1W0AA

Solution structure of the trans form of the human alpha-hemoglobin stabilizing protein (ahsp)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
LLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the alpha-hemoglobin stabilizing protein: insights into conformational heterogeneity and binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords ALPHA-HEMOGLOBIN STABILIZING PROTEIN
total genus 32
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1w0aA00
3Q5DA 1W09A 4IDOA 3OVUA 3X1DA 3IA3A 1XZYA 1W0AA 4IDPA 1Y01A 3QNUA 4IDNA 3Q5EA 1Z8UA 1W0BA 4IDQA 3QOFA
chains in the Genus database with same CATH superfamily
2LT3A 3ZEFB 4LFCT 3OYZA 5L3CB 5ABHA 4XZCA 1FJGT 3CPZA 4N78D 2XQ5A 1XDOA 5AQRB 3QB5K 2VURA 1UX5A 1WR0A 2NP9A 2YU1A 3RYIE 1NWMX 2Y6XA 5ETWA 1NAFA 2KINB 4NPPA 2ZM0A 2Q9QD 3MZKB 3Q5EA 4JI5T 4UF0A 5AQQB 4QHOA 5FY1A 3ZSSA 4EOZB 5JTGA 3R84B 4HFEA 2D9DA 5AQKB 2K24A 5KDMC 2X66A 4CXXA 5AQFB 1MIYA 4JI8T 1MMGA 2LRLA 4H9NC 3DP7A 5FXVA 4EEBA 2H88A 3WI3A 4LF7T 3E0ZA 3Q5WA 3LBXB 2YDQA 2YK0A 2Q9QB 1S94A 4HN9A 4IE7A 3ZC1A 5LBMA 3C50A 4DR7T 1HNZT 2K48A 2BG9B 3RI5A 5JDLA 1BR1A 3FZMB 3UTKA 2DLRA 4ILUA 1WYBA 4EIWA 2CM0A 3ZCIA 3E22E 2LE8A 3UQ4A 1VRBA 2XAFB 4U72A 1AJ3A 4CI1B 2YEVC 5AQGB 2YU2A 4HWDA 2I59A 5FY7A 2JJ9A 2RP4A 2LHRA 3UUBA 3NVOA 4ERRA 4CN4A 5JR9A 3F57A 5ABGA 2MTQA 3NRXA 4X1YE 2JRKA 5HCMA 4O2AE 3UU5A 4BAYB 3T1YT 5AQSB 2WQYA 4OHFA 4IT4A 5JDGA 5LGNB 4L5GA 3U78A 5HEJA 3CQGB 3M65A 3N9NA 3KV9A 4GOUA 3RPUA 2KZ7B 2UXXB 1XZYA 3AEBA 2JMKA 5JVDE 2FBWA 2LSKA 3N9OA 4MFRA 1OEDA 1WLXA 2MOZA 3RQUA 2DHRA 3FZLB 3JAFA 5ABEA 3BQKA 2BS3A 3I9YA 4Z90A 2KT9A 3KBTA 4U3CA 2CWYA 4V1Av 4JEUB 5JDHA 2HH7A 2BKOA 2BS2A 2PG8A 3NWIA 3RRCA 2VKHA 3OPCA 3KDSE 5LB7B 2CXDA 3N9LA 4TWDA 5CA1E 2J1DG 2R6GF 2WM9A 4AQFC 2H89A 2V7IA 3FXDB 5FXZA 2J47A 2LOPA 2G0UA 2CEAA 2PFVA 5A1LA 4DR1T 2X9XA 4ZZBA 5LMNT 1E2AA 1H7CA 3PU3A 4I50E 1MMNA 2V6YA 1HX8A 3AEAA 4ILAA 4FJOA 