2N9DA

Structure analysis of the tom1 gat domain reveals distinct ligand-specific conformational states
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
b'EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of Myb protein 1
publication title Structure of the GAT domain of the endosomal adapter protein Tom1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 38
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n9dA00
1WRDA 1YD8G 1WR6A 1NAFA 1O3XA 2N2NA 2N9DA 1NWMX 1OXZA 1X79A
chains in the Genus database with same CATH superfamily
3ZSSA 2JIWA 4ZZCA 2CE7A 3CWZB 4DBQA 5JDNA 3QUJA 2M6BA 5HEHA 3ZMTB 4HFDA 3QNUA 5FY7A 4YY3T 3MA9A 2ACXA 1D1CA 3ZEFB 3AE4A 3AA6B 2Y8DA 4L5GA 4YTPA 3CIRA 5LGUB 3N9MA 4GKJT 5M4YA 3A7MA 3ZLIA 2KLQA 2CHOA 2VK9A 4EB6E 4CN6A 4HEAA 4HWFA 4OYJA 3VRAA 4X64T 2WS3A 3DJBA 5ABFB 2KSRA 4ZS2A 1XDPA 3CK6A 3RGLA 4EEDA 2XY8B 2W4XA 3ZCIA 2RA1A 1US7B 4PJJA 4MLKA 1FMWA 3UTKA 1MMNA 2NWBA 5HEOA 4ZI3C 3M65A 1YQ3A 2WDVA 2LSIA 3LG7A 3J9X1 3UUMA 5CJ5A 3ZN0B 2X0YA 3I9YA 2BG9A 5EK2A 5L3BB 4XBFB 2UU9T 4DMVA 4AI6A 2CXDA 3T1YT 4L0RA 1W0AA 4N78D 5AQMB 3E0ZA 4PJMA 2I0MA 2BS2A 2NOXA 2BG9C 2L3LA 4O4HE 3RKOA 3PDYA 4YTNA 3RQWA 3K3OA 4TZ4C 2WBLA 1LRZA 1JNZA 3ZT5A 3JC6D 2JRKA 2K24A 4YSZA 3FBLA 4KI0F 4ZI2C 3AA1B 5JRCA 4TV9E 5LG3A 1BR0A 4I0UA 5LHHB 3UU6A 1YW0A 2D5UA 2IAKA 2LRKA 3ZMUB 3LJCA 4H63H 4HFCA 3UU5A 1YKEB 3CX8B 3EABA 4LFCT 3RX6A 1WR0A 1UX5A 4CI3B 2WP9A 3LK3B 4UV8B 2HH7A 5HCMA 3E22E 3CKDA 4ILAA 3UULA 3KV5A 2YINA 1N33T 1I6ZA 4PAGA 1MNDA 2H7OA 3RRCA 3E08A 3AE6A 5FXXA 4HFHA 4JI3T 3BQIA 5HXEA 2KNDA 1T7SA 4A56A 3ZSTA 5AQNB 2CXLA 2VB6A 3RIUA 2LSYA 3AVSA 4GK0E 5ABGA 5L3GB 2XAGB 3PUZF 3ZT6A 4OYKA 1HS7A 3HKEE 3ZYKA 4GOUA 4ZS3A 3RIUC 3LFMA 4E7ZA 5IYZE 5FNVE 4IGUA 3AA0B 1SA0E 4IT4A 4H9RC 4C90A 4EYUA 2XSBA 5ETWA 4YJ2E 4O2BE 4HGAA 5CFBA 3P50A 4HWCA 4ISTA 4CI1B 1Z8UA 3RQUA 2UXDT 1OEDA 3N9PA 3JCFA 2Z6EA 5HAXA 2ZM8A 4B6XA 3TLUA 4GYSA 3RC3A 3N9NA 1NENA 1HG2A 1CHUA 4KP3C 3GN5A 3AVRA 4KUMB 3UUBA 4UIGA 4TN7B 2KWIB 2XQ8A 4JI0T 3QC9A 3GA8A 4HWDA 4JI6T 1KFYA 2VKJA 4O4LE 2D2SA 4JYAT 3RIFA 5TAOA 2OLTA 2LEHA 2DL1A 3C4XA 3UQ7A 4EV6A 1Y01A 1G8XA 5GONE 4X62T 3CQXC 4FI5A 4QXHB 3GN5B 4HTEA 5ADXL 4DV5T 4YJ3E 4OFZA 1X9BA 2P9BA 4DR2T 4DV7T 2IHR1 3ZYMA 5EZYE 5AQRB 1D1AA 2DLRA 4DO0A 3FZFB 3ZC0A 1S35A 4OX9T 1FIOA 5HXCA 4X1YE 2VASA 2XQ7A 1FMVA 2XQYA 4PK4A 3C4WA 1XWMA 4YXDA 1HNXT 2LLYA 4QHOA 3AE5A 4G2AA 3FZKB 4TX5A 4LMLA 2LOSA 2CA5A 3IF8B 5FXVA 3AEGA 2LOPA 3FZHB 3ZJ2A 2E5LT 2CXFA 3KDSE 5LJMA 3AE1A 2BVLA 1KK7A 4UR9A 3PJAA 3MACA 4QXBB 4IHJE 2E9XA 3CVRA 4AKGA 4OHFA 2CRBA 4DV2T 3H3AA 2MYSA 3LSVA 4GKKT 2C5JA 5LBQB 5LB7B 3TKLB 4X66T 2N2NA 5F8PA 2VL0A 2X0LB 2UXBT 2E9XC 2XJ7A 2H88A 4XZCA 4MFRA 4Q25A 4ILBA 2R6GF 2PTFA 5LCYA 4MBQA 2X68A 5HXHA 2KINB 4HKAA 2V1DB 2HN2A 5A1LA 1W0BA 2LT3A 4UEMA 1UX4A 5JVDE 4F8HA 3ZT7A 5AQHB 2IIUA 3AEFA 2BBHA 5LP6E 5KDMC 2G0UA 5AQVB 2V5DA 2UUAT 1IBMT 2YN6A 4P1NA 1LKXA 3MZKB 3R6NA 4IL9A 3PUYF 4YT0A 4CN4A 2FUPA 3OPCA 1WCRA 4DR3T 2Q9QB 4OK0A 1JNRA 2E2AA 3PTRB 4QXCB 3K1SA 3RH3A 3ZMSB 3RIAA 5FP3A 2V26A 2K3WA 2YKSA 3ZMZB 3EDUA 5AQJB 4PW8A 3P4QA 5CB4E 5JDHA 4HN9A 2CWYA 4QH1A 2DI4A 5L47A 5F5WA 3VKGA 4O2AE 3AE8A 4NUVA 3FB2A 5HXRA 2ZM6T 3K3QC 2MBGA 1T8BA 2KMFA 5HWYA 4B3RT 4NPPA 1E7PA 2VKHA 3GWHA 3QOFA 5L4EA 4DR5T 2ES0A 4NXMT 4LF5T 3WAJA 3I9WA 4PJNA 2BVMA 4YLHA 4TWFA 5JDFA 3MKDA 2J62A 4CQIA 2MTQA 4AKLA 2M67A 5ABFA 3PUVF 5FYMA 5J1GA 4PNIA 2C5IT 4UF0A 3KINB 4KX6A 4P09A 2W61A 1WRDA 5HEGA 4AQFA 4LF7T 1I94T 4JI4T 3I1AA 4U2YA 1HF8A 2F4VT 1NWMX 3FXDB 1G73A 2V6YA 3AAIA 2CPTA 2SPCA 3H37A 5HCJA 4JBWF 1HNWT 3PU3A 4AKHA 4AQFC 4QX8B 3V5SA 3ZPOA 2N1GA 2KT9A 3A8YC 4A97A 3ZMVB 1U4QA 4QH5A 2NR4A 4TUYE 4UF0B 1MMDA 4EOZB 4IE6A 3NRXA 5L3DB 5AQTB 3O4XE 1VCSA 1NEKA 5HYAA 1W09A 3JAFA 3KBUA 3QB5K 2LHNA 1IAPA 2V6YB 4CZZB 2PG8A 4M1PA 3WAKA 1D0YA 5FY1A 4MALA 5DJQC 2XAJB 1N34T 2XZEA 4ERRA 2WSSV 5L3CB 3N9LA 5KX5E 3P4WA 4B3MT 3Q5DA 3RHWA 5J2TE 3HKCE 1YXRA 2K5BB 2UXCT 1KEYA 3C50A 3SS1A 2V5CA 3D0TA 3MJXA 2NW9A 3Q5WA 2XHEB 4X1IE 1X79A 2QVAA 3VKHA 1ZEEA 3Q2MA 2JQHA 3O1HA 4CI2B 2BS4A 4EGWA 2VQET 5C2TA 4BJMA 2FBWA 1HCIA 4LF9T 4J2CA 5LA6E 3OBVE 3SWHA 2WMNA 4LF8T 3VR8A 2V7MA 4FJOA 3FBZA 3BQLA 3EI0A 2I6HA 5AQKB 4K0UA 4AISA 1GQEA 3NRYA 4P0BA 