2N9DA

Structure analysis of the tom1 gat domain reveals distinct ligand-specific conformational states
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of Myb protein 1
publication title Structure of the GAT domain of the endosomal adapter protein Tom1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 38
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n9dA00
1YD8G 2N2NA 1X79A 1NAFA 1O3XA 1NWMX 1OXZA 1WRDA 1WR6A 2N9DA
chains in the Genus database with same CATH superfamily
3CK6A 1S94A 3ZMZB 5JVDE 5FNVE 4UV8B 2MPKA 2UXCT 5HYAA 3CMLA 1ZP0A 4ERRA 4OFZA 3PURA 5L3BB 2WU5A 2XQYA 3RF1A 3SS1A 4HFCA 4DBQA 3X1DA 4AKLA 1T7SA 1VRBA 4PFOA 1HG5A 3H37A 5DQVA 3VRAA 2LEHA 3UUXB 4YHHT 4HTEA 3MACA 3I9YA 2MOZA 3DJBA 2CPTA 2VL8A 1BR4A 4Z8XA 4IDNA 2ZM0A 1FMWA 2SPCA 2JMHA 2F4VT 3B13A 4X1YE 3PU8A 3KDSE 2X9WA 3B5MA 4HFVA 4N78D 2QRXA 4DV0T 2E5VA 4KHPT 5L3FB 4EEDA 2VK9A 4TV9E 3P4QA 4C90A 2LHNA 3DTOA 4KX6A 2VL0A 4YSXA 4HWDA 5L47A 2Q9QA 5AQGB 3JADA 4QXBB 3AE6A 3NZQA 4IGUA 2M67A 4KI0F 1D1AA 4FI5A 5FMNA 1LVKA 2P9BA 4GYSA 3LJCA 4KMCA 2LRKA 3FXEB 4JYAT 1US7B 2B76A 2V8SV 4Z90A 3EDVA 2D2SA 2X0LB 2LE8A 2L8KA 2V6YA 3FZKB 3PTRB 2W63A 4U7IA 1WR0A 3EVYA 2ZLYA 3WAKA 3KBTA 3ZLIA 3UU4A 5LOVE 3ZN0B 4JI7T 2V7JA 2LSKA 5JDHA 3ZKRA 4JI3T 3QB5K 2LKGA 2DLRA 1HX8A 4AQFC 3RQWA 3J7Yq 2ZM8A 3N5LA 1GQEA 1SE7A 4YJ3E 1ZV4X 4DV2T 3ONLC 3LK3B 1IZNB 2WQYA 3CX6B 4X5TA 3NZPA 4QH5A 1Z8UA 4ZHQE 1UUSA 3NRXA 3UUBA 3UT5E 1NWMX 5HCMA 2XPKA 5J1GA 4OYKA 3AE2A 5JDLA 2V7IA 3PUWF 3K3QC 5LG3A 2BG9E 2BBHA 4HKAA 3F57A 5CFBA 1D0ZA 3ZEFB 4DV5T 2DI4A 3UULA 5HAXA 3I0OA 2Q9QB 3UU6A 4KUMB 1JNRA 4KP3C 2E9XD 5KMGP 5L3EB 2CXFA 1OEDE 2OA5A 2W0GA 3MXZA 2CM0A 3UU8A 2W66A 5JDGA 1LKXA 1YW0A 3VHLA 2HPJA 4GKJT 3RI5A 5LHIB 4IDPA 5ABFA 3ZMTB 5ABHA 3MZKB 5IYZE 4DNDA 3CVRA 5ETWA 1XDOA 2FJDA 5LCYA 1N33T 5J2UE 2K9AA 2BG9C 2XJ7A 2EHOB 3PDYA 4EGWA 3AAAB 4XBFB 2V1DB 3RKGA 5A1LA 2V6YB 2NW9A 4MBQA 4LF9T 4UF0A 3S4UA 2WMOA 1IJ5A 3AEBA 2PTFA 3AE9A 5J2TE 3UU3A 4IE5A 2N1GA 4IL9A 2MTQA 3OYXA 4F6RC 3MA9A 4PJMA 2E8IA 4EYYR 1FIOA 1Z0PA 3AAIA 3ZYKA 4QXCB 5JDFA 2CXDA 3ZT7A 3N9PA 4YT0A 3NBXX 4TNVA 3BQLA 4TWHA 3RYCE 4HFBA 3PUXF 5CJ5A 1XNRT 3L09A 2VQFT 2CLYC 3I1AA 3PU3A 3QOFA 3MKDA 3C98B 4LMLA 5HEJA 3A7MA 3ZYMA 4J2CA 3ONJA 5CGMA 3RPUA 4X66T 2VVSA 2X0HA 1O3XA 4YTMA 4QXHB 5BMVE 5LYJE 3AEEA 4NXMT 5FXWA 4AISA 1E7PA 1KK7A 3QUJA 1W9RA 4TUYE 4DR4T 5LA6E 2V5DA 3O9XA 4DR7T 3RIAA 4HEAA 4O4JE 4NPPA 4ZI3D 2X51A 2VVNA 3T1HT 3RRCA 4CI2B 2X66A 4CN6A 1N34T 2QA7A 2LOPA 3TLUA 2PG8A 4UEMA 2CBJA 1HNZT 3HL6A 2QGSA 3ETVA 4EXTA 3T1YT 4LMJA 3QK6A 1YKHB 2W4XA 3AVSA 2XQ6A 2W61A 2YOEA 4GYRA 4XZCA 3WI3A 3PV0F 3D0TA 3SWHA 2XQ4A 4U74A 2BDEA 4YXDA 5FKYA 3OVUA 4EV6A 4I43B 4UF0B 4NUUA 2PFVA 1HFAA 1B7TA 2J62A 3AECA 3ZSTA 2X0YA 2BVMA 1HG2A 3K3OA 4V1Av 3JC6D 2XZEA 4TV8E 4CI1B 2IC6A 3GN5A 5J0ZA 3N2KE 1IAPA 4ANJA 4U72A 4YJ2E 2UXXB 4GK0E 4GK5E 5IWAT 3I9WA 5JR9C 2X68A 1E2AA 2LOSA 3L3PA 2WBLA 3AEAA 5LHHB 2PJQA 3N9QA 2D9DA 3RH3A 5AQHB 1I94T 4ZOLE 2PBIA 4HGAA 3C4XA 4YSYA 2XQ7A 2YN6A 2HPLA 4O2AE 4U7YA 4E7SA 3ZC1A 2CE7A 5AQVB 3VKHA 1XDPA 4DUYT 4CXXA 5AQOB 4JI6T 4B3ST 4DMWA 2IIUA 2XSBA 4KHZF 4PW8A 1WYCA 4K0KT 1W09A 3N9MA 4EYUA 4L5GA 2DNXA 3HKEE 3RYHE 2BS2A 3AXJA 1NENA 3HA4A 4DV3T 2MBGA 2WDVA 3CQXC 1UCUA 3CX8B 4IDZA 2NTXA 2JQ9A 1HR0T 2Q9QD 2BS4A 2E2AA 3E0ZA 2VB6A 1VCSA 2VWAA 2V7MA 4DVDA 1WCRA 1BR1A 4K0UA 5FVKA 2FUPA 3P4WA 2V7KA 5L3GB 4XAXB 4BA9A 4HFEA 4E7ZA 2NW8A 2EHOD 2XQ3A 2L9QA 4CXYA 1E1HB 3TLSA 4O4HE 3EAMA 1W0AA 5HXHA 3G06A 5LGNB 2BG9A 4L9IA 5AQPB 5ABEA 5JH7E 2NW7A 4ZZCA 4DO0A 1MMDA 2QVAA 1I6ZA 3C4ZA 4LFAT 4LFCT 3A5XA 2E9XC 3LFMA 3K3NA 1OEDA 3PUZF 1UURA 4PFPA 4AKGA 4ASKA 4DR3T 2H89A 3AEGA 3BK9A 4H9SE 3UQ4A 1YXRA 4H9OC 1XNQT 3I0QA 3KVAA 4EIWA 4LMKA 4UELA 4KBMB 1MMAA 1MIYA 1D0YA 2CWYA 2XUEA 3CQGB 2YEVC 4AQGA 5LBMA 1IBKT 3AXJB 4TZ4C 3CIRA 1LRZA 3LDQB 4PNIA 4FJOA 3L8RA 2V5CA 4X20E 2KNDA 5JDMA 5LMUT 2E5LT 4OK0A 4CZZB 5KXJA 2A2FX 2UXBT 4YY3T 1XWMA 3KV9A 2BZBA 2I6HA 5LGUB 3M3ZB 2IDOB 2VKHA 4AI6A 3ANWB 1KFYA 3P50A 4O8SA 3HKCE 1HCIA 2XAHB 5AQQB 4A56A 2Y48B 4JUYA 4IE4A 1IBMT 3JCFA 1XMQT 3RKOA 3ZT6A 3P4RA 5L3DB 3KV4A 3ZCJA 4YTPA 2CMRA 2FJAA 5F3JA 3QNUA 2YU1A 4WBOA 4ZI3C 2LJLA 4YHJA 1H7CA 4C91A 3SOLA 4ZI2D 4X64T 3AEDA 3P7IA 