2N9DA

Structure analysis of the tom1 gat domain reveals distinct ligand-specific conformational states
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the GAT domain of the endosomal adapter protein Tom1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Target of Myb protein 1
total genus 38
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n9dA00
1WRDA 1NWMX 1X79A 1WR6A 1YD8G 2N9DA 1OXZA 1NAFA 2N2NA 1O3XA
chains in the Genus database with same CATH superfamily
4AISA 1E1HB 2XQ9A 3UUBA 5L3GB 5LOVE 5LNKA 3PUQA 3C64A 5ABEA 4ZZCA 2XQ3A 3KDSE 2WMOA 2AXDS 4PK6A 3Q5WA 1KNZA 1VRBA 3PJAA 3PUSA 3RC8A 3Q5XA 2WU2A 2YK0A 3I9WA 2KXPB 4MLKA 5AQKB 4JI1T 5IHYA 3RX6A 3MK7C 2E9XD 2LSKA 3Q9DA 4DV7T 3CWZB 2M6IA 3PURA 4WZXA 3CMLA 4X1IE 3TKLB 3B13A 3N9MA 3A5XA 1SA0E 1WRDA 3BQLA 4U31A 1L0VA 2WWVA 3BQIA 3NZPA 2CHOA 3ZN0B 3F2EA 1JNZA 3Q2MA 4AKRB 4DR5T 4PAGA 4LFBT 2N9DA 2XSBA 1HNZT 2JQQA 2X67A 3CQGB 5FMNA 4MFRA 4B6XA 4A97A 1T7SA 5CA1E 5LP6E 4AKHA 2NR4A 4QX8B 1X79A 2WB5A 2XQ6A 3H37A 4GIWA 4U7IA 2XHEB 5CJ5A 1SUMB 2BZBA 5HEGA 3SWHA 4CXWA 2L8KA 4PW8A 4OYJA 3A8YC 4UV8B 1UUSA 2CA5A 3RYCE 2MYSA 2J47A 2Z6EA 3AEDA 3C51A 3NVOA 4PK5A 5FVLA 1BR4A 2FBWA 2Q9QB 2VVNA 1XDPA 2WU5A 4I0UA 3RYHE 5C3JA 3C4WA 5AQJB 2XPKA 4PNIA 2LOPA 3N9QA 2G0UA 3PUZF 3QOFA 4QH5A 4UIGA 4Q25A 5LJNA 4O4LE 2IW5B 3OYXA 4DR1T 2UXCT 3FB2A 4CQIA 3PUGA 3LBXB 3P50A 4QKNA 2BG9B 5L3FB 2A3DA 2PJQA 2Y6XA 4UF0B 4UV9B 3NKZA 3CX7B 1Z0PA 3P4QA 2W00A 4NUUA 5LG3A 3CX6B 1LKXA 3CK6A 3H3MA 4CXXA 2IC6A 5AQHB 2HN1A 3TLUA 2WDVA 3KVAA 4X1YE 2W0GA 5EZYE 1YQ4A 5JDMA 4DR7T 3KVBA 3AEAA 4ZI7E 2D5UA 2WMNA 1WCRA 4U2ZA 3P4RA 2DL1A 2EHOD 2UXNB 3AVRA 5AQPB 1WLXA 4EXTA 5JQGE 2ODUA 4ZEYA 2XQYA 3ZPOA 5ABHA 1YKEB 2KLQA 5JVDE 2IC9A 3AAAB 5AQQB 4O4HE 3T1YT 4GK0E 2KSRA 1HFAA 3TLWA 2XAHB 3FXEB 3R6NA 2XAGB 3AXJA 3CQCB 2LKHA 2UUAT 3ZN1B 4AQFA 1VCTA 3LSVA 3UU3A 1J5ET 3AE6A 4WYVA 2K48A 2WCAA 5H6QB 2I0MA 3UT5E 1U4QA 1ZHCA 4MHCA 4MBQA 5KX5E 5JREA 3VKHA 4UXNB 3HKCE 5AQTB 5J0ZA 1OEDA 5LGTB 4ISSA 3FBZA 3CPZA 3K1SA 2FJAA 3AE8A 3JC6C 3QB5K 4QWNB 4CI2B 1MMGA 4YSYA 5LHIB 4YXDA 5L2LA 4COFA 4K0KT 5JR9B 2V7LA 3C4XA 3CQXC 3OKQA 1YXRA 5H6RB 1IAPA 2CBJA 4JEHB 4CN4A 2WBLA 4HKAA 3PDYA 4OX9T 3TLSA 2E9XA 4JYAT 4B3RT 4TNWA 1R8IA 1WR6A 3N9NA 3PUXF 3EVYA 3MXZA 4OK0A 5J2UE 1UX5A 2ES0A 5LB7B 5HYAA 2JQHA 5FY0A 3OTOT 4GKKT 3D0TA 3GWHA 2W4XA 4N78D 5AFUL 3ZJ2A 2LRLA 4L5GA 4X5TA 1US7B 4JI2T 2MOZA 3UU6A 4GKJT 3HI2A 3ZCJA 3PUAA 4EOZB 3AECA 4V1Av 2BG9C 4H9PC 4U7YA 5EK3A 1BR1A 2XQ5A 3AEEA 5DQWA 4LF6T 3AA6B 1MIYA 2E9XB 2IDOB 2L9QA 3ZLIA 2M67A 4KBMB 1N36T 2N1GA 2W62A 4AQFC 1MNDA 4I50E 4A98A 4EIWA 1UX4A 5DQVA 3JAEA 3UU5A 1AJ3A 3SRZA 4IDPA 2OA5A 5JTGA 2D0TA 5CGMA 4QXHB 5LBQB 2CWYA 2H3RA 2SPCA 2ODVA 4ISTA 1OWAA 3UU8A 5LYJE 1IBKT 4E7ZA 1OXZA 4KP3C 3UTKA 2V7IA 2H89A 3ANWA 4DMWA 1J1JA 2DCFA 4P0BA 1WYBA 4ZHQE 1V9DA 2JMHA 1E2AA 2NW7A 3KFWX 2CLYC 2WZIA 2WP9A 4ADZA 5JRCB 4JUYA 4BJMA 4BA9A 2X0YA 4ILCA 5L47A 1MMDA 1O3XA 2V7MA 4HWIB 2BG9E 3E0ZA 1JNRA 1SHZC 1YW0A 5FVKA 2VK9A 5L4HA 4HFIA 2E8IA 2JQKA 4HWCA 4DV4T 2JQ9A 4FI5A 2YU1A 1SE7A 3EHZA 4F8HA 4H9RC 1HG5A 4YTNA 2CXFA 5AQSB 5HWYA 2AE9A 5BR8T 1IBMT 5HAXA 2LRKA 2PBIA 2RA1A 3FHNA 4PK4A 3WAKA 2DHRA 3RYFE 1BR0A 4U3CA 2CM0A 3AVSA 3RGLA 3GA8A 2M6BA 3M65A 4HE8A 1N33T 1D1AA 3VRAA 2LSGA 5HWXA 2V6YB 3H3AA 4C91A 3AEGA 4O4JE 2EHOB 3HKBE 1LVKA 2CBIA 4YJ2E 4DR3T 2JRKA 5TAOA 3RIFA 4U74A 4IE5A 3ZYMA 3O1JA 3AEBA 2UXDT 1W0BA 5J2TE 3N9PA 3UFEA 2OV9A 2MPKA 3AAIA 5LHHB 4IDOA 4DV3T 2MTQA 2HN2A 1WYCA 4IDZA 2W67A 3FZFB 2LE8A 4JLEA 2V6YA 4QXBB 2MBGA 4DV1T 4HWDA 1NENA 2QGSA 2A2FX 4TNVA 5IWAT 2VKHA 3BK9A 4NXMT 1LRZA 1WR0A 4EEDA 2E9XC 2D2SA 1XZYA 4X1KE 2UUBT 2BS4A 2Y8DA 2CXDA 3EI0A 2UXBT 1KNPA 3HKDE 5LXTE 2BS3A 4H9SE 2BBJA 4X62T 2I6HA 4XBFB 4DVDA 3KBTA 2H7VC 3P4PA 4GOUA 2L3LA 4QH4A 2XY8B 4ZS3A 3RLFF 3ESLA 5CA0E 5HEJA 3I9YA 2VURA 3AEFA 4YHJA 3ONJA 2XAQB 4EYYR 2KNDA 3SOLA 2JPFA 1HNWT 4O2AE 4JEUB 1YQ3A 3VU7H 4CN6A 3MJXA 2C5IT 3OJAA 4LF8T 2V6XA 2LLYA 4OHFA 4B3TT 3N2OA 1M62A 2CE7A 2YKSA 3LBXA 4KHPT 2W66A 3ZMUB 3P8CD 5IUXA 2B1EA 5GONE 5JR9C 3QB5A 1IJ5A 5JDQA 1U5PA 2KZ7B 2BVMA 2W63A 2KWHA 2XQ7A 4H63V 3T1HT 4XZCA 4UELA 1FMWA 2K5BB 3AE4A 2Q9QA 3QUJA 4WBNE 2BKPA 5HEOA 3VHLA 2XZEA 5F3JA 4JI4T 2LKGA 4PJLA 