3L3PA 2LM2A 4ANJA 4JI1T 5FL1A 3VU7H 4LF6T 4I55E 1D0ZA 3RI5A 3X1DA 4AQGA 2W67A 1R8IA 2KXPB 5ABEA 5J2UE 3L39A 2H3RA 4I4TE 4DV0T 4GIWA 3AE2A 2C0SA 3PJAJ 2XQ4A 3KVAA 2A2FX 3ZCJA 5KXJA 2X9XA 3AEDA 5F3JA 3N2OA 2XM1A 3L8RA 1E2AA 3FHNA 4U72A 1Z0PA 3LK42 1ZOYA 2JQKA 2QRXA 4IDOA 3M3ZB 2E5VA 3TLTA 4PK5A 3B13A 2JMHA 3NWIA 4C91A 2IDOB 2LM9A 2L9QA 3J7Yq 1KNPA 2X67A 3DTOA 1XZYA 3C4ZA 2XAFB 3K3NA 3UU8A 1UGOA 3JC6C 3C51A 3PV0F 2BG9E 1ZHCA 2VVNA 2XTLA 4A98A 2W00A 2VQFT 5LGTB 2AE9A 2J1DG 4HFVA 1MIVA 3OVUA 1MIYA 1J5WA 3H3MA 3HI2A 2EHOD 3PUQA 3ESLA 3NVOA 3UU4A 1ZKEA 5CA1E 2W0GA 3I0OA 5JREA 3FXEB 3DP7A 4PK6A 3RYFE 3QB5A 4PFPA 5LOVE 4H9PC 4BA9A 3O1IA 3V5UA 1HFAA 4A5XA 2ODUA 4EYYR 2XQ6A 5FVLA 2K9AA 5LXTE 1OEDC 4ZEYA 4B3TT 4Z90A 4I50E 3CMLA 4U2ZA 1VOMA 3I0QA 4BAYB 2WU5A 4DR7T 3TLSA 5EK4A 2ODVA 2H89A 2CCQA 3OYZA 2LKHA 5AQIB 1MMGA 4Z8XA 3UUXB 3IEEA 3VRBA 3P4SA 4GYRA 4TNVA 2PBIA 3AEEA 2CMRA 1AJ3A 3ZYLA 2IC9A 3AB3B 4JI2T 2WU2A 5AQQB 3N5LA 3HL6A 3ONLC 3SOLA 2W66A 4LMJA 4TNWA 2B76A 3NZPA 5JDQA 1MMAA 4E7SA 5JR9B 2NTYA 2IW5B 2X66A 2C5KT 4L9IA 4AIUA 4ILUA 5C8YE 2Q9QD 2EHOA 5EK3A 4ADZA 4WNKA 3UQ4A 4LFAT 3BK9A 4DV1T 4H9NC 3O9XA 5LBMA 2BDEA 2V8SV 1ZP0A 2WM9A 5LNKA 3N2GE 3IBPA 4CN1A 5AQSB 2XAHB 1QUUA 2I59A 3PUXF 4Z91A 4DBRA 1U5PA 4EZ4A 3CPZA 4JEUB 2EHOB 5JTGA 2E8IA 4JV5T 4UVBB 2A3DA 3S4UA 2Y6XA 2L8KA 3GMIA 4DMWA 4B3ST 5LG4A 4X5TA 2X0HA 2ZM2A 4JI7T 1M62A 3P4PA 4IDPA 4X1KE 1IBLT 2CBJA 5ABHA 2ACZA 3B5MA 3R84B 4IE7A 4G63A 3C64A 2YU1A 4ZXLA 4U3CA 2Q9QA 2FJEA 4DVDA 2VWAA 3AEAA 1EZ3A 1QLBA 2LJLA 1KNZA 1YD8G 1L0VA 4U7YA 3KFWX 5FL0A 3ZN1B 3KV6A 5DQWA 1N32T 2DHRA 3LDQB 2Q9QC 2CLYC 5H6RB 2MAWA 4YFSA 5IWAT 1FEWA 1VCTA 4EAHA 4ASKA 1MNEA 2A9UA 2XUEA 4CXYA 4DUYT 2VURA 3AE3A 3T1HT 2HPLA 1XDOA 5J0ZA 4H9QC 3ONXA 5JDLA 4IDNA 4HWHA 1HX8A 4JLEA 3ONJA 3RPUA 3ZC1A 4DV4T 4ZI3D 2XAQB 3KV9A 2MPKA 2YU2A 2X9YA 2WQYA 5CA0E 1H7CA 3ZJ1A 1V9DA 3ZKRA 4UVAB 3PUSA 3ANWA 4IL4A 5L4HA 5JDMA 2YOEA 2XQ5A 4HE8A 2XPKA 5FVKA 4WBOA 2LSJA 3AE9A 2ZM0A 2YDQA 2W63A 1HR0T 3KVBA 4QKNA 4LMKA 3F57A 4KHPT 3PURA 2Y48B 2UUCT 3C98B 4ZHQE 4TWDA 2YDRA 2LE8A 3ANWB 2N9DA 4NXNT 3B57A 5LHGB 5FKYA 4ZI2D 4ZI7E 4H63V 2BS3A 5AQGB 4JEHB 3AAEB 5JQGE 3WI3A 2XQAA 4JI8T 2DWKA 2LSKA 5FMNA 4MHCA 1WLXA 3FZLB 2FJAA 3CX6B 4UXNB 1B7TA 5LMUT 3PU8A 5JH7E 4DR1T 3KV4A 1UURA 3MK7C 4U74A 1SUMB 1N36T 5LJNA 4LF4T 1CUNA 2NW8A 4O4IE 4X20E 5FXWA 4PFOA 2LHRA 1YQ4A 5LHIB 3LBXA 4P0AA 4HWIB 3OJAA 1BR2A 5LMNT 1UK5A 1IZNB 2W62A 4U7IA 2WY2A 5C3JA 2NP9A 2OV9A 3K8PC 4JI5T 2QA7A 4EXTA 2J4GA 2YK0A 4QWNB 2DCFA 4PJLA 3N9OA 1BR1A 3UT5E 3HA4A 2LRLA 2V7IA 3UUNA 5CGMA 3LBXB 2BKPA 3RRWA 4YHJA 4U33A 3CQCB 3PUWF 4TV8E 4UELA 2WWUA 2BG9B 3EUHA 2ZMAA 2VVSA 3OKQA 1IBKT 1YKHB 2FJBA 4GK5E 4H9SE 2GK9A 4DUZT 2HN1A 2OA5A 2WAUA 2YEVC 4U31A 1M7KA 2NTXA 3SFDA 1WFDA 2KWHA 3PE0A 3VHLA 4BJNA 4KMCA 3F31A 1W9RA 1UUSA 2JQQA 3EAMA 4WYVA 1ZV4X 4CXXA 3ETUA 4EZHA 5JDGA 3JAEA 5JRCB 3CX7B 2YDSA 2WZIA 4HFBA 2WMOA 1SE7A 2B1EA 2V7KA 1D0XA 4COFA 3JADA 1OWAA 2QGSA 2XQ3A 3TLWA 2BKNA 4HFIA 3U78A 1SHZC 4DNDA 1IJ5A 3UU3A 5DQVA 4DV3T 3SFEA 3UFGA 3EDVA 5L2LA 2IMLA 2X9WA 1XNRT 3FZMB 2JPFA 3N9QA 2JQ9A 3IA3A 2M6IA 2RP4A 4EEBA 4IE4A 5LYJE 2LSGA 5HWXA 1IJ6A 2KZ7B 5FY0A 2LKGA 2WZHA 2H7VC 4AQYT 4X65T 4KBMB 3F2EA 5LGNB 5KMGP 2WCAA 2BZBA 3Q5EA 3HR0A 3RKGA 3EHZA 4IREA 2J47A 2CWOA 5HEUA 2XM2A 4ZOLE 4K0KT 4QX7B 3T8OA 2CBIA 1HG5A 4AXPA 3NKZA 4DIDB 5JR9A 2V6XA 4HFEA 5BMVE 1WR6A 3RF1A 3IHRA 3U3IA 4IDZA 2WB5A 4QH4A 5AFUL 3AECA 5HXSA 1UCUA 1FJGT 1OEDB 5JR9C 2E9XD 3P4RA 4O4JE 3LK2B 4ILCA 2X51A 1Y64B 1D1BA 3P7IA 4O8SA 3Q5XA 4IIJE 5E0OA 4DR4T 5BR8T 2IUBA 4DR6T 3TLVA 2CHNA 4LFBT 2JJ9A 4NUUA 3VR9A 2CM0A 2K48A 1E1HB 1HX1B 3O1JA 2D9DA 3NBXX 4KHZF 2UXNB 1XMOT 3P8CD 3OYXA 4YSYA 4DV6T 4JUYA 3BQKA 3AAAB 3MXZA 2DWGA 2EHOC 4I43B 1WYCA 1T72A 1WYBA 4ISSA 2PJQA 2UXXB 3HKBE 3EVYA 3AXJA 3SRZA 2W2UA 4EIWA 4YSXA 2HHHT 3W15B 3AA7B 3A5XA 1T98A 1J5ET 2V7JA 2ZLYA 5L3EB 1HTJF 4ZZBA 2NW7A 1LVKA 4NIQA 3AE7A 2MOZA 3HKDE 5AQPB 2PFVA 1KF6A 3RYHE 3RYCE 3ABVA 3RC8A 5AQOB 1OEDE 2V7LA 5IHYA 4AKRB 4AKIA 3AXJB 3NZQA 2IC6A 2BBJA 3PUGA 3N2KE 2VKOA 2A72A 5IUXA 4H9OC 3RLFF 5AQUB 2X9HA 2XASB 1NAFA 1S94A 2QYWA 2E9XB 2CEAA 3Q9DA 3QK6A 1KNRA 3PUAA 4TWHA 3UFEA 4F6RC 3RYIE 1J1JA 5FXZA 5H6QB 5L3FB 4WBNE 2D0UA 5AQFB 3AEBA 2BKOA 3G06A 4V1Av 1XNQT 2XQ9A 4YTMA 2HPJA 2VKDA 5AQLB 1MIWA 1XMQT 2UUBT 4WW0A 1OXZA 4UVCB 2AXDS 4IE5A 1O3XA 4XAXB 1HNZT 2JMKA 2CLYB 1QSDA 5DABA 2WWVA 3ETVA 4IDQA 2RPAA 2WDRA 3CQGB 4WZXA 1LVFA 1DU2A 4UV9B 2VL8A 1VRBA 2DNXA 3KBTA 4YHHT 4IE0A 3OTOT 2FJDA 5HEJA 2WDQA 2XSAA 1BR4A 4CXWA 3L09A 2D0TA