5CB4E 5H6QB 1SUMB 3EI0A 5KDMC 2BVLA 2KZ7B 4F8HA 4U2ZA 2XSAA 4U2YA 1OEDB 5JR9A 4IDOA 2H7OA 1UK5A 1FJGT 3TLWA 4H9RC 3PUVF 3R84B 1VOMA 3E22E 5EZYE 4H9QC 5FXZA 3ZT5A 3AAEB 3RLFF 5HEGA 2FBWA 3AE4A 2KT9A 3EDUA 4JI5T 2YDRA 2Z6EA 3EUHA 4AQYT 4P09A 5LNKA 5FY1A 2K5BB 3JC6C 4WW0A 2LSIA 1FEWA 2VKOA 4DMVA 3AB3B 4HE8A 5HXRA 3C4WA 4QH1A 4DR2T 2VKDA 2OLTA 1WFDA 4LF7T 4LF8T 3WAJA 2UUAT 3KV5A 4ZI7E 4QX8B 3FZFB 2D0UA 4HN9A 5FL1A 3O1HA 3C50A 5JQGE 2IW5B 1WLXA 5AQKB 4EZ4A 4JLEA 4DUZT 1OXZA 1X79A 4I50E 4AKHA 3RGLA 4TWDA 1D0XA 4HWIB 3H3MA 4M1PA 5EK2A 4UVBB 2IC9A 5LJNA 3FZMB 3OKQA 2KWIB 2NR4A 3IEEA 5C3JA 1LVFA 3KINB 2VURA 4NXNT 1ZHCA 3HKDE 3KV6A 4ILCA 1M7KA 4QHOA 3P8CD 3CWZB 2OV9A 4O4LE 2QYWA 2XAJB 1KNRA 3OTOT 2NOXA 2Q9QC 2WCAA 2D0TA 2RPAA 3N2GE 3O1JA 1UX5A 2MAWA 5FL0A 4X1IE 2BBJA 5LBQB 2XTLA 4TN7B 5L3CB 2VQET 2XASB 5JR9B 1MIWA 2LM9A 2E9XA 4WZXA 3Q5DA 5IUXA 2HH7A 4EZHA 3U3IA 2WS3A 3ZPOA 5HEHA 5HWXA 3F31A 4DV7T 2EHOC 4CN4A 3RC8A 3UTKA 3BQKA 2CA5A 2JQKA 5AQRB 4LFBT 5JRCA 2ODVA 5HXCA 5ABFB 4A5XA 3O4XE 3AE8A 3ABVA 3F2EA 5AQUB 4OHFA 2N2NA 5FYMA 2UU9T 1S35A 1R8IA 2CCQA 2FJEA 2UUBT 3PUAA 1HNWT 5ADXL 5E0OA 2L3LA 1JNZA 3N9NA 3J9X1 1HS7A 1YQ3A 4U3CA 2M6BA 2JQHA 2X9YA 2XQAA 1OWAA 3PJAJ 2WU2A 2LKHA 4H9NC 4CQIA 4QKNA 3ZN1B 3CX7B 4AQFA 3AVRA 4UV9B 3CKDA 2YU2A 2W00A 2YINA 1HTJF 3RC3A 4I55E 3FZHB 4IIJE 3LK2B 1YKEB 2DHRA 2LLYA 2WWUA 3ZMSB 3OJAA 4ILUA 3ZMUB 2VKJA 5LB7B 2HN2A 3IA3A 5AQIB 2G0UA 2YDSA 5HXEA 5LXTE 4LF6T 1BR2A 4JI4T 2HN1A 2VASA 3P4PA 1X9BA 4IT4A 4COFA 3CQCB 4IHJE 4B3MT 2AXDS 3T8OA 4DV1T 1W0BA 5F8PA 2R6GF 4ZXLA 2LSYA 4DV6T 3MJXA 2NTYA 2BKOA 2BKNA 2YDQA 2ES0A 2X67A 3UFEA 1YQ4A 4GIWA 1KEYA 3VRBA 5AQJB 5C8YE 4ZI2C 5FY0A 5LG4A 4JI0T 5AQNB 4JBWF 2Y6XA 4WBNE 2RA1A 5CA1E 4I0UA 4IE0A 2ZMAA 4X1KE 3ZCIA 2WB5A 5CA0E 1WR6A 1SA0E 3GA8A 2LRLA 2BS3A 3FBLA 2KSRA 4YFSA 4AXPA 1FMVA 3PUQA 3H3AA 4ZS3A 5HEUA 3GN5B 2A9UA 3AE5A 2W67A 3B57A 3PE0A 3K1SA 5IHYA 1MNEA 3ZSSA 2YKSA 4HFHA 3RIFA 3OPCA 5LP6E 2H7VC 1Y01A 2BKPA 3QB5A 5FXVA 3Q5XA 3AE7A 1EZ3A 4EEBA 2Y8DA 3TLTA 5FXXA 3N2OA 4PJLA 1D1BA 1MMNA 2JRKA 3ZYLA 2KLQA 5EK4A 4G2AA 5AQSB 3JAFA 4LF4T 4HWCA 5FP3A 2I0MA 1YD8G 2A3DA 3AA6B 2KXPB 5TAOA 4OX9T 2UXNB 5LHGB 2JQQA 4P0BA 3ETUA 2KMFA 5M4YA 2V26A 2XAQB 3FZLB 5HCJA 3E08A 3FXDB 3KFWX 3HR0A 1J1JA 1J5ET 3Q5EA 3ESLA 3NKZA 2WM9A 2WY2A 2H88A 3IBPA 1DU2A 1IJ6A 3W15B 3OYZA 2JJ9A 2LSJA 4JI1T 3RIUC 3LSVA 5JTGA 2EHOA 2WSSV 5JDNA 3HI2A 3EHZA 2CHNA 4EAHA 2W2UA 4CI3B 4JEUB 2IUBA 3Q5WA 2N9DA 5DQWA 3R6NA 2XM2A 2RP4A 2UUCT 1CHUA 3PUGA 4IL4A 2WWVA 3PUSA 4BJMA 2WDRA 2CEAA 1IBLT 2LSGA 2BG9B 5DJQC 2DCFA 2CRBA 2XQ8A 5HXSA 3ZC0A 3RHWA 4BAYB 4TWFA 2K3WA 1ZOYA 4UVAB 2LM2A 2JIWA 3AA7B 3AA1B 2C5JA 4ILBA 4AKRB 4GKKT 1HX1B 3UUNA 1HF8A 4L0RA 4ISSA 1J5WA 1UX4A 2CLYB 1NEKA 4HWHA 4PJNA 4QX7B 5BR8T 5LGTB 2XY8B 2JMKA 4ADZA 3Q2MA 3PUYF 3FB2A 4YTNA 2HHHT 3V5SA 2C5KT 1AJ3A 4HFIA 3SRZA 2H3RA 2XHEB 4QWNB 3ZMVB 4PJJA 1V9DA 2X9XA 2CWOA 3TLVA 2X9HA 5LMNT 2IAKA 1D1CA 1L0VA 4DBRA 4PK5A 2XQ5A 2XQ9A 1ZEEA 1SHZC 4WYVA 4YSZA 2WDQA 3ONXA 2LHRA 1NAFA 1QUUA 3OBVE 3RYIE 2D5UA 3DP7A 4AIUA 2ZM2A 2MYSA 5FVLA 3FHNA 4AKIA 5ABGA 3GMIA 3V5UA 4DIDB 2AE9A 1KNPA 3CPZA 1KNZA 3ZJ2A 4ZS2A 4BJNA 4O2BE 4IREA 3QC9A 2A72A 4LF5T 2WMNA 1M62A 2KINB 2WAUA 4U31A 5AQLB 2ACZA 1OEDC 4A98A 3EABA 5EK3A 5F5WA 3NWIA 4MFRA 4X65T 5KX5E 4H63V 3AE3A 5AQTB 4JI8T 2XAFB 5JDQA 2IMLA 1HNXT 4Z91A 4JI2T 3NVOA 2DWGA 3VU7H 5AFUL 4NIQA 3KVBA 2J4GA 4MLKA 3FBZA 1WRDA 3UUMA 3VKGA 2JPFA 4PK4A 3IHRA 2ZM6T 4IE6A 4B3RT 2GK9A 4UXNB 2DL1A 4H9PC 3N9LA 5L4EA 4YLHA 1BR0A 4UR9A 4P0AA 3LBXA 1N36T 5L2LA 2CBIA 4X62T 3IF8B 2WP9A 5GONE 4MALA 3LK42 4P1NA 2B1EA 4HFDA 1U4QA 5AQFB 4A97A 2W62A 4NUVA 4B6XA 3GWHA 4G63A 4IE7A 4H63H 3UU5A 4JEHB 2YK0A 5JREA 3SFDA 3Q9DA 3BQIA 2V7LA 5FY7A 4ISTA 3C64A 3UFGA 3RRWA 3MK7C 3L39A 4UVCB 2IHR1 4DR5T 1KF6A 4Q25A 4MHCA 3RIUA 2NWBA 4U33A 3VR9A 5H6RB 3VR8A 1UGOA 2C5IT 4DR1T 1T72A 5L4HA 4CXWA 3AA0B 3LG7A 5DABA 4DV4T 2ODUA 3JAEA 4EOZB 3M65A 4O4IE 4WNKA 2LT3A 3AEFA 5AQMB 1T98A 2I59A 4PAGA 2J47A 1U5PA 4DR6T 2UXDT 4GOUA 3HKBE 1T8BA 4JV5T 4ZEYA 3PJAA 5LJMA 2C0SA 3A8YC 2K24A 1N32T 2XAGB 1XZYA 1MMGA 3C51A 3RX6A 4OYJA 4I4TE 3N9OA 3TKLB 2KWHA 1G8XA 5HWYA 3P4SA 1QSDA 2J1DG 2WZHA 3AE1A 3K8PC 3O1IA 2DWKA 2E9XB 5HEOA 3RQUA 1MIVA 1G73A 2NP9A 4HWFA 1ZKEA 2M6IA 4PK6A 3SFEA 2FJBA 2CHOA 5C2TA 3LBXB 4UIGA 1VCTA 4IDQA 2CXLA 4B3TT 3RYFE 3NRYA 1MNDA 2WZIA 4ILAA 3U78A 4CN1A 2V6XA 3UQ7A 1Y64B 1CUNA 4TX5A 5JRCB 4TNWA 4EB6E 3KBUA 2XM1A 4ZZBA 1XMOT 4QH4A 2ACXA 1WYBA 2K48A 3ANWA 1QLBA 3ZJ1A