5AQLB 4LMKA 5FP3A 3RIAA 3AE9A 3QNUA 3AA7B 4FI5A 5LP6E 3NBXX 3HR0A 4PW8A 5J1GA 4YTPA 3VKHA 2NW7A 1ZOYA 4G63A 2XQ6A 4NUUA 4QXCB 3PJAA 4XAXB 2BVMA 3UU3A 3N5LA 3X1DA 4DBQA 3AE7A 2LOSA 2WDRA 2WDQA 3ONXA 2MBGA 3ZMTB 4ASKA 2Q9QC 1GQEA 2XQ8A 3CIRA 2JIWA 4IHJE 2XAHB 5L2LA 3QK6A 3IBPA 3V5SA 4AKIA 2WY2A 2VVNA 3NRYA 3VHLA 2CRBA 3CK6A 3JAEA 3PUVF 2LSIA 2NOXA 4NIQA 4JI3T 2X0LB 5LXTE 4DV0T 4IDPA 2X9HA 1B7TA 3LK3B 1N36T 2PBIA 3ZPOA 3ZMUB 1ZV4X 3NZQA 1XMQT 5IHYA 2C0SA 3IEEA 4ILBA 5HEOA 3RH3A 2UU9T 4LFAT 4YJ2E 4EZHA 2ACXA 2QGSA 4QH4A 1FEWA 2VVSA 2Z6EA 3RC3A 1HF8A 2XM2A 5FVKA 5BMVE 2IAKA 4CXYA 2B76A 1UCUA 2LHNA 3C4XA 3B13A 3FZFB 2FJBA 1Y01A 2B1EA 5AQHB 4EGWA 5KXJA 4CQIA 3Q5DA 3W15B 1D0ZA 2XQ3A 4GIWA 1FIOA 4DR2T 4AKHA 3OVUA 2WZHA 5HWXA 5AQVB 5L3GB 2KWHA 2Y8DA 2VKDA 4HWHA 4L9IA 1Y64B 5H6RB 1W0BA 4PAGA 3UUMA 4AKGA 2XAGB 5J0ZA 1D1BA 2HN1A 1W09A 3AEDA 2KSRA 2V8SV 3H3AA 1J5ET 2E5LT 1BR0A 2LM9A 2HPLA 4ZI2C 5CGMA 4LF8T 5L47A 3B57A 3B5MA 4NXMT 4YTMA 4DIDB 2JPFA 2XQAA 2A9UA 3HA4A 1VCTA 2N9DA 4H9SE 4TNWA 5DQWA 1OEDC 5BR8T 3OKQA 1OXZA 2XTLA 4H63V 4ZI2D 4EXTA 4JYAT 4L0RA 4O4HE 5J2UE 4AXPA 3PUGA 3ZJ2A 5LG4A 2X0YA 3LK2B 3EAMA 4LF5T 3PUSA 1HG2A 3UU4A 4KUMB 2WMNA 2KMFA 3OBVE 3VRBA 5HAXA 4YTNA 5JR9B 3WAJA 3UUXB 2F4VT 3ZC0A 2JQQA 1FMWA 1BR4A 4UVAB 3KV5A 3BK9A 3RHWA 2ZM6T 3PURA 4X1IE 3P4SA 5F3JA 3AEEA 3RC8A 1YKHB 1DU2A 1XWMA 4EEDA 1HX1B 3GA8A 5HXEA 3ZYMA 3KBUA 4TV8E 1MIVA 2EHOA 2H3RA 2A2FX 3I0QA 4KX6A 5AQJB 3AE8A 2L3LA 2BG9E 2MYSA 3AE5A 2E9XC 1KF6A 2XHEB 2XZEA 5FKYA 3SFDA 3ZN0B 4HE8A 3PJAJ 4WYVA 4YSXA 3KINB 3UUNA 1US7B 3TLSA 3E08A 5AQMB 1W0AA 3ZKRA 2E8IA 3VR9A 3RIUC 2E2AA 1I94T 4QXBB 3C64A 2CLYB 4KBMB 3FBLA 2I6HA 2CLYC 5FNVE 4DV6T 4UV9B 4BJNA 4ZEYA 3N9MA 4DBRA 1XNQT 2VQET 4U33A 2IC6A 1KEYA 2LJLA 5E0OA 4EAHA 5FXXA 2BDEA 5JR9C 1LKXA 2BBJA 2XAJB 2X9YA 2XPKA 2DCFA 2NTXA 2DWKA 2YDSA 2VL0A 3LG7A 4ISTA 4MLKA 3RF1A 4UELA 2X9WA 2XQYA 3RYFE 4H9OC 4MALA 3MA9A 4KI0F 