2N9DA

Structure analysis of the tom1 gat domain reveals distinct ligand-specific conformational states
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the GAT domain of the endosomal adapter protein Tom1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Target of Myb protein 1
total genus 38
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n9dA00
2N2NA 1NWMX 1WRDA 1WR6A 1YD8G 1NAFA 1OXZA 2N9DA 1X79A 1O3XA
chains in the Genus database with same CATH superfamily
3UU5A 3QB5K 1G73A 2C5JA 3ABVA 4GYSA 4EEDA 4ZZBA 4DR5T 4UR9A 2MTQA 1KK7A 2VKDA 3QOFA 4JBWF 2KNDA 3EDUA 3LFMA 3J9X1 3UT5E 5JTGA 1NEKA 2NW7A 2QVAA 3OYXA 2LSGA 5HEHA 2HH7A 3N9MA 2LE8A 3QB5A 2CCQA 4ZHQE 2IAKA 1J5WA 2BKPA 2Y6XA 3FZLB 3KDSE 5LBQB 2J1DG 5F3JA 5DABA 3PUWF 3RIUC 5IUXA 2PFVA 5FVKA 3ZYLA 2VB6A 5LGTB 3PE0A 5FXVA 3ZT7A 2LHRA 4IDZA 2V26A 4U7YA 4EEBA 2QYWA 2WDQA 1BR4A 2BS4A 1KNPA 3ANWA 4DUYT 5JDMA 1CUNA 2PJQA 4HFIA 3AXJB 2WB5A 1HNZT 3CPZA 4ILCA 5HYAA 3N2GE 4HKAA 5LG4A 1NAFA 1UURA 5AQKB 4FI5A 3C4ZA 3RQUA 3AE9A 3IA3A 4IE5A 3AEBA 3ZKRA 2LKGA 1GQEA 4J2CA 4ZS3A 3RYHE 1J1JA 4KMCA 3LBXA 4Z90A 3RQWA 5J2UE 1WR0A 3D0TA 2IDOB 3L3PA 1T98A 2KWHA 5HEOA 4TV8E 3LBXB 3UUBA 2H89A 5DQWA 3CX7B 4X1KE 5F8PA 4PJLA 3RYCE 1MIVA 1N32T 2X66A 5EK2A 5DQVA 2QA7A 2JPFA 1HFAA 3E0ZA 3FHNA 3B57A 5AQNB 2E9XC 3N2OA 2JRKA 5AQQB 5JR9B 5JDHA 2I6HA 2LOSA 2W66A 5L3FB 4AQYT 2BVLA 4JYAT 2XM2A 4IDPA 4IIJE 2X0LB 2L9QA 2YOEA 3OYZA 2XJ7A 3L39A 4U7IA 2G0UA 2MPKA 3EVYA 2ZM6T 2V7LA 4IGUA 4LFAT 2HN1A 2VK9A 4HN9A 4JUYA 4ZI2C 3T1YT 2DCFA 1HG2A 1WYBA 2VKJA 5AQOB 1YKEB 2CWOA 2V7IA 5H6QB 4LF4T 2JMKA 3RF1A 3HKDE 5H6RB 5HXRA 3K3OA 3SOLA 5J1GA 4U72A 5J2TE 1NENA 2CE7A 3EUHA 3P4WA 3T1HT 3ZMSB 2UXXB 1UGOA 2PG8A 2NP9A 5IWAT 5FMNA 4TNWA 5L3BB 2LOPA 3JAFA 3FZKB 5LBMA 3RC3A 1E7PA 1IBKT 2E5LT 1N36T 3SFDA 4LMLA 3V5SA 3PJAA 1LRZA 2DNXA 1HG5A 2WMNA 5AQLB 1T8BA 5EK4A 4JI8T 5HXSA 2VQET 4UEMA 3QNUA 2X9HA 3RH3A 2XAGB 4EAHA 2UU9T 1T72A 1WYCA 2WU2A 3T8OA 1ZP0A 4C91A 4LF7T 3K8PC 3BQKA 3CQCB 2LSIA 2YN6A 2ZM8A 2LEHA 4ISTA 2X0HA 4IT4A 4HWFA 4AQFC 5AFUL 2R6GF 4IE0A 4HFDA 3UU3A 3J7Yq 2CEAA 4HFVA 5CGMA 2RPAA 5J0ZA 4QH5A 2M6BA 1YW0A 2XASB 2Z6EA 4ISSA 1HX8A 2E2AA 3IF8B 3R6NA 4TV9E 2ZM0A 2NW8A 4H63H 4DV7T 3PUQA 3O9XA 2XPKA 3SRZA 3O1IA 5LYJE 3EABA 5KMGP 2XZEA 4PK6A 5LGNB 5L2LA 1BR2A 2W2UA 4IDQA 2E9XB 1UX4A 5JR9C 2P9BA 2XAJB 3I1AA 3ZSSA 3NVOA 4JI0T 3RI5A 4H9NC 4JV5T 1VCTA 3ZN0B 4LFBT 2DWKA 2E9XA 3FZMB 3LDQB 3OBVE 4ILBA 4B6XA 4BA9A 4HWCA 3ZJ2A 5HCMA 5AQMB 3SWHA 2BG9A 3BQIA 5LHIB 1YKHB 2K48A 5HXEA 2IIUA 2XQYA 4OX9T 3E22E 3O1JA 4YFSA 3ZYMA 2YKSA 4MALA 4NIQA 1XDOA 3Q2MA 2CBIA 2EHOC 2Q9QC 1BR0A 1D0XA 1KNRA 4JEHB 5L4HA 5JREA 3FB2A 3WAKA 4EV6A 5M4YA 3X1DA 2BBHA 2AE9A 2E5VA 1KEYA 1O3XA 3NZQA 3RIAA 4O4JE 4TNVA 3MK7C 3HA4A 5JVDE 4TWHA 4PJMA 4XBFB 1ZV4X 4XZCA 4YT0A 4BJMA 3U3IA 2DL1A 2F4VT 5LNKA 2WWVA 1HS7A 1ZKEA 3RIUA 3Q9DA 2YEVC 2LLYA 2W4XA 4K0UA 5ABEA 4HFBA 5LP6E 1SA0E 4GK5E 2HHHT 2V6YB 1OEDC 5JDQA 1UCUA 4GK0E 5LG3A 2DHRA 2BDEA 4DV2T 5GONE 4JI5T 2HN2A 1U4QA 2FBWA 2WS3A 3OJAA 4IL9A 5FY1A 4YSZA 4JEUB 5LB7B 1Y01A 4UVBB 1W9RA 3F57A 4I55E 2VQFT 1N33T 3CX6B 4DMVA 1OEDA 4M1PA 5LMUT 3C51A 3Q5XA 3PTRB 2UXBT 3UQ4A 4PJJA 4DVDA 4G63A 2WDVA 3KVBA 5LXTE 2XQ7A 2QGSA 3HKEE 3HKBE 4DIDB 2X9XA 3UUMA 4UV8B 2D2SA 3AE4A 1HNXT 4LF6T 3AE8A 4AKLA 4L5GA 4CN1A 3JADA 5LHGB 4DR6T 2DI4A 1KF6A 2XM1A 5AQPB 5JH7E 3RIFA 5ABFA 4DV4T 4GKJT 2ODUA 5JRCA 2CHOA 3VRBA 4UIGA 2LM2A 3GA8A 1B7TA 1Z8UA 2MOZA 4PFPA 5AQHB 2L3LA 3LSVA 2D9DA 5EZYE 5LA6E 2N2NA 4X65T 1XNRT 3LG7A 5CJ5A 3NRYA 4DV3T 3AEFA 2XQ8A 3CQGB 4KP3C 3AVRA 1IBMT 3P4QA 3I0QA 2D5UA 2JQ9A 2YK0A 3WI3A 3ZSTA 3GWHA 2BG9C 4DNDA 1IBLT 4QXBB 3N5LA 4V1Av 5AQIB 1ZHCA 4YTPA 2YU2A 2BVMA 1UUSA 1YD8G 4EYYR 2M6IA 2W00A 4CI1B 2LSKA 1E2AA 3UTKA 3JC6D 4EYUA 1WCRA 3KVAA 1MIYA 3HKCE 3B13A 4JI2T 2J4GA 5HXHA 1MMNA 4HFHA 1HCIA 2A2FX 1X79A 3AE2A 5ETWA 3H37A 4BAYB 3ANWB 4JI4T 3VKHA 4H9QC 4HWDA 3O4XE 4DV0T 2K24A 3RKGA 2KLQA 2SPCA 3KV6A 1UX5A 5AQJB 3BQLA 3RGLA 5LJMA 1XWMA 2ZMAA 2K3WA 4P0AA 5ADXL 4U74A 1H7CA 3SFEA 2CXDA 2H88A 4IDOA 4ZI3C 2W0GA 5CA0E 3AEGA 5FNVE 1I6ZA 5CA1E 2W62A 1D0YA 4UELA 4UVCB 3ZC0A 3PUXF 4OFZA 2KMFA 5C8YE 2PBIA 3PUGA 3JC6C 2YDSA 2KZ7B 2CBJA 3MXZA 4WBOA 2XQ4A 5FVLA 1J5ET 1VOMA 1MMDA 