chains in the Genus database with same CATH topology
3D0TA 3SWHA 1S94A 3ZMZB 4EAHA 4CI3B 4U74A 5JVDE 5FNVE 4UV8B 3WAJA 3KV5A 4JEUB 2BDEA 4ZI7E 5HYAA 4QX8B 2D0UA 3Q5WA 4HN9A 3CMLA 2N9DA 5DQWA 4I43B 4UF0B 3O1HA 4NUUA 3R6NA 2PFVA 1HFAA 2RP4A 4ERRA 1B7TA 3C50A 4OFZA 5JQGE 2IW5B 3PURA 2BVMA 1HG2A 1WLXA 5L3BB 3K3OA 3PUGA 2XQYA 4EZ4A 3PUSA 4JLEA 3SS1A 4V1Av 4BJMA 4DBQA 2CEAA 2LSGA 1OXZA 3JC6D 4AKLA 4TV8E 4CI1B 1VRBA 2IC6A 4PFOA 5DJQC 1HG5A 1X79A 2DCFA 3H37A 3GN5A 4I50E 4AKHA 3N2KE 1IAPA 5HXSA 1D0XA 4M1PA 4ANJA 5EK2A 5DQVA 3ZC0A 4U72A 4UVBB 2IC9A 4YJ2E 5LJNA 2LEHA 2UXXB 3OKQA 2KWIB 3IEEA 4GK0E 4GK5E 4HTEA 3UUXB 1LVFA 3MACA 3KINB 3I9WA 3I9YA 2MOZA 4BAYB 2X68A 5JR9C 2LOSA 3DJBA 2VL8A 2WBLA 3L3PA 5LHHB 2PJQA 1ZHCA 3HKDE 4UVAB 3N9QA 3RH3A 1BR4A 3KV6A 4Z8XA 2ZM0A 3AA7B 1FMWA 2PBIA 3C4XA 4HGAA 4ZOLE 2SPCA 3AA1B 2JMHA 2C5JA 3B13A 4QHOA 4X1YE 3P8CD 3CWZB 3KDSE 3PU8A 2HPLA 2X9WA 4O4LE 4AKRB 4HFVA 4O2AE 4N78D 2XAJB 3UUNA 2NOXA 2Q9QC 4E7SA 3ZC1A 2CE7A 1HF8A 5L3FB 4L0RA 4ISSA 2VK9A 4TV9E 1UX4A 2D0TA 3VKHA 2CLYB 4CXXA 4PJNA 4QX7B 2LHNA 3N2GE 4C90A 3O1JA 1UX5A 5LGTB 3DTOA 4X1IE 4DMWA 5LBQB 2JMKA 2XTLA 4ADZA 4TN7B 3Q2MA 4PW8A 1WYCA 5L3CB 2XASB 3FB2A 5JR9B 1MIWA 3V5SA 2LM9A 2C5KT 1AJ3A 2E9XA 2Q9QA 3N9MA 3SRZA 4EYUA 2H3RA 2XHEB 4L5GA 2HH7A 2DNXA 3NZQA 4IGUA 4PJJA 3HKEE 4QWNB 4QXBB 3U3IA 1V9DA 3ZMVB 2X9XA 2M67A 3RYHE 4EZHA 1D1AA 3ZPOA 2CWOA 3HA4A 5HWXA 4FI5A 3F31A 2X9HA 2MBGA 5FMNA 2IAKA 1D1CA 4DBRA 3CQXC 4PK5A 2EHOC 1LVKA 1UCUA 1ZEEA 3CX8B 1SHZC 2P9BA 4GYSA 4IDZA 3LJCA 2NTXA 3RC8A 3UTKA 2Q9QD 4KMCA 3FXEB 3BQKA 3ONXA 2CA5A 2LHRA 1NAFA 1US7B 3E0ZA 2VB6A 5JRCA 2ODVA 1QUUA 2VWAA 3OBVE 2V7MA 3RYIE 3EDVA 2D2SA 5HXCA 4DVDA 2D5UA 3DP7A 2X0LB 3O4XE 2LE8A 2L8KA 2ZM2A 2MYSA 3F2EA 3PTRB 2W63A 3FHNA 1BR1A 4OHFA 2N2NA 5FYMA 1S35A 4K0UA 4AKIA 3GMIA 2CCQA 2V7KA 3V5UA 3EVYA 2ZLYA 5L3GB 3WAKA 3KBTA 4XAXB 3ZLIA 5LOVE 3ZN0B 4BA9A 2V7JA 2LSKA 3PUAA 5JDHA 5ADXL 5E0OA 2L3LA 4E7ZA 2NW8A 3N9NA 2DLRA 3J9X1 2EHOD 1HS7A 3CPZA 1HX8A 1KNZA 3ZJ2A 2L9QA 4ZS2A 4AQFC 4CXYA 1E1HB 4O4HE 3J7Yq 2ZM8A 4BJNA 5HXHA 5LGNB 3N5LA 4O2BE 4YJ3E 4L9IA 2X9YA 1OWAA 1ZV4X 3QC9A 2A72A 5JH7E 2NW7A 3LK3B 1IZNB 2WMNA 4H9NC 2KINB 2WAUA 4CQIA 4QKNA 3CX6B 3ZN1B 3CX7B 4DO0A 4AQFA 1MMDA 3AVRA 3NZPA 4UV9B 3CKDA 2YU2A 3C4ZA 2W00A 4ZHQE 2YINA 1HTJF 3NRXA 3RC3A 4I55E 5EK3A 3A5XA 4IIJE 3LK2B 4MFRA 5KX5E 3UT5E 1NWMX 4H63V 1YKEB 2E9XC 2XAFB 2DHRA 3LFMA 5J1GA 5JDQA 4OYKA 5JDLA 3K3NA 2WWUA 3ZMSB 2V7IA 4PFPA 3OJAA 4ILUA 3ZMUB 4AKGA 4ASKA 2DWGA 2VKJA 3K3QC 3VU7H 5AFUL 3KVBA 4HKAA 4MLKA 3FBZA 3F57A 1WRDA 3BK9A 4H9SE 3UUMA 3VKGA 2JPFA 4H9OC 4PK4A 2G0UA 3I0QA 1D0ZA 3IHRA 3KVAA 3ZEFB 4EIWA 4IE6A 4UELA 2GK9A 2DI4A 4KBMB 3UULA 4UXNB 4H9PC 3N9LA 1MMAA 5HXEA 4YLHA 1BR0A 5LXTE 5HAXA 3I0OA 4P0AA 1BR2A 1MIYA 3LBXA 1D0YA 2CWYA 2VASA 2Q9QB 2XUEA 3CQGB 5L2LA 4KUMB 2YEVC 4AQGA 5LBMA 3CQCB 3IF8B 5GONE 4MALA 4IHJE 3LK42 4KP3C 4TZ4C 2B1EA 2E9XD 5KMGP 3T8OA 1U4QA 1LRZA 5L3EB 4PNIA 2CXFA 4FJOA 2OA5A 2W62A 2W0GA 3MXZA 2CM0A 4NUVA 5F8PA 4B6XA 4X20E 2LSYA 5JDGA 3GWHA 1LKXA 1YW0A 2KNDA 3MJXA 5JDMA 3VHLA 2HPJA 5LHIB 4OK0A 3ZMTB 4G63A 4IE7A 2NTYA 4H63H 4CZZB 4JEHB 2YK0A 3MZKB 5JREA 5IYZE 2A2FX 4DNDA 3CVRA 3Q9DA 5ETWA 5LCYA 2ES0A 2X67A 3UFEA 5J2UE 2K9AA 2V7LA 3BQIA 5FY7A 4ISTA 3KV9A 2EHOB 2BZBA 3PDYA 3AAAB 3C64A 4XBFB 2V1DB 5LGUB 3RRWA 3MK7C 4GIWA 2VKHA 5A1LA 2NW9A 4AI6A 3ANWB 4MBQA 4UVCB 5C8YE 4UF0A 4O8SA 3S4UA 2WMOA 5FY0A 4ZI2C 5LG4A 3HKCE 1IJ5A 5J2TE 4IE5A 2N1GA 2Y6XA 2MTQA 4WBNE 3OYXA 2RA1A 4F6RC 1HCIA 3MA9A 4MHCA 4PJMA 2E8IA 2XAHB 5CA1E 4EYYR 4IE0A 1FIOA 1Z0PA 2ZMAA 4X1KE 3AAIA 3ZCIA 3ZYKA 4A56A 1WR6A 2NWBA 4QXCB 5JDFA 1SA0E 2Y48B 2CXDA 3GA8A 5CA0E 4JUYA 4IE4A 5H6RB 3FBLA 4YFSA 3N9PA 2C5IT 3NBXX 4AXPA 4CXWA 3BQLA 3AA0B 3RYCE 3LG7A 5DABA 1FMVA 3RKOA 2ODUA 3PUQA 3H3AA 4ZS3A 4EOZB 3GN5B 5L3DB 3KV4A 3M65A 3ZCJA 4O4IE 4WNKA 2LT3A 3L09A 2CMRA 2CLYC 3B57A 3PE0A 5IHYA 3I1AA 1T98A 3PU3A 1MNEA 2I59A 3MKDA 3C98B 4PAGA 5F3JA 5LP6E 2YU1A 4WBOA 