4P0BA 3VU7H 2LEHA 4I55E 4U2YA 3ZT6A 4PJLA 3ZN1B 3AVSA 4CI2B 3A8YC 1D0YA 5AFUL 1ZP0A 3AEFA 4WBNE 4K0KT 2LSJA 2MAWA 3K3NA 2WWUA 2WP9A 1MNEA 5HXCA 2JQKA 1J1JA 3FHNA 4H9PC 2CMRA 2GK9A 2XSAA 4TV9E 2EHOD 4ANJA 1QSDA 1T98A 3FZHB 3IA3A 3PUXF 2VWAA 2DNXA 4OFZA 5HEGA 4EV6A 1UK5A 5LGTB 5M4YA 4DR3T 4DMVA 4KHPT 3QC9A 3BQIA 3LSVA 2DL1A 4H9RC 2QA7A 4HFDA 5AQNB 1QUUA 1UURA 2M6BA 3J9X1 4NUVA 4HFHA 3TLTA 2QVAA 2XQ9A 5IYZE 1HS7A 3C98B 4H63H 3ONLC 4J2CA 2W62A 3Q5XA 2W61A 1L0VA 1OEDE 3UU6A 2JQHA 2BVLA 2EHOB 5C2TA 1XNRT 2A3DA 5LGUB 1KNPA 2VB6A 4UR9A 4OK0A 1QLBA 4IDOA 4UXNB 4DNDA 2KXPB 4IE4A 5LMUT 3ABVA 1S35A 3C4ZA 2AXDS 2CBIA 5EK4A 4YFSA 4DUYT 4B3ST 4JI6T 1XDPA 2KLQA 2ODVA 3AXJB 3AXJA 3F31A 4YXDA 2V6YB 4B3MT 5JREA 4DV1T 4E7SA 4O4LE 4QKNA 4ZI3C 4ILCA 2E5VA 1YW0A 3QB5A 3RLFF 5AQUB 1IBLT 5JRCB 2XQ4A 4JUYA 3PV0F 4F6RC 1ZKEA 5L3EB 1IJ6A 5HYAA 2C5KT 2D5UA 3O1JA 4JI7T 3CVRA 3PUZF 4I4TE 3ZYLA 2ODUA 2BKPA 1SHZC 2RA1A 3LDQB 2Q9QA 3O4XE 1IAPA 3N2GE 3AAAB 4HWIB 4B3TT 2D0TA 2V5CA 2CBJA 1HTJF 3AAIA 4IDNA 3EDVA 4IE0A 2WU2A 5FXWA 1T72A 5GONE 4YHHT 4CI3B 2FJEA 2VK9A 3SRZA 2CA5A 2L8KA 2V7JA 1WYCA 2V7MA 4UVCB 1N32T 3A7MA 1OEDB 1D1AA 2W0GA 3VR8A 4DV7T 4O4IE 1HG5A 5HCJA 3JADA 4P0AA 2ZM2A 1MNDA 3HL6A 4NXNT 3FB2A 2VKOA 3ETUA 4JBWF 4TZ4C 4UEMA 2K5BB 4Q25A 4DV4T 3GWHA 3O1HA 3BQLA 4IIJE 1KNRA 4HFIA 4MHCA 2WCAA 4IE5A 4WBOA 3PUWF 3RYCE 4A56A 3TLUA 4IDZA 3PUQA 4LMJA 4A97A 4QX8B 5HXRA 1JNZA 4ZZCA 4U7IA 2MPKA 4AQYT 4MBQA 1J5WA 5CA0E 4EZ4A 5FL0A 3S4UA 3RRWA 3JC6D 1YD8G 3K1SA 4HKAA 3RX6A 2W4XA 4P09A 4PFOA 4PFPA 1V9DA 5DQVA 2K9AA 2ACZA 2LKHA 2W00A 4TNVA 4YSZA 4DV5T 2Y48B 3RYHE 1R8IA 4HFVA 4P1NA 4ZI7E 4AKLA 3O9XA 3FXEB 3AA0B 2V26A 3ZT5A 1Z0PA 4X66T 3TKLB 4KHZF 2QYWA 5FYMA 4YHJA 3J7Yq 2LM2A 4ADZA 4GKKT 3EABA 3ANWA 3JC6C 2NWBA 3AVRA 5JH7E 2ZMAA 2WWVA 2XM1A 3G06A 1W9RA 4QH5A 4YJ3E 3KVBA 2AE9A 1UGOA 2CXFA 5ADXL 3HKEE 5J2TE 4DV2T 4WNKA 5DABA 3T1HT 4DVDA 3UQ7A 4A98A 4PJJA 3CX6B 3HKDE 