3ZSTA 2FJBA 4JI5T 2ZM8A 1Y64B 4G63A 2VL8A 3ZMSB 3ZT7A 2X9HA 4IE4A 2WWUA 2LM2A 3GN5A 3PE0A 4TX5A 5AQIB 5ABGA 4DO0A 1MMNA 5FL1A 1D0YA 2D0UA 3SS1A 3T8OA 3F31A 4P0AA 5FKYA 2P9BA 3ABVA 3N9LA 3IEEA 2LEHA 3PUYF 2WZHA 3ZSSA 4O2BE 2WDQA 4YSXA 4LF4T 3PUVF 2IAKA 1E7PA 2NW8A 2HHHT 1KFYA 3E22E 4DV2T 4GYRA 3ZC1A 3MA9A 3N9OA 2JJ9A 4GK5E 2VWAA 2EHOA 2NTXA 2X9WA 4HN9A 4YFSA 3VR9A 3ZCIA 4AKLA 2HPJA 3PV0F 4P1NA 2BS2A 2CMRA 4H9OC 5LJMA 1X9BA 4JBWF 4KUMB 4TWDA 2GK9A 4IE7A 2JMKA 3AE7A 4WNKA 4ZXLA 3RF1A 4LFCT 5KMGP 2LSIA 1HTJF 1ZEEA 2BDEA 4EYUA 2C5KT 5KDMC 3N5LA 5C2TA 3PU3A 1QLBA 2ZMAA 5L3EB 4PFPA 2V7JA 3LJCA 3ZYKA 1UURA 3IBPA 3EDVA 4UVAB 4A56A 3U3IA 5HXHA 2A72A 3RIUA 2FUPA 5HXEA 2E5LT 3ETUA 2WY2A 2MAWA 4HFDA 2UUCT 4LF5T 1N34T 1OEDE 3IF8B 5F5WA 1KEYA 4X64T 5M4YA 1I6ZA 3K3NA 2H88A 4B3MT 2DI4A 4U72A 2ACZA 3JC6D 4BAYB 3B57A 2NW9A 3JCFA 2C5JA 2Y48B 4YTPA 2KINB 3RC3A 5FY1A 3PTRB 3RIUC 4UVCB 3EDUA 3KV6A 2QA7A 2WAUA 5LA6E 4DIDB 1NAFA 4PJNA 4NPPA 4C90A 2PFVA 2YDSA 3O1HA 1YD8G 1HCIA 2X0HA 3K3OA 2I59A 4UVBB 5LHGB 3GMIA 5LCYA 1CUNA 4H9QC 4X66T 4DV6T 2XTLA 4PFOA 4QHOA 2DWGA 5DJQC 3ZJ1A 1W9RA 5AQMB 3ZT5A 2UU9T 1B7TA 1UCUA 2HH7A 3LK2B 3PUWF 4J2CA 4DUZT 1GQEA 2BG9A 4AKIA 3RHWA 4CN1A 3CIRA 4QX7B 1T72A 2QYWA 3RRCA 5ABFA 3NWIA 4YT0A 1BR2A 2K3WA 2E5VA 3RIAA 2VL0A 5HCJA 3J7Yq 2CEAA 2YDRA 3HR0A 4QH1A 4H9NC 4LMLA 4MALA 4JV5T 2YOEA 3UUXB 3UQ7A 4TWFA 2IIUA 3GN5B 4HFBA 4YY3T 1D1CA 5FL0A 2XSAA 3ZYLA 4EGWA 1VCSA 3S4UA 1Y01A 4O4IE 2V7KA 4UR9A 3AA0B 3B5MA 4IDNA 4DR4T 2WM9A 2WQYA 2E2AA 1FJGT 5C8YE 5JRCA 4DMVA 5ABFB 2V8SV 1H7CA 3UU4A 3LK3B 5AQNB 2BKNA 2IHR1 2RP4A 3R84B 4IDQA 5EK4A 1HX1B 2ZM2A 3ONXA 2K24A 5F8PA 4ILAA 5FNVE 4IL4A 5JDNA 3HA4A 3M3ZB 4QXCB 2YDQA 3BQKA 5HXSA 2BVLA 1HS7A 5HEUA 4ILBA 1D1BA 2DWKA 5LBMA 4EV6A 2KMFA 3ANWB 3RRWA 3K8PC 1LVFA 4AQYT 4IE0A 3WAJA 2J62A 2X66A 3SFEA 4E7SA 3X1DA 3QK6A 3IHRA 4Z8XA 1KF6A 2LSJA 2LSYA 3C4ZA 4IHJE 4FJOA 4DBQA 3O1IA 1S94A 2BBHA 1ZKEA 2FJEA 4Z90A 1YKHB 1D0XA 2VB6A 2A9UA 3L3PA 4KMCA 5HXCA 3V5SA 4EAHA 3UQ4A 3I0OA 3V5UA 4AKGA 5FP3A 3KV9A 5AQOB 4G2AA 4IL9A 4TZ4C 2PG8A 5LMUT 4PJJA 4ZOLE 4ZS2A 2QRXA 4AIUA 4ZZBA 2YU2A 3VKGA 4KHZF 3G06A 3AA1B 4P09A 5AQLB 2D9DA 1UK5A 4L0RA 5JR9A 3NRYA 2BKOA 4KX6A 3NBXX 4ZI3D 3HL6A 1QUUA 4AI6A 5ETWA 5AQVB 1FEWA 3RYIE 1M7KA 2DLRA 3L39A 4K0UA 5FXVA 2XM1A 4HFHA 4UF0A 1XNQT 2VQET 1D0ZA 1XDOA 4IT4A 2J1DG 3ETVA 4M1PA 4U33A 5L4EA 2X68A 4CXYA 1HG2A 3KV4A 3C98B 1IZNB 2XJ7A 4GYSA 4ANJA 1IJ6A 5L3BB 3Q5DA 1ZV4X 2VKDA 4ILUA 3EAMA 5AQGB 2CWOA 3CX8B 3RQWA 3LFMA 3MZKB 3AE3A 2NP9A 5FXXA 2CRBA 4I43B 2VQFT 3RKGA 1MMAA 4F6RC 2KT9A 4HTEA 2H7OA 2IMLA 2X0LB 1NWMX 4DR2T 2VVSA 3RQUA 2CCQA 2HPLA 2NWBA 2ZM0A 3FZLB 1XMQT 1FMVA 1ZP0A 3F57A 1HR0T 1DU2A 5JDGA 3DTOA 3LK42 4CI1B 2Q9QC 4YSZA 4JI6T 2NOXA 3U78A 4OFZA 4ASKA 5J1GA 4ZI3C 5LGNB 1ZOYA 2CHNA 3CVRA 3AE1A 3ONLC 4HFVA 3UFGA 1IBLT 1HF8A 3VR8A 4I4TE 4JI7T 1KK7A 4TWHA 2VASA 2UXXB 5AQRB 2XQAA 1N32T 3ZKRA 4YLHA 3WI3A 4IE6A 5L3CB 2Q9QD 4PJMA 3P4WA 4TV9E 5IYZE 3ZC0A 1Z8UA 3P4SA 4EEBA 1NEKA 2XQ4A 2V5DA 3AE2A 2RPAA 3LDQB 1T8BA 2LOSA 4BJNA 4DV0T 3AE5A 4IREA 2CXLA 2X51A 3KINB 1HNXT 4B3ST 4JI0T 4YJ3E 4LFAT 2LHNA 2LT3A 2VKOA 3PJAJ 3ZT6A 4AXPA 2X9YA 5JDHA 3N2KE 2XUEA 3FZHB 3RH3A 3JAFA 1T98A 1W09A 1UGOA 2LHRA 4U2YA 1G73A 4LMJA 1HX8A 5A1LA 2R6GF 4DR6T 2LM9A 2DNXA 2XAFB 4TUYE 3ZMTB 3E08A 1EZ3A 4IIJE 2ZM6T 4LF7T 4DUYT 4NUVA 1OEDC 2J4GA 4EB6E 4JI3T 2FJDA 3A7MA 3O9XA 4UEMA 4ZI2D 5HCMA 4NXNT 3I1AA 4HFCA 2CLYB 3MACA 4IGUA 5LGUB 3UUNA 2PTFA 3KBUA 1OEDB 3CKDA 2JIWA 4H63H 2WSSV 3L09A 1QSDA 5ADXL 2C0SA 1S35A 3ZMVB 3DJBA 4YTMA 5FY7A 1FIOA 2VKJA 3EABA 5AQFB 2ZLYA 3FXDB 2YN6A 3KV5A 2N2NA 2K9AA 4L9IA 4NIQA 4TN7B 2EHOC 3AXJB 2WDRA 2KWIB 4DBRA 5KXJA 3K3QC 3VRBA 3J9X1 3P7IA 2V1DB 3O4XE 2OLTA 4OYKA 3C50A 4X20E 2XQ8A 2XASB 3OVUA 1MNEA 3NRXA 5BMVE 3Q5EA 4TV8E 3PU8A 4EZHA 5L3DB 2CPTA 2YEVC 5E0OA 5FYMA 1XWMA 4HGAA 3RPUA 2W61A 3SFDA 1KNRA 4Z91A 3UULA 2XM2A 4DNDA 1J5WA 2LJLA 4HWHA 1I94T 3AA7B 5JDFA 4ZI2C 1XNRT 4XAXB 2B76A 3OBVE 5CFBA 3MKDA 4HFEA 3AE9A 4I55E 1XMOT 1G8XA 4HEAA 4JI8T 2WS3A 4A5XA 1CHUA 4X65T 3FBLA 3FZMB 4KI0F 5FXZA 3RI5A 4WBOA 5EK2A 4DV5T 2IUBA 3RKOA 4LMKA 4WW0A 3UUMA 5DABA 3QC9A 5HEHA 3ZMZB 1W0AA 4CI3B 5LG4A 3JADA 3L8RA 2NTYA 2V26A 1VOMA 2F4VT 5LMNT 5JDLA 2YINA 5HXRA 3TLTA 3W15B 3EUHA 5AQUB 2XAJB 4CZZB 2W2UA 3QNUA 4ERRA 4HWFA 3AB3B 3AAEB 3ZEFB 3N2GE 1MIWA 3DP7A 4YHHT 4O8SA 3NZQA 3TLVA 3HKEE 5FXWA 2ACXA 4EZ4A 3OPCA 3IA3A 3I0QA 5JH7E 2X9XA 4AQGA 2QVAA 3LG7A 3OYZA 1WFDA 4LF9T 5CB4E 1MIVA 2V5CA 3FZKB