4ZI3C 2H7VC 1U5PA 2LJLA 4YHJA 1H7CA 4C91A 3ZYMA 3SOLA 4ZI2D 5FXVA 3Q5XA 4GOUA 3HKBE 1EZ3A 4J2CA 2Y8DA 3P7IA 5LJMA 3RPUA 5CB4E 2C0SA 2K24A 5FXXA 5H6QB 5KDMC 2XAGB 1MMGA 3N2OA 3C51A 4PJLA 1O3XA 1D1BA 2BVLA 2KZ7B 4QXHB 3RX6A 1MMNA 4OYJA 4I4TE 3N9OA 5JR9A 2JRKA 5BMVE 5LYJE 2H7OA 3TKLB 3ZYLA 2KWHA 1G8XA 2KLQA 5HWYA 5FXWA 5EK4A 4G2AA 1KK7A 3QUJA 1QSDA 2J1DG 4H9RC 3R84B 1VOMA 3E22E 5FP3A 4TUYE 5EZYE 3ZJ1A 4H9QC 3K8PC 1YD8G 5LA6E 2A3DA 3O1IA 3AA6B 2KXPB 2DWKA 3O9XA 2E9XB 4HEAA 4O4JE 5FXZA 5TAOA 2UXNB 5LHGB 3AAEB 2JQQA 4ZI3D 2X51A 4P0BA 1MIVA 3ETUA 3RRCA 1G73A 2NP9A 2KMFA 5M4YA 1ZKEA 2V26A 4PK6A 2XAQB 4CI2B 2KT9A 3LBXB 3E08A 3EDUA 3FXDB 2X66A 3KFWX 4UIGA 3HR0A 2QA7A 2LOPA 2CXLA 2PG8A 4UEMA 3ESLA 3RYFE 3NRYA 2Z6EA 3EUHA 4P09A 5LNKA 1MNDA 3HL6A 3U78A 2QGSA 5FY1A 3ETVA 4EXTA 2K5BB 2WM9A 3QK6A 3JC6C 4WW0A 3IBPA 2LSIA 1YKHB 1IJ6A 1CUNA 1Y64B 4TX5A 5JRCB 1FEWA 3AVSA 2VKOA 3W15B 3OYZA 4EB6E 2W61A 4DMVA 2JJ9A 3KBUA 2LSJA 3AB3B 2EHOA 4GYRA 4XZCA 4HE8A 2WSSV 5HXRA 3C4WA 2ACXA 3WI3A 1WYBA 2K48A 3ANWA 5JDNA 2VKDA 3HI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YD8 G;  2N2N A;  1X79 A;  1NAF A;  1O3X A;  1NWM X;  1OXZ A;  1WRD A;  1WR6 A;  2N9D A; 
#chains in the Genus database with same CATH topology
 3CK6 A;  1S94 A;  3ZMZ B;  5JVD E;  5FNV E;  4UV8 B;  2MPK A;  2UXC T;  5HYA A;  3CML A;  1ZP0 A;  4ERR A;  4OFZ A;  3PUR A;  5L3B B;  2WU5 A;  2XQY A;  3RF1 A;  3SS1 A;  4HFC A;  4DBQ A;  3X1D A;  4AKL A;  1T7S A;  1VRB A;  4PFO A;  1HG5 A;  3H37 A;  5DQV A;  3VRA A;  2LEH A;  3UUX B;  4YHH T;  4HTE A;  3MAC A;  3I9Y A;  2MOZ A;  3DJB A;  2CPT A;  2VL8 A;  1BR4 A;  4Z8X A;  4IDN A;  2ZM0 A;  1FMW A;  2SPC A;  2JMH A;  2F4V T;  3B13 A;  4X1Y E;  3PU8 A;  3KDS E;  2X9W A;  3B5M A;  4HFV A;  4N78 D;  2QRX A;  4DV0 T;  2E5V A;  4KHP T;  5L3F B;  4EED A;  2VK9 A;  4TV9 E;  3P4Q A;  4C90 A;  2LHN A;  3DTO A;  4KX6 A;  2VL0 A;  4YSX A;  4HWD A;  5L47 A;  2Q9Q A;  5AQG B;  3JAD A;  4QXB B;  3AE6 A;  3NZQ A;  4IGU A;  2M67 A;  4KI0 F;  1D1A A;  4FI5 A;  5FMN A;  1LVK A;  2P9B A;  4GYS A;  3LJC A;  4KMC A;  2LRK A;  3FXE B;  4JYA T;  1US7 B;  2B76 A;  2V8S V;  4Z90 A;  3EDV A;  2D2S A;  2X0L B;  2LE8 A;  2L8K A;  2V6Y A;  3FZK B;  3PTR B;  2W63 A;  4U7I A;  1WR0 A;  3EVY A;  2ZLY A;  3WAK A;  3KBT A;  3ZLI A;  3UU4 A;  5LOV E;  3ZN0 B;  4JI7 T;  2V7J A;  2LSK A;  5JDH A;  3ZKR A;  4JI3 T;  3QB5 K;  2LKG A;  2DLR A;  1HX8 A;  4AQF C;  3RQW A;  3J7Y q;  2ZM8 A;  3N5L A;  1GQE A;  1SE7 A;  4YJ3 E;  1ZV4 X;  4DV2 T;  3ONL C;  3LK3 B;  1IZN B;  2WQY A;  3CX6 B;  4X5T A;  3NZP A;  4QH5 A;  1Z8U A;  4ZHQ E;  1UUS A;  3NRX A;  3UUB A;  3UT5 E;  1NWM X;  5HCM A;  2XPK A;  5J1G A;  4OYK A;  3AE2 A;  5JDL A;  2V7I A;  3PUW F;  3K3Q C;  5LG3 A;  2BG9 E;  2BBH A;  4HKA A;  3F57 A;  5CFB A;  1D0Z A;  3ZEF B;  4DV5 T;  2DI4 A;  3UUL A;  5HAX A;  3I0O A;  2Q9Q B;  3UU6 A;  4KUM B;  1JNR A;  4KP3 C;  2E9X D;  5KMG P;  5L3E B;  2CXF A;  1OED E;  2OA5 A;  2W0G A;  3MXZ A;  2CM0 A;  3UU8 A;  2W66 A;  5JDG A;  1LKX A;  1YW0 A;  3VHL A;  2HPJ A;  4GKJ T;  3RI5 A;  5LHI B;  4IDP A;  5ABF A;  3ZMT B;  5ABH A;  3MZK B;  5IYZ E;  4DND A;  3CVR A;  5ETW A;  1XDO A;  2FJD A;  5LCY A;  1N33 T;  5J2U E;  2K9A A;  2BG9 C;  2XJ7 A;  2EHO B;  3PDY A;  4EGW A;  3AAA B;  4XBF B;  2V1D B;  3RKG A;  5A1L A;  2V6Y B;  2NW9 A;  4MBQ A;  4LF9 T;  4UF0 A;  3S4U A;  2WMO A;  1IJ5 A;  3AEB A;  2PTF A;  3AE9 A;  5J2T E;  3UU3 A;  4IE5 A;  2N1G A;  4IL9 A;  2MTQ A;  3OYX A;  4F6R C;  3MA9 A;  4PJM A;  2E8I A;  4EYY R;  1FIO A;  1Z0P A;  3AAI A;  3ZYK A;  4QXC B;  5JDF A;  2CXD A;  3ZT7 A;  3N9P A;  4YT0 A;  3NBX X;  4TNV A;  3BQL A;  4TWH A;  3RYC E;  4HFB A;  3PUX F;  5CJ5 A;  1XNR T;  3L09 A;  2VQF T;  2CLY C;  3I1A A;  3PU3 A;  3QOF A;  3MKD A;  3C98 B;  4LML A;  5HEJ A;  3A7M A;  3ZYM A;  4J2C A;  3ONJ A;  5CGM A;  3RPU A;  4X66 T;  2VVS A;  2X0H A;  1O3X A;  4YTM A;  4QXH B;  5BMV E;  5LYJ E;  3AEE A;  4NXM T;  5FXW A;  4AIS A;  1E7P A;  1KK7 A;  3QUJ A;  1W9R A;  4TUY E;  4DR4 T;  5LA6 E;  2V5D A;  3O9X A;  4DR7 T;  3RIA A;  4HEA A;  4O4J E;  4NPP A;  4ZI3 D;  2X51 A;  2VVN A;  3T1H T;  3RRC A;  4CI2 B;  2X66 A;  4CN6 A;  1N34 