4IE6A 2OLTA 4KP3C 4AKRB 2BS4A 5FMNA 5JDFA 3CX8B 4HFBA 2YN6A 3MK7C 4ZS3A 5L4EA 5LNKA 1ZEEA 4JI0T 1CUNA 5AQIB 1YQ4A 3EUHA 5LHIB 2C5JA 2WSSV 3M3ZB 3OYXA 4DR4T 3UU8A 2JMHA 4CN1A 3VRAA 2W66A 3SWHA 5FVLA 3QUJA 1YXRA 3AB3B 2OA5A 3ZMVB 1Z8UA 3HKBE 3IHRA 2X67A 4QX7B 5F5WA 3L3PA 5C8YE 2V7KA 2IW5B 2BBHA 4AQFA 2LLYA 2YDRA 4LFBT 3EHZA 4PK6A 3FZKB 3P7IA 5F8PA 2KNDA 4E7ZA 2CE7A 4ZOLE 3ZMSB 4IREA 3HKCE 3P4WA 3MACA 5TAOA 1HCIA 5IUXA 4TX5A 4YSYA 3N9QA 2V6XA 3AA6B 4Z91A 4ZS2A 3ZMZB 2WMOA 4LF6T 2NW9A 4BJMA 2C5IT 2WB5A 4WZXA 4HGAA 3CX7B 4GYRA 4OYKA 4AISA 1ZHCA 1N33T 1NENA 4CXWA 2PTFA 4HFCA 2UXCT 3HI2A 4JI1T 3VKGA 5HEHA 1IZNB 2PJQA 3PUAA 2HPJA 2JQ9A 2WAUA 3CWZB 1G8XA 2SPCA 1E1HB 1EZ3A 3RIFA 3ZSTA 3WAKA 3ZCJA 2NW8A 2ZM8A 4F8HA 5FL1A 4LF9T 3ZT7A 4OX9T 4LF4T 2CHOA 2YOEA 3I1AA 5FY0A 2XUEA 1M62A 3AE4A 2H7OA 3ESLA 1N34T 1T7SA 4ZXLA 1WFDA 4QWNB 2UUCT 3A5XA 2NR4A 3AE3A 5AQOB 1I6ZA 1VCSA 2XJ7A 4CN6A 2E9XA 5LG3A 3TLWA 3V5UA 2IIUA 4EB6E 4B6XA 4XBFB 5HWYA 3IF8B 3OTOT 2XAQB 1WR6A 2HN2A 3AAEB 3P8CD 4X65T 3UT5E 2UXDT 2WU5A 3JCFA 4IDQA 3KVAA 5LOVE 2CWOA 3LFMA 2D2SA 5EK2A 5L3DB 5L3FB 4IL9A 4JEHB 4DR5T 2LSGA 3MJXA 5JDQA 4X62T 1JNRA 1HNXT 4HWCA 3AE6A 2CPTA 2L9QA 1FMVA 3ZYKA 1SUMB 3CKDA 4HEAA 2WS3A 4IL4A 2LKGA 3P4PA 4YY3T 4JV5T 1LRZA 4M1PA 3PTRB 4O4JE 2IMLA 2W2UA 4TWFA 5JQGE 4OYJA 3O1IA 2X68A 3TLVA 4O8SA 3N2OA 5JDNA 2FJDA 5ABFB 5EZYE 5LHHB 3MKDA 5LHGB 5IWAT 1YKEB 4O2BE 2WZIA 4YLHA 4EYUA 5CFBA 2E9XD 4CZZB 3H3MA 1WCRA 3RQWA 2WDVA 4PJMA 2CCQA 1D0XA 1X79A 2DI4A 2J62A 1T8BA 3EI0A 3KFWX 4YT0A 5JDMA 1WRDA 3K3QC 4C91A 1IJ5A 2ES0A 4ZHQE 3AE1A 3AE2A 4JI2T 3UFEA 3AECA 3DTOA 3KV4A 4H9QC 4AI6A 3Q2MA 2E9XB 3C51A 3ETVA 5JRCA 1UX4A 3ONJA 4GK5E 4U2ZA 1LVFA 4AIUA 2IDOB 2YINA 1E7PA 1G73A 2M6IA 4BA9A 3U3IA 4ISSA 2BKNA 2V5DA 3NKZA 4X20E 4U31A 1SA0E 2EHOC 2LSYA 3I9WA 5KMGP 2UUBT 3R6NA 1XMOT 1HFAA 5L3BB 4IGUA 2XASB 3L39A 2XSBA 3QOFA 4GKJT 1CHUA 3P50A 2IUBA 4PJNA 3F2EA 3LBXA 3C4WA 5H6QB 