4YLHA 4DBQA 3P4SA 4PK5A 3EAMA 2BS3A 1D1BA 2LRKA 4X5TA 4DR4T 3VHLA 2JQQA 4MFRA 3S4UA 3AAEB 4EZHA 4JI7T 2V7KA 1U5PA 2FJAA 3FZHB 2BS2A 3PURA 3QK6A 4ZI7E 5AQFB 2XQ5A 3TLWA 2OA5A 2WDRA 4B3TT 3MZKB 5LHHB 3KV5A 4X1YE 3A5XA 3TLUA 4F8HA 2DLRA 5JRCB 4CI2B 2XQ9A 3TLVA 5ABFB 4F6RC 1WFDA 2VL8A 2BG9B 3VR8A 5LGUB 4U33A 4H63V 1MMAA 2NTYA 4H9PC 5AQUB 1OXZA 2V8SV 3OVUA 1M7KA 2LRLA 2WU5A 3P4PA 4U2YA 3UU8A 4B3MT 2RP4A 2D0UA 1JNRA 2LT3A 5ABGA 4WZXA 2IHR1 4QX8B 4A98A 4AKGA 2XQ6A 1SUMB 1ZEEA 3I0OA 1IAPA 5FY7A 1QUUA 2VWAA 3ZMUB 4CZZB 4HWHA 3C64A 3PUZF 1HTJF 4O2BE 4IL4A 3TLSA 5LJNA 4E7ZA 4QXHB 1X9BA 2FUPA 2A72A 2K9AA 3H3MA 4PW8A 4YXDA 2XAQB 2VKOA 2W63A 4AISA 1IJ5A 5L3DB 4DR1T 1D0ZA 2V5DA 4DUZT 4DBRA 2IUBA 3LK42 2X9YA 1LVFA 4TZ4C 5JDLA 3FBZA 3RLFF 2VASA 2Y48B 3JAEA 4QH1A 3MACA 5L4EA 2CPTA 4KHZF 4CXXA 5FP3A 4ANJA 3ONJA 2V6YA 4NPPA 2C0SA 3P4RA 3UUNA 1YQ3A 2WZHA 4OK0A 1MNDA 2ACXA 3V5UA 2K5BB 4COFA 3AB3B 3ZMZB 2PTFA 2XUEA 3GN5B 2AXDS 2JIWA 4I50E 4U31A 2YINA 3ZCJA 1Y64B 4I43B 3HL6A 3ZC1A 1YXRA 3QUJA 2NOXA 1KFYA 1OEDB 2WMOA 2YDQA 2X51A 3A8YC 2E9XD 1MNEA 3N9NA 5L3CB 3KFWX 2IMLA 2BG9E 2LJLA 2I59A 4QKNA 2KXPB 5LOVE 5TAOA 2QRXA 1I94T 4X62T 4O4LE 4ZOLE 4YY3T 3PV0F 3PUAA 4NUUA 4EB6E 2CWYA 4K0KT 3AAAB 1M62A 3AEDA 4YJ3E 4JI6T 4DR2T 4AKHA 4DV5T 3UFEA 3L8RA 2EHOD 2Q9QD 2X67A 4CN6A 4H9OC 3PU8A 2X0YA 4ZZCA 1JNZA 4HFCA 5L3EB 5HXCA 1EZ3A 5HAXA 5C3JA 5KXJA 2HPLA 4O2AE 2VVNA 3IEEA 4IHJE 3ZEFB 5HEJA 1Z0PA 3Q5DA 3N9OA 4QH4A 5ABHA 3RYIE 1ZOYA 4Z91A 2IW5B 4X64T 2HPJA 3PUSA 2WP9A 1QLBA 2VKHA 3TKLB 2IC9A 2NWBA 4KI0F 3H3AA 5JDNA 2WCAA 2XSBA 2NW9A 3F31A 4X66T 4DV6T 1W0BA 3PUVF 3ZN1B 4BJNA 5BMVE 3ZLIA 4LFCT 1AJ3A 4U3CA 2W61A 4LMJA 1W09A 4PFOA 5JR9A 4GIWA 4I4TE 4AQGA 4TN7B 2N1GA 3AE1A 3AE3A 2XQ3A 3C50A 2V5CA 3NRXA 2A3DA 2W67A 3N9LA 3AXJA 4MLKA 3ZT5A 4B3RT 4HGAA 1VRBA 2YDRA 4YJ2E 3NKZA 4KHPT 2L8KA 5LCYA 2C5KT 4NXNT 4O8SA 3CVRA 4CN4A 1UK5A 3ESLA 4CI3B 3EI0A 1D1AA 4KX6A 4WW0A 3ZPOA 3UQ7A 3AVSA 5KDMC 2CA5A 4QXCB 4GKKT 4N78D 2H7VC 3ZMVB 1FMWA 4EIWA 4ZEYA 2N9DA 1S94A 3CIRA 4YSYA 5LMNT 3UU6A 4JI3T 4X20E 3VRAA 5CB4E 3ETUA 1US7B 5FL0A 2UUBT 5FYMA 1YQ4A 3AA0B 3R84B 1XMQT 4LMKA 4HFEA 2LHNA 2FJEA 3RRCA 5DJQC 3EHZA 5A1LA 2WQYA 2XSAA 4AIUA 5FL1A 5L3GB 3P50A 2WWUA 3PDYA 2VVSA 4AI6A 3G06A 3AAIA 4KUMB 4UVAB 1IZNB 3FBLA 3KBTA 1OEDE 4DO0A 4L9IA 2DWGA 2V7JA 2EHOA 2Q9QA 2B76A 3MKDA 3Q5EA 4O4IE 3RX6A 4YTMA 5AQTB 2UXCT 1XZYA 4HE8A 2EHOB 2Q9QB 3IHRA 2LM9A 2Y8DA 3AE7A 4UV9B 1WRDA 5EK3A 1HX1B 4DMWA 4PAGA 3ONXA 4ERRA 2E8IA 4AQFA 4WNKA 5AQSB 3JCFA 4TWDA 3AA1B 5IHYA 4ZI2D 3DTOA 2WY2A 1R8IA 1T7SA 4ZS2A 3MJXA 5AQGB 3I9WA 1XDPA 2WBLA 3A7MA 3SS1A 2ZLYA 4I0UA 3ZMTB 4NUVA 3O1HA 1FIOA 1VCSA 4HWIB 3WAJA 2MBGA 2OV9A 4EZ4A 2BKNA 5HEUA 3K3NA 2KT9A 4YHJA 4ILAA 2WM9A 3OKQA 4IE6A 4L0RA 2LSYA 5FY0A 2UUCT 4NXMT 4ZI3D 2CLYC 4DR7T 4YSXA 4PK4A 3C98B 3AECA 3CK6A 2C5IT 3RYFE 1XNQT 2RA1A 4IE7A 4P1NA 3TLTA 2UXNB 5E0OA 3AE6A 4ADZA 4CXWA 4CQIA 2B1EA 1LKXA 4ASKA 3DP7A 4E7SA 3N9QA 2XAFB 1HR0T 3VKGA 3UFGA 4A56A 4DV1T 2A9UA 4H9RC 5KX5E 2XY8B 2NTXA 3CX8B 4X1IE 4YTNA 5C2TA 4PJNA 4U2ZA 3ETVA 3C4WA 3UUXB 2KSRA 2M67A 3W15B 1FMVA 2I0MA 3BK9A 4LF8T 2XTLA 4EOZB 2CLYB 2KINB 3GN5A 3L09A 4O4HE 1HNWT 3F2EA 3KINB 1IJ6A 4HEAA 3NBXX 4PNIA 3AEEA 5HEGA 4KBMB 2CM0A 3RRWA 5JDGA 5L47A 2JJ9A 2ZM2A 3KV9A 5CFBA 2MAWA 1DU2A 1WLXA 4XAXB 4ZXLA 3P8CD 2LKHA 1LVKA 3MA9A 4C90A 4CXYA 3AE5A 3CKDA 5F5WA 4IE4A 4HTEA 4JI1T 3KV4A 3FXDB 2ODVA 2X9WA 3ZJ1A 3CQXC 4Q25A 3LK3B 3OPCA 3VR9A 5JQGE 4TWFA 3I9YA 2XHEB 2IC6A 5JDFA 2J47A 4YHHT 4MBQA 3VU7H 4A5XA 3ZT6A 3P7IA 2WZIA 2UUAT 4LF5T 5FKYA 3KBUA 1FJGT 2CHNA 2XQAA 1N34T 5FXXA 3IBPA 3NZPA 1SE7A 2XAHB 2KWIB 4QX7B 1D1CA 2JMHA 2VL0A 4WBNE 3HI2A 2CXLA 1V9DA 2J62A 2YU1A 3GMIA 2LSJA 4GYRA 4JLEA 4QHOA 2WSSV 3K3QC 2GK9A 2MYSA 2VURA 4TX5A 3ZCIA 2X68A 2BKOA 4IREA 4P09A 5IYZE 4DR3T 4AKIA 4A97A 4UXNB 3C4XA 4QWNB 4WYVA 2ACZA 3RHWA 3CMLA 4OHFA 4OYKA 4MHCA 4LF9T 1KNZA 3QC9A 3AEAA 5FXZA 4IDNA 2CMRA 2OLTA 4EXTA 2BBJA 5BR8T 4G2AA 2V1DB 4H9SE 4AKRB 1QSDA 2JQKA 1XMOT 2WAUA 3HR0A 1HF8A 4UF0B 3ZYKA 1NWMX 5AQRB 1MIWA 1S35A 3FXEB 3FZFB 3K1SA 3EDVA 3LK2B 4TUYE 1CHUA 5AQVB 3RPUA 3B5MA 1E1HB 2CXFA 2FJDA 4GOUA 1SHZC 3M3ZB 4UF0A 2ES0A 2JQHA 1FEWA 3PJAJ 3PU3A 3AA7B 3LJCA 3DJBA 4ILUA 5FXWA 3U78A 5HWYA 1G8XA 4P0BA 2V7MA 2UXDT 3RKOA 4B3ST 4FJOA 2FJBA 3AA6B 2H7OA 2V6XA 3E08A 4Z8XA 3UU4A 3OTOT 3CWZB 4AXPA 2BZBA 3RC8A 1WR6A 2CRBA 3Q5WA 5HWXA 2H3RA 4EGWA 4OYJA 3N2KE 3UULA 1BR1A 1OWAA 3NWIA 2NR4A 3PUYF 3N9PA 1W0AA 3ONLC 1MMGA 1L0VA 5HCJA 3M65A 2D0TA