chains in the Genus database with same CATH topology
4PK6A 3RYFE 3EUHA 2ZMAA 4PFPA 5LOVE 4AKGA 4H9PC 4OHFA 2CE7A 3OKQA 4BA9A 3CWZB 4DBQA 5JDNA 3O1IA 3QUJA 3V5UA 1HFAA 1YKHB 2ODUA 2MYSA 3H3AA 4EYYR 4GK5E 4H9SE 2GK9A 2K9AA 5LXTE 2C5JA 5LBQB 3TKLB 4I50E 2N2NA 2OA5A 3CMLA 1VOMA 3I0QA 3ZMTB 5F8PA 4BAYB 2X0LB 2WAUA 2YEVC 2E9XC 4XZCA 5EK4A 2ODVA 5FY7A 2CCQA 3MA9A 4MFRA 2NTXA 2ACXA 3OYZA 1D1CA 5LCYA 1MMGA 4Z8XA 3UUXB 3IEEA 3ZEFB 4GYRA 4MBQA 3AA6B 2KWHA 2PBIA 3PE0A 3VHLA 2Y8DA 2X68A 4BJNA 5HXHA 4KMCA 4L5GA 2KINB 2CMRA 5LGUB 3F31A 3N9MA 4HKAA 2V1DB 5M4YA 2JQQA 1AJ3A 3ZLIA 3ZYLA 2IC9A 2KLQA 5A1LA 3AB3B 1ZV4X 2LT3A 4CXXA 4UEMA 3ETUA 4EZHA 5JDGA 1UX4A 5JVDE 5JRCB 2VK9A 3CX7B 4EB6E 4HEAA 4OYJA 3N5LA 3HL6A 2WMOA 3DJBA 2B1EA 3SOLA 2V7KA 1D0XA 4ZS2A 1OWAA 2QGSA 5LP6E 5KDMC 3NZPA 2G0UA 1MMAA 5JDQA 3U78A 4E7SA 5JR9B 3ZCIA 2NTYA 1SHZC 1US7B 2RA1A 4PJJA 4DNDA 1IJ5A 4MLKA 5DQVA 2IW5B 1LKXA 2X66A 3MZKB 1FMWA 3R6NA 3UTKA 1MMNA 2C5KT 2NWBA 4L9IA 4ZI3C 4ILUA 5C8YE 2Q9QD 3M65A 2EHOA 2LSIA 3LG7A 3J9X1 5EK3A 3UUMA 4ADZA 4WNKA 2Q9QB 3EDVA 3ZN0B 5L2LA 2X9WA 4OK0A 3I9YA 2JPFA 3N9QA 3PTRB 5EK2A 4QXCB 5L3BB 3BK9A 3RH3A 2RP4A 4XBFB 3ZMSB 4H9NC 5FP3A 3O9XA 5LBMA 2BDEA 4DMVA 4AI6A 2V26A 4IE4A 2CXDA 5LYJE 2WM9A 3ZMZB 2LSGA 4L0RA 5LNKA 3EDUA 3IBPA 3N2GE 4N78D 2XAHB 4PW8A 5HWXA 1IJ6A 1QUUA 2KZ7B 3E0ZA 4PJMA 5CB4E 5JDHA 5FY0A 4HN9A 2CWYA 2I59A 2NOXA 2L3LA 4O4HE 3RKOA 2H7VC 2DI4A 3PDYA 4DBRA 1U5PA 4EZ4A 3CPZA 4JEUB 3VKGA 3K3OA 2EHOB 4O2AE 4TZ4C 4NUVA 3FB2A 2E8IA 5HXRA 2WBLA 3K3QC 4KBMB 2MBGA 2KMFA 5HWYA 1LRZA 4UVBB 3JC6D 2A3DA 2VKHA 3GWHA 3F2EA 2JRKA 3S4UA 2K24A 5LGNB 2ES0A 3FBLA 2Y6XA 2L8KA 5KMGP 2BZBA 4ZI2C 3WAJA 3GMIA 3AA1B 4DMWA 5JRCA 3HR0A 3I9WA 4PJNA 4TV9E 5LG4A 1BR0A 2BVMA 2CWOA 4YLHA 4ZOLE 5JDFA 5LHHB 3MKDA 4CQIA 1YW0A 2MTQA 2D5UA 4AKLA 2ZM2A 2M67A 4QX7B 5FYMA 2IAKA 5J1GA 3T8OA 4PNIA 2C5IT 4UF0A 1HG5A 3KINB 4AXPA 4P09A 2W61A 1WRDA 4AQFA 3ZMUB 3LJCA 4X1KE 5JR9A 5BMVE 3I1AA 4H63H 1YKEB 1WR6A 3CX8B 1HF8A 1NWMX 3IHRA 3U3IA 3FXDB 1G73A 3R84B 4IE7A 4G63A 3AAIA 4IDZA 3C64A 2SPCA 2YU1A 3RX6A 3H37A 2Q9QA 1UX5A 4CI3B 5AFUL 5HXSA 3LK3B 4DVDA 2VWAA 3PU3A 4AKHA 1UCUA 4UV8B 2HH7A 4AQFC 1EZ3A 4QX8B 3V5SA 3ZPOA 5JR9C 3E22E 2LJLA 2N1GA 3CKDA 2E9XD 2KT9A 4O4JE 3UULA 3ZMVB 1U4QA 3LK2B 1KNZA 1YD8G 3KFWX 2X51A 3ZN1B 1Y64B 3KV6A 4TUYE 3KV5A 4UF0B 2YINA 5DQWA 1MMDA 1D1BA 3P7IA 4O8SA 4EOZB 3Q5XA 4IIJE 3NRXA 4IE6A 2DHRA 4PAGA 5E0OA 5L3DB 1MNDA 2Q9QC 2CLYC 2H7OA 3O4XE 3RRCA 5HYAA 5H6RB 3E08A 5FXXA 4YFSA 3BQIA 3KBUA 1FEWA 2KNDA 2LHNA 5HXEA 4EAHA 1IAPA 4CZZB 2PG8A 4M1PA 4ASKA 4A56A 3WAKA 1D0YA 1MNEA 2JJ9A 4NUUA 2CM0A 2K48A 1E1HB 2CXLA 3O1JA 2XUEA 4MALA 5FY1A 2VB6A 5DJQC 4CXYA 3NBXX 2LSYA 2XAJB 2UXNB 3AVSA 4GK0E 3P8CD 4ERRA 3OYXA 2WSSV 5L3CB 3N9LA 2HPLA 5KX5E 5L3GB 2XAGB 5J2TE 4H9QC 3HKCE 4JUYA 3BQKA 3ONXA 5JDLA 3AAAB 2K5BB 4OYKA 1HS7A 3HKEE 1HX8A 3MXZA 2DWGA 4JLEA 2EHOC 4I43B 3ZYKA 1WYCA 4GOUA 3RPUA 3ZC1A 1WYBA 4ISSA 4ZS3A 4ZI3D 2XAQB 3C50A 2PJQA 3KV9A 3LFMA 3SS1A 4E7ZA 5IYZE 2UXXB 2YU2A 5FNVE 2X9YA 4IGUA 3AA0B 3D0TA 3HKBE 3EVYA 5CA0E 3MJXA 2NW9A 1H7CA 3SRZA 3Q5WA 2XHEB 4X1IE 1SA0E 3ZJ1A 4EIWA 1V9DA 4UVAB 4H9RC 3PUSA 3ANWA 3W15B 4C90A 3AA7B 4EYUA 3A5XA 1X79A 1T98A 5ETWA 2V7JA 4YJ2E 4O2BE 4HGAA 3VKHA 2ZLYA 5L3EB 1HTJF 5JDMA 2NW7A 4HE8A 1ZEEA 3Q2MA 1LVKA 3O1HA 4ISTA 4CI2B 4CI1B 4BJMA 4WBOA 1HCIA 2LSJA 2ZM0A 4J2CA 5LA6E 3N9PA 3OBVE 2MOZA 3HKDE 3SWHA 2W63A 2WMNA 2V7MA 2PFVA 4FJOA 3KVBA 3FBZA 3BQLA 2Z6EA 5HAXA 3RYHE 2ZM8A 4B6XA 4GYSA 4QKNA 3RYCE 3RC8A 3F57A 3RC3A 4K0UA 3N9NA 2V7LA 3PURA 5IHYA 3NRYA 2Y48B 4P0BA 3C98B 4ZHQE 4AKRB 3L3PA 1HG2A 4AKIA 4KP3C 3GN5A 3AVRA 4KUMB 4ANJA 3NZQA 4UIGA 4TN7B 2KWIB 2LE8A 2N9DA 3ANWB 3B57A 5LHGB 3QC9A 2IC6A 3VU7H 3GA8A 4ZI2D 4ZI7E 4H63V 3PUGA 4I55E 1D0ZA 2VKJA 3N2KE 2VKOA 4JEHB 2A72A 4AQGA 3AAEB 4O4LE 2D2SA 4H9OC 2X9HA 2XASB 1NAFA 5TAOA 5JQGE 1S94A 2LEHA 3WI3A 2KXPB 2DWKA 2LSKA 3C4XA 5J2UE 2E9XB 5FMNA 4MHCA 1WLXA 