDE A;  4UF0 B;  2WAU A;  4YHJ A;  5DQW A;  1HTJ F;  2LSJ A;  3I0O A;  4L5G A;  4JUY A;  2X51 A;  4UF0 A;  3N9L A;  1EZ3 A;  3NRY A;  1YKE B;  4FJO A;  2RA1 A;  4PK5 A;  4CXX A;  2JRK A;  5ADX L;  5L2L A;  3N9P A;  4OFZ A;  3NZQ A;  3ZMS B;  2NW8 A;  5LJM A;  1S35 A;  5L3D B;  4C91 A;  5EZY E;  2WM9 A;  3ONX A;  4ERR A;  2YEV C;  2X0L B;  4OYJ A;  4Z8X A;  4ILU A;  2WWU A;  4CQI A;  5LA6 E;  5JRC B;  3P8C D;  4OYK A;  3ZC0 A;  3KVA A;  2RP4 A;  2V7K A;  3AA1 B;  1SHZ C;  2NTX A;  2LJL A;  4X20 E;  5FP3 A;  2PG8 A;  4KMC A;  5JRC A;  3JC6 C;  3UTK A;  2X9W A;  4GIW A;  2NOX A;  3O1H A;  2BVM A;  2N2N A;  4CI2 B;  2XAJ B;  3UUM A;  2V7I A;  2JJ9 A;  5DAB A;  4CXW A;  3AAE B;  5FY1 A;  3KV4 A;  3OBV E;  3CQX C;  3UT5 E;  2W0G A;  4K0U A;  3F31 A;  2XAS B;  2PFV A;  4O4H E;  1NAF A;  3MJX A;  4AQG A;  4J2C A;  3OJA A;  1MMN A;  2V7L A;  5L3G B;  2KND A;  3N2G E;  1V9D A;  4UVC B;  2CWY A;  1BR4 A;  2DWK A;  3I1A A;  3ZYM A;  1QSD A;  3DJB A;  2DI4 A;  4UEM A;  2N1G A;  4ISS A;  4EYY R;  3RYC E;  3E22 E;  5DQV A;  1US7 B;  4L0R A;  2YU1 A;  3L3P A;  2CMR A;  3PTR B;  4O4J E;  4HE8 A;  2VWA A;  3UUL A;  4QXC B;  1FIO A;  3CX7 B;  1UX4 A;  4WW0 A;  2E9X D;  2KWI B;  2W62 A;  2YIN A;  4PJJ A;  2KMF A;  2K24 A;  1OXZ A;  1HF8 A;  4EZ4 A;  3ZEF B;  3ZMT B;  3VHL A;  3V5S A;  2A2F X;  2IC9 A;  3AAA B;  4ZS3 A;  4UIG A;  3T8O A;  4DND A;  3VKH A;  5CA1 E;  3AA6 B;  3ZCI A;  2DCF A;  3MZK B;  1ZEE A;  3PU8 A;  2XAQ B;  2UXX B;  4PJN A;  5LOV E;  3BK9 A;  3PUG A;  5LNK A;  3HL6 A;  4PJM A;  2Q9Q D;  3AVR A;  2V26 A;  3FBL A;  4TV9 E;  3HR0 A;  3LK3 B;  1UX5 A;  4FI5 A;  1HG5 A;  4UV8 B;  3SWH A;  1D1B A;  5L3E B;  1QUU A;  3E0Z A;  2LSI A;  5CB4 E;  3CKD A;  5HYA A;  1YW0 A;  2C5K T;  2KIN B;  4GOU A;  4QHO A;  3OYX A;  4IIJ E;  4IE0 A;  4V1A v;  4ZI3 C;  3U78 A;  2PBI A;  4O8S A;  5FNV E;  5L3B B;  4AKR B;  5JDL A;  1MND A;  3SRZ A;  3N9O A;  4I4T E;  1MMG A;  4GYS A;  4EZH A;  4TZ4 C;  3ZJ1 A;  4XBF B;  3AVS A;  1Z0P A;  3K3N A;  5HXH A;  3LFM A;  3WAK A;  1G8X A;  1IZN B;  1HS7 A;  3ZMV B;  2X68 A;  4O2B E;  3CWZ B;  2EHO D;  4C90 A;  4P09 A;  1MIW A;  5HAX A;  4TUY E;  3DTO A;  3PUQ A;  4ZI2 D;  4AXP A;  2LEH A;  2QA7 A;  5JRE A;  1B7T A;  5LBM A;  1IJ5 A;  2HPL A;  5JR9 B;  2N9D A;  3CX6 B;  4QXB B;  2Y6X A;  2X66 A;  5JDF A;  1T98 A;  2W63 A;  2JQQ A;  5HXE A;  4DMW A;  3NBX X;  3ETV A;  5JR9 A;  2WMO A;  3WAJ A;  5JVD E;  2VKJ A;  2CXD A;  5M4Y A;  3MKD A;  5AFU L;  1BR1 A;  3LBX B;  2L3L A;  5JR9 C;  4B6X A;  1UCU A;  3ZMZ B;  2HH7 A;  3PUS A;  2CE7 A;  5FY7 A;  5E0O A;  3LBX A;  2CLY B;  2JMH A;  3C64 A;  3KV6 A;  4GYR A;  3GWH A;  4JEU B;  4AKG A;  2KLQ A;  2LOS A;  3VU7 H;  2DWG A;  3HKB E;  1FEW A;  3RRW A;  4CI1 B;  3ZPO A;  1G73 A;  1LKX A;  2E8I A;  3F2E A;  