chains in the Genus database with same CATH topology
1G73A 2C5JA 4GYSA 2MTQA 1KK7A 2VKDA 3J9X1 2KNDA 3EDUA 3LFMA 3UT5E 2NW7A 3OYXA 2LSGA 2HH7A 3N9MA 2LE8A 2CCQA 4ZHQE 2IAKA 2Y6XA 3KDSE 5LBQB 2J1DG 5F3JA 5DABA 2PFVA 3ZYLA 2VB6A 5LGTB 3PE0A 5FXVA 2LHRA 4IDZA 2V26A 1BR4A 3ANWA 5JDMA 1CUNA 2PJQA 3CPZA 5HYAA 3N2GE 4HKAA 5LG4A 1NAFA 4E7ZA 4FI5A 3C4ZA 4IE5A 3RYHE 4J2CA 4ZS3A 4KMCA 3LBXA 5J2UE 3D0TA 3L3PA 1T98A 2KWHA 4TV8E 3LBXB 5DQWA 3CX7B 4X1KE 5F8PA 4PJLA 3RYCE 1MIVA 2X66A 5EK2A 5DQVA 3E0ZA 2JPFA 1HFAA 2QA7A 3FHNA 3B57A 2E9XC 3N2OA 2JRKA 5JR9B 5JDHA 2LOSA 5L3FB 2BVLA 4IIJE 2X0LB 2L9QA 3OYZA 2G0UA 3EVYA 2V7LA 4IGUA 2VK9A 4HN9A 4JUYA 4ZI2C 2DCFA 1HG2A 1WYBA 2VKJA 1YKEB 2CWOA 2V7IA 5H6QB 2JMKA 3HKDE 5H6RB 5HXRA 3K3OA 3SOLA 5J1GA 4U72A 5J2TE 2CE7A 3EUHA 3ZMSB 2UXXB 2PG8A 2NP9A 5FMNA 5L3BB 2LOPA 5LBMA 3RC3A 3V5SA 1LRZA 2DNXA 1HG5A 2WMNA 5EK4A 5HXSA 4UEMA 3RH3A 2X9HA 2XAGB 4EAHA 1WYCA 3T8OA 4C91A 3K8PC 3BQKA 3CQCB 2LSIA 2ZM8A 4ISTA 2LEHA 4AQFC 5AFUL 4IE0A 3J7Yq 2CEAA 4HFVA 1YW0A 2XASB 2Z6EA 4ISSA 1HX8A 3IF8B 3R6NA 4TV9E 2NW8A 4H63H 3PUQA 3O9XA 3SRZA 3O1IA 5LYJE 5L2LA 5KMGP 4PK6A 5LGNB 1BR2A 2E9XB 1UX4A 5JR9C 2P9BA 2XAJB 3I1AA 4H9NC 3ZN0B 2DWKA 2E9XA 3OBVE 4B6XA 4BA9A 3ZJ2A 3SWHA 3BQIA 5LHIB 1YKHB 2K48A 5HXEA 2XQYA 3E22E 3O1JA 4YFSA 3ZYMA 4MALA 3Q2MA 2EHOC 2Q9QC 1BR0A 1D0XA 4JEHB 5JREA 3FB2A 3WAKA 5M4YA 1O3XA 3NZQA 4O4JE 3MK7C 3HA4A 5JVDE 4PJMA 4XBFB 1ZV4X 4XZCA 4BJMA 3U3IA 5LNKA 1HS7A 1ZKEA 3Q9DA 2YEVC 4K0UA 5LP6E 1SA0E 4GK5E 5JDQA 1UCUA 4GK0E 2DHRA 2BDEA 5GONE 1U4QA 3OJAA 5FY1A 4JEUB 4UVBB 3F57A 4I55E 3CX6B 4DMVA 4M1PA 3C51A 3Q5XA 3PTRB 4PJJA 4DVDA 4G63A 3KVBA 5LXTE 2QGSA 3HKEE 3HKBE 2X9XA 3UUMA 4UV8B 2D2SA 4AKLA 4L5GA 5LHGB 2DI4A 5JH7E 2ODUA 5JRCA 4UIGA 3GA8A 4PFPA 1B7TA 5EZYE 2MOZA 2L3LA 5LA6E 2N2NA 3LG7A 3NRYA 4KP3C 3CQGB 3AVRA 3I0QA 2D5UA 2YK0A 3WI3A 3GWHA 4DNDA 4QXBB 3N5LA 4V1Av 1ZHCA 2YU2A 2BVMA 1YD8G 4EYYR 4CI1B 2W00A 2LSKA 3UTKA 3JC6D 4EYUA 3KVAA 1MIYA 3HKCE 3B13A 5HXHA 1MMNA 1HCIA 2A2FX 1X79A 5ETWA 3H37A 4BAYB 3ANWB 3VKHA 4H9QC 3O4XE 2K24A 2KLQA 2SPCA 3KV6A 1UX5A 3BQLA 5LJMA 2ZMAA 4P0AA 5ADXL 4U74A 1H7CA 2CXDA 4ZI3C 2W0GA 5CA0E 5FNVE 5CA1E 2W62A 1D0YA 4UELA 4UVCB 3ZC0A 4OFZA 2KMFA 5C8YE 2PBIA 3PUGA 3JC6C 3MXZA 2KZ7B 4WBOA 1VOMA 1MMDA 4YLHA 4DBQA 4PK5A 1D1BA 3VHLA 2JQQA 4MFRA 3AAEB 4EZHA 2V7KA 1U5PA 3PURA 3QK6A 4ZI7E 2OA5A 3MZKB 5LHHB 3KV5A 4X1YE 3A5XA 5JRCB 2DLRA 4F6RC 2VL8A 5LGUB 4H63V 1MMAA 2NTYA 4H9PC 1OXZA 2RP4A 2D0UA 2LT3A 4QX8B 4AKGA 1ZEEA 3I0OA 5FY7A 1IAPA 1QUUA 2VWAA 3ZMUB 4CZZB 3C64A 1HTJF 4O2BE 5LJNA 4QXHB 4PW8A 2A72A 2K9AA 2XAQB 2VKOA 2W63A 1IJ5A 5L3DB 1D0ZA 4DBRA 3LK42 2X9YA 1LVFA 4TZ4C 5JDLA 3FBZA 2VASA 2Y48B 3MACA 4CXXA 5FP3A 4ANJA 2C0SA 3UUNA 4OK0A 1MNDA 2ACXA 3V5UA 2K5BB 3AB3B 3ZMZB 2XUEA 3GN5B 3ZCJA 4I50E 2YINA 1Y64B 4I43B 3HL6A 3ZC1A 2D0TA 2NOXA 2WMOA 3QUJA 2X51A 3N9NA 2E9XD 1MNEA 5L3CB 3KFWX 2LJLA 2I59A 4QKNA 2KXPB 5LOVE 5TAOA 4O4LE 4ZOLE 3PUAA 4NUUA 4EB6E 2CWYA 3AAAB 4YJ3E 4AKHA 3UFEA 2EHOD 2Q9QD 2X67A 4H9OC 3PU8A 5L3EB 5HXCA 1EZ3A 5HAXA 2HPLA 4O2AE 3IEEA 4IHJE 3ZEFB 1Z0PA 3N9OA 3RYIE 2IW5B 2HPJA 3PUSA 2VKHA 3TKLB 2IC9A 2NWBA 3H3AA 5JDNA 2NW9A 3F31A 1AJ3A 3ZN1B 4BJNA 5BMVE 3ZLIA 2W61A 5JR9A 4PFOA 4GIWA 4I4TE 4AQGA 4TN7B 2N1GA 3C50A 3NRXA 2A3DA 3N9LA 4MLKA 4HGAA 1VRBA 4YJ2E 2L8KA 5LCYA 2C5KT 4O8SA 3CVRA 3ESLA 4CI3B 3ZPOA 1D1AA 4WW0A 3AVSA 5KDMC 2CA5A 4QXCB 4N78D 2H7VC 3ZMVB 1FMWA 4EIWA 2N9DA 1S94A 4X20E 5CB4E 3ETUA 1US7B 5FYMA 3AA0B 3R84B 2LHNA 3RRCA 5DJQC 5A1LA 5L3GB 2WWUA 3PDYA 4AI6A 3AAIA 4KUMB 4UVAB 1IZNB 3FBLA 3KBTA 4DO0A 4L9IA 2DWGA 2V7JA 2EHOA 2Q9QA 4O4IE 3MKDA 3RX6A 4HE8A 2EHOB 2Q9QB 3IHRA 2LM9A 2Y8DA 4UV9B 5EK3A 1WRDA 4DMWA 4ERRA 4PAGA 3ONXA 2E8IA 4AQFA 4WNKA 3AA1B 5IHYA 4ZI2D 3DTOA 4ZS2A 3MJXA 3I9WA 2WBLA 3SS1A 3ZMTB 2ZLYA 4NUVA 3O1HA 1FIOA 3WAJA 2MBGA 4EZ4A 3K3NA 2KT9A 4YHJA 2WM9A 3OKQA 4IE6A 4L0RA 2LSYA 5FY0A 4ZI3D 2CLYC 4PK4A 3C98B 2C5IT 3RYFE 2RA1A 4IE7A 2UXNB 5E0OA 4ADZA 4CXWA 4CQIA 2B1EA 