2H3RA 4I4TE 2CEAA 3Q9DA 3QK6A 1G8XA 4GIWA 5GONE 3PUAA 2C0SA 3CX6B 3KVAA 4UXNB 3UFEA 2A2FX 3CQXC 3ZCJA 4FI5A 4QXHB 2X9XA 3FXEB 1B7TA 3GN5B 5F3JA 4HTEA 5ADXL 4F6RC 3RYIE 3N2OA 3PU8A 5JH7E 3FHNA 3KV4A 4YJ3E 4OFZA 5FXZA 5H6QB 5L3FB 2P9BA 4U72A 3MK7C 4U74A 1Z0PA 3ZYMA 4WBNE 5EZYE 2D0UA 3LK42 5LJNA 1CUNA 1D1AA 2NW8A 2DLRA 4V1Av 4DO0A 3ZC0A 4PK5A 1S35A 4O4IE 4X20E 2HPJA 2VKDA 1FIOA 1MIWA 5FXWA 4PFOA 3B13A 2LHRA 5HXCA 2JMHA 5LHIB 4WW0A 1OXZA 4X1YE 3LBXA 4C91A 4P0AA 2VASA 4UVCB 2LM9A 3OJAA 4IE5A 1BR2A 1O3XA 4XAXB 1FMVA 2JMKA 2XQYA 2L9QA 3J7Yq 4PK4A 2CLYB 3C4WA 1IZNB 2W62A 2X67A 4QHOA 1QSDA 3DTOA 5DABA 3ETVA 4G2AA 3C4ZA 2XAFB 3K3NA 4TX5A 3JC6C 2NP9A 3CQGB 3C51A 2LOSA 3K8PC 2CA5A 3IF8B 1LVFA 5FXVA 4UV9B 2QA7A 2VL8A 1ZHCA 4EXTA 1VRBA 2DNXA 3KBTA 2LOPA 2XTLA 2W00A 2YK0A 4QWNB 2DCFA 4PJLA 5LGTB 3N9OA 1BR1A 3UT5E 2J1DG 4IE0A 3ZJ2A 3HA4A 4HFVA 1MIVA 2CXFA 1MIYA 2V7IA 3KDSE 3UUNA 3HI2A 5LJMA 2EHOD 2BVLA 3PUQA 1KK7A 3ESLA 3LBXB 3RRWA 4YHJA 1ZKEA 5CA1E 3CQCB 3MACA 2W0GA 4QXBB 1BR4A 4IHJE 2E9XA 4CXWA 3I0OA 3L09A 4TV8E 3CVRA 4UELA 5JREA 2D0TA 2WWUA 3DP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRD A;  1YD8 G;  1WR6 A;  1NAF A;  1O3X A;  2N2N A;  2N9D A;  1NWM X;  1OXZ A;  1X79 A; 
#chains in the Genus database with same CATH topology
 3ZSS A;  2JIW A;  4ZZC A;  2CE7 A;  3CWZ B;  4DBQ A;  5JDN A;  3QUJ A;  2M6B A;  5HEH A;  3ZMT B;  4HFD A;  3QNU A;  5FY7 A;  4YY3 T;  3MA9 A;  2ACX A;  1D1C A;  3ZEF B;  3AE4 A;  3AA6 B;  2Y8D A;  4L5G A;  4YTP A;  3CIR A;  5LGU B;  3N9M A;  4GKJ T;  5M4Y A;  3A7M A;  3ZLI A;  2KLQ A;  2CHO A;  2VK9 A;  4EB6 E;  4CN6 A;  4HEA A;  4HWF A;  4OYJ A;  3VRA A;  4X64 T;  2WS3 A;  3DJB A;  5ABF B;  2KSR A;  4ZS2 A;  1XDP A;  3CK6 A;  3RGL A;  4EED A;  2XY8 B;  2W4X A;  3ZCI A;  2RA1 A;  1US7 B;  4PJJ A;  4MLK A;  1FMW A;  3UTK A;  1MMN A;  2NWB A;  5HEO A;  4ZI3 C;  3M65 A;  1YQ3 A;  2WDV A;  2LSI A;  3LG7 A;  3J9X 1;  3UUM A;  5CJ5 A;  3ZN0 B;  2X0Y A;  3I9Y A;  2BG9 A;  5EK2 A;  5L3B B;  4XBF B;  2UU9 T;  4DMV A;  4AI6 A;  2CXD A;  3T1Y T;  4L0R A;  1W0A A;  4N78 D;  5AQM B;  3E0Z A;  4PJM A;  2I0M A;  2BS2 A;  2NOX A;  2BG9 C;  2L3L A;  4O4H E;  3RKO A;  3PDY A;  4YTN A;  3RQW A;  3K3O A;  4TZ4 C;  2WBL A;  1LRZ A;  1JNZ A;  3ZT5 A;  3JC6 D;  2JRK A;  2K24 A;  4YSZ A;  3FBL A;  4KI0 F;  4ZI2 C;  3AA1 B;  5JRC A;  4TV9 E;  5LG3 A;  1BR0 A;  4I0U A;  5LHH B;  3UU6 A;  1YW0 A;  2D5U A;  2IAK A;  2LRK A;  3ZMU B;  3LJC A;  4H63 H;  4HFC A;  3UU5 A;  1YKE B;  3CX8 B;  3EAB A;  4LFC T;  3RX6 A;  1WR0 A;  1UX5 A;  4CI3 B;  2WP9 A;  3LK3 B;  4UV8 B;  2HH7 A;  5HCM A;  3E22 E;  3CKD A;  4ILA A;  3UUL A;  3KV5 A;  2YIN A;  1N33 T;  1I6Z A;  4PAG A;  1MND A;  2H7O A;  3RRC A;  3E08 A;  3AE6 A;  5FXX A;  4HFH A;  4JI3 T;  3BQI A;  5HXE A;  2KND A;  1T7S A;  4A56 A;  3ZST A;  5AQN B;  2CXL A;  2VB6 A;  3RIU A;  2LSY A;  3AVS A;  4GK0 E;  5ABG A;  5L3G B;  2XAG B;  3PUZ F;  3ZT6 A;  4OYK A;  1HS7 A;  3HKE E;  3ZYK A;  4GOU A;  4ZS3 A;  3RIU C;  3LFM A;  4E7Z A;  5IYZ E;  5FNV E;  4IGU A;  3AA0 B;  1SA0 E;  4IT4 A;  4H9R C;  4C90 A;  4EYU A;  2XSB A;  5ETW A;  4YJ2 E;  4O2B E;  4HGA A;  5CFB A;  3P50 A;  4HWC A;  4IST A;  4CI1 B;  1Z8U A;  3RQU A;  2UXD T;  1OED A;  3N9P A;  3JCF A;  2Z6E A;  5HAX A;  2ZM8 A;  4B6X A;  3TLU A;  4GYS A;  3RC3 A;  3N9N A;  1NEN A;  1HG2 A;  1CHU A;  4KP3 C;  3GN5 A;  3AVR A;  4KUM B;  3UUB A;  4UIG A;  4TN7 B;  2KWI B;  2XQ8 A;  4JI0 T;  3QC9 A;  3GA8 A;  4HWD A;  4JI6 T;  1KFY A;  2VKJ A;  4O4L E;  2D2S A;  4JYA T;  3RIF A;  5TAO A;  2OLT A;  2LEH A;  2DL1 A;  3C4X A;  3UQ7 A;  4EV6 A;  1Y01 A;  1G8X A;  5GON E;  4X62 T;  3CQX C;  4FI5 A;  4QXH B;  3GN5 B;  4HTE A;  5ADX L;  4DV5 T;  4YJ3 E;  4OFZ A;  1X9B A;  2P9B A;  4DR2 T;  4DV7 T;  2IHR 1;  3ZYM A;  5EZY E;  5AQR B;  1D1A A;  2DLR A;  4DO0 A;  3FZF B;  3ZC0 A;  1S35 A;  4OX9 T;  1FIO A;  5HXC A;  4X1Y E;  2VAS A;  2XQ7 A;  1FMV A;  2XQY A;  4PK4 A;  3C4W A;  1XWM A;  4YXD A;  1HNX T;  2LLY A;  4QHO A;  3AE5 A;  4G2A A;  3FZK B;  4TX5 A;  4LML A;  2LOS A;  2CA5 A;  3IF8 B;  5FXV A;  3AEG A;  2LOP A;  3FZH B;  3ZJ2 A;  2E5L T;  2CXF A;  3KDS E;  5LJM A;  3AE1 A;  2BVL A;  1KK7 A;  4UR9 