T;  2QA7 A;  2LOP A;  3TLU A;  2PG8 A;  4UEM A;  2CBJ A;  1HNZ T;  3HL6 A;  2QGS A;  3ETV A;  4EXT A;  3T1Y T;  4LMJ A;  3QK6 A;  1YKH B;  2W4X A;  3AVS A;  2XQ6 A;  2W61 A;  2YOE A;  4GYR A;  4XZC A;  3WI3 A;  3PV0 F;  3D0T A;  3SWH A;  2XQ4 A;  4U74 A;  2BDE A;  4YXD A;  5FKY A;  3OVU A;  4EV6 A;  4I43 B;  4UF0 B;  4NUU A;  2PFV A;  1HFA A;  1B7T A;  2J62 A;  3AEC A;  3ZST A;  2X0Y A;  2BVM A;  1HG2 A;  3K3O A;  4V1A v;  3JC6 D;  2XZE A;  4TV8 E;  4CI1 B;  2IC6 A;  3GN5 A;  5J0Z A;  3N2K E;  1IAP A;  4ANJ A;  4U72 A;  4YJ2 E;  2UXX B;  4GK0 E;  4GK5 E;  5IWA T;  3I9W A;  5JR9 C;  2X68 A;  1E2A A;  2LOS A;  3L3P A;  2WBL A;  3AEA A;  5LHH B;  2PJQ A;  3N9Q A;  2D9D A;  3RH3 A;  5AQH B;  1I94 T;  4ZOL E;  2PBI A;  4HGA A;  3C4X A;  4YSY A;  2XQ7 A;  2YN6 A;  2HPL A;  4O2A E;  4U7Y A;  4E7S A;  3ZC1 A;  2CE7 A;  5AQV B;  3VKH A;  1XDP A;  4DUY T;  4CXX A;  5AQO B;  4JI6 T;  4B3S T;  4DMW A;  2IIU A;  2XSB A;  4KHZ F;  4PW8 A;  1WYC A;  4K0K T;  1W09 A;  3N9M A;  4EYU A;  4L5G A;  2DNX A;  3HKE E;  3RYH E;  2BS2 A;  3AXJ A;  1NEN A;  3HA4 A;  4DV3 T;  2MBG A;  2WDV A;  3CQX C;  1UCU A;  3CX8 B;  4IDZ A;  2NTX A;  2JQ9 A;  1HR0 T;  2Q9Q D;  2BS4 A;  2E2A A;  3E0Z A;  2VB6 A;  1VCS A;  2VWA A;  2V7M A;  4DVD A;  1WCR A;  1BR1 A;  4K0U A;  5FVK A;  2FUP A;  3P4W A;  2V7K A;  5L3G B;  4XAX B;  4BA9 A;  4HFE A;  4E7Z A;  2NW8 A;  2EHO D;  2XQ3 A;  2L9Q A;  4CXY A;  1E1H B;  3TLS A;  4O4H E;  3EAM A;  1W0A A;  5HXH A;  3G06 A;  5LGN B;  2BG9 A;  4L9I A;  5AQP B;  5ABE A;  5JH7 E;  2NW7 A;  4ZZC A;  4DO0 A;  1MMD A;  2QVA A;  1I6Z A;  3C4Z A;  4LFA T;  4LFC T;  3A5X A;  2E9X C;  3LFM A;  3K3N A;  1OED A;  3PUZ F;  1UUR A;  4PFP A;  4AKG A;  4ASK A;  4DR3 T;  2H89 A;  3AEG A;  3BK9 A;  4H9S E;  3UQ4 A;  1YXR A;  4H9O C;  1XNQ T;  3I0Q A;  3KVA A;  4EIW A;  4LMK A;  4UEL A;  4KBM B;  1MMA A;  1MIY A;  1D0Y A;  2CWY A;  2XUE A;  3CQG B;  2YEV C;  4AQG A;  5LBM A;  1IBK T;  3AXJ B;  4TZ4 C;  3CIR A;  1LRZ A;  3LDQ B;  4PNI A;  4FJO A;  3L8R A;  2V5C A;  4X20 E;  2KND A;  5JDM A;  5LMU T;  2E5L T;  4OK0 A;  4CZZ B;  5KXJ A;  2A2F X;  2UXB T;  4YY3 T;  1XWM A;  3KV9 A;  2BZB A;  2I6H A;  5LGU B;  3M3Z B;  2IDO B;  2VKH A;  4AI6 A;  3ANW B;  1KFY A;  3P50 A;  4O8S A;  3HKC E;  1HCI A;  2XAH B;  5AQQ B;  4A56 A;  2Y48 B;  4JUY A;  4IE4 A;  1IBM T;  3JCF A;  1XMQ T;  3RKO A;  3ZT6 A;  3P4R A;  5L3D B;  3KV4 A;  3ZCJ A;  4YTP A;  2CMR A;  2FJA A;  5F3J A;  3QNU A;  2YU1 A;  4WBO A;  4ZI3 C;  2LJL A;  4YHJ A;  1H7C A;  4C91 A;  3SOL A;  4ZI2 D;  4X64 T;  3AED A;  3P7I A;  5CB4 E;  5H6Q B;  1SUM B;  3EI0 A;  5KDM C;  2BVL A;  2KZ7 B;  4F8H A;  4U2Z A;  2XSA A;  4U2Y A;  1OED B;  5JR9 A;  4IDO A;  2H7O A;  1UK5 A;  1FJG T;  3TLW A;  4H9R C;  3PUV F;  3R84 B;  1VOM A;  3E22 E;  5EZY E;  4H9Q C;  5FXZ A;  3ZT5 A;  3AAE B;  3RLF F;  5HEG A;  2FBW A;  3AE4 A;  2KT9 A;  3EDU A;  4JI5 T;  2YDR A;  2Z6E A;  3EUH A;  4AQY T;  4P09 A;  5LNK A;  5FY1 A;  2K5B B;  3JC6 C;  4WW0 A;  2LSI A;  1FEW A;  2VKO A;  4DMV A;  3AB3 B;  4HE8 A;  5HXR A;  3C4W A;  4QH1 A;  4DR2 T;  2VKD A;  2OLT A;  1WFD A;  4LF7 T;  4LF8 T;  3WAJ A;  2UUA T;  3KV5 A;  4ZI7 E;  4QX8 B;  3FZF B;  2D0U A;  4HN9 A;  5FL1 A;  3O1H A;  3C50 A;  5JQG E;  2IW5 B;  1WLX A;  5AQK B;  4EZ4 A;  4JLE A;  4DUZ T;  1OXZ A;  1X79 A;  4I50 E;  4AKH A;  3RGL A;  4TWD A;  1D0X A;  4HWI B;  3H3M A;  4M1P A;  5EK2 A;  4UVB B;  2IC9 A;  5LJN A;  3FZM B;  3OKQ A;  2KWI B;  2NR4 A;  3IEE A;  5C3J A;  1LVF A;  3KIN B;  2VUR A;  4NXN T;  1ZHC A;  3HKD E;  3KV6 A;  4ILC A;  1M7K A;  4QHO A;  3P8C D;  3CWZ B;  2OV9 A;  4O4L E;  2QYW A;  2XAJ B;  1KNR A;  3OTO T;  2NOX A;  2Q9Q C;  2WCA A;  2D0T A;  2RPA A;  3N2G E;  3O1J A;  1UX5 A;  2MAW A;  5FL0 A;  4X1I E;  2BBJ A;  5LBQ B;  2XTL A;  4TN7 B;  5L3C B;  2VQE T;  2XAS B;  5JR9 B;  1MIW A;  2LM9 A;  2E9X A;  4WZX A;  3Q5D A;  5IUX A;  2HH7 A;  4EZH A;  3U3I A;  2WS3 A;  3ZPO A;  5HEH A;  5HWX A;  3F31 A;  4DV7 T;  2EHO C;  4CN4 A;  3RC8 A;  3UTK A;  3BQK A;  2CA5 A;  2JQK A;  5AQR B;  4LFB T;  5JRC A;  2ODV A;  5HXC A;  5ABF B;  4A5X A;  3O4X E;  3AE8 A;  3ABV A;  3F2E A;  5AQU B;  4OHF A;  2N2N A;  5FYM