4C90A 4PK4A 1MIWA 1VOMA 3I0OA 1YQ3A 3NZPA 4TUYE 2IHR1 2KWIB 3RKGA 4I43B 4K0UA 4PNIA 1O3XA 1UUSA 3EVYA 1MMAA 2VKJA 5ABFA 2UXBT 3PDYA 2OV9A 4HTEA 3RIUA 2FUPA 3T8OA 2QRXA 3KV6A 4U7YA 3L8RA 2M67A 3DJBA 2VL8A 3CQXC 2FJAA 2CHNA 3CQCB 3N2KE 2V1DB 5HXHA 3K3OA 2N1GA 3PE0A 3PUYF 4QH1A 4WW0A 2BZBA 5LJNA 4G2AA 3OJAA 1LVKA 2VASA 4GK0E 5LBQB 3RKOA 1M7KA 2BG9A 4PK5A 5EK3A 1U5PA 2BG9C 2XY8B 2YKSA 4U74A 4QXHB 1IBKT 1X9BA 3GN5A 3PU8A 3P4RA 5DJQC 3H37A 5L4HA 3LK42 3P4QA 4ZI3D 2W63A 3D0TA 5LJMA 2RPAA 1SE7A 2NTYA 2HHHT 5CJ5A 1HNWT 2P9BA 4A5XA 5KX5E 1D1CA 4UV8B 2X0HA 2IC9A 3CMLA 5AQTB 2XQ7A 3N9PA 1IBMT 4DR6T 4JI4T 2D0UA 4UF0B 3UULA 4EYYR 4LMLA 2ZLYA 3AEGA 3RGLA 4DV3T 1HR0T 3LJCA 2H7VC 2V7LA 3EDUA 2N2NA 5HEUA 4I0UA 3GN5B 1KFYA 1OWAA 3SFEA 4X5TA 3SOLA 4DMWA 4KMCA 1MMDA 3UFGA 4B3RT 1U4QA 3SS1A 2K3WA 4DUZT 2I0MA 5HXSA 4X1KE 2X51A 2UXNB 3GMIA 2W67A 3FBZA 3L09A 2A72A 3ZJ1A 5AQPB 4COFA 3ANWB 3MXZA 2LRKA 5LA6E 2CXLA 2WBLA 2J4GA 4AQGA 4Z8XA 4GYSA 5LYJE 4TWHA 2VQFT 4UIGA 2DWGA 1KNZA 3K8PC 4DO0A 4UVBB 1BR2A 3Q9DA 4TN7B 2UUAT 3AA1B 4X64T 1NEKA 5C3JA 4HWFA 5LCYA 1KK7A 3ZLIA 4JLEA 5CB4E
chains in the Genus database with same CATH topology
3Q5DA 1W09A 4IDOA 3OVUA 3X1DA 3IA3A 1XZYA 1W0AA 4IDPA 1Y01A 3QNUA 4IDNA 3Q5EA 1Z8UA 1W0BA 4IDQA 3QOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5D A;  1W09 A;  4IDO A;  3OVU A;  3X1D A;  3IA3 A;  1XZY A;  1W0A A;  4IDP A;  1Y01 A;  3QNU A;  4IDN A;  3Q5E A;  1Z8U A;  1W0B A;  4IDQ A;  3QOF A; 
#chains in the Genus database with same CATH topology
 2LT3 A;  3ZEF B;  4LFC T;  3OYZ A;  5L3C B;  5ABH A;  4XZC A;  1FJG T;  3CPZ A;  4N78 D;  2XQ5 A;  1XDO A;  5AQR B;  3QB5 K;  2VUR A;  1UX5 A;  1WR0 A;  2NP9 A;  2YU1 A;  3RYI E;  1NWM X;  2Y6X A;  5ETW A;  1NAF A;  2KIN B;  4NPP A;  2ZM0 A;  2Q9Q D;  3MZK B;  3Q5E A;  4JI5 T;  4UF0 A;  5AQQ B;  4QHO A;  5FY1 A;  3ZSS A;  4EOZ B;  5JTG A;  3R84 B;  4HFE A;  2D9D A;  5AQK