A;  3PJA A;  3MAC A;  4QXB B;  4IHJ E;  2E9X A;  3CVR A;  4AKG A;  4OHF A;  2CRB A;  4DV2 T;  3H3A A;  2MYS A;  3LSV A;  4GKK T;  2C5J A;  5LBQ B;  5LB7 B;  3TKL B;  4X66 T;  2N2N A;  5F8P A;  2VL0 A;  2X0L B;  2UXB T;  2E9X C;  2XJ7 A;  2H88 A;  4XZC A;  4MFR A;  4Q25 A;  4ILB A;  2R6G F;  2PTF A;  5LCY A;  4MBQ A;  2X68 A;  5HXH A;  2KIN B;  4HKA A;  2V1D B;  2HN2 A;  5A1L A;  1W0B A;  2LT3 A;  4UEM A;  1UX4 A;  5JVD E;  4F8H A;  3ZT7 A;  5AQH B;  2IIU A;  3AEF A;  2BBH A;  5LP6 E;  5KDM C;  2G0U A;  5AQV B;  2V5D A;  2UUA T;  1IBM T;  2YN6 A;  4P1N A;  1LKX A;  3MZK B;  3R6N A;  4IL9 A;  3PUY F;  4YT0 A;  4CN4 A;  2FUP A;  3OPC A;  1WCR A;  4DR3 T;  2Q9Q B;  4OK0 A;  1JNR A;  2E2A A;  3PTR B;  4QXC B;  3K1S A;  3RH3 A;  3ZMS B;  3RIA A;  5FP3 A;  2V26 A;  2K3W A;  2YKS A;  3ZMZ B;  3EDU A;  5AQJ B;  4PW8 A;  3P4Q A;  5CB4 E;  5JDH A;  4HN9 A;  2CWY A;  4QH1 A;  2DI4 A;  5L47 A;  5F5W A;  3VKG A;  4O2A E;  3AE8 A;  4NUV A;  3FB2 A;  5HXR A;  2ZM6 T;  3K3Q C;  2MBG A;  1T8B A;  2KMF A;  5HWY A;  4B3R T;  4NPP A;  1E7P A;  2VKH A;  3GWH A;  3QOF A;  5L4E A;  4DR5 T;  2ES0 A;  4NXM T;  4LF5 T;  3WAJ A;  3I9W A;  4PJN A;  2BVM A;  4YLH A;  4TWF A;  5JDF A;  3MKD A;  2J62 A;  4CQI A;  2MTQ A;  4AKL A;  2M67 A;  5ABF A;  3PUV F;  5FYM A;  5J1G A;  4PNI A;  2C5I T;  4UF0 A;  3KIN B;  4KX6 A;  4P09 A;  2W61 A;  1WRD A;  5HEG A;  4AQF A;  4LF7 T;  1I94 T;  4JI4 T;  3I1A A;  4U2Y A;  1HF8 A;  2F4V T;  1NWM X;  3FXD B;  1G73 A;  2V6Y A;  3AAI A;  2CPT A;  2SPC A;  3H37 A;  5HCJ A;  4JBW F;  1HNW T;  3PU3 A;  4AKH A;  4AQF C;  4QX8 B;  3V5S A;  3ZPO A;  2N1G A;  2KT9 A;  3A8Y C;  4A97 A;  3ZMV B;  1U4Q A;  4QH5 A;  2NR4 A;  4TUY E;  4UF0 B;  1MMD A;  4EOZ B;  4IE6 A;  3NRX A;  5L3D B;  5AQT B;  3O4X E;  1VCS A;  1NEK A;  5HYA A;  1W09 A;  3JAF A;  3KBU A;  3QB5 K;  2LHN A;  1IAP A;  2V6Y B;  4CZZ B;  2PG8 A;  4M1P A;  3WAK A;  1D0Y A;  5FY1 A;  4MAL A;  5DJQ C;  2XAJ B;  1N34 T;  2XZE A;  4ERR A;  2WSS V;  5L3C B;  3N9L A;  5KX5 E;  3P4W A;  4B3M T;  3Q5D A;  3RHW A;  5J2T E;  3HKC E;  1YXR A;  2K5B B;  2UXC T;  1KEY A;  3C50 A;  3SS1 A;  2V5C A;  3D0T A;  3MJX A;  2NW9 A;  3Q5W A;  2XHE B;  4X1I E;  1X79 A;  2QVA A;  3VKH A;  1ZEE A;  3Q2M A;  2JQH A;  3O1H A;  4CI2 B;  2BS4 A;  4EGW A;  2VQE T;  5C2T A;  4BJM A;  2FBW A;  1HCI A;  4LF9 T;  4J2C A;  5LA6 E;  3OBV E;  3SWH A;  2WMN A;  4LF8 T;  3VR8 A;  2V7M A;  4FJO A;  3FBZ A;  3BQL A;  3EI0 A;  2I6H A;  5AQK B;  4K0U A;  4AIS A;  1GQE A;  3NRY A;  4P0B A;  3L3P A;  2LM2 A;  4ANJ A;  4JI1 T;  5FL1 A;  3VU7 H;  4LF6 T;  4I55 E;  1D0Z A;  3RI5 A;  3X1D A;  4AQG A;  2W67 A;  1R8I A;  2KXP B;  5ABE A;  5J2U E;  3L39 A;  2H3R A;  4I4T E;  4DV0 T;  4GIW A;  3AE2 A;  2C0S A;  3PJA J;  2XQ4 A;  3KVA A;  2A2F X;  3ZCJ A;  5KXJ A;  2X9X A;  3AED A;  5F3J A;  3N2O A;  2XM1 A;  3L8R A;  1E2A A;  3FHN A;  4U72 A;  1Z0P A;  3LK4 2;  1ZOY A;  2JQK A;  2QRX A;  4IDO A;  3M3Z B;  2E5V A;  3TLT A;  4PK5 A;  3B13 A;  2JMH A;  3NWI A;  4C91 A;  2IDO B;  2LM9 A;  2L9Q A;  3J7Y q;  1KNP A;  2X67 A;  3DTO A;  1XZY A;  3C4Z A;  2XAF B;  3K3N A;  3UU8 A;  1UGO A;  3JC6 C;  3C51 A;  3PV0 F;  2BG9 E;  1ZHC A;  2VVN A;  2XTL A;  4A98 A;  2W00 A;  2VQF T;  5LGT B;  2AE9 A;  2J1D G;  4HFV A;  1MIV A;  3OVU A;  1MIY A;  1J5W A;  3H3M A;  3HI2 A;  2EHO D;  3PUQ A;  3ESL A;  3NVO A;  3UU4 A;  1ZKE A;  5CA1 E;  2W0G A;  3I0O A;  5JRE A;  3FXE B;  3DP7 A;  4PK6 A;  3RYF E;  3QB5 A;  4PFP A;  5LOV E;  4H9P C;  4BA9 A;  3O1I A;  3V5U A;  1HFA A;  4A5X A;  2ODU A;  4EYY R;  2XQ6 A;  5FVL A;  2K9A A;  5LXT E;  1OED C;  4ZEY A;  4B3T T;  4Z90 A;  4I50 E;  3CML A;  4U2Z A;  1VOM A;  3I0Q A;  4BAY B;  2WU5 A;  4DR7 T;  3TLS A;  5EK4 A;  2ODV A;  2H89 A;  2CCQ A;  3OYZ A;  2LKH A;  5AQI B;  1MMG A;  4Z8X A;  3UUX B;  3IEE A;  3VRB A;  3P4S A;  4GYR A;  4TNV A;  2PBI A;  3AEE A;  2CMR A;  1AJ3 A;  3ZYL A;  2IC9 A;  3AB3 B;  4JI2 T;  2WU2 A;  5AQQ B;  3N5L A;  3HL6 A;  3ONL C;  3SOL A;  2W66 A;  4LMJ A;  4TNW A;  2B76 A;  3NZP A;  5JDQ A;  1MMA A;  4E7S A;  5JR9 B;  2NTY A;  2IW5 B;  2X66 A;  2C5K T;  4L9I A;  4AIU A;  4ILU A;  5C8Y E;  2Q9Q D;  2EHO A;  5EK3 A;  4ADZ A;  4WNK