chains in the Genus database with same CATH topology
1E1HB 5LOVE 5LNKA 3PUQA 3C64A 3KDSE 2WMOA 4PK6A 3Q5WA 1KNZA 1VRBA 3PUSA 3RC8A 3Q5XA 2YK0A 3I9WA 2KXPB 4MLKA 5IHYA 3RX6A 3MK7C 2E9XD 2LSKA 3Q9DA 3CWZB 3PURA 4X1IE 3CMLA 3TKLB 3B13A 3N9MA 3A5XA 1SA0E 1WRDA 3BQLA 3BQIA 3NZPA 3ZN0B 4AKRB 3F2EA 3Q2MA 4PAGA 2N9DA 2JQQA 2X67A 3CQGB 5FMNA 4MFRA 4B6XA 5CA1E 4AKHA 5LP6E 4QX8B 1X79A 3H37A 4GIWA 2XHEB 2BZBA 4CXWA 3SWHA 2L8KA 4PW8A 4OYJA 4UV8B 3RYCE 2CA5A 2MYSA 2Z6EA 4PK5A 3C51A 3UUMA 3RYHE 1BR4A 2Q9QB 3C4WA 4PNIA 4UIGA 2LOPA 3N9QA 2G0UA 5LJNA 4O4LE 2IW5B 3OYXA 3FB2A 4CQIA 3PUGA 3LBXB 4QKNA 5L3FB 2A3DA 2PJQA 2Y6XA 4UF0B 4UV9B 3CX7B 1Z0PA 2W00A 4NUUA 3CX6B 1LKXA 4CXXA 2IC6A 3KVAA 4X1YE 2W0GA 5EZYE 5JDMA 3KVBA 4ZI7E 2D5UA 2WMNA 3AVRA 2EHOD 2UXNB 4EXTA 1WLXA 5JQGE 2ODUA 2XQYA 3ZPOA 1YKEB 2KLQA 5JVDE 2IC9A 3AAAB 4O4HE 4GK0E 1HFAA 2XAHB 3FXEB 3R6NA 2XAGB 3CQCB 3ZN1B 4AQFA 2K48A 5H6QB 3UT5E 1U4QA 1ZHCA 4MHCA 4MBQA 5KX5E 5JREA 3VKHA 4UXNB 3HKCE 5LGTB 4ISSA 3FBZA 3CPZA 4QWNB 4CI2B 3JC6C 1MMGA 5LHIB 5L2LA 5JR9B 2V7LA 3C4XA 3CQXC 3OKQA 5H6RB 1IAPA 4JEHB 2WBLA 4HKAA 3PDYA 2E9XA 1WR6A 3N9NA 3EVYA 3MXZA 4OK0A 5J2UE 1UX5A 2ES0A 5HYAA 5FY0A 3D0TA 3GWHA 4N78D 5AFUL 3ZJ2A 4L5GA 1US7B 2MOZA 3HI2A 3ZCJA 3PUAA 4EOZB 4V1Av 4H9PC 5EK3A 1BR1A 5DQWA 3AA6B 1MIYA 2E9XB 2L9QA 3ZLIA 2M67A 4KBMB 2N1GA 2W62A 4AQFC 1MNDA 4I50E 4EIWA 1AJ3A 1UX4A 5DQVA 2OA5A 2D0TA 4QXHB 5LBQB 2CWYA 2H3RA 2SPCA 2ODVA 4ISTA 1OWAA 5LYJE 4E7ZA 1OXZA 4KP3C 3UTKA 2V7IA 4DMWA 3ANWA 4ZHQE 2DCFA 4P0BA 1WYBA 1V9DA 2JMHA 2NW7A 3KFWX 2CLYC 4ADZA 5JRCB 4JUYA 4BJMA 4BA9A 1MMDA 1O3XA 2V7MA 3E0ZA 1SHZC 1YW0A 2VK9A 2E8IA 4FI5A 2YU1A 4H9RC 1HG5A 2CXFA 5HWYA 5HAXA 1BR0A 2PBIA 2RA1A 3FHNA 4PK4A 3WAKA 2DHRA 3RYFE 2CM0A 3AVSA 3GA8A 3M65A 4HE8A 1D1AA 2LSGA 5HWXA 3H3AA 4C91A 4O4JE 2EHOB 3HKBE 1LVKA 4YJ2E 2JRKA 5TAOA 4U74A 4IE5A 3ZYMA 3O1JA 3N9PA 3UFEA 3AAIA 5LHHB 2MTQA 1WYCA 4IDZA 4JLEA 2LE8A 4QXBB 2MBGA 2QGSA 2A2FX 2VKHA 3BK9A 1LRZA 2E9XC 2D2SA 4X1KE 2Y8DA 2CXDA 3HKDE 5LXTE 4H9SE 4XBFB 4DVDA 3KBTA 2H7VC 4GOUA 2L3LA 5CA0E 4ZS3A 3ESLA 3I9YA 4YHJA 2XAQB 4EYYR 2KNDA 3SOLA 2JPFA 4O2AE 4JEUB 3VU7H 3MJXA 2C5IT 3OJAA 4OHFA 3N2OA 2CE7A 3LBXA 3ZMUB 3P8CD 2B1EA 5GONE 5JR9C 1IJ5A 5JDQA 1U5PA 2KZ7B 2BVMA 2W63A 2KWHA 4H63V 4XZCA 4UELA 1FMWA 2K5BB 3QUJA 2Q9QA 4WBNE 3VHLA 5F3JA 4PJLA 3ZMSB 2ZM8A 1Y64B 4G63A 2VL8A 2X9HA 4IE4A 2WWUA 3PE0A 3GN5A 4TX5A 4DO0A 1MMNA 1D0YA 2D0UA 3SS1A 3T8OA 3F31A 4P0AA 2P9BA 3N9LA 3IEEA 2LEHA 4O2BE 2IAKA 2NW8A 3E22E 4GYRA 3ZC1A 3MA9A 3N9OA 2JJ9A 4GK5E 2VWAA 2EHOA 2NTXA 2X9WA 4HN9A 4YFSA 3ZCIA 4AKLA 2HPJA 2CMRA 4H9OC 5LJMA 4KUMB 4WNKA 2GK9A 4IE7A 2JMKA 5KMGP 2LSIA 1HTJF 1ZEEA 2BDEA 4EYUA 2C5KT 5KDMC 3N5LA 3PU3A 2ZMAA 5L3EB 4PFPA 2V7JA 3LJCA 3ZYKA 4A56A 3IBPA 3EDVA 4UVAB 5HXHA 3U3IA 5HXEA 2A72A 3ETUA 3IF8B 5M4YA 3K3NA 2DI4A 4U72A 3JC6D 4BAYB 3B57A 2NW9A 2C5JA 2Y48B 2KINB 3RC3A 5FY1A 3PTRB 4UVCB 3EDUA 3KV6A 2QA7A 2WAUA 5LA6E 1NAFA 4PJNA 4C90A 2PFVA 3O1HA 1YD8G 1HCIA 3K3OA 4UVBB 2I59A 5LHGB 3GMIA 5LCYA 1CUNA 4H9QC 2XTLA 4PFOA 4QHOA 2DWGA 5DJQC 3ZJ1A 1B7TA 1UCUA 2HH7A 3LK2B 4J2CA 4AKIA 4QX7B 3RRCA 1BR2A 3J7Yq 2CEAA 3HR0A 4H9NC 4MALA 3UUXB 3GN5B 1D1CA 3ZYLA 3S4UA 4O4IE 2V7KA 3AA0B 2WM9A 5JRCA 5C8YE 4DMVA 1H7CA 3LK3B 3R84B 2RP4A 5EK4A 2ZM2A 3ONXA 2K24A 5F8PA 5FNVE 5JDNA 3HA4A 4QXCB 3BQKA 5HXSA 2BVLA 1HS7A 1D1BA 2DWKA 5LBMA 2KMFA 3ANWB 3RRWA 3K8PC 1LVFA 4IE0A 3WAJA 2X66A 4E7SA 3QK6A 3IHRA 4Z8XA 2LSJA 2LSYA 3C4ZA 4IHJE 4DBQA 4FJOA 5J2TE 3O1IA 1S94A 1ZKEA 1YKHB 1D0XA 2VB6A 3L3PA 4KMCA 5HXCA 3V5SA 4EAHA 4ERRA 3I0OA 3V5UA 4AKGA 5FP3A 3KV9A 4G2AA 4TZ4C 2PG8A 4PJJA 4ZOLE 4ZS2A 2YU2A 3VKGA 3AA1B 4P09A 4L0RA 5JR9A 3NRYA 3NBXX 4ZI3D 3HL6A 1QUUA 4AI6A 5ETWA 1FEWA 3RYIE 2DLRA 4K0UA 5FXVA 4UF0A 1D0ZA 2J1DG 3ETVA 4M1PA 4CXYA 2X68A 1HG2A 3KV4A 3C98B 1IZNB 4GYSA 4ANJA 5L3BB 1IJ6A 1ZV4X 2VKDA 4ILUA 2CWOA 3CX8B 3LFMA 3MZKB 5FXXA 2NP9A 1MMAA 4F6RC 2KT9A 4HTEA 2H7OA 2X0LB 1NWMX 2CCQA 2HPLA 2NWBA 2ZM0A 1FMVA 3F57A 5JDGA 