A;  2UU9 T;  1S35 A;  1R8I A;  2CCQ A;  2FJE A;  2UUB T;  3PUA A;  1HNW T;  5ADX L;  5E0O A;  2L3L A;  1JNZ A;  3N9N A;  3J9X 1;  1HS7 A;  1YQ3 A;  4U3C A;  2M6B A;  2JQH A;  2X9Y A;  2XQA A;  1OWA A;  3PJA J;  2WU2 A;  2LKH A;  4H9N C;  4CQI A;  4QKN A;  3ZN1 B;  3CX7 B;  4AQF A;  3AVR A;  4UV9 B;  3CKD A;  2YU2 A;  2W00 A;  2YIN A;  1HTJ F;  3RC3 A;  4I55 E;  3FZH B;  4IIJ E;  3LK2 B;  1YKE B;  2DHR A;  2LLY A;  2WWU A;  3ZMS B;  3OJA A;  4ILU A;  3ZMU B;  2VKJ A;  5LB7 B;  2HN2 A;  3IA3 A;  5AQI B;  2G0U A;  2YDS A;  5HXE A;  5LXT E;  4LF6 T;  1BR2 A;  4JI4 T;  2HN1 A;  2VAS A;  3P4P A;  1X9B A;  4IT4 A;  4COF A;  3CQC B;  4IHJ E;  4B3M T;  2AXD S;  3T8O A;  4DV1 T;  1W0B A;  5F8P A;  2R6G F;  4ZXL A;  2LSY A;  4DV6 T;  3MJX A;  2NTY A;  2BKO A;  2BKN A;  2YDQ A;  2ES0 A;  2X67 A;  3UFE A;  1YQ4 A;  4GIW A;  1KEY A;  3VRB A;  5AQJ B;  5C8Y E;  4ZI2 C;  5FY0 A;  5LG4 A;  4JI0 T;  5AQN B;  4JBW F;  2Y6X A;  4WBN E;  2RA1 A;  5CA1 E;  4I0U A;  4IE0 A;  2ZMA A;  4X1K E;  3ZCI A;  2WB5 A;  5CA0 E;  1WR6 A;  1SA0 E;  3GA8 A;  2LRL A;  2BS3 A;  3FBL A;  2KSR A;  4YFS A;  4AXP A;  1FMV A;  3PUQ A;  3H3A A;  4ZS3 A;  5HEU A;  3GN5 B;  2A9U A;  3AE5 A;  2W67 A;  3B57 A;  3PE0 A;  3K1S A;  5IHY A;  1MNE A;  3ZSS A;  2YKS A;  4HFH A;  3RIF A;  3OPC A;  5LP6 E;  2H7V C;  1Y01 A;  2BKP A;  3QB5 A;  5FXV A;  3Q5X A;  3AE7 A;  1EZ3 A;  4EEB A;  2Y8D A;  3TLT A;  5FXX A;  3N2O A;  4PJL A;  1D1B A;  1MMN A;  2JRK A;  3ZYL A;  2KLQ A;  5EK4 A;  4G2A A;  5AQS B;  3JAF A;  4LF4 T;  4HWC A;  5FP3 A;  2I0M A;  1YD8 G;  2A3D A;  3AA6 B;  2KXP B;  5TAO A;  4OX9 T;  2UXN B;  5LHG B;  2JQQ A;  4P0B A;  3ETU A;  2KMF A;  5M4Y A;  2V26 A;  2XAQ B;  3FZL B;  5HCJ A;  3E08 A;  3FXD B;  3KFW X;  3HR0 A;  1J1J A;  1J5E T;  3Q5E A;  3ESL A;  3NKZ A;  2WM9 A;  2WY2 A;  2H88 A;  3IBP A;  1DU2 A;  1IJ6 A;  3W15 B;  3OYZ A;  2JJ9 A;  2LSJ A;  4JI1 T;  3RIU C;  3LSV A;  5JTG A;  2EHO A;  2WSS V;  5JDN A;  3HI2 A;  3EHZ A;  2CHN A;  4EAH A;  2W2U A;  4CI3 B;  4JEU B;  2IUB A;  3Q5W A;  2N9D A;  5DQW A;  3R6N A;  2XM2 A;  2RP4 A;  2UUC T;  1CHU A;  3PUG A;  4IL4 A;  2WWV A;  3PUS A;  4BJM A;  2WDR A;  2CEA A;  1IBL T;  2LSG A;  2BG9 B;  5DJQ C;  2DCF A;  2CRB A;  2XQ8 A;  5HXS A;  3ZC0 A;  3RHW A;  4BAY B;  4TWF A;  2K3W A;  1ZOY A;  4UVA B;  2LM2 A;  2JIW A;  3AA7 B;  3AA1 B;  2C5J A;  4ILB A;  4AKR B;  4GKK T;  1HX1 B;  3UUN A;  1HF8 A;  4L0R A;  4ISS A;  1J5W A;  1UX4 A;  2CLY B;  1NEK A;  4HWH A;  4PJN A;  4QX7 B;  5BR8 T;  5LGT B;  2XY8 B;  2JMK A;  4ADZ A;  3Q2M A;  3PUY F;  3FB2 A;  4YTN A;  2HHH T;  3V5S A;  2C5K T;  1AJ3 A;  4HFI A;  3SRZ A;  2H3R A;  2XHE B;  4QWN B;  3ZMV B;  4PJJ A;  1V9D A;  2X9X A;  2CWO A;  3TLV A;  2X9H A;  5LMN T;  2IAK A;  1D1C A;  1L0V A;  4DBR A;  4PK5 A;  2XQ5 A;  2XQ9 A;  1ZEE A;  1SHZ C;  4WYV A;  4YSZ A;  2WDQ A;  3ONX A;  2LHR A;  1NAF A;  1QUU A;  3OBV E;  3RYI E;  2D5U A;  3DP7 A;  4AIU A;  2ZM2 A;  2MYS A;  5FVL A;  3FHN A;  4AKI A;  5ABG A;  3GMI A;  3V5U A;  4DID B;  2AE9 A;  1KNP A;  3CPZ A;  1KNZ A;  3ZJ2 A;  4ZS2 A;  4BJN A;  4O2B E;  4IRE A;  3QC9 A;  2A72 A;  4LF5 T;  2WMN A;  1M62 A;  2KIN B;  2WAU A;  4U31 A;  5AQL B;  2ACZ A;  1OED C;  4A98 A;  3EAB A;  5EK3 A;  5F5W A;  3NWI A;  4MFR A;  4X65 T;  5KX5 E;  4H63 V;  3AE3 A;  5AQT B;  4JI8 T;  2XAF B;  5JDQ A;  2IML A;  1HNX T;  4Z91 A;  4JI2 T;  3NVO A;  2DWG A;  3VU7 H;  5AFU L;  4NIQ A;  3KVB A;  2J4G A;  4MLK A;  3FBZ A;  1WRD A;  3UUM A;  3VKG A;  2JPF A;  4PK4 A;  3IHR A;  2ZM6 T;  4IE6 A;  4B3R T;  2GK9 A;  4UXN B;  2DL1 A;  4H9P C;  3N9L A;  5L4E A;  4YLH A;  1BR0 A;  4UR9 A;  4P0A A;  3LBX A;  1N36 T;  5L2L A;  2CBI A;  4X62 T;  3IF8 B;  2WP9 A;  5GON E;  4MAL A;  3LK4 2;  4P1N A;  2B1E A;  4HFD A;  1U4Q A;  5AQF B;  4A97 A;  2W62 A;  4NUV A;  4B6X A;  3GWH A;  4G63 A;  4IE7 A;  4H63 H;  3UU5 A;  4JEH B;  2YK0 A;  5JRE A;  3SFD A;  3Q9D A;  3BQI A;  2V7L A;  5FY7 A;  4IST A;  3C64 A;  3UFG A;  3RRW A;  3MK7 C;  3L39 A;  4UVC B;  2IHR 1;  4DR5 T;  1KF6 A;  4Q25 A;  4MHC A;  3RIU A;  2NWB A;  4U33 A;  3VR9 A;  5H6R B;  3VR8 A;  1UGO A;  2C5I T;  4DR1 T;  1T72 A;  5L4H A;  4CXW A;  3AA0 B;  3LG7 