A;  3UQ4 A;  4LFA T;  3BK9 A;  4DV1 T;  4H9N C;  3O9X A;  5LBM A;  2BDE A;  2V8S V;  1ZP0 A;  2WM9 A;  5LNK A;  3N2G E;  3IBP A;  4CN1 A;  5AQS B;  2XAH B;  1QUU A;  2I59 A;  3PUX F;  4Z91 A;  4DBR A;  1U5P A;  4EZ4 A;  3CPZ A;  4JEU B;  2EHO B;  5JTG A;  2E8I A;  4JV5 T;  4UVB B;  2A3D A;  3S4U A;  2Y6X A;  2L8K A;  3GMI A;  4DMW A;  4B3S T;  5LG4 A;  4X5T A;  2X0H A;  2ZM2 A;  4JI7 T;  1M62 A;  3P4P A;  4IDP A;  4X1K E;  1IBL T;  2CBJ A;  5ABH A;  2ACZ A;  3B5M A;  3R84 B;  4IE7 A;  4G63 A;  3C64 A;  2YU1 A;  4ZXL A;  4U3C A;  2Q9Q A;  2FJE A;  4DVD A;  2VWA A;  3AEA A;  1EZ3 A;  1QLB A;  2LJL A;  1KNZ A;  1YD8 G;  1L0V A;  4U7Y A;  3KFW X;  5FL0 A;  3ZN1 B;  3KV6 A;  5DQW A;  1N32 T;  2DHR A;  3LDQ B;  2Q9Q C;  2CLY C;  5H6R B;  2MAW A;  4YFS A;  5IWA T;  1FEW A;  1VCT A;  4EAH A;  4ASK A;  1MNE A;  2A9U A;  2XUE A;  4CXY A;  4DUY T;  2VUR A;  3AE3 A;  3T1H T;  2HPL A;  1XDO A;  5J0Z A;  4H9Q C;  3ONX A;  5JDL A;  4IDN A;  4HWH A;  1HX8 A;  4JLE A;  3ONJ A;  3RPU A;  3ZC1 A;  4DV4 T;  4ZI3 D;  2XAQ B;  3KV9 A;  2MPK A;  2YU2 A;  2X9Y A;  2WQY A;  5CA0 E;  1H7C A;  3ZJ1 A;  1V9D A;  3ZKR A;  4UVA B;  3PUS A;  3ANW A;  4IL4 A;  5L4H A;  5JDM A;  2YOE A;  2XQ5 A;  4HE8 A;  2XPK A;  5FVK A;  4WBO A;  2LSJ A;  3AE9 A;  2ZM0 A;  2YDQ A;  2W63 A;  1HR0 T;  3KVB A;  4QKN A;  4LMK A;  3F57 A;  4KHP T;  3PUR A;  2Y48 B;  2UUC T;  3C98 B;  4ZHQ E;  4TWD A;  2YDR A;  2LE8 A;  3ANW B;  2N9D A;  4NXN T;  3B57 A;  5LHG B;  5FKY A;  4ZI2 D;  4ZI7 E;  4H63 V;  2BS3 A;  5AQG B;  4JEH B;  3AAE B;  5JQG E;  3WI3 A;  2XQA A;  4JI8 T;  2DWK A;  2LSK A;  5FMN A;  4MHC A;  1WLX A;  3FZL B;  2FJA A;  3CX6 B;  4UXN B;  1B7T A;  5LMU T;  3PU8 A;  5JH7 E;  4DR1 T;  3KV4 A;  1UUR A;  3MK7 C;  4U74 A;  1SUM B;  1N36 T;  5LJN A;  4LF4 T;  1CUN A;  2NW8 A;  4O4I E;  4X20 E;  5FXW A;  4PFO A;  2LHR A;  1YQ4 A;  5LHI B;  3LBX A;  4P0A A;  4HWI B;  3OJA A;  1BR2 A;  5LMN T;  1UK5 A;  1IZN B;  2W62 A;  4U7I A;  2WY2 A;  5C3J A;  2NP9 A;  2OV9 A;  3K8P C;  4JI5 T;  2QA7 A;  4EXT A;  2J4G A;  2YK0 A;  4QWN B;  2DCF A;  4PJL A;  3N9O A;  1BR1 A;  3UT5 E;  3HA4 A;  2LRL A;  2V7I A;  3UUN A;  5CGM A;  3LBX B;  2BKP A;  3RRW A;  4YHJ A;  4U33 A;  3CQC B;  3PUW F;  4TV8 E;  4UEL A;  2WWU A;  2BG9 B;  3EUH A;  2ZMA A;  2VVS A;  3OKQ A;  1IBK T;  1YKH B;  2FJB A;  4GK5 E;  4H9S E;  2GK9 A;  4DUZ T;  2HN1 A;  2OA5 A;  2WAU A;  2YEV C;  4U31 A;  1M7K A;  2NTX A;  3SFD A;  1WFD A;  2KWH A;  3PE0 A;  3VHL A;  4BJN A;  4KMC A;  3F31 A;  1W9R A;  1UUS A;  2JQQ A;  3EAM A;  4WYV A;  1ZV4 X;  4CXX A;  3ETU A;  4EZH A;  5JDG A;  3JAE A;  5JRC B;  3CX7 B;  2YDS A;  2WZI A;  4HFB A;  2WMO A;  1SE7 A;  2B1E A;  2V7K A;  1D0X A;  4COF A;  3JAD A;  1OWA A;  2QGS A;  2XQ3 A;  3TLW A;  2BKN A;  4HFI A;  3U78 A;  1SHZ C;  4DND A;  1IJ5 A;  3UU3 A;  5DQV A;  4DV3 T;  3SFE A;  3UFG A;  3EDV A;  5L2L A;  2IML A;  2X9W A;  1XNR T;  3FZM B;  2JPF A;  3N9Q A;  2JQ9 A;  3IA3 A;  2M6I A;  2RP4 A;  4EEB A;  4IE4 A;  5LYJ E;  2LSG A;  5HWX A;  1IJ6 A;  2KZ7 B;  5FY0 A;  2LKG A;  2WZH A;  2H7V C;  4AQY T;  4X65 T;  4KBM B;  3F2E A;  5LGN B;  5KMG P;  2WCA A;  2BZB A;  3Q5E A;  3HR0 A;  3RKG A;  3EHZ A;  4IRE A;  2J47 A;  2CWO A;  5HEU A;  2XM2 A;  4ZOL E;  4K0K T;  4QX7 B;  3T8O A;  2CBI A;  1HG5 A;  4AXP A;  3NKZ A;  4DID B;  5JR9 A;  2V6X A;  4HFE A;  5BMV E;  1WR6 A;  3RF1 A;  3IHR A;  3U3I A;  4IDZ A;  2WB5 A;  4QH4 A;  5AFU L;  3AEC A;  5HXS A;  1UCU A;  1FJG T;  1OED B;  5JR9 C;  2E9X D;  3P4R A;  4O4J E;  3LK2 B;  4ILC A;  2X51 A;  1Y64 B;  1D1B A;  3P7I A;  4O8S A;  3Q5X A;  4IIJ E;  5E0O A;  4DR4 T;  5BR8 T;  2IUB A;  4DR6 T;  3TLV A;  2CHN A;  4LFB T;  2JJ9 A;  4NUU A;  3VR9 A;  2CM0 A;  2K48 A;  1E1H B;  1HX1 B;  3O1J A;  2D9D A;  3NBX X;  4KHZ F;  2UXN B;  1XMO T;  3P8C D;  3OYX A;  4YSY A;  4DV6 T;  4JUY A;  3BQK A;  3AAA B;  3MXZ A;  2DWG A;  2EHO C;  4I43 B;  1WYC A;  1T72 A;  1WYB A;  4ISS A;  2PJQ A;  2UXX B;  3HKB E;  3EVY A;  3AXJ A;  3SRZ A;  2W2U A;  4EIW A;  4YSX A;  2HHH T;  3W15 B;  3AA7 B;  3A5X A;  1T98 A;  1J5E T;  2V7J A;  2ZLY A;  5L3E B;  1HTJ F;  4ZZB A;  2NW7 A;  1LVK A;  4NIQ A;  3AE7 A;  2MOZ A;  3HKD E;  