3DTOA 3LK42 4CI1B 2Q9QC 2NOXA 3U78A 4OFZA 4ASKA 5J1GA 4ZI3C 5LGNB 3CVRA 4HFVA 1HF8A 4I4TE 1KK7A 2VASA 2UXXB 4YLHA 3WI3A 4IE6A 5L3CB 2Q9QD 4PJMA 4TV9E 5IYZE 3ZC0A 2LOSA 4BJNA 2CXLA 2X51A 3KINB 4YJ3E 2LHNA 2LT3A 2VKOA 4AXPA 2X9YA 5JDHA 3N2KE 2XUEA 3RH3A 1T98A 2LHRA 1G73A 1HX8A 5A1LA 2LM9A 2DNXA 2XAFB 4TUYE 3ZMTB 3E08A 1EZ3A 4IIJE 4NUVA 4EB6E 3O9XA 4UEMA 4ZI2D 3I1AA 2CLYB 3MACA 4IGUA 5LGUB 3UUNA 3KBUA 3CKDA 4H63H 2WSSV 3L09A 1QSDA 5ADXL 2C0SA 1S35A 3ZMVB 3DJBA 5FY7A 1FIOA 2VKJA 2ZLYA 3FXDB 5CB4E 3KV5A 2N2NA 2K9AA 4L9IA 4TN7B 4I43B 2EHOC 4DBRA 2KWIB 3K3QC 3J9X1 3P7IA 2V1DB 3O4XE 4OYKA 4X20E 3C50A 2XASB 1MNEA 3NRXA 5BMVE 4TV8E 3PU8A 4EZHA 5L3DB 2YEVC 5E0OA 3SRZA 5FYMA 4HGAA 3RPUA 5L3GB 2W61A 3UULA 4DNDA 2LJLA 3AA7B 5JDFA 4ZI2C 4XAXB 3OBVE 3MKDA 4I55E 1G8XA 4HEAA 3FBLA 5FXZA 4WBOA 5EK2A 3RKOA 4WW0A 5DABA 3QC9A 4CI3B 3ZMZB 5LG4A 2NTYA 2V26A 1VOMA 5JDLA 2YINA 5HXRA 3W15B 3EUHA 2XAJB 4CZZB 3AB3B 3AAEB 3ZEFB 3N2GE 1MIWA 3DP7A 4O8SA 3NZQA 3HKEE 5FXWA 2ACXA 4EZ4A 3I0QA 5JH7E 2X9XA 4AQGA 3LG7A 3OYZA 1MIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRD A;  1NWM X;  1X79 A;  1WR6 A;  1YD8 G;  2N9D A;  1OXZ A;  1NAF A;  2N2N A;  1O3X A; 
#chains in the Genus database with same CATH topology
 4AIS A;  1E1H B;  2XQ9 A;  3UUB A;  5L3G B;  5LOV E;  5LNK A;  3PUQ A;  3C64 A;  5ABE A;  4ZZC A;  2XQ3 A;  3KDS E;  2WMO A;  2AXD S;  4PK6 A;  3Q5W A;  1KNZ A;  1VRB A;  3PJA A;  3PUS A;  3RC8 A;  3Q5X A;  2WU2 A;  2YK0 A;  3I9W A;  2KXP B;  4MLK A;  5AQK B;  4JI1 T;  5IHY A;  3RX6 A;  3MK7 C;  2E9X D;  2LSK A;  3Q9D A;  4DV7 T;  3CWZ B;  2M6I A;  3PUR A;  4WZX A;  3CML A;  4X1I E;  3TKL B;  3B13 A;  3N9M A;  3A5X A;  1SA0 E;  1WRD A;  3BQL A;  4U31 A;  1L0V A;  2WWV A;  3BQI A;  3NZP A;  2CHO A;  3ZN0 B;  3F2E A;  1JNZ A;  3Q2M A;  4AKR B;  4DR5 T;  4PAG A;  4LFB T;  2N9D A;  2XSB A;  1HNZ T;  2JQQ A;  2X67 A;  3CQG B;  5FMN A;  4MFR A;  4B6X A;  4A97 A;  1T7S A;  5CA1 E;  5LP6 E;  4AKH A;  2NR4 A;  4QX8 B;  1X79 A;  2WB5 A;  2XQ6 A;  3H37 A;  4GIW A;  4U7I A;  2XHE B;  5CJ5 A;  1SUM B;  2BZB A;  5HEG A;  3SWH A;  4CXW A;  2L8K A;  4PW8 A;  4OYJ A;  3A8Y C;  4UV8 B;  1UUS A;  2CA5 A;  3RYC E;  2MYS A;  2J47 A;  2Z6E A;  3AED A;  3C51 A;  3NVO A;  4PK5 A;  5FVL A;  1BR4 A;  2FBW A;  2Q9Q B;  2VVN A;  1XDP A;  2WU5 A;  4I0U A;  3RYH E;  5C3J A;  3C4W A;  5AQJ B;  2XPK A;  4PNI A;  2LOP A;  3N9Q A;  2G0U A;  3PUZ F;  3QOF A;  4QH5 A;  4UIG A;  4Q25 A;  5LJN A;  4O4L E;  2IW5 B;  3OYX A;  4DR1 T;  2UXC T;  3FB2 A;  4CQI A;  3PUG A;  3LBX B;  3P50 A;  4QKN A;  2BG9 B;  5L3F B;  2A3D A;  2PJQ A;  2Y6X A;  4UF0 B;  4UV9 B;  3NKZ A;  3CX7 B;  1Z0P A;  3P4Q A;  2W00 A;  4NUU A;  5LG3 A;  3CX6 B;  1LKX A;  3CK6 A;  3H3M A;  4CXX A;  2IC6 A;  5AQH B;  2HN1 A;  3TLU A;  2WDV A;  3KVA A;  4X1Y E;  2W0G A;  5EZY E;  1YQ4 A;  5JDM A;  4DR7 T;  3KVB A;  3AEA A;  4ZI7 E;  2D5U A;  2WMN A;  1WCR A;  4U2Z A;  3P4R A;  2DL1 A;  2EHO D;  2UXN B;  3AVR A;  5AQP B;  1WLX A;  4EXT A;  5JQG E;  2ODU A;  4ZEY A;  2XQY A;  3ZPO A;  5ABH A;  1YKE B;  2KLQ A;  5JVD E;  2IC9 A;  3AAA B;  5AQQ B;  4O4H E;  3T1Y T;  4GK0 E;  2KSR A;  1HFA A;  3TLW A;  2XAH B;  3FXE B;  3R6N A;  2XAG B;  3AXJ A;  3CQC B;  2LKH A;  2UUA T;  3ZN1 B;  4AQF A;  1VCT A;  3LSV A;  3UU3 A;  1J5E T;  3AE6 A;  4WYV A;  2K48 A;  2WCA A;  5H6Q B;  2I0M A;  3UT5 E;  1U4Q A;  1ZHC A;  4MHC A;  4MBQ A;  5KX5 E;  5JRE A;  3VKH A;  4UXN B;  3HKC E;  5AQT B;  5J0Z A;  1OED A;  5LGT B;  4ISS A;  3FBZ A;  3CPZ A;  3K1S A;  2FJA A;  3AE8 A;  3JC6 C;  3QB5 K;  4QWN B;  4CI2 B;  1MMG A;  4YSY A;  5LHI B;  4YXD A;  5L2L A;  4COF A;  4K0K T;  5JR9 B;  2V7L A;  3C4X A;  3CQX C;  3OKQ A;  1YXR A;  5H6R B;  1IAP A;  2CBJ A;  4JEH B;  4CN4 A;  2WBL A;  4HKA A;  3PDY A;  4OX9 T;  3TLS A;  2E9X A;  4JYA T;  4B3R T;  4TNW A;  1R8I A;  1WR6 A;  3N9N A;  3PUX F;  3EVY A;  3MXZ A;  4OK0 A;  5J2U E;  1UX5 A;  2ES0 A;  5LB7 B;  5HYA A;  2JQH A;  5FY0 A;  3OTO T;  4GKK T;  3D0T A;  3GWH A;  2W4X A;  4N78 D;  5AFU L;  3ZJ2 A;  2LRL A;  4L5G A;  4X5T A;  1US7 B;  4JI2 T;  2MOZ A;  3UU6 A;  4GKJ T;  3HI2 A;  3ZCJ A;  3PUA A;  4EOZ B;  3AEC A;  4V1A v;  2BG9 C;  4H9P C;  4U7Y