B;  2K24 A;  5KDM C;  2X66 A;  4CXX A;  5AQF B;  1MIY A;  4JI8 T;  1MMG A;  2LRL A;  4H9N C;  3DP7 A;  5FXV A;  4EEB A;  2H88 A;  3WI3 A;  4LF7 T;  3E0Z A;  3Q5W A;  3LBX B;  2YDQ A;  2YK0 A;  2Q9Q B;  1S94 A;  4HN9 A;  4IE7 A;  3ZC1 A;  5LBM A;  3C50 A;  4DR7 T;  1HNZ T;  2K48 A;  2BG9 B;  3RI5 A;  5JDL A;  1BR1 A;  3FZM B;  3UTK A;  2DLR A;  4ILU A;  1WYB A;  4EIW A;  2CM0 A;  3ZCI A;  3E22 E;  2LE8 A;  3UQ4 A;  1VRB A;  2XAF B;  4U72 A;  1AJ3 A;  4CI1 B;  2YEV C;  5AQG B;  2YU2 A;  4HWD A;  2I59 A;  5FY7 A;  2JJ9 A;  2RP4 A;  2LHR A;  3UUB A;  3NVO A;  4ERR A;  4CN4 A;  5JR9 A;  3F57 A;  5ABG A;  2MTQ A;  3NRX A;  4X1Y E;  2JRK A;  5HCM A;  4O2A E;  3UU5 A;  4BAY B;  3T1Y T;  5AQS B;  2WQY A;  4OHF A;  4IT4 A;  5JDG A;  5LGN B;  4L5G A;  3U78 A;  5HEJ A;  3CQG B;  3M65 A;  3N9N A;  3KV9 A;  4GOU A;  3RPU A;  2KZ7 B;  2UXX B;  1XZY A;  3AEB A;  2JMK A;  5JVD E;  2FBW A;  2LSK A;  3N9O A;  4MFR A;  1OED A;  1WLX A;  2MOZ A;  3RQU A;  2DHR A;  3FZL B;  3JAF A;  5ABE A;  3BQK A;  2BS3 A;  3I9Y A;  4Z90 A;  2KT9 A;  3KBT A;  4U3C A;  2CWY A;  4V1A v;  4JEU B;  5JDH A;  2HH7 A;  2BKO A;  2BS2 A;  2PG8 A;  3NWI A;  3RRC A;  2VKH A;  3OPC A;  3KDS E;  5LB7 B;  2CXD A;  3N9L A;  4TWD A;  5CA1 E;  2J1D G;  2R6G F;  2WM9 A;  4AQF C;  2H89 A;  2V7I A;  3FXD B;  5FXZ A;  2J47 A;  2LOP A;  2G0U A;  2CEA A;  2PFV A;  5A1L A;  4DR1 T;  2X9X A;  4ZZB A;  5LMN T;  1E2A A;  1H7C A;  3PU3 A;  4I50 E;  1MMN A;  2V6Y A;  1HX8 A;  3AEA A;  4ILA A;  4FJO A;  5AQL B;  4LMK A;  5FP3 A;  3RIA A;  3AE9 A;  3QNU A;  3AA7 B;  4FI5 A;  5LP6 E;  3NBX X;  3HR0 A;  4PW8 A;  5J1G A;  4YTP A;  3VKH A;  2NW7 A;  1ZOY A;  4G63 A;  2XQ6 A;  4NUU A;  4QXC B;  3PJA A;  4XAX B;  2BVM A;  3UU3 A;  3N5L A;  3X1D A;  4DBQ A;  3AE7 A;  2LOS A;  2WDR A;  2WDQ A;  3ONX A;  2MBG A;  3ZMT B;  4ASK A;  2Q9Q C;  1GQE A;  2XQ8 A;  3CIR A;  2JIW A;  4IHJ E;  2XAH B;  