4AKL A;  2CLY C;  4ZOL E;  5LGU B;  3N2K E;  3IF8 B;  1HFA A;  5LP6 E;  5LHG B;  3V5U A;  1MMD A;  4IE5 A;  3NZP A;  4PFP A;  3ANW B;  4WBN E;  3JC6 D;  3MXZ A;  2CA5 A;  3GN5 B;  1KNZ A;  2X9Y A;  4O2A E;  4X1Y E;  5JQG E;  3ANW A;  2K48 A;  2C5J A;  4H9R C;  3RYH E;  2C0S A;  2V7J A;  3LK2 B;  4GK0 E;  4YLH A;  2Y48 B;  2I59 A;  1SA0 E;  3GN5 A;  3AA7 B;  5KX5 E;  5JDN A;  4G2A A;  3R6N A;  1AJ3 A;  1BR2 A;  3IHR A;  2LHR A;  4G63 A;  5FMN A;  5FXX A;  1LVK A;  3ZN1 B;  2CEA A;  2H3R A;  5F3J A;  3AAI A;  4AKI A;  4EYU A;  5JDG A;  2X67 A;  2KXP B;  3UUN A;  4EIW A;  4P0B A;  2JPF A;  5LYJ E;  4DVD A;  2XUE A;  4QWN B;  4O4I E;  4H9P C;  4PAG A;  5LCY A;  4AQF A;  4DO0 A;  3LG7 A;  1WLX A;  2C5I T;  4HFV A;  3EDU A;  2E9X B;  5JH7 E;  5EK3 A;  4AQF C;  4YJ2 E;  2ODU A;  2X9H A;  3N9N A;  5BMV E;  3CQG B;  5LGT B;  3RC3 A;  2E9X A;  5HWX A;  4QX7 B;  4CI3 B;  1YKH B;  2DHR A;  4QX8 B;  4MHC A;  3I0Q A;  3EUH A;  3ESL A;  3K3Q C;  4KUM B;  2WMN A;  4YFS A;  3R84 B;  4EOZ B;  2ZM2 A;  4AKH A;  2E9X C;  5J2T E;  2A3D A;  2VAS A;  4I50 E;  3ETU A;  5DJQ C;  3ZLI A;  3B57 A;  1S94 A;  1WYB A;  5HXS A;  2ZMA A;  5LJN A;  4ZHQ E;  3OKQ A;  3RPU A;  3CVR A;  4BJM A;  1U4Q A;  3LK4 2;  4HTE A;  4TX5 A;  3O9X A;  3EVY A;  3Q5W A;  2YK0 A;  3J7Y q;  2UXN B;  2Z6E A;  3QC9 A;  5H6Q B;  4PNI A;  4BA9 A;  3Q2M A;  4ZI3 D;  2XHE B;  3OYZ A;  1BR0 A;  5HXR A;  3WI3 A;  1ZHC A;  3C50 A;  1LRZ A;  3PUR A;  3FB2 A;  3DP7 A;  4PK4 A;  4MAL A;  4TN7 B;  5A1L A;  5J2U E;  3MAC A;  4IGU A;  2B1E A;  3SOL A;  2D0T A;  3TKL B;  4XZC A;  3BQI A;  3EDV A;  3VKG A;  4UV9 B;  2DLR A;  2ODV A;  2VB6 A;  2ZLY A;  2J1D G;  2X9X A;  2KT9 A;  2L9Q A;  4EXT A;  5KDM C;  5LHH B;  2LT3 A;  4QKN A;  5FXV A;  3I9Y A;  2KWH A;  2A72 A;  2OA5 A;  3E08 A;  3L09 A;  4U72 A;  4PK6 A;  2D0U A;  4WNK A;  1D0Y A;  3KDS E;  2SPC A;  2W61 A;  4JEH B;  3ZMU B;  4X1I E;  4DBR A;  4BAY B;  4N78 D;  4KP3 C;  5FXZ A;  1CUN A;  3N9Q A;  3KFW X;  2PJQ A;  1FMV A;  4IE4 A;  2IW5 B;  4EAH A;  2ZM8 A;  2LHN A;  3N9M A;  4ZS2 A;  2VK9 A;  4ASK A;  2YU2 A;  5IYZ E;  1D0Z A;  5EK2 A;  2NTY A;  4PW8 A;  5ETW A;  4DBQ A;  1KK7 A;  3LJC A;  4UXN B;  2CXL A;  5J1G A;  2LSG A;  3ZN0 B;  2DNX A;  2XAH B;  2Y8D A;  2L8K A;  3F57 A;  3Q9D A;  5LHI B;  4CZZ B;  1VRB A;  4OHF A;  2M67 A;  3HKD E;  2XQY A;  3P7I A;  2K9A A;  3C51 A;  2LSY A;  5LGN B;  4ANJ A;  4U74 A;  2XTL A;  1FMW A;  3ZYK A;  2XAF B;  2VKH A;  2MOZ A;  4H9O C;  4H9S E;  2WBL A;  4H9N C;  2K5B B;  4HGA A;  4O4L E;  3UFE A;  1MMA A;  3W15 B;  3GMI A;  2JMK A;  4MBQ A;  1HX8 A;  5C8Y E;  1MIV A;  3RKO A;  1U5P A;  1MIY A;  4IDZ A;  3I9W A;  5HWY A;  5H6R B;  1LVF A;  2MTQ A;  5IHY A;  4NUV A;  3K3O A;  4I43 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...