5AQP B;  2PFV A;  1KF6 A;  3RYH E;  3RYC E;  3ABV A;  3RC8 A;  5AQO B;  1OED E;  2V7L A;  5IHY A;  4AKR B;  4AKI A;  3AXJ B;  3NZQ A;  2IC6 A;  2BBJ A;  3PUG A;  3N2K E;  2VKO A;  2A72 A;  5IUX A;  4H9O C;  3RLF F;  5AQU B;  2X9H A;  2XAS B;  1NAF A;  1S94 A;  2QYW A;  2E9X B;  2CEA A;  3Q9D A;  3QK6 A;  1KNR A;  3PUA A;  4TWH A;  3UFE A;  4F6R C;  3RYI E;  1J1J A;  5FXZ A;  5H6Q B;  5L3F B;  4WBN E;  2D0U A;  5AQF B;  3AEB A;  2BKO A;  3G06 A;  4V1A v;  1XNQ T;  2XQ9 A;  4YTM A;  2HPJ A;  2VKD A;  5AQL B;  1MIW A;  1XMQ T;  2UUB T;  4WW0 A;  1OXZ A;  4UVC B;  2AXD S;  4IE5 A;  1O3X A;  4XAX B;  1HNZ T;  2JMK A;  2CLY B;  1QSD A;  5DAB A;  2WWV A;  3ETV A;  4IDQ A;  2RPA A;  2WDR A;  3CQG B;  4WZX A;  1LVF A;  1DU2 A;  4UV9 B;  2VL8 A;  1VRB A;  2DNX A;  3KBT A;  4YHH T;  4IE0 A;  3OTO T;  2FJD A;  5HEJ A;  2WDQ A;  2XSA A;  1BR4 A;  4CXW A;  3L09 A;  2D0T A; 
#chains in the Genus database with same CATH homology
 4PK6 A;  3RYF E;  3EUH A;  2ZMA A;  4PFP A;  5LOV E;  4AKG A;  4H9P C;  4OHF A;  2CE7 A;  3OKQ A;  4BA9 A;  3CWZ B;  4DBQ A;  5JDN A;  3O1I A;  3QUJ A;  3V5U A;  1HFA A;  1YKH B;  2ODU A;  2MYS A;  3H3A A;  4EYY R;  4GK5 E;  4H9S E;  2GK9 A;  2K9A A;  5LXT E;  2C5J A;  5LBQ B;  3TKL B;  4I50 E;  2N2N A;  2OA5 A;  3CML A;  1VOM A;  3I0Q A;  3ZMT B;  5F8P A;  4BAY B;  2X0L B;  2WAU A;  2YEV C;  2E9X C;  4XZC A;  5EK4 A;  2ODV A;  5FY7 A;  2CCQ A;  3MA9 A;  4MFR A;  2NTX A;  2ACX A;  3OYZ A;  1D1C A;  5LCY A;  1MMG A;  4Z8X A;  3UUX B;  3IEE A;  3ZEF B;  4GYR A;  4MBQ A;  3AA6 B;  2KWH A;  2PBI A;  3PE0 A;  3VHL A;  2Y8D A;  2X68 A;  4BJN A;  5HXH A;  4KMC A;  4L5G A;  2KIN B;  2CMR A;  5LGU B;  3F31 A;  3N9M A;  4HKA A;  2V1D B;  5M4Y A;  2JQQ A;  1AJ3 A;  3ZLI A;  3ZYL A;  2IC9 A;  2KLQ A;  5A1L A;  3AB3 B;  1ZV4 X;  2LT3 A;  4CXX A;  4UEM A;  3ETU A;  4EZH A;  5JDG A;  1UX4 A;  5JVD E;  5JRC B;  2VK9 A;  3CX7 B;  4EB6 E;  4HEA A;  4OYJ A;  3N5L A;  3HL6 A;  2WMO A;  3DJB A;  2B1E A;  3SOL A;  2V7K A;  1D0X A;  4ZS2 A;  1OWA A;  2QGS A;  5LP6 E;  5KDM C;  3NZP A;  2G0U A;  1MMA A;  5JDQ A;  3U78 A;  4E7S A;  5JR9 B;  3ZCI A;  2NTY A;  1SHZ C;  1US7 B;  2RA1 A;  4PJJ A;  4DND A;  1IJ5 A;  4MLK A;  5DQV A;  2IW5 B;  1LKX A;  2X66 A;  3MZK B;  1FMW A;  3R6N A;  3UTK A;  1MMN A;  2C5K T;  2NWB A;  4L9I A;  4ZI3 C;  4ILU A;  5C8Y E;  2Q9Q D;  3M65 A;  2EHO A;  2LSI A;  3LG7 A;  3J9X 1;  5EK3 A;  3UUM A;  4ADZ A;  4WNK A;  2Q9Q B;  3EDV A;  3ZN0 B;  5L2L A;  2X9W A;  4OK0 A;  3I9Y A;  2JPF A;  3N9Q A;  3PTR B;  5EK2 A;  4QXC B;  5L3B B;  3BK9 A;  3RH3 A;  2RP4 A;  4XBF B;  3ZMS B;  4H9N C;  5FP3 A;  3O9X A;  5LBM A;  2BDE A;  4DMV A;  4AI6 A;  2V26 A;  4IE4 A;  2CXD A;  5LYJ E;  2WM9 A;  3ZMZ B;  2LSG A;  4L0R A;  5LNK A;  3EDU A;  3IBP A;  3N2G E;  4N78 D;  2XAH B;  4PW8 A;  5HWX A;  1IJ6 A;  1QUU A;  2KZ7 B;  3E0Z A;  4PJM A;  5CB4 E;  5JDH A;  5FY0 A;  4HN9 A;  2CWY A;  2I59 A;  2NOX A;  2L3L A;  4O4H E;  3RKO A;  2H7V C;  2DI4 A;  3PDY A;  4DBR A;  1U5P A;  4EZ4 A;  3CPZ A;  4JEU B;  3VKG A;  3K3O A;  2EHO B;  4O2A E;  4TZ4 C;  4NUV A;  3FB2 A;  2E8I A;  5HXR A;  2WBL A;  3K3Q C;  4KBM B;  2MBG A;  2KMF A;  5HWY A;  1LRZ A;  4UVB B;  3JC6 D;  2A3D A;  2VKH A;  3GWH A;  3F2E A;  2JRK A;  3S4U A;  2K24 A;  5LGN B;  2ES0 A;  3FBL A;  2Y6X A;  2L8K A;  5KMG P;  2BZB A;  4ZI2 C;  3WAJ A;  3GMI A;  3AA1 B;  4DMW A;  5JRC A;  3HR0 A;  3I9W A;  4PJN A;  4TV9 E;  5LG4 A;  1BR0 A;  2BVM A;  2CWO A;  4YLH A;  4ZOL E;  5JDF A;  5LHH B;  3MKD A;  4CQI A;  1YW0 A;  2MTQ A;  2D5U A;  4AKL A;  2ZM2 A;  2M67 A;  4QX7 B;  5FYM A;  2IAK A;  5J1G A;  3T8O A;  4PNI A;  2C5I T;  4UF0 A;  1HG5 A;  3KIN B;  4AXP A;  4P09 A;  2W61 A;  1WRD A;  4AQF A;  3ZMU B;  3LJC A;  4X1K E;  5JR9 A;  5BMV E;  3I1A A;  4H63 H;  1YKE B;  1WR6 A;  3CX8 B;  1HF8 A;  1NWM X;  3IHR A;  3U3I A;  3FXD B;  1G73 A;  3R84 B;  4IE7 A;  4G63 A;  3AAI A;  4IDZ A;  3C64 A;  2SPC A;  2YU1 A;  3RX6 A;  3H37 A;  2Q9Q A;  1UX5 A;  4CI3 B;  5AFU L;  5HXS A;  3LK3 B;  4DVD A;  2VWA A;  3PU3 A;  4AKH A;  1UCU A;  4UV8 B;  2HH7 A;  4AQF C;  1EZ3 A;  4QX8 B;  3V5S A;  3ZPO A;  5JR9 C;  3E22 E;  2LJL A;  2N1G A;  3CKD A;  2E9X D;  