5L2L A;  3QK6 A;  3IBP A;  3V5S A;  4AKI A;  2WY2 A;  2VVN A;  3NRY A;  3VHL A;  2CRB A;  3CK6 A;  3JAE A;  3PUV F;  2LSI A;  2NOX A;  4NIQ A;  4JI3 T;  2X0L B;  5LXT E;  4DV0 T;  4IDP A;  2X9H A;  1B7T A;  3LK3 B;  1N36 T;  2PBI A;  3ZPO A;  3ZMU B;  1ZV4 X;  3NZQ A;  1XMQ T;  5IHY A;  2C0S A;  3IEE A;  4ILB A;  5HEO A;  3RH3 A;  2UU9 T;  4LFA T;  4YJ2 E;  4EZH A;  2ACX A;  2QGS A;  4QH4 A;  1FEW A;  2VVS A;  2Z6E A;  3RC3 A;  1HF8 A;  2XM2 A;  5FVK A;  5BMV E;  2IAK A;  4CXY A;  2B76 A;  1UCU A;  2LHN A;  3C4X A;  3B13 A;  3FZF B;  2FJB A;  1Y01 A;  2B1E A;  5AQH B;  4EGW A;  5KXJ A;  4CQI A;  3Q5D A;  3W15 B;  1D0Z A;  2XQ3 A;  4GIW A;  1FIO A;  4DR2 T;  4AKH A;  3OVU A;  2WZH A;  5HWX A;  5AQV B;  5L3G B;  2KWH A;  2Y8D A;  2VKD A;  4HWH A;  4L9I A;  1Y64 B;  5H6R B;  1W0B A;  4PAG A;  3UUM A;  4AKG A;  2XAG B;  5J0Z A;  1D1B A;  2HN1 A;  1W09 A;  3AED A;  2KSR A;  2V8S V;  3H3A A;  1J5E T;  2E5L T;  1BR0 A;  2LM9 A;  2HPL A;  4ZI2 C;  5CGM A;  4LF8 T;  5L47 A;  3B57 A;  3B5M A;  4NXM T;  4YTM A;  4DID B;  2JPF A;  2XQA A;  2A9U A;  3HA4 A;  1VCT A;  2N9D A;  4H9S E;  4TNW A;  5DQW A;  1OED C;  5BR8 T;  3OKQ A;  1OXZ A;  2XTL A;  4H63 V;  4ZI2 D;  4EXT A;  4JYA T;  4L0R A;  4O4H E;  5J2U E;  4AXP A;  3PUG A;  3ZJ2 A;  5LG4 A;  2X0Y A;  3LK2 B;  3EAM A;  4LF5 T;  3PUS A;  1HG2 A;  3UU4 A;  4KUM B;  2WMN A;  2KMF A;  3OBV E;  3VRB A;  5HAX A;  4YTN A;  5JR9 B;  3WAJ A;  3UUX B;  2F4V T;  3ZC0 A;  2JQQ A;  1FMW A;  1BR4 A;  4UVA B;  3KV5 A;  3BK9 A;  3RHW A;  2ZM6 T;  3PUR A;  4X1I E;  3P4S A;  5F3J A;  3AEE A;  3RC8 A;  1YKH B;  1DU2 A;  1XWM A;  4EED A;  1HX1 B;  3GA8 A;  5HXE A;  3ZYM A;  3KBU A;  4TV8 E;  1MIV A;  2EHO A;  2H3R A;  2A2F X;  3I0Q A;  4KX6 A;  5AQJ B;  3AE8 A;  2L3L A;  2BG9 E;  2MYS A;  3AE5 A;  2E9X C;  1KF6 A;  2XHE B;  2XZE A;  5FKY A;  3SFD A;  3ZN0 B;  4HE8 A;  3PJA J;  4WYV A;  4YSX A;  3KIN B;  