A;  5EK3 A;  1BR1 A;  2XQ5 A;  3AEE A;  5DQW A;  4LF6 T;  3AA6 B;  1MIY A;  2E9X B;  2IDO B;  2L9Q A;  3ZLI A;  2M67 A;  4KBM B;  1N36 T;  2N1G A;  2W62 A;  4AQF C;  1MND A;  4I50 E;  4A98 A;  4EIW A;  1UX4 A;  5DQV A;  3JAE A;  3UU5 A;  1AJ3 A;  3SRZ A;  4IDP A;  2OA5 A;  5JTG A;  2D0T A;  5CGM A;  4QXH B;  5LBQ B;  2CWY A;  2H3R A;  2SPC A;  2ODV A;  4IST A;  1OWA A;  3UU8 A;  5LYJ E;  1IBK T;  4E7Z A;  1OXZ A;  4KP3 C;  3UTK A;  2V7I A;  2H89 A;  3ANW A;  4DMW A;  1J1J A;  2DCF A;  4P0B A;  1WYB A;  4ZHQ E;  1V9D A;  2JMH A;  1E2A A;  2NW7 A;  3KFW X;  2CLY C;  2WZI A;  2WP9 A;  4ADZ A;  5JRC B;  4JUY A;  4BJM A;  4BA9 A;  2X0Y A;  4ILC A;  5L47 A;  1MMD A;  1O3X A;  2V7M A;  4HWI B;  2BG9 E;  3E0Z A;  1JNR A;  1SHZ C;  1YW0 A;  5FVK A;  2VK9 A;  5L4H A;  4HFI A;  2E8I A;  2JQK A;  4HWC A;  4DV4 T;  2JQ9 A;  4FI5 A;  2YU1 A;  1SE7 A;  3EHZ A;  4F8H A;  4H9R C;  1HG5 A;  4YTN A;  2CXF A;  5AQS B;  5HWY A;  2AE9 A;  5BR8 T;  1IBM T;  5HAX A;  2LRK A;  2PBI A;  2RA1 A;  3FHN A;  4PK4 A;  3WAK A;  2DHR A;  3RYF E;  1BR0 A;  4U3C A;  2CM0 A;  3AVS A;  3RGL A;  3GA8 A;  2M6B A;  3M65 A;  4HE8 A;  1N33 T;  1D1A A;  3VRA A;  2LSG A;  5HWX A;  2V6Y B;  3H3A A;  4C91 A;  3AEG A;  4O4J E;  2EHO B;  3HKB E;  1LVK A;  2CBI A;  4YJ2 E;  4DR3 T;  2JRK A;  5TAO A;  3RIF A;  4U74 A;  4IE5 A;  3ZYM A;  3O1J A;  3AEB A;  2UXD T;  1W0B A;  5J2T E;  3N9P A;  3UFE A;  2OV9 A;  2MPK A;  3AAI A;  5LHH B;  4IDO A;  4DV3 T;  2MTQ A;  2HN2 A;  1WYC A;  4IDZ A;  2W67 A;  3FZF B;  2LE8 A;  4JLE A;  2V6Y A;  4QXB B;  2MBG A;  4DV1 T;  4HWD A;  1NEN A;  2QGS A;  2A2F X;  4TNV A;  5IWA T;  2VKH A;  3BK9 A;  4NXM T;  1LRZ A;  1WR0 A;  4EED A;  2E9X C;  2D2S A;  1XZY A;  4X1K E;  2UUB T;  2BS4 A;  2Y8D A;  2CXD A;  3EI0 A;  2UXB T;  1KNP A;  3HKD E;  5LXT E;  2BS3 A;  4H9S E;  2BBJ A;  4X62 T;  2I6H A;  4XBF B;  4DVD A;  3KBT A;  2H7V C;  3P4P A;  4GOU A;  2L3L A;  4QH4 A;  2XY8 B;  4ZS3 A;  3RLF F;  3ESL A;  5CA0 E;  5HEJ A;  3I9Y A;  2VUR A;  3AEF A;  4YHJ A;  3ONJ A;  2XAQ B;  4EYY R;  2KND A;  3SOL A;  2JPF A;  1HNW T;  4O2A E;  4JEU B;  1YQ3 A;  3VU7 H;  4CN6 A;  3MJX A;  2C5I T;  3OJA A;  4LF8 T;  2V6X A;  2LLY A;  4OHF A;  4B3T T;  3N2O A;  1M62 A;  2CE7 A;  2YKS A;  3LBX A;  4KHP T;  2W66 A;  3ZMU B;  3P8C D;  5IUX A;  2B1E A;  5GON E;  5JR9 C;  3QB5 A;  1IJ5 A;  5JDQ A;  1U5P A;  2KZ7 B;  2BVM A;  2W63 A;  2KWH A;  2XQ7 A;  4H63 V;  3T1H T;  4XZC A;  4UEL A;  1FMW A;  2K5B B;  3AE4 A;  2Q9Q A;  3QUJ A;  4WBN E;  2BKP A;  5HEO A;  3VHL A;  2XZE A;  5F3J A;  4JI4 T;  2LKG A;  4PJL A;  3ZST A;  2FJB A;  4JI5 T;  2ZM8 A;  1Y64 B;  4G63 A;  2VL8 A;  3ZMS B;  3ZT7 A;  2X9H A;  4IE4 A;  2WWU A;  2LM2 A;  3GN5 A;  3PE0 A;  4TX5 A;  5AQI B;  5ABG A;  4DO0 A;  1MMN A;  5FL1 A;  1D0Y A;  2D0U A;  3SS1 A;  3T8O A;  3F31 A;  4P0A A;  5FKY A;  2P9B A;  3ABV A;  3N9L A;  3IEE A;  2LEH A;  3PUY F;  2WZH A;  3ZSS A;  4O2B E;  2WDQ A;  4YSX A;  4LF4 T;  3PUV F;  2IAK A;  1E7P A;  2NW8 A;  2HHH T;  1KFY A;  3E22 E;  4DV2 T;  4GYR A;  3ZC1 A;  3MA9 A;  3N9O A;  2JJ9 A;  4GK5 E;  2VWA A;  2EHO A;  2NTX A;  2X9W A;  4HN9 A;  4YFS A;  3VR9 A;  3ZCI A;  4AKL A;  2HPJ A;  3PV0 F;  4P1N A;  2BS2 A;  2CMR A;  4H9O C;  5LJM A;  1X9B A;  4JBW F;  4KUM B;  4TWD A;  2GK9 A;  4IE7 A;  2JMK A;  3AE7 A;  4WNK A;  4ZXL A;  3RF1 A;  4LFC T;  5KMG P;  2LSI A;  1HTJ F;  1ZEE A;  2BDE A;  4EYU A;  2C5K T;  5KDM C;  3N5L A;  5C2T A;  3PU3 A;  1QLB A;  2ZMA A;  5L3E B;  4PFP A;  2V7J A;  3LJC A;  3ZYK A;  1UUR A;  3IBP A;  3EDV A;  4UVA B;  4A56 A;  3U3I A;  5HXH A;  2A72 A;  3RIU A;  2FUP A;  5HXE A;  2E5L T;  3ETU A;  2WY2 A;  2MAW A;  4HFD A;  2UUC T;  4LF5 T;  1N34 T;  1OED E;  3IF8 B;  5F5W A;  1KEY A;  4X64 T;  5M4Y A;  1I6Z A;  3K3N A;  2H88 A;  4B3M T;  2DI4 A;  4U72 A;  2ACZ A;  3JC6 D;  4BAY B;  3B57 A;  2NW9 A;  3JCF A;  2C5J A;  2Y48 B;  4YTP A;  2KIN B;  3RC3 A;  5FY1 A;  3PTR B;  3RIU C;  4UVC B;  3EDU A;  3KV6 A;  2QA7 A;  2WAU A;  5LA6 E;  4DID B;  1NAF A;  4PJN A;  4NPP A;  4C90 A;  2PFV A;  2YDS A;  3O1H A;  1YD8 G;  1HCI A;  2X0H A;  3K3O A;  2I59 A;  4UVB B;  5LHG B;  3GMI A;  5LCY A;  1CUN A;  4H9Q C;  4X66 