2KT9 A;  4O4J E;  3UUL A;  3ZMV B;  1U4Q A;  3LK2 B;  1KNZ A;  1YD8 G;  3KFW X;  2X51 A;  3ZN1 B;  1Y64 B;  3KV6 A;  4TUY E;  3KV5 A;  4UF0 B;  2YIN A;  5DQW A;  1MMD A;  1D1B A;  3P7I A;  4O8S A;  4EOZ B;  3Q5X A;  4IIJ E;  3NRX A;  4IE6 A;  2DHR A;  4PAG A;  5E0O A;  5L3D B;  1MND A;  2Q9Q C;  2CLY C;  2H7O A;  3O4X E;  3RRC A;  5HYA A;  5H6R B;  3E08 A;  5FXX A;  4YFS A;  3BQI A;  3KBU A;  1FEW A;  2KND A;  2LHN A;  5HXE A;  4EAH A;  1IAP A;  4CZZ B;  2PG8 A;  4M1P A;  4ASK A;  4A56 A;  3WAK A;  1D0Y A;  1MNE A;  2JJ9 A;  4NUU A;  2CM0 A;  2K48 A;  1E1H B;  2CXL A;  3O1J A;  2XUE A;  4MAL A;  5FY1 A;  2VB6 A;  5DJQ C;  4CXY A;  3NBX X;  2LSY A;  2XAJ B;  2UXN B;  3AVS A;  4GK0 E;  3P8C D;  4ERR A;  3OYX A;  2WSS V;  5L3C B;  3N9L A;  2HPL A;  5KX5 E;  5L3G B;  2XAG B;  5J2T E;  4H9Q C;  3HKC E;  4JUY A;  3BQK A;  3ONX A;  5JDL A;  3AAA B;  2K5B B;  4OYK A;  1HS7 A;  3HKE E;  1HX8 A;  3MXZ A;  2DWG A;  4JLE A;  2EHO C;  4I43 B;  3ZYK A;  1WYC A;  4GOU A;  3RPU A;  3ZC1 A;  1WYB A;  4ISS A;  4ZS3 A;  4ZI3 D;  2XAQ B;  3C50 A;  2PJQ A;  3KV9 A;  3LFM A;  3SS1 A;  4E7Z A;  5IYZ E;  2UXX B;  2YU2 A;  5FNV E;  2X9Y A;  4IGU A;  3AA0 B;  3D0T A;  3HKB E;  3EVY A;  5CA0 E;  3MJX A;  2NW9 A;  1H7C A;  3SRZ A;  3Q5W A;  2XHE B;  4X1I E;  1SA0 E;  3ZJ1 A;  4EIW A;  1V9D A;  4UVA B;  4H9R C;  3PUS A;  3ANW A;  3W15 B;  4C90 A;  3AA7 B;  4EYU A;  3A5X A;  1X79 A;  1T98 A;  5ETW A;  2V7J A;  4YJ2 E;  4O2B E;  4HGA A;  3VKH A;  2ZLY A;  5L3E B;  1HTJ F;  5JDM A;  2NW7 A;  4HE8 A;  1ZEE A;  3Q2M A;  1LVK A;  3O1H A;  4IST A;  4CI2 B;  4CI1 B;  4BJM A;  4WBO A;  1HCI A;  2LSJ A;  2ZM0 A;  4J2C A;  5LA6 E;  3N9P A;  3OBV E;  2MOZ A;  3HKD E;  3SWH A;  2W63 A;  2WMN A;  2V7M A;  2PFV A;  4FJO A;  3KVB A;  3FBZ A;  3BQL A;  2Z6E A;  5HAX A;  3RYH E;  2ZM8 A;  4B6X A;  4GYS A;  4QKN A;  3RYC E;  3RC8 A;  3F57 A;  3RC3 A;  4K0U A;  3N9N A;  2V7L A;  3PUR A;  5IHY A;  3NRY A;  2Y48 B;  4P0B A;  3C98 B;  4ZHQ E;  4AKR B;  3L3P A;  1HG2 A;  4AKI A;  4KP3 C;  3GN5 A;  3AVR A;  4KUM B;  4ANJ A;  3NZQ A;  4UIG A;  4TN7 B;  2KWI B;  2LE8 A;  2N9D A;  3ANW B;  3B57 A;  5LHG B;  3QC9 A;  2IC6 A;  3VU7 H;  3GA8 A;  4ZI2 D;  4ZI7 E;  4H63 V;  3PUG A;  4I55 E;  1D0Z A;  2VKJ A;  3N2K E;  2VKO A;  4JEH B;  2A72 A;  4AQG A;  3AAE B;  4O4L E;  2D2S A;  4H9O C;  2X9H A;  2XAS B;  1NAF A;  5TAO A;  5JQG E;  1S94 A;  2LEH A;  3WI3 A;  2KXP B;  2DWK A;  2LSK A;  3C4X A;  5J2U E;  2E9X B;  5FMN A;  4MHC A;  1WLX A;  2H3R A;  4I4T E;  2CEA A;  3Q9D A;  3QK6 A;  1G8X A;  4GIW A;  5GON E;  3PUA A;  2C0S A;  3CX6 B;  3KVA A;  4UXN B;  3UFE A;  2A2F X;  3CQX C;  3ZCJ A;  4FI5 A;  4QXH B;  2X9X A;  3FXE B;  1B7T A;  3GN5 B;  5F3J A;  4HTE A;  5ADX L;  4F6R C;  3RYI E;  3N2O A;  3PU8 A;  5JH7 E;  3FHN A;  3KV4 A;  4YJ3 E;  4OFZ A;  5FXZ A;  5H6Q B;  5L3F B;  2P9B A;  4U72 A;  3MK7 C;  4U74 A;  1Z0P A;  3ZYM A;  4WBN E;  5EZY E;  2D0U A;  3LK4 2;  5LJN A;  1CUN A;  1D1A A;  2NW8 A;  2DLR A;  4V1A v;  4DO0 A;  3ZC0 A;  4PK5 A;  1S35 A;  4O4I E;  4X20 E;  2HPJ A;  2VKD A;  1FIO A;  1MIW A;  5FXW A;  4PFO A;  3B13 A;  2LHR A;  5HXC A;  2JMH A;  5LHI B;  4WW0 A;  1OXZ A;  4X1Y E;  3LBX A;  4C91 A;  4P0A A;  2VAS A;  4UVC B;  2LM9 A;  3OJA A;  4IE5 A;  1BR2 A;  1O3X A;  4XAX B;  1FMV A;  2JMK A;  2XQY A;  2L9Q A;  3J7Y q;  4PK4 A;  2CLY B;  3C4W A;  1IZN B;  2W62 A;  2X67 A;  4QHO A;  1QSD A;  3DTO A;  5DAB A;  3ETV A;  4G2A A;  3C4Z A;  2XAF B;  3K3N A;  4TX5 A;  3JC6 C;  2NP9 A;  3CQG B;  3C51 A;  2LOS A;  3K8P C;  2CA5 A;  3IF8 B;  1LVF A;  5FXV A;  4UV9 B;  2QA7 A;  2VL8 A;  1ZHC A;  4EXT A;  1VRB A;  2DNX A;  3KBT A;  2LOP A;  2XTL A;  2W00 A;  2YK0 A;  4QWN B;  2DCF A;  4PJL A;  5LGT B;  3N9O A;  1BR1 A;  3UT5 E;  2J1D G;  4IE0 A;  3ZJ2 A;  3HA4 A;  4HFV A;  1MIV A;  2CXF A;  1MIY A;  2V7I A;  3KDS E;  3UUN A;  3HI2 A;  5LJM A;  2EHO D;  2BVL A;  3PUQ A;  1KK7 A;  3ESL A;  3LBX B;  3RRW A;  4YHJ A;  1ZKE A;  5CA1 E;  3CQC B;  3MAC A;  2W0G A;  4QXB B;  1BR4 A;  4IHJ E;  2E9X A;  4CXW A;  3I0O A;  3L09 A;  4TV8 E;  3CVR A;  4UEL A;  5JRE A;  2D0T A;  2WWU A;  3DP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...