3UUN A;  1US7 B;  3TLS A;  3E08 A;  5AQM B;  1W0A A;  3ZKR A;  2E8I A;  3VR9 A;  3RIU C;  2E2A A;  1I94 T;  4QXB B;  3C64 A;  2CLY B;  4KBM B;  3FBL A;  2I6H A;  2CLY C;  5FNV E;  4DV6 T;  4UV9 B;  4BJN A;  4ZEY A;  3N9M A;  4DBR A;  1XNQ T;  2VQE T;  4U33 A;  2IC6 A;  1KEY A;  2LJL A;  5E0O A;  4EAH A;  5FXX A;  2BDE A;  5JR9 C;  1LKX A;  2BBJ A;  2XAJ B;  2X9Y A;  2XPK A;  2DCF A;  2NTX A;  2DWK A;  2YDS A;  2VL0 A;  3LG7 A;  4IST A;  4MLK A;  3RF1 A;  4UEL A;  2X9W A;  2XQY A;  3RYF E;  4H9O C;  4MAL A;  3MA9 A;  4KI0 F;  4P0B A;  3VU7 H;  2LEH A;  4I55 E;  4U2Y A;  3ZT6 A;  4PJL A;  3ZN1 B;  3AVS A;  4CI2 B;  3A8Y C;  1D0Y A;  5AFU L;  1ZP0 A;  3AEF A;  4WBN E;  4K0K T;  2LSJ A;  2MAW A;  3K3N A;  2WWU A;  2WP9 A;  1MNE A;  5HXC A;  2JQK A;  1J1J A;  3FHN A;  4H9P C;  2CMR A;  2GK9 A;  2XSA A;  4TV9 E;  2EHO D;  4ANJ A;  1QSD A;  1T98 A;  3FZH B;  3IA3 A;  3PUX F;  2VWA A;  2DNX A;  4OFZ A;  5HEG A;  4EV6 A;  1UK5 A;  5LGT B;  5M4Y A;  4DR3 T;  4DMV A;  4KHP T;  3QC9 A;  3BQI A;  3LSV A;  2DL1 A;  4H9R C;  2QA7 A;  4HFD A;  5AQN B;  1QUU A;  1UUR A;  2M6B A;  3J9X 1;  4NUV A;  4HFH A;  3TLT A;  2QVA A;  2XQ9 A;  5IYZ E;  1HS7 A;  3C98 B;  4H63 H;  3ONL C;  4J2C A;  2W62 A;  3Q5X A;  2W61 A;  1L0V A;  1OED E;  3UU6 A;  2JQH A;  2BVL A;  2EHO B;  5C2T A;  1XNR T;  2A3D A;  5LGU B;  1KNP A;  2VB6 A;  4UR9 A;  4OK0 A;  1QLB A;  4IDO A;  4UXN B;  4DND A;  2KXP B;  4IE4 A;  5LMU T;  3ABV A;  1S35 A;  3C4Z A;  2AXD S;  2CBI A;  5EK4 A;  4YFS A;  4DUY T;  4B3S T;  4JI6 T;  1XDP A;  2KLQ A;  2ODV A;  3AXJ B;  3AXJ A;  3F31 A;  4YXD A;  2V6Y B;  4B3M T;  5JRE A;  4DV1 T;  4E7S A;  4O4L E;  4QKN A;  4ZI3 C;  4ILC A;  2E5V A;  1YW0 A;  3QB5 A;  3RLF F;  5AQU B;  1IBL T;  5JRC B;  2XQ4 A;  4JUY A;  3PV0 F;  4F6R C;  1ZKE A;  5L3E B;  1IJ6 A;  5HYA A;  2C5K T;  2D5U A;  3O1J A;  4JI7 T;  3CVR A;  3PUZ F;  4I4T E;  3ZYL A;  2ODU A;