T;  4DV6 T;  2XTL A;  4PFO A;  4QHO A;  2DWG A;  5DJQ C;  3ZJ1 A;  1W9R A;  5AQM B;  3ZT5 A;  2UU9 T;  1B7T A;  1UCU A;  2HH7 A;  3LK2 B;  3PUW F;  4J2C A;  4DUZ T;  1GQE A;  2BG9 A;  4AKI A;  3RHW A;  4CN1 A;  3CIR A;  4QX7 B;  1T72 A;  2QYW A;  3RRC A;  5ABF A;  3NWI A;  4YT0 A;  1BR2 A;  2K3W A;  2E5V A;  3RIA A;  2VL0 A;  5HCJ A;  3J7Y q;  2CEA A;  2YDR A;  3HR0 A;  4QH1 A;  4H9N C;  4LML A;  4MAL A;  4JV5 T;  2YOE A;  3UUX B;  3UQ7 A;  4TWF A;  2IIU A;  3GN5 B;  4HFB A;  4YY3 T;  1D1C A;  5FL0 A;  2XSA A;  3ZYL A;  4EGW A;  1VCS A;  3S4U A;  1Y01 A;  4O4I E;  2V7K A;  4UR9 A;  3AA0 B;  3B5M A;  4IDN A;  4DR4 T;  2WM9 A;  2WQY A;  2E2A A;  1FJG T;  5C8Y E;  5JRC A;  4DMV A;  5ABF B;  2V8S V;  1H7C A;  3UU4 A;  3LK3 B;  5AQN B;  2BKN A;  2IHR 1;  2RP4 A;  3R84 B;  4IDQ A;  5EK4 A;  1HX1 B;  2ZM2 A;  3ONX A;  2K24 A;  5F8P A;  4ILA A;  5FNV E;  4IL4 A;  5JDN A;  3HA4 A;  3M3Z B;  4QXC B;  2YDQ A;  3BQK A;  5HXS A;  2BVL A;  1HS7 A;  5HEU A;  4ILB A;  1D1B A;  2DWK A;  5LBM A;  4EV6 A;  2KMF A;  3ANW B;  3RRW A;  3K8P C;  1LVF A;  4AQY T;  4IE0 A;  3WAJ A;  2J62 A;  2X66 A;  3SFE A;  4E7S A;  3X1D A;  3QK6 A;  3IHR A;  4Z8X A;  1KF6 A;  2LSJ A;  2LSY A;  3C4Z A;  4IHJ E;  4FJO A;  4DBQ A;  3O1I A;  1S94 A;  2BBH A;  1ZKE A;  2FJE A;  4Z90 A;  1YKH B;  1D0X A;  2VB6 A;  2A9U A;  3L3P A;  4KMC A;  5HXC A;  3V5S A;  4EAH A;  3UQ4 A;  3I0O A;  3V5U A;  4AKG A;  5FP3 A;  3KV9 A;  5AQO B;  4G2A A;  4IL9 A;  4TZ4 C;  2PG8 A;  5LMU T;  4PJJ A;  4ZOL E;  4ZS2 A;  2QRX A;  4AIU A;  4ZZB A;  2YU2 A;  3VKG A;  4KHZ F;  3G06 A;  3AA1 B;  4P09 A;  5AQL B;  2D9D A;  1UK5 A;  4L0R A;  5JR9 A;  3NRY A;  2BKO A;  4KX6 A;  3NBX X;  4ZI3 D;  3HL6 A;  1QUU A;  4AI6 A;  5ETW A;  5AQV B;  1FEW A;  3RYI E;  1M7K A;  2DLR A;  3L39 A;  4K0U A;  5FXV A;  2XM1 A;  4HFH A;  4UF0 A;  1XNQ T;  2VQE T;  1D0Z A;  1XDO A;  4IT4 A;  2J1D G;  3ETV A;  4M1P A;  4U33 A;  5L4E A;  2X68 A;  4CXY A;  1HG2 A;  3KV4 A;  3C98 B;  1IZN B;  2XJ7 A;  4GYS A;  4ANJ A;  1IJ6 A;  5L3B B;  3Q5D A;  1ZV4 X;  2VKD A;  4ILU A;  3EAM A;  5AQG B;  2CWO A;  3CX8 B;  3RQW A;  3LFM A;  3MZK B;  3AE3 A;  2NP9 A;  5FXX A;  2CRB A;  4I43 B;  2VQF T;  3RKG A;  1MMA A;  4F6R C;  2KT9 A;  4HTE A;  2H7O A;  2IML A;  2X0L B;  1NWM X;  4DR2 T;  2VVS A;  3RQU A;  2CCQ A;  2HPL A;  2NWB A;  2ZM0 A;  3FZL B;  1XMQ T;  1FMV A;  1ZP0 A;  3F57 A;  1HR0 T;  1DU2 A;  5JDG A;  3DTO A;  3LK4 2;  4CI1 B;  2Q9Q C;  4YSZ A;  4JI6 T;  2NOX A;  3U78 A;  4OFZ A;  4ASK A;  5J1G A;  4ZI3 C;  5LGN B;  1ZOY A;  2CHN A;  3CVR A;  3AE1 A;  3ONL C;  4HFV A;  3UFG A;  1IBL T;  1HF8 A;  3VR8 A;  4I4T E;  4JI7 T;  1KK7 A;  4TWH A;  2VAS A;  2UXX B;  5AQR B;  2XQA A;  1N32 T;  3ZKR A;  4YLH A;  3WI3 A;  4IE6 A;  5L3C B;  2Q9Q D;  4PJM A;  3P4W A;  4TV9 E;  5IYZ E;  3ZC0 A;  1Z8U A;  3P4S A;  4EEB A;  1NEK A;  2XQ4 A;  2V5D A;  3AE2 A;  2RPA A;  3LDQ B;  1T8B A;  2LOS A;  4BJN A;  4DV0 T;  3AE5 A;  4IRE A;  2CXL A;  2X51 A;  3KIN B;  1HNX T;  4B3S T;  4JI0 T;  4YJ3 E;  4LFA T;  2LHN A;  2LT3 A;  2VKO A;  3PJA J;  3ZT6 A;  4AXP A;  2X9Y A;  5JDH A;  3N2K E;  2XUE A;  3FZH B;  3RH3 A;  3JAF A;  1T98 A;  1W09 A;  1UGO A;  2LHR A;  4U2Y A;  1G73 A;  4LMJ A;  1HX8 A;  5A1L A;  2R6G F;  4DR6 T;  2LM9 A;  2DNX A;  2XAF B;  4TUY E;  3ZMT B;  3E08 A;  1EZ3 A;  4IIJ E;  2ZM6 T;  4LF7 T;  4DUY T;  4NUV A;  1OED C;  2J4G A;  4EB6 E;  4JI3 T;  2FJD A;  3A7M A;  3O9X A;  4UEM A;  4ZI2 D;  5HCM A;  4NXN T;  3I1A A;  4HFC A;  2CLY B;  3MAC A;  4IGU A;  5LGU B;  3UUN A;  2PTF A;  3KBU A;  1OED B;  3CKD A;  2JIW A;  4H63 H;  2WSS V;  3L09 A;  1QSD A;  5ADX L;  2C0S A;  1S35 A;  3ZMV B;  3DJB A;  4YTM A;  5FY7 A;  1FIO A;  2VKJ A;  3EAB A;  5AQF B;  2ZLY A;  3FXD B;  2YN6 A;  3KV5 A;  2N2N A;  2K9A A;  4L9I A;  4NIQ A;  4TN7 B;  2EHO C;  3AXJ B;  2WDR A;  2KWI B;  4DBR A;  5KXJ A;  3K3Q C;  3VRB A;  3J9X 1;  3P7I A;  2V1D B;  3O4X E;  2OLT A;  4OYK A;  3C50 A;  4X20 E;  2XQ8 A;  2XAS B;  3OVU A;  1MNE A;  3NRX A;  5BMV E;  3Q5E A;  4TV8 E;  3PU8 A;  4EZH A;  5L3D B;  2CPT A;  2YEV C;  5E0O A;  5FYM A;  1XWM A;  4HGA A;  3RPU A;  2W61 A;  3SFD A;  1KNR A;  4Z91 A;  3UUL A;  