A;  5DAB A;  4DV4 T;  2ODU A;  3JAE A;  4EOZ B;  3M65 A;  4O4I E;  4WNK A;  2LT3 A;  3AEF A;  5AQM B;  1T98 A;  2I59 A;  4PAG A;  2J47 A;  1U5P A;  4DR6 T;  2UXD T;  4GOU A;  3HKB E;  1T8B A;  4JV5 T;  4ZEY A;  3PJA A;  5LJM A;  2C0S A;  3A8Y C;  2K24 A;  1N32 T;  2XAG B;  1XZY A;  1MMG A;  3C51 A;  3RX6 A;  4OYJ A;  4I4T E;  3N9O A;  3TKL B;  2KWH A;  1G8X A;  5HWY A;  3P4S A;  1QSD A;  2J1D G;  2WZH A;  3AE1 A;  3K8P C;  3O1I A;  2DWK A;  2E9X B;  5HEO A;  3RQU A;  1MIV A;  1G73 A;  2NP9 A;  4HWF A;  1ZKE A;  2M6I A;  4PK6 A;  3SFE A;  2FJB A;  2CHO A;  5C2T A;  3LBX B;  4UIG A;  1VCT A;  4IDQ A;  2CXL A;  4B3T T;  3RYF E;  3NRY A;  1MND A;  2WZI A;  4ILA A;  3U78 A;  4CN1 A;  2V6X A;  3UQ7 A;  1Y64 B;  1CUN A;  4TX5 A;  5JRC B;  4TNW A;  4EB6 E;  3KBU A;  2XM1 A;  4ZZB A;  1XMO T;  4QH4 A;  2ACX A;  1WYB A;  2K48 A;  3ANW A;  1QLB A;  3ZJ1 A; 
#chains in the Genus database with same CATH homology
 3D0T A;  3SWH A;  1S94 A;  3ZMZ B;  4EAH A;  4CI3 B;  4U74 A;  5JVD E;  5FNV E;  4UV8 B;  3WAJ A;  3KV5 A;  4JEU B;  2BDE A;  4ZI7 E;  5HYA A;  4QX8 B;  2D0U A;  3Q5W A;  4HN9 A;  3CML A;  2N9D A;  5DQW A;  4I43 B;  4UF0 B;  3O1H A;  4NUU A;  3R6N A;  2PFV A;  1HFA A;  2RP4 A;  4ERR A;  1B7T A;  3C50 A;  4OFZ A;  5JQG E;  2IW5 B;  3PUR A;  2BVM A;  1HG2 A;  1WLX A;  5L3B B;  3K3O A;  3PUG A;  2XQY A;  4EZ4 A;  3PUS A;  4JLE A;  3SS1 A;  4V1A v;  4BJM A;  4DBQ A;  2CEA A;  2LSG A;  1OXZ A;  3JC6 D;  4AKL A;  4TV8 E;  4CI1 B;  1VRB A;  2IC6 A;  4PFO A;  5DJQ C;  1HG5 A;  1X79 A;  2DCF A;  3H37 A;  3GN5 A;  4I50 E;  4AKH A;  3N2K E;  1IAP A;  5HXS A;  1D0X A;  4M1P A;  4ANJ A;  5EK2 A;  5DQV A;  3ZC0 A;  4U72 A;  4UVB B;  2IC9 A;  4YJ2 E;  5LJN A;  2LEH A;  2UXX B;  3OKQ A;  2KWI B;  3IEE A;  4GK0 E;  4GK5 E;  4HTE A;  3UUX B;  1LVF A;  3MAC A;  3KIN B;  3I9W A;  3I9Y A;  2MOZ A;  4BAY B;  2X68 A;  5JR9 C;  2LOS A;  3DJB A;  2VL8 A;  2WBL A;  3L3P A;  5LHH B;  2PJQ A;  1ZHC A;  3HKD E;  4UVA B;  3N9Q A;  3RH3 A;  1BR4 A;  3KV6 A;  4Z8X A;  2ZM0 A;  3AA7 B;  1FMW A;  2PBI A;  3C4X A;  4HGA A;  4ZOL E;  2SPC A;  3AA1 B;  2JMH A;  2C5J A;  3B13 A;  4QHO A;  4X1Y E;  3P8C D;  3CWZ B;  3KDS E;  3PU8 A;  2HPL A;  2X9W A;  4O4L E;  4AKR B;  4HFV A;  4O2A E;  4N78 D;  2XAJ B;  3UUN A;  2NOX A;  2Q9Q C;  4E7S A;  3ZC1 A;  2CE7 A;  1HF8 A;  5L3F B;  4L0R A;  4ISS A;  2VK9 A;  4TV9 E;  1UX4 A;  2D0T A;  3VKH A;  2CLY B;  4CXX A;  4PJN A;  4QX7 B;  2LHN A;  3N2G E;  4C90 A;  3O1J A;  1UX5 A;  5LGT B;  3DTO A;  4X1I E;  4DMW A;  5LBQ B;  2JMK A;  2XTL A;  4ADZ A;  4TN7 B;  3Q2M A;  4PW8 A;  1WYC A;  5L3C B;  2XAS B;  3FB2 A;  5JR9 B;  1MIW A;  3V5S A;  2LM9 A;  2C5K T;  1AJ3 A;  2E9X A;  2Q9Q A;  3N9M A;  3SRZ A;  4EYU A;  2H3R A;  2XHE B;  4L5G A;  2HH7 A;  2DNX A;  3NZQ A;  4IGU A;  4PJJ A;  3HKE E;  4QWN B;  4QXB B;  3U3I A;  1V9D A;  3ZMV B;  2X9X A;  2M67 A;  3RYH E;  4EZH A;  1D1A A;  3ZPO A;  2CWO A;  3HA4 A;  5HWX A;  4FI5 A;  3F31 A;  2X9H A;  2MBG A;  5FMN A;  2IAK A;  1D1C A;  4DBR A;  3CQX C;  4PK5 A;  2EHO C;  1LVK A;  1UCU A;  1ZEE A;  3CX8 B;  1SHZ C;  2P9B A;  4GYS A;  4IDZ A;  3LJC A;  2NTX A;  3RC8 A;  3UTK A;  2Q9Q D;  4KMC A;  3FXE B;  3BQK A;  3ONX A;  2CA5 A;  2LHR A;  1NAF A;  1US7 B;  3E0Z A;  2VB6 A;  5JRC A;  2ODV A;  1QUU A;  2VWA A;  3OBV E;  2V7M A;  3RYI E;  3EDV A;  2D2S A;  5HXC A;  4DVD A;  2D5U A;  3DP7 A;  2X0L B;  3O4X E;  2LE8 A;  2L8K A;  2ZM2 A;  2MYS A;  3F2E A;  3PTR B;  2W63 A;  3FHN A;  1BR1 A;  4OHF A;  2N2N A;  5FYM A;  1S35 A;  4K0U A;  4AKI A;  3GMI A;  2CCQ A;  2V7K A;  3V5U A;  3EVY A;  2ZLY A;  5L3G B;  3WAK A;  3KBT A;  4XAX B;  3ZLI A;  5LOV E;  3ZN0 B;  4BA9 A;  2V7J A;  2LSK A;  3PUA A;  5JDH A;  5ADX L;  5E0O A;  2L3L A;  4E7Z A;  2NW8 A;  3N9N A;  2DLR A;  3J9X 1;  2EHO D;  1HS7 A;  3CPZ A;  1HX8 A;  1KNZ A;  3ZJ2 A;  2L9Q A;  4ZS2 A;  4AQF C;  4CXY A;  1E1H B;  4O4H E;  3J7Y q;  2ZM8 A;  4BJN A;  5HXH A;  5LGN B;  3N5L A;  4O2B E;  4YJ3 E;  4L9I A;  2X9Y A;  1OWA A;  1ZV4 X;  3QC9 A;  2A72 A;  5JH7 E;  2NW7 A;  3LK3 B;  1IZN B;  2WMN A;  4H9N C;  2KIN B;  2WAU A;  4CQI A;  4QKN A;  3CX6 B;  3ZN1 B;  3CX7 B;  4DO0 A;  4AQF A;  1MMD