1LKXA 4ASKA 3DP7A 4E7SA 3N9QA 2XAFB 3VKGA 4A56A 4H9RC 5KX5E 2NTXA 3CX8B 4X1IE 4PJNA 3ETVA 3C4WA 3UUXB 3W15B 2M67A 4EOZB 1FMVA 3BK9A 2XTLA 2CLYB 2KINB 3GN5A 3L09A 4O4HE 3F2EA 3KINB 1IJ6A 4HEAA 3NBXX 4PNIA 4KBMB 2CM0A 3RRWA 5JDGA 2JJ9A 2ZM2A 3KV9A 1WLXA 4XAXB 3P8CD 1LVKA 3MA9A 4C90A 4CXYA 3CKDA 4IE4A 4HTEA 3KV4A 3FXDB 2ODVA 2X9WA 3ZJ1A 3CQXC 5JQGE 3LK3B 3I9YA 2XHEB 2IC6A 5JDFA 4MBQA 3VU7H 3P7IA 3KBUA 5FXXA 3IBPA 3NZPA 4QX7B 2XAHB 2KWIB 4WBNE 1D1CA 2JMHA 3HI2A 2CXLA 1V9DA 2YU1A 3GMIA 4GYRA 2LSJA 4JLEA 4QHOA 4TX5A 2WSSV 3K3QC 2GK9A 2MYSA 3S4UA 3ZCIA 2X68A 4P09A 5IYZE 4AKIA 4UXNB 3C4XA 4QWNB 3CMLA 4OHFA 4OYKA 4MHCA 1KNZA 3QC9A 5FXZA 2CMRA 4EXTA 4G2AA 2V1DB 4H9SE 4AKRB 1QSDA 2WAUA 3HR0A 1HF8A 4UF0B 3ZYKA 1NWMX 1MIWA 1S35A 3FXEB 4CI2B 4TUYE 3EDVA 3LK2B 3RPUA 1E1HB 2CXFA 4GOUA 4UF0A 1SHZC 2ES0A 1FEWA 3PU3A 3AA7B 3LJCA 3DJBA 4ILUA 5FXWA 3U78A 5HWYA 1G8XA 4P0BA 2V7MA 3RKOA 4FJOA 3AA6B 2H7OA 3E08A 4Z8XA 3CWZB 4AXPA 2BZBA 3RC8A 1WR6A 3Q5WA 5HWXA 2H3RA 4OYJA 3N2KE 3UULA 1BR1A 1OWAA 3N9PA 1MMGA 3M65A 2ZM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2N A;  1NWM X;  1WRD A;  1WR6 A;  1YD8 G;  1NAF A;  1OXZ A;  2N9D A;  1X79 A;  1O3X A; 
#chains in the Genus database with same CATH topology
 3UU5 A;  3QB5 K;  1G73 A;  2C5J A;  3ABV A;  4GYS A;  4EED A;  4ZZB A;  4DR5 T;  4UR9 A;  2MTQ A;  1KK7 A;  2VKD A;  3QOF A;  4JBW F;  2KND A;  3EDU A;  3LFM A;  3J9X 1;  3UT5 E;  5JTG A;  1NEK A;  2NW7 A;  2QVA A;  3OYX A;  2LSG A;  5HEH A;  2HH7 A;  3N9M A;  2LE8 A;  3QB5 A;  2CCQ A;  4ZHQ E;  2IAK A;  1J5W A;  2BKP A;  2Y6X A;  3FZL B;  3KDS E;  5LBQ B;  2J1D G;  5F3J A;  5DAB A;  3PUW F;  3RIU C;  5IUX A;  2PFV A;  5FVK A;  3ZYL A;  2VB6 A;  5LGT B;  3PE0 A;  5FXV A;  3ZT7 A;  2LHR A;  4IDZ A;  2V26 A;  4U7Y A;  4EEB A;  2QYW A;  2WDQ A;  1BR4 A;  2BS4 A;  1KNP A;  3ANW A;  4DUY T;  5JDM A;  1CUN A;  2PJQ A;  4HFI A;  3AXJ B;  2WB5 A;  1HNZ T;  3CPZ A;  4ILC A;  5HYA A;  3N2G E;  4HKA A;  5LG4 A;  1NAF A;  1UUR A;  5AQK B;  4FI5 A;  3C4Z A;  3RQU A;  3AE9 A;  3IA3 A;  4IE5 A;  3AEB A;  3ZKR A;  2LKG A;  1GQE A;  4J2C A;  4ZS3 A;  3RYH E;  1J1J A;  4KMC A;  3LBX A;  4Z90 A;  3RQW A;  5J2U E;  1WR0 A;  3D0T A;  2IDO B;  3L3P A;  1T98 A;  2KWH A;  5HEO A;  4TV8 E;  3LBX B;  3UUB A;  2H89 A;  5DQW A;  3CX7 B;  4X1K E;  5F8P A;  4PJL A;  3RYC E;  1MIV A;  1N32 T;  2X66 A;  5EK2 A;  5DQV A;  2QA7 A;  2JPF A;  1HFA A;  3E0Z A;  3FHN A;  3B57 A;  5AQN B;  2E9X C;  3N2O A;  2JRK A;  5AQQ B;  5JR9 B;  5JDH A;  2I6H A;  2LOS A;  2W66 A;  5L3F B;  4AQY T;  2BVL A;  4JYA T;  2XM2 A;  4IDP A;  4IIJ E;  2X0L B;  2L9Q A;  2YOE A;  3OYZ A;  2XJ7 A;  3L39 A;  4U7I A;  2G0U A;  2MPK A;  3EVY A;  2ZM6 T;  2V7L A;  4IGU A;  4LFA T;  2HN1 A;  2VK9 A;  4HN9 A;  4JUY A;  4ZI2 C;  3T1Y T;  2DCF A;  1HG2 A;  1WYB A;  2VKJ A;  5AQO B;  1YKE B;  2CWO A;  2V7I A;  5H6Q B;  4LF4 T;  2JMK A;  3RF1 A;  3HKD E;  5H6R B;  5HXR A;  3K3O A;  3SOL A;  5J1G A;  4U72 A;  5J2T E;  1NEN A;  2CE7 A;  3EUH A;  3P4W A;  3T1H T;  3ZMS B;  2UXX B;  1UGO A;  2PG8 A;  2NP9 A;  5IWA T;  5FMN A;  4TNW A;  5L3B B;  2LOP A;  3JAF A;  3FZK B;  5LBM A;  3RC3 A;  1E7P A;  1IBK T;  2E5L T;  1N36 T;  3SFD A;  4LML A;  3V5S A;  3PJA A;  1LRZ A;  2DNX A;  1HG5 A;  2WMN A;  5AQL B;  1T8B A;  5EK4 A;  4JI8 T;  5HXS A;  2VQE T;  4UEM A;  3QNU A;  2X9H A;  3RH3 A;  2XAG B;  4EAH A;  2UU9 T;  1T72 A;  1WYC A;  2WU2 A;  3T8O A;  1ZP0 A;  4C91 A;  4LF7 T;  3K8P C;  3BQK A;  3CQC B;  2LSI A;  2YN6 A;  2ZM8 A;  2LEH A;  4IST A;  2X0H A;  4IT4 A;  4HWF A;  4AQF C;  5AFU L;  2R6G F;  4IE0 A;  4HFD A;  3UU3 A;  3J7Y q;  2CEA A;  4HFV A;  5CGM A;  2RPA A;  5J0Z A;  4QH5 A;  2M6B A;  1YW0 A;  2XAS B;  2Z6E A;  4ISS A;  1HX8 A;  2E2A A;  3IF8 B;  3R6N A;  4TV9 E;  2ZM0 A;  2NW8 A;  4H63 H;  4DV7 T;  3PUQ A;  3O9X A;  2XPK A;  3SRZ A;  3O1I A;  5LYJ E;  3EAB A;  5KMG P;  2XZE A;  4PK6 A;  5LGN B;  5L2L A;  1BR2 A;  2W2U A;  4IDQ A;  2E9X B;  1UX4 A;  5JR9 C;  2P9B A;  2XAJ B;  3I1A A;  3ZSS A;  3NVO A;  4JI0 T;  3RI5 A;  4H9N C;  4JV5 T;  1VCT A;  3ZN0 B;  4LFB T;  2DWK A;  2E9X A;  3FZM B;  3LDQ B;  3OBV E;  4ILB A;  4B6X A;  4BA9 A;  4HWC A;  3ZJ2 A;  5HCM A;  5AQM B;  3SWH A;  2BG9 A;  3BQI A;  5LHI B;  1YKH B;  2K48 A;  5HXE A;  2IIU A;  2XQY A;  4OX9 T;  3E22 E;  3O1J A;  4YFS A;  3ZYM A;  2YKS A;  4MAL A;  4NIQ A;  1XDO A;  3Q2M A;  2CBI A;  2EHO C;  2Q9Q C;  1BR0 A;  1D0X A;  1KNR A;  4JEH B;  5L4H A;  5JRE A;  3FB2 A;  3WAK A;  4EV6 A;  5M4Y A;  3X1D A;  2BBH A;  2AE9 A;  2E5V A;  1KEY A;  1O3X A;  3NZQ A;  3RIA A;  4O4J E;  4TNV A;  3MK7 C;  3HA4 A;  5JVD E;  4TWH A;  4PJM A;  4XBF B;  1ZV4 X;  4XZC A;  4YT0 A;  4BJM A;  3U3I A;  2DL1 A;  2F4V T;  5LNK A;  2WWV A;  1HS7 A;  1ZKE A;  3RIU A;  3Q9D A;  2YEV C;  2LLY A;  2W4X A;  4K0U A;  5ABE A;  4HFB A;  5LP6 E;  1SA0 E;  4GK5 E;  2HHH T;  2V6Y B;  1OED C;  5JDQ A;  1UCU A;  4GK0 E;  5LG3 A;  2DHR A;  2BDE A;  4DV2 T;  5GON E;  4JI5 T;  2HN2 A;  1U4Q A;  2FBW A;  2WS3 A;  3OJA A;  4IL9 A;  5FY1 A;  4YSZ A;  4JEU B;  5LB7 B;  1Y01 A;  4UVB B;  1W9R A;  3F57 A;  4I55 E;  2VQF T;  1N33 T;  3CX6 B;  4DMV A;  1OED A;  4M1P A;  5LMU T;  3C51 A;  3Q5X A;  3PTR B;  2UXB T;  3UQ4 A;  4PJJ A;  4DVD A;  4G63 A;  2WDV A;  3KVB A;  5LXT E;  2XQ7 A;  2QGS A;  3HKE E;  3HKB E;  4DID B;  2X9X A;  3UUM A;  4UV8 B;  2D2S A;  3AE4 A;  1HNX T;  4LF6 T;  3AE8 A;  4AKL A;  4L5G A;  4CN1 A;  3JAD A;  5LHG B;  4DR6 T;  2DI4 A;  1KF6 A;  2XM1 A;  5AQP B;  5JH7 E;  3RIF A;  5ABF A;  4DV4 T;  4GKJ T;  2ODU A;  5JRC A;  2CHO A;  3VRB A;  4UIG A;  2LM2 A;  3GA8 A;  1B7T A;  1Z8U A;  2MOZ A;  4PFP A;  5AQH B;  2L3L A;  3LSV A;  2D9D A;  5EZY E;  5LA6 E;  2N2N A;  4X65 T;  1XNR T;  3LG7 A;  5CJ5 A;  3NRY A;  4DV3 T;  3AEF A;  2XQ8 A;  3CQG B;  4KP3 C;  3AVR A;  1IBM T;  3P4Q A;  3I0Q A;  2D5U A;  2JQ9 A;  2YK0 A;  3WI3 A;  3ZST A;  3GWH A;  2BG9 C;  4DND A;  1IBL T;  4QXB B;  3N5L A;  4V1A v;  5AQI B;  1ZHC A;  4YTP A;  2YU2 A;  2BVM A;  1UUS A;  1YD8 G;  4EYY R;  2M6I A;  2W00 A;  4CI1 B;  2LSK A;  1E2A A;  3UTK A;  3JC6 D;  4EYU A;  1WCR A;  3KVA A;  1MIY A;  3HKC E;  3B13 A;  4JI2 T;  2J4G A;  5HXH A;  1MMN A;  4HFH A;  1HCI A;  2A2F X;  1X79 A;  3AE2 A;  5ETW A;  3H37 A;  4BAY B;  3ANW B;  4JI4 T;  3VKH A;  4H9Q C;  4HWD A;  3O4X E;  4DV0 T;  2K24 A;  3RKG A;  2KLQ A;  2SPC A;  3KV6 A;  1UX5 A;  5AQJ B;  3BQL A;  3RGL A;  5LJM A;  1XWM A;  2ZMA A;  2K3W A;  4P0A A;  5ADX L;  4U74 A;  1H7C A;  3SFE A;  2CXD A;  2H88 A;  4IDO A;  4ZI3 C;  2W0G A;  5CA0 E;  3AEG A;  5FNV E;  1I6Z A;  5CA1 E;  2W62 A;  1D0Y A;  4UEL A;  4UVC B;  3ZC0 A;  3PUX F;  4OFZ A;  2KMF A;  5C8Y E;  2PBI A;  3PUG A;  3JC6 C;  2YDS A;  2KZ7 B;  2CBJ A;  3MXZ A;  4WBO A;  2XQ4 A;  5FVL A;  1J5E T;  1VOM A;  1MMD A;  4YLH A;  4DBQ A;  3P4S A;  4PK5 A;  3EAM A;  2BS3 A;  1D1B A;  2LRK A;  4X5T A;  4DR4 T;  3VHL A;  2JQQ A;  4MFR A;  3S4U A;  3AAE B;  4EZH A;  4JI7 T;  2V7K A;  1U5P A;  2FJA A;  3FZH B;  2BS2 A;  3PUR A;  3QK6 A;  4ZI7 E;  5AQF B;  2XQ5 A;  3TLW A;  2OA5 A;  2WDR A;  4B3T T;  3MZK B;  5LHH B;  3KV5 A;  4X1Y E;  3A5X A;  3TLU A;  4F8H A;  2DLR A;  5JRC B;  4CI2 B;  2XQ9 A;  3TLV A;  5ABF B;  4F6R C;  1WFD A;  2VL8 A;  2BG9 B;  3VR8 A;  5LGU B;  4U33 A;  4H63 V;  1MMA A;  2NTY A;  4H9P C;  5AQU B;  1OXZ A;  2V8S V;  3OVU A;  1M7K A;  2LRL A;  2WU5 A;  3P4P A;  4U2Y A;  3UU8 A;  4B3M T;  2RP4 A;  2D0U A;  1JNR A;  2LT3 A;  5ABG A;  4WZX A;  2IHR 1;  4QX8 B;  4A98 A;  4AKG A;  2XQ6 A;  1SUM B;  1ZEE A;  3I0O A;  1IAP A;  5FY7 A;  1QUU A;  2VWA A;  3ZMU B;  4CZZ B;  4HWH A;  3C64 A;  3PUZ F;  1HTJ F;  4O2B E;  4IL4 A;  3TLS A;  5LJN A;  4E7Z A;  4QXH B;  1X9B A;  2FUP A;  2A72 A;  2K9A A;  3H3M A;  4PW8 A;  4YXD A;  2XAQ B;  2VKO A;  2W63 A;  4AIS A;  1IJ5 A;  5L3D B;  4DR1 T;  1D0Z A;  2V5D A;  4DUZ T;  4DBR A;  2IUB A;  3LK4 2;  2X9Y A;  1LVF A;  4TZ4 C;  5JDL A;  3FBZ A;  3RLF F;  2VAS A;  2Y48 B;  3JAE A;  4QH1 A;  3MAC A;  5L4E A;  2CPT A;  4KHZ F;  4CXX A;  5FP3 A;  4ANJ A;  3ONJ A;  2V6Y A;  4NPP A;  2C0S A;  3P4R A;  3UUN A;  1YQ3 A;  2WZH A;  4OK0 A;  1MND A;  2ACX A;  3V5U A;  2K5B B;  4COF A;  3AB3 B;  3ZMZ B;  2PTF A;  2XUE A;  3GN5 B;  2AXD S;  2JIW A;  4I50 E;  4U31 A;  2YIN A;  3ZCJ A;  1Y64 B;  4I43 B;  3HL6 A;  3ZC1 A;  1YXR A;  3QUJ A;  2NOX A;  1KFY A;  1OED B;  2WMO A;  2YDQ A;  2X51 A;  3A8Y C;  2E9X D;  1MNE A;  3N9N A;  5L3C B;  3KFW X;  2IML A;  2BG9 E;  2LJL A;  2I59 A;  4QKN A;  2KXP B;  5LOV E;  5TAO A;  2QRX A;  1I94 T;  4X62 T;  4O4L E;  4ZOL E;  4YY3 T;  3PV0 F;  3PUA A;  4NUU A;  4EB6 E;  2CWY A;  4K0K T;  3AAA B;  1M62 A;  3AED A;  4YJ3 E;  4JI6 T;  4DR2 T;  4AKH A;  4DV5 T;  3UFE A;  3L8R A;  2EHO D;  2Q9Q D;  2X67 A;  4CN6 A;  4H9O C;  3PU8 A;  2X0Y A;  4ZZC A;  1JNZ A;  4HFC A;  5L3E B;  5HXC A;  1EZ3 A;  5HAX A;  5C3J A;  5KXJ A;  2HPL A;  4O2A E;  2VVN A;  3IEE A;  4IHJ E;  3ZEF B;  5HEJ A;  1Z0P A;  3Q5D A;  3N9O A;  4QH4 A;  5ABH A;  3RYI E;  1ZOY A;  4Z91 A;  2IW5 B;  4X64 T;  2HPJ A;  3PUS A;  2WP9 A;  1QLB A;  2VKH A;  3TKL B;  2IC9 A;  2NWB A;  4KI0 F;  3H3A A;  5JDN A;  2WCA A;  2XSB A;  2NW9 A;  3F31 A;  4X66 T;  4DV6 T;  1W0B A;  3PUV F;  3ZN1 B;  4BJN A;  5BMV E;  3ZLI A;  4LFC T;  1AJ3 A;  4U3C A;  2W61 A;  4LMJ A;  1W09 A;  4PFO A;  5JR9 A;  4GIW A;  4I4T E;  4AQG A;  4TN7 B;  2N1G A;  3AE1 A;  3AE3 A;  2XQ3 A;  3C50 A;  2V5C A;  3NRX A;  2A3D A;  2W67 A;  3N9L A;  3AXJ A;  4MLK A;  3ZT5 A;  4B3R T;  4HGA A;  1VRB A;  2YDR A;  4YJ2 E;  3NKZ A;  4KHP T;  2L8K A;  5LCY A;  2C5K T;  4NXN T;  4O8S A;  3CVR A;  4CN4 A;  1UK5 A;  3ESL A;  4CI3 B;  3EI0 A;  1D1A A;  4KX6 A;  4WW0 A;  3ZPO A;  3UQ7 A;  3AVS A;  5KDM C;  2CA5 A;  4QXC B;  4GKK T;  4N78 D;  2H7V C;  3ZMV B;  1FMW A;  4EIW A;  4ZEY A;  2N9D A;  1S94 A;  3CIR A;  4YSY A;  5LMN T;  3UU6 A;  4JI3 T;  4X20 E;  3VRA A;  5CB4 E;  3ETU A;  1US7 B;  5FL0 A;  2UUB T;  5FYM A;  1YQ4 A;  3AA0 B;  3R84 B;  1XMQ T;  4LMK A;  4HFE A;  2LHN A;  2FJE A;  3RRC A;  5DJQ C;  3EHZ A;  5A1L A;  2WQY A;  2XSA A;  4AIU A;  5FL1 A;  5L3G B;  3P50 A;  2WWU A;  3PDY A;  2VVS A;  4AI6 A;  3G06 A;  3AAI A;  4KUM B;  4UVA B;  1IZN B;  3FBL A;  3KBT A;  1OED E;  4DO0 A;  4L9I A;  2DWG A;  2V7J A;  2EHO A;  2Q9Q A;  2B76 A;  3MKD A;  3Q5E A;  4O4I E;  3RX6 A;  4YTM A;  5AQT B;  2UXC T;  1XZY A;  4HE8 A;  2EHO B;  2Q9Q B;  3IHR A;  2LM9 A;  2Y8D A;  3AE7 A;  4UV9 B;  1WRD A;  5EK3 A;  1HX1 B;  4DMW A;  4PAG A;  3ONX A;  4ERR A;  2E8I A;  4AQF A;  4WNK A;  5AQS B;  3JCF A;  4TWD A;  3AA1 B;  5IHY A;  4ZI2 D;  3DTO A;  2WY2 A;  1R8I A;  1T7S A;  4ZS2 A;  3MJX A;  5AQG B;  3I9W A;  1XDP A;  2WBL A;  3A7M A;  3SS1 A;  2ZLY A;  4I0U A;  3ZMT B;  4NUV A;  3O1H A;  1FIO A;  1VCS A;  4HWI B;  3WAJ A;  2MBG A;  2OV9 A;  4EZ4 A;  2BKN A;  5HEU A;  3K3N A;  2KT9 A;  4YHJ A;  4ILA A;  2WM9 A;  3OKQ A;  4IE6 A;  4L0R A;  2LSY A;  5FY0 A;  2UUC T;  4NXM T;  4ZI3 D;  2CLY C;  4DR7 T;  4YSX A;  4PK4 A;  3C98 B;  3AEC A;  3CK6 A;  2C5I T;  3RYF E;  1XNQ T;  2RA1 A;  4IE7 A;  4P1N A;  3TLT A;  2UXN B;  5E0O A;  3AE6 A;  4ADZ A;  4CXW A;  4CQI A;  2B1E A;  1LKX A;  4ASK A;  3DP7 A;  4E7S A;  3N9Q A;  2XAF B;  1HR0 T;  3VKG A;  3UFG A;  4A56 A;  4DV1 T;  2A9U A;  4H9R C;  5KX5 E;  2XY8 B;  2NTX A;  3CX8 B;  4X1I E;  4YTN A;  5C2T A;  4PJN A;  4U2Z A;  3ETV A;  3C4W A;  3UUX B;  2KSR A;  2M67 A;  3W15 B;  1FMV A;  2I0M A;  3BK9 A;  4LF8 T;  2XTL A;  4EOZ B;  2CLY B;  2KIN B;  3GN5 A;  3L09 A;  4O4H E;  1HNW T;  3F2E A;  3KIN B;  1IJ6 A;  4HEA A;  3NBX X;  4PNI A;  3AEE A;  5HEG A;  4KBM B;  2CM0 A;  3RRW A;  5JDG A;  5L47 A;  2JJ9 A;  2ZM2 A;  3KV9 A;  5CFB A;  2MAW A;  1DU2 A;  1WLX A;  4XAX B;  4ZXL A;  3P8C D;  2LKH A;  1LVK A;  3MA9 A;  4C90 A;  4CXY A;  3AE5 A;  3CKD A;  5F5W A;  4IE4 A;  4HTE A;  4JI1 T;  3KV4 A;  3FXD B;  2ODV A;  2X9W A;  3ZJ1 A;  3CQX C;  4Q25 A;  3LK3 B;  3OPC A;  3VR9 A;  5JQG E;  4TWF A;  3I9Y A;  2XHE B;  2IC6 A;  5JDF A;  2J47 A;  4YHH T;  4MBQ A;  3VU7 H;  4A5X A;  3ZT6 A;  3P7I A;  2WZI A;  2UUA T;  4LF5 T;  5FKY A;  3KBU A;  1FJG T;  2CHN A;  2XQA A;  1N34 T;  5FXX A;  3IBP A;  3NZP A;  1SE7 A;  2XAH B;  2KWI B;  4QX7 B;  1D1C A;  2JMH A;  2VL0 A;  4WBN E;  3HI2 A;  2CXL A;  1V9D A;  2J62 A;  2YU1 A;  3GMI A;  2LSJ A;  4GYR A;  4JLE A;  4QHO A;  2WSS V;  3K3Q C;  2GK9 A;  2MYS A;  2VUR A;  4TX5 A;  3ZCI A;  2X68 A;  2BKO A;  4IRE A;  4P09 A;  5IYZ E;  4DR3 T;  4AKI A;  4A97 A;  4UXN B;  3C4X A;  4QWN B;  4WYV A;  2ACZ A;  3RHW A;  3CML A;  4OHF A;  4OYK A;  4MHC A;  4LF9 T;  1KNZ A;  3QC9 A;  3AEA A;  5FXZ A;  4IDN A;  2CMR A;  2OLT A;  4EXT A;  2BBJ A;  5BR8 T;  4G2A A;  2V1D B;  4H9S E;  4AKR B;  1QSD A;  2JQK A;  1XMO T;  2WAU A;  3HR0 A;  1HF8 A;  4UF0 B;  3ZYK A;  1NWM X;  5AQR B;  1MIW A;  1S35 A;  3FXE B;  3FZF B;  3K1S A;  3EDV A;  3LK2 B;  4TUY E;  1CHU A;  5AQV B;  3RPU A;  3B5M A;  1E1H B;  2CXF A;  2FJD A;  4GOU A;  1SHZ C;  3M3Z B;  4UF0 A;  2ES0 A;  2JQH A;  1FEW A;  3PJA J;  3PU3 A;  3AA7 B;  3LJC A;  3DJB A;  4ILU A;  5FXW A;  3U78 A;  5HWY A;  1G8X A;  4P0B A;  2V7M A;  2UXD T;  3RKO A;  4B3S T;  4FJO A;  2FJB A;  3AA6 B;  2H7O A;  2V6X A;  3E08 A;  4Z8X A;  3UU4 A;  3OTO T;  3CWZ B;  4AXP A;  2BZB A;  3RC8 A;  1WR6 A;  2CRB A;  3Q5W A;  5HWX A;  2H3R A;  4EGW A;  4OYJ A;  3N2K E;  3UUL A;  1BR1 A;  1OWA A;  3NWI A;  2NR4 A;  3PUY F;  3N9P A;  1W0A A;  3ONL C;  1MMG A;  1L0V A;  5HCJ A;  3M65 A;  2D0T A; 
#chains in the Genus database with same CATH homology
 1G73 A;  2C5J A;  4GYS A;  2MTQ A;  1KK7 A;  2VKD A;  3J9X 1;  2KND A;  3EDU A;  3LFM A;  3UT5 E;  2NW7 A;  3OYX A;  2LSG A;  2HH7 A;  3N9M A;  2LE8 A;  2CCQ A;  4ZHQ E;  2IAK A;  2Y6X A;  3KDS E;  5LBQ B;  2J1D G;  5F3J A;  5DAB A;  2PFV A;  3ZYL A;  2VB6 A;  5LGT B;  3PE0 A;  5FXV A;  2LHR A;  4IDZ A;  2V26 A;  1BR4 A;  3ANW A;  5JDM A;  1CUN A;  2PJQ A;  3CPZ A;  5HYA A;  3N2G E;  4HKA A;  5LG4 A;  1NAF A;  4E7Z A;  4FI5 A;  3C4Z A;  4IE5 A;  3RYH E;  4J2C A;  4ZS3 A;  4KMC A;  3LBX A;  5J2U E;  3D0T A;  3L3P A;  1T98 A;  2KWH A;  4TV8 E;  3LBX B;  5DQW A;  3CX7 B;  4X1K E;  5F8P A;  4PJL A;  3RYC E;  1MIV A;  2X66 A;  5EK2 A;  5DQV A;  3E0Z A;  2JPF A;  1HFA A;  2QA7 A;  3FHN A;  3B57 A;  2E9X C;  3N2O A;  2JRK A;  5JR9 B;  5JDH A;  2LOS A;  5L3F B;  2BVL A;  4IIJ E;  2X0L B;  2L9Q A;  3OYZ A;  2G0U A;  3EVY A;  2V7L A;  4IGU A;  2VK9 A;  4HN9 A;  4JUY A;  4ZI2 C;  2DCF A;  1HG2 A;  1WYB A;  2VKJ A;  1YKE B;  2CWO A;  2V7I A;  5H6Q B;  2JMK A;  3HKD E;  5H6R B;  5HXR A;  3K3O A;  3SOL A;  5J1G A;  4U72 A;  5J2T E;  2CE7 A;  3EUH A;  3ZMS B;  2UXX B;  2PG8 A;  2NP9 A;  5FMN A;  5L3B B;  2LOP A;  5LBM A;  3RC3 A;  3V5S A;  1LRZ A;  2DNX A;  1HG5 A;  2WMN A;  5EK4 A;  5HXS A;  4UEM A;  3RH3 A;  2X9H A;  2XAG B;  4EAH A;  1WYC A;  3T8O A;  4C91 A;  3K8P C;  3BQK A;  3CQC B;  2LSI A;  2ZM8 A;  4IST A;  2LEH A;  4AQF C;  5AFU L;  4IE0 A;  3J7Y q;  2CEA A;  4HFV A;  1YW0 A;  2XAS B;  2Z6E A;  4ISS A;  1HX8 A;  3IF8 B;  3R6N A;  4TV9 E;  2NW8 A;  4H63 H;  3PUQ A;  3O9X A;  3SRZ A;  3O1I A;  5LYJ E;  5L2L A;  5KMG P;  4PK6 A;  5LGN B;  1BR2 A;  2E9X B;  1UX4 A;  5JR9 C;  2P9B A;  2XAJ B;  3I1A A;  4H9N C;  3ZN0 B;  2DWK A;  2E9X A;  3OBV E;  4B6X A;  4BA9 A;  3ZJ2 A;  3SWH A;  3BQI A;  5LHI B;  1YKH B;  2K48 A;  5HXE A;  2XQY A;  3E22 E;  3O1J A;  4YFS A;  3ZYM A;  4MAL A;  3Q2M A;  2EHO C;  2Q9Q C;  1BR0 A;  1D0X A;  4JEH B;  5JRE A;  3FB2 A;  3WAK A;  5M4Y A;  1O3X A;  3NZQ A;  4O4J E;  3MK7 C;  3HA4 A;  5JVD E;  4PJM A;  4XBF B;  1ZV4 X;  4XZC A;  4BJM A;  3U3I A;  5LNK A;  1HS7 A;  1ZKE A;  3Q9D A;  2YEV C;  4K0U A;  5LP6 E;  1SA0 E;  4GK5 E;  5JDQ A;  1UCU A;  4GK0 E;  2DHR A;  2BDE A;  5GON E;  1U4Q A;  3OJA A;  5FY1 A;  4JEU B;  4UVB B;  3F57 A;  4I55 E;  3CX6 B;  4DMV A;  4M1P A;  3C51 A;  3Q5X A;  3PTR B;  4PJJ A;  4DVD A;  4G63 A;  3KVB A;  5LXT E;  2QGS A;  3HKE E;  3HKB E;  2X9X A;  3UUM A;  4UV8 B;  2D2S A;  4AKL A;  4L5G A;  5LHG B;  2DI4 A;  5JH7 E;  2ODU A;  5JRC A;  4UIG A;  3GA8 A;  4PFP A;  1B7T A;  5EZY E;  2MOZ A;  2L3L A;  5LA6 E;  2N2N A;  3LG7 A;  3NRY A;  4KP3 C;  3CQG B;  3AVR A;  3I0Q A;  2D5U A;  2YK0 A;  3WI3 A;  3GWH A;  4DND A;  4QXB B;  3N5L A;  4V1A v;  1ZHC A;  2YU2 A;  2BVM A;  1YD8 G;  4EYY R;  4CI1 B;  2W00 A;  2LSK A;  3UTK A;  3JC6 D;  4EYU A;  3KVA A;  1MIY A;  3HKC E;  3B13 A;  5HXH A;  1MMN A;  1HCI A;  2A2F X;  1X79 A;  5ETW A;  3H37 A;  4BAY B;  3ANW B;  3VKH A;  4H9Q C;  3O4X E;  2K24 A;  2KLQ A;  2SPC A;  3KV6 A;  1UX5 A;  3BQL A;  5LJM A;  2ZMA A;  4P0A A;  5ADX L;  4U74 A;  1H7C A;  2CXD A;  4ZI3 C;  2W0G A;  5CA0 E;  5FNV E;  5CA1 E;  2W62 A;  1D0Y A;  4UEL A;  4UVC B;  3ZC0 A;  4OFZ A;  2KMF A;  5C8Y E;  2PBI A;  3PUG A;  3JC6 C;  3MXZ A;  2KZ7 B;  4WBO A;  1VOM A;  1MMD A;  4YLH A;  4DBQ A;  4PK5 A;  1D1B A;  3VHL A;  2JQQ A;  4MFR A;  3AAE B;  4EZH A;  2V7K A;  1U5P A;  3PUR A;  3QK6 A;  4ZI7 E;  2OA5 A;  3MZK B;  5LHH B;  3KV5 A;  4X1Y E;  3A5X A;  5JRC B;  2DLR A;  4F6R C;  2VL8 A;  5LGU B;  4H63 V;  1MMA A;  2NTY A;  4H9P C;  1OXZ A;  2RP4 A;  2D0U A;  2LT3 A;  4QX8 B;  4AKG A;  1ZEE A;  3I0O A;  5FY7 A;  1IAP A;  1QUU A;  2VWA A;  3ZMU B;  4CZZ B;  3C64 A;  1HTJ F;  4O2B E;  5LJN A;  4QXH B;  4PW8 A;  2A72 A;  2K9A A;  2XAQ B;  2VKO A;  2W63 A;  1IJ5 A;  5L3D B;  1D0Z A;  4DBR A;  3LK4 2;  2X9Y A;  1LVF A;  4TZ4 C;  5JDL A;  3FBZ A;  2VAS A;  2Y48 B;  3MAC A;  4CXX A;  5FP3 A;  4ANJ A;  2C0S A;  3UUN A;  4OK0 A;  1MND A;  2ACX A;  3V5U A;  2K5B B;  3AB3 B;  3ZMZ B;  2XUE A;  3GN5 B;  3ZCJ A;  4I50 E;  2YIN A;  1Y64 B;  4I43 B;  3HL6 A;  3ZC1 A;  2D0T A;  2NOX A;  2WMO A;  3QUJ A;  2X51 A;  3N9N A;  2E9X D;  1MNE A;  5L3C B;  3KFW X;  2LJL A;  2I59 A;  4QKN A;  2KXP B;  5LOV E;  5TAO A;  4O4L E;  4ZOL E;  3PUA A;  4NUU A;  4EB6 E;  2CWY A;  3AAA B;  4YJ3 E;  4AKH A;  3UFE A;  2EHO D;  2Q9Q D;  2X67 A;  4H9O C;  3PU8 A;  5L3E B;  5HXC A;  1EZ3 A;  5HAX A;  2HPL A;  4O2A E;  3IEE A;  4IHJ E;  3ZEF B;  1Z0P A;  3N9O A;  3RYI E;  2IW5 B;  2HPJ A;  3PUS A;  2VKH A;  3TKL B;  2IC9 A;  2NWB A;  3H3A A;  5JDN A;  2NW9 A;  3F31 A;  1AJ3 A;  3ZN1 B;  4BJN A;  5BMV E;  3ZLI A;  2W61 A;  5JR9 A;  4PFO A;  4GIW A;  4I4T E;  4AQG A;  4TN7 B;  2N1G A;  3C50 A;  3NRX A;  2A3D A;  3N9L A;  4MLK A;  4HGA A;  1VRB A;  4YJ2 E;  2L8K A;  5LCY A;  2C5K T;  4O8S A;  3CVR A;  3ESL A;  4CI3 B;  3ZPO A;  1D1A A;  4WW0 A;  3AVS A;  5KDM C;  2CA5 A;  4QXC B;  4N78 D;  2H7V C;  3ZMV B;  1FMW A;  4EIW A;  2N9D A;  1S94 A;  4X20 E;  5CB4 E;  3ETU A;  1US7 B;  5FYM A;  3AA0 B;  3R84 B;  2LHN A;  3RRC A;  5DJQ C;  5A1L A;  5L3G B;  2WWU A;  3PDY A;  4AI6 A;  3AAI A;  4KUM B;  4UVA B;  1IZN B;  3FBL A;  3KBT A;  4DO0 A;  4L9I A;  2DWG A;  2V7J A;  2EHO A;  2Q9Q A;  4O4I E;  3MKD A;  3RX6 A;  4HE8 A;  2EHO B;  2Q9Q B;  3IHR A;  2LM9 A;  2Y8D A;  4UV9 B;  5EK3 A;  1WRD A;  4DMW A;  4ERR A;  4PAG A;  3ONX A;  2E8I A;  4AQF A;  4WNK A;  3AA1 B;  5IHY A;  4ZI2 D;  3DTO A;  4ZS2 A;  3MJX A;  3I9W A;  2WBL A;  3SS1 A;  3ZMT B;  2ZLY A;  4NUV A;  3O1H A;  1FIO A;  3WAJ A;  2MBG A;  4EZ4 A;  3K3N A;  2KT9 A;  4YHJ A;  2WM9 A;  3OKQ A;  4IE6 A;  4L0R A;  2LSY A;  5FY0 A;  4ZI3 D;  2CLY C;  4PK4 A;  3C98 B;  2C5I T;  3RYF E;  2RA1 A;  4IE7 A;  2UXN B;  5E0O A;  4ADZ A;  4CXW A;  4CQI A;  2B1E A;  1LKX A;  4ASK A;  3DP7 A;  4E7S A;  3N9Q A;  2XAF B;  3VKG A;  4A56 A;  4H9R C;  5KX5 E;  2NTX A;  3CX8 B;  4X1I E;  4PJN A;  3ETV A;  3C4W A;  3UUX B;  3W15 B;  2M67 A;  4EOZ B;  1FMV A;  3BK9 A;  2XTL A;  2CLY B;  2KIN B;  3GN5 A;  3L09 A;  4O4H E;  3F2E A;  3KIN B;  1IJ6 A;  4HEA A;  3NBX X;  4PNI A;  4KBM B;  2CM0 A;  3RRW A;  5JDG A;  2JJ9 A;  2ZM2 A;  3KV9 A;  1WLX A;  4XAX B;  3P8C D;  1LVK A;  3MA9 A;  4C90 A;  4CXY A;  3CKD A;  4IE4 A;  4HTE A;  3KV4 A;  3FXD B;  2ODV A;  2X9W A;  3ZJ1 A;  3CQX C;  5JQG E;  3LK3 B;  3I9Y A;  2XHE B;  2IC6 A;  5JDF A;  4MBQ A;  3VU7 H;  3P7I A;  3KBU A;  5FXX A;  3IBP A;  3NZP A;  4QX7 B;  2XAH B;  2KWI B;  4WBN E;  1D1C A;  2JMH A;  3HI2 A;  2CXL A;  1V9D A;  2YU1 A;  3GMI A;  4GYR A;  2LSJ A;  4JLE A;  4QHO A;  4TX5 A;  2WSS V;  3K3Q C;  2GK9 A;  2MYS A;  3S4U A;  3ZCI A;  2X68 A;  4P09 A;  5IYZ E;  4AKI A;  4UXN B;  3C4X A;  4QWN B;  3CML A;  4OHF A;  4OYK A;  4MHC A;  1KNZ A;  3QC9 A;  5FXZ A;  2CMR A;  4EXT A;  4G2A A;  2V1D B;  4H9S E;  4AKR B;  1QSD A;  2WAU A;  3HR0 A;  1HF8 A;  4UF0 B;  3ZYK A;  1NWM X;  1MIW A;  1S35 A;  3FXE B;  4CI2 B;  4TUY E;  3EDV A;  3LK2 B;  3RPU A;  1E1H B;  2CXF A;  4GOU A;  4UF0 A;  1SHZ C;  2ES0 A;  1FEW A;  3PU3 A;  3AA7 B;  3LJC A;  3DJB A;  4ILU A;  5FXW A;  3U78 A;  5HWY A;  1G8X A;  4P0B A;  2V7M A;  3RKO A;  4FJO A;  3AA6 B;  2H7O A;  3E08 A;  4Z8X A;  3CWZ B;  4AXP A;  2BZB A;  3RC8 A;  1WR6 A;  3Q5W A;  5HWX A;  2H3R A;  4OYJ A;  3N2K E;  3UUL A;  1BR1 A;  1OWA A;  3N9P A;  1MMG A;  3M65 A;  2ZM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...