2XM2 A;  4DND A;  1J5W A;  2LJL A;  4HWH A;  1I94 T;  3AA7 B;  5JDF A;  4ZI2 C;  1XNR T;  4XAX B;  2B76 A;  3OBV E;  5CFB A;  3MKD A;  4HFE A;  3AE9 A;  4I55 E;  1XMO T;  1G8X A;  4HEA A;  4JI8 T;  2WS3 A;  4A5X A;  1CHU A;  4X65 T;  3FBL A;  3FZM B;  4KI0 F;  5FXZ A;  3RI5 A;  4WBO A;  5EK2 A;  4DV5 T;  2IUB A;  3RKO A;  4LMK A;  4WW0 A;  3UUM A;  5DAB A;  3QC9 A;  5HEH A;  3ZMZ B;  1W0A A;  4CI3 B;  5LG4 A;  3JAD A;  3L8R A;  2NTY A;  2V26 A;  1VOM A;  2F4V T;  5LMN T;  5JDL A;  2YIN A;  5HXR A;  3TLT A;  3W15 B;  3EUH A;  5AQU B;  2XAJ B;  4CZZ B;  2W2U A;  3QNU A;  4ERR A;  4HWF A;  3AB3 B;  3AAE B;  3ZEF B;  3N2G E;  1MIW A;  3DP7 A;  4YHH T;  4O8S A;  3NZQ A;  3TLV A;  3HKE E;  5FXW A;  2ACX A;  4EZ4 A;  3OPC A;  3IA3 A;  3I0Q A;  5JH7 E;  2X9X A;  4AQG A;  2QVA A;  3LG7 A;  3OYZ A;  1WFD A;  4LF9 T;  5CB4 E;  1MIV A;  2V5C A;  3FZK B; 
#chains in the Genus database with same CATH homology
 1E1H B;  5LOV E;  5LNK A;  3PUQ A;  3C64 A;  3KDS E;  2WMO A;  4PK6 A;  3Q5W A;  1KNZ A;  1VRB A;  3PUS A;  3RC8 A;  3Q5X A;  2YK0 A;  3I9W A;  2KXP B;  4MLK A;  5IHY A;  3RX6 A;  3MK7 C;  2E9X D;  2LSK A;  3Q9D A;  3CWZ B;  3PUR A;  4X1I E;  3CML A;  3TKL B;  3B13 A;  3N9M A;  3A5X A;  1SA0 E;  1WRD A;  3BQL A;  3BQI A;  3NZP A;  3ZN0 B;  4AKR B;  3F2E A;  3Q2M A;  4PAG A;  2N9D A;  2JQQ A;  2X67 A;  3CQG B;  5FMN A;  4MFR A;  4B6X A;  5CA1 E;  4AKH A;  5LP6 E;  4QX8 B;  1X79 A;  3H37 A;  4GIW A;  2XHE B;  2BZB A;  4CXW A;  3SWH A;  2L8K A;  4PW8 A;  4OYJ A;  4UV8 B;  3RYC E;  2CA5 A;  2MYS A;  2Z6E A;  4PK5 A;  3C51 A;  3UUM A;  3RYH E;  1BR4 A;  2Q9Q B;  3C4W A;  4PNI A;  4UIG A;  2LOP A;  3N9Q A;  2G0U A;  5LJN A;  4O4L E;  2IW5 B;  3OYX A;  3FB2 A;  4CQI A;  3PUG A;  3LBX B;  4QKN A;  5L3F B;  2A3D A;  2PJQ A;  2Y6X A;  4UF0 B;  4UV9 B;  3CX7 B;  1Z0P A;  2W00 A;  4NUU A;  3CX6 B;  1LKX A;  4CXX A;  2IC6 A;  3KVA A;  4X1Y E;  2W0G A;  5EZY E;  5JDM A;  3KVB A;  4ZI7 E;  2D5U A;  2WMN A;  3AVR A;  2EHO D;  2UXN B;  4EXT A;  1WLX A;  5JQG E;  2ODU A;  2XQY A;  3ZPO A;  1YKE B;  2KLQ A;  5JVD E;  2IC9 A;  3AAA B;  4O4H E;  4GK0 E;  1HFA A;  2XAH B;  3FXE B;  3R6N A;  2XAG B;  3CQC B;  3ZN1 B;  4AQF A;  2K48 A;  5H6Q B;  3UT5 E;  1U4Q A;  1ZHC A;  4MHC A;  4MBQ A;  5KX5 E;  5JRE A;  3VKH A;  4UXN B;  3HKC E;  5LGT B;  4ISS A;  3FBZ A;  3CPZ A;  4QWN B;  4CI2 B;  3JC6 C;  1MMG A;  5LHI B;  5L2L A;  5JR9 B;  2V7L A;  3C4X A;  3CQX C;  3OKQ A;  5H6R B;  1IAP A;  4JEH B;  2WBL A;  4HKA A;  3PDY A;  2E9X A;  1WR6 A;  3N9N A;  3EVY A;  3MXZ A;  4OK0 A;  5J2U E;  1UX5 A;  2ES0 A;  5HYA A;  5FY0 A;  3D0T A;  3GWH A;  4N78 D;  5AFU L;  3ZJ2 A;  4L5G A;  1US7 B;  2MOZ A;  3HI2 A;  3ZCJ A;  3PUA A;  4EOZ B;  4V1A v;  4H9P C;  5EK3 A;  1BR1 A;  5DQW A;  3AA6 B;  1MIY A;  2E9X B;  2L9Q A;  3ZLI A;  2M67 A;  4KBM B;  2N1G A;  2W62 A;  4AQF C;  1MND A;  4I50 E;  4EIW A;  1AJ3 A;  1UX4 A;  5DQV A;  2OA5 A;  2D0T A;  4QXH B;  5LBQ B;  2CWY A;  2H3R A;  2SPC A;  2ODV A;  4IST A;  1OWA A;  5LYJ E;  4E7Z A;  1OXZ A;  4KP3 C;  3UTK A;  2V7I A;  4DMW A;  3ANW A;  4ZHQ E;  2DCF A;  4P0B A;  1WYB A;  1V9D A;  2JMH A;  2NW7 A;  3KFW X;  2CLY C;  4ADZ A;  5JRC B;  4JUY A;  4BJM A;  4BA9 A;  1MMD A;  1O3X A;  2V7M A;  3E0Z A;  1SHZ C;  1YW0 A;  2VK9 A;  2E8I A;  4FI5 A;  2YU1 A;  4H9R C;  1HG5 A;  2CXF A;  5HWY A;  5HAX A;  1BR0 A;  2PBI A;  2RA1 A;  3FHN A;  4PK4 A;  3WAK A;  2DHR A;  3RYF E;  2CM0 A;  3AVS A;  3GA8 A;  3M65 A;  4HE8 A;  1D1A A;  2LSG A;  5HWX A;  3H3A A;  4C91 A;  4O4J E;  2EHO B;  3HKB E;  1LVK A;  4YJ2 E;  2JRK A;  5TAO A;  4U74 A;  4IE5 A;  3ZYM A;  3O1J A;  3N9P A;  3UFE A;  3AAI A;  5LHH B;  2MTQ A;  1WYC A;  4IDZ A;  4JLE A;  2LE8 A;  4QXB B;  2MBG A;  2QGS A;  2A2F X;  2VKH A;  3BK9 A;  1LRZ A;  2E9X C;  2D2S A;  4X1K E;  2Y8D A;  2CXD A;  3HKD E;  5LXT E;  4H9S E;  4XBF B;  4DVD A;  3KBT A;  2H7V C;  4GOU A;  2L3L A;  5CA0 E;  4ZS3 A;  3ESL A;  3I9Y A;  4YHJ A;  2XAQ B;  4EYY R;  2KND A;  3SOL A;  2JPF A;  4O2A E;  4JEU B;  3VU7 H;  3MJX A;  2C5I T;  3OJA A;  4OHF A;  3N2O A;  2CE7 A;  3LBX A;  3ZMU B;  3P8C D;  2B1E A;  5GON E;  5JR9 C;  1IJ5 A;  5JDQ A;  1U5P A;  2KZ7 