A;  3AVR A;  3NZP A;  4UV9 B;  3CKD A;  2YU2 A;  3C4Z A;  2W00 A;  4ZHQ E;  2YIN A;  1HTJ F;  3NRX A;  3RC3 A;  4I55 E;  5EK3 A;  3A5X A;  4IIJ E;  3LK2 B;  4MFR A;  5KX5 E;  3UT5 E;  1NWM X;  4H63 V;  1YKE B;  2E9X C;  2XAF B;  2DHR A;  3LFM A;  5J1G A;  5JDQ A;  4OYK A;  5JDL A;  3K3N A;  2WWU A;  3ZMS B;  2V7I A;  4PFP A;  3OJA A;  4ILU A;  3ZMU B;  4AKG A;  4ASK A;  2DWG A;  2VKJ A;  3K3Q C;  3VU7 H;  5AFU L;  3KVB A;  4HKA A;  4MLK A;  3FBZ A;  3F57 A;  1WRD A;  3BK9 A;  4H9S E;  3UUM A;  3VKG A;  2JPF A;  4H9O C;  4PK4 A;  2G0U A;  3I0Q A;  1D0Z A;  3IHR A;  3KVA A;  3ZEF B;  4EIW A;  4IE6 A;  4UEL A;  2GK9 A;  2DI4 A;  4KBM B;  3UUL A;  4UXN B;  4H9P C;  3N9L A;  1MMA A;  5HXE A;  4YLH A;  1BR0 A;  5LXT E;  5HAX A;  3I0O A;  4P0A A;  1BR2 A;  1MIY A;  3LBX A;  1D0Y A;  2CWY A;  2VAS A;  2Q9Q B;  2XUE A;  3CQG B;  5L2L A;  4KUM B;  2YEV C;  4AQG A;  5LBM A;  3CQC B;  3IF8 B;  5GON E;  4MAL A;  4IHJ E;  3LK4 2;  4KP3 C;  4TZ4 C;  2B1E A;  2E9X D;  5KMG P;  3T8O A;  1U4Q A;  1LRZ A;  5L3E B;  4PNI A;  2CXF A;  4FJO A;  2OA5 A;  2W62 A;  2W0G A;  3MXZ A;  2CM0 A;  4NUV A;  5F8P A;  4B6X A;  4X20 E;  2LSY A;  5JDG A;  3GWH A;  1LKX A;  1YW0 A;  2KND A;  3MJX A;  5JDM A;  3VHL A;  2HPJ A;  5LHI B;  4OK0 A;  3ZMT B;  4G63 A;  4IE7 A;  2NTY A;  4H63 H;  4CZZ B;  4JEH B;  2YK0 A;  3MZK B;  5JRE A;  5IYZ E;  2A2F X;  4DND A;  3CVR A;  3Q9D A;  5ETW A;  5LCY A;  2ES0 A;  2X67 A;  3UFE A;  5J2U E;  2K9A A;  2V7L A;  3BQI A;  5FY7 A;  4IST A;  3KV9 A;  2EHO B;  2BZB A;  3PDY A;  3AAA B;  3C64 A;  4XBF B;  2V1D B;  5LGU B;  3RRW A;  3MK7 C;  4GIW A;  2VKH A;  5A1L A;  2NW9 A;  4AI6 A;  3ANW B;  4MBQ A;  4UVC B;  5C8Y E;  4UF0 A;  4O8S A;  3S4U A;  2WMO A;  5FY0 A;  4ZI2 C;  5LG4 A;  3HKC E;  1IJ5 A;  5J2T E;  4IE5 A;  2N1G A;  2Y6X A;  2MTQ A;  4WBN E;  3OYX A;  2RA1 A;  4F6R C;  1HCI A;  3MA9 A;  4MHC A;  4PJM A;  2E8I A;  2XAH B;  5CA1 E;  4EYY R;  4IE0 A;  1FIO A;  1Z0P A;  2ZMA A;  4X1K E;  3AAI A;  3ZCI A;  3ZYK A;  4A56 A;  1WR6 A;  2NWB A;  4QXC B;  5JDF A;  1SA0 E;  2Y48 B;  2CXD A;  3GA8 A;  5CA0 E;  4JUY A;  4IE4 A;  5H6R B;  3FBL A;  4YFS A;  3N9P A;  2C5I T;  3NBX X;  4AXP A;  4CXW A;  3BQL A;  3AA0 B;  3RYC E;  3LG7 A;  5DAB A;  1FMV A;  3RKO A;  2ODU A;  3PUQ A;  3H3A A;  4ZS3 A;  4EOZ B;  3GN5 B;  5L3D B;  3KV4 A;  3M65 A;  3ZCJ A;  4O4I E;  4WNK A;  2LT3 A;  3L09 A;  2CMR A;  2CLY C;  3B57 A;  3PE0 A;  5IHY A;  3I1A A;  1T98 A;  3PU3 A;  1MNE A;  2I59 A;  3MKD A;  3C98 B;  4PAG A;  5F3J A;  5LP6 E;  2YU1 A;  4WBO A;  4ZI3 C;  2H7V C;  1U5P A;  2LJL A;  4YHJ A;  1H7C A;  4C91 A;  3ZYM A;  3SOL A;  4ZI2 D;  5FXV A;  3Q5X A;  4GOU A;  3HKB E;  1EZ3 A;  4J2C A;  2Y8D A;  3P7I A;  5LJM A;  3RPU A;  5CB4 E;  2C0S A;  2K24 A;  5FXX A;  5H6Q B;  5KDM C;  2XAG B;  1MMG A;  3N2O A;  3C51 A;  4PJL A;  1O3X A;  1D1B A;  2BVL A;  2KZ7 B;  4QXH B;  3RX6 A;  1MMN A;  4OYJ A;  4I4T E;  3N9O A;  5JR9 A;  2JRK A;  5BMV E;  5LYJ E;  2H7O A;  3TKL B;  3ZYL A;  2KWH A;  1G8X A;  2KLQ A;  5HWY A;  5FXW A;  5EK4 A;  4G2A A;  1KK7 A;  3QUJ A;  1QSD A;  2J1D G;  4H9R C;  3R84 B;  1VOM A;  3E22 E;  5FP3 A;  4TUY E;  5EZY E;  3ZJ1 A;  4H9Q C;  3K8P C;  1YD8 G;  5LA6 E;  2A3D A;  3O1I A;  3AA6 B;  2KXP B;  2DWK A;  3O9X A;  2E9X B;  4HEA A;  4O4J E;  5FXZ A;  5TAO A;  2UXN B;  5LHG B;  3AAE B;  2JQQ A;  4ZI3 D;  2X51 A;  4P0B A;  1MIV A;  3ETU A;  3RRC A;  1G73 A;  2NP9 A;  2KMF A;  5M4Y A;  1ZKE A;  2V26 A;  4PK6 A;  2XAQ B;  4CI2 B;  2KT9 A;  3LBX B;  3E08 A;  3EDU A;  3FXD B;  2X66 A;  3KFW X;  4UIG A;  3HR0 A;  2QA7 A;  2LOP A;  2CXL A;  2PG8 A;  4UEM A;  3ESL A;  3RYF E;  3NRY A;  2Z6E A;  3EUH A;  4P09 A;  5LNK A;  1MND A;  3HL6 A;  3U78 A;  2QGS A;  5FY1 A;  3ETV A;  4EXT A;  2K5B B;  2WM9 A;  3QK6 A;  3JC6 C;  4WW0 A;  3IBP A;  2LSI A;  1YKH B;  1IJ6 A;  1CUN A;  1Y64 B;  4TX5 A;  5JRC B;  1FEW A;  3AVS A;  2VKO A;  3W15 B;  3OYZ A;  4EB6 E;  2W61 A;  4DMV A;  2JJ9 A;  3KBU A;  2LSJ A;  3AB3 B;  2EHO A;  4GYR A;  4XZC A;  4HE8 A;  2WSS V;  5HXR A;  3C4W A;  2ACX A;  3WI3 A;  1WYB A;  2K48 A;  3ANW A;  5JDN A;  2VKD A;  3HI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...