B;  2BVM A;  2W63 A;  2KWH A;  4H63 V;  4XZC A;  4UEL A;  1FMW A;  2K5B B;  3QUJ A;  2Q9Q A;  4WBN E;  3VHL A;  5F3J A;  4PJL A;  3ZMS B;  2ZM8 A;  1Y64 B;  4G63 A;  2VL8 A;  2X9H A;  4IE4 A;  2WWU A;  3PE0 A;  3GN5 A;  4TX5 A;  4DO0 A;  1MMN A;  1D0Y A;  2D0U A;  3SS1 A;  3T8O A;  3F31 A;  4P0A A;  2P9B A;  3N9L A;  3IEE A;  2LEH A;  4O2B E;  2IAK A;  2NW8 A;  3E22 E;  4GYR A;  3ZC1 A;  3MA9 A;  3N9O A;  2JJ9 A;  4GK5 E;  2VWA A;  2EHO A;  2NTX A;  2X9W A;  4HN9 A;  4YFS A;  3ZCI A;  4AKL A;  2HPJ A;  2CMR A;  4H9O C;  5LJM A;  4KUM B;  4WNK A;  2GK9 A;  4IE7 A;  2JMK A;  5KMG P;  2LSI A;  1HTJ F;  1ZEE A;  2BDE A;  4EYU A;  2C5K T;  5KDM C;  3N5L A;  3PU3 A;  2ZMA A;  5L3E B;  4PFP A;  2V7J A;  3LJC A;  3ZYK A;  4A56 A;  3IBP A;  3EDV A;  4UVA B;  5HXH A;  3U3I A;  5HXE A;  2A72 A;  3ETU A;  3IF8 B;  5M4Y A;  3K3N A;  2DI4 A;  4U72 A;  3JC6 D;  4BAY B;  3B57 A;  2NW9 A;  2C5J A;  2Y48 B;  2KIN B;  3RC3 A;  5FY1 A;  3PTR B;  4UVC B;  3EDU A;  3KV6 A;  2QA7 A;  2WAU A;  5LA6 E;  1NAF A;  4PJN A;  4C90 A;  2PFV A;  3O1H A;  1YD8 G;  1HCI A;  3K3O A;  4UVB B;  2I59 A;  5LHG B;  3GMI A;  5LCY A;  1CUN A;  4H9Q C;  2XTL A;  4PFO A;  4QHO A;  2DWG A;  5DJQ C;  3ZJ1 A;  1B7T A;  1UCU A;  2HH7 A;  3LK2 B;  4J2C A;  4AKI A;  4QX7 B;  3RRC A;  1BR2 A;  3J7Y q;  2CEA A;  3HR0 A;  4H9N C;  4MAL A;  3UUX B;  3GN5 B;  1D1C A;  3ZYL A;  3S4U A;  4O4I E;  2V7K A;  3AA0 B;  2WM9 A;  5JRC A;  5C8Y E;  4DMV A;  1H7C A;  3LK3 B;  3R84 B;  2RP4 A;  5EK4 A;  2ZM2 A;  3ONX A;  2K24 A;  5F8P A;  5FNV E;  5JDN A;  3HA4 A;  4QXC B;  3BQK A;  5HXS A;  2BVL A;  1HS7 A;  1D1B A;  2DWK A;  5LBM A;  2KMF A;  3ANW B;  3RRW A;  3K8P C;  1LVF A;  4IE0 A;  3WAJ A;  2X66 A;  4E7S A;  3QK6 A;  3IHR A;  4Z8X A;  2LSJ A;  2LSY A;  3C4Z A;  4IHJ E;  4DBQ A;  4FJO A;  5J2T E;  3O1I A;  1S94 A;  1ZKE A;  1YKH B;  1D0X A;  2VB6 A;  3L3P A;  4KMC A;  5HXC A;  3V5S A;  4EAH A;  4ERR A;  3I0O A;  3V5U A;  4AKG A;  5FP3 A;  3KV9 A;  4G2A A;  4TZ4 C;  2PG8 A;  4PJJ A;  4ZOL E;  4ZS2 A;  2YU2 A;  3VKG A;  3AA1 B;  4P09 A;  4L0R A;  5JR9 A;  3NRY A;  3NBX X;  4ZI3 D;  3HL6 A;  1QUU A;  4AI6 A;  5ETW A;  1FEW A;  3RYI E;  2DLR A;  4K0U A;  5FXV A;  4UF0 A;  1D0Z A;  2J1D G;  3ETV A;  4M1P A;  4CXY A;  2X68 A;  1HG2 A;  3KV4 A;  3C98 B;  1IZN B;  4GYS A;  4ANJ A;  5L3B B;  1IJ6 A;  1ZV4 X;  2VKD A;  4ILU A;  2CWO A;  3CX8 B;  3LFM A;  3MZK B;  5FXX A;  2NP9 A;  1MMA A;  4F6R C;  2KT9 A;  4HTE A;  2H7O A;  2X0L B;  1NWM X;  2CCQ A;  2HPL A;  2NWB A;  2ZM0 A;  1FMV A;  3F57 A;  5JDG A;  3DTO A;  3LK4 2;  4CI1 B;  2Q9Q C;  2NOX A;  3U78 A;  4OFZ A;  4ASK A;  5J1G A;  4ZI3 C;  5LGN B;  3CVR A;  4HFV A;  1HF8 A;  4I4T E;  1KK7 A;  2VAS A;  2UXX B;  4YLH A;  3WI3 A;  4IE6 A;  5L3C B;  2Q9Q D;  4PJM A;  4TV9 E;  5IYZ E;  3ZC0 A;  2LOS A;  4BJN A;  2CXL A;  2X51 A;  3KIN B;  4YJ3 E;  2LHN A;  2LT3 A;  2VKO A;  4AXP A;  2X9Y A;  5JDH A;  3N2K E;  2XUE A;  3RH3 A;  1T98 A;  2LHR A;  1G73 A;  1HX8 A;  5A1L A;  2LM9 A;  2DNX A;  2XAF B;  4TUY E;  3ZMT B;  3E08 A;  1EZ3 A;  4IIJ E;  4NUV A;  4EB6 E;  3O9X A;  4UEM A;  4ZI2 D;  3I1A A;  2CLY B;  3MAC A;  4IGU A;  5LGU B;  3UUN A;  3KBU A;  3CKD A;  4H63 H;  2WSS V;  3L09 A;  1QSD A;  5ADX L;  2C0S A;  1S35 A;  3ZMV B;  3DJB A;  5FY7 A;  1FIO A;  2VKJ A;  2ZLY A;  3FXD B;  5CB4 E;  3KV5 A;  2N2N A;  2K9A A;  4L9I A;  4TN7 B;  4I43 B;  2EHO C;  4DBR A;  2KWI B;  3K3Q C;  3J9X 1;  3P7I A;  2V1D B;  3O4X E;  4OYK A;  4X20 E;  3C50 A;  2XAS B;  1MNE A;  3NRX A;  5BMV E;  4TV8 E;  3PU8 A;  4EZH A;  5L3D B;  2YEV C;  5E0O A;  3SRZ A;  5FYM A;  4HGA A;  3RPU A;  5L3G B;  2W61 A;  3UUL A;  4DND A;  2LJL A;  3AA7 B;  5JDF A;  4ZI2 C;  4XAX B;  3OBV E;  3MKD A;  4I55 E;  1G8X A;  4HEA A;  3FBL A;  5FXZ A;  4WBO A;  5EK2 A;  3RKO A;  4WW0 A;  5DAB A;  3QC9 A;  4CI3 B;  3ZMZ B;  5LG4 A;  2NTY A;  2V26 A;  1VOM A;  5JDL A;  2YIN A;  5HXR A;  3W15 B;  3EUH A;  2XAJ B;  4CZZ B;  3AB3 B;  3AAE B;  3ZEF B;  3N2G E;  1MIW A;  3DP7 A;  4O8S A;  3NZQ A;  3HKE E;  5FXW A;  2ACX A;  4EZ4 A;  3I0Q A;  5JH7 E;  2X9X A;  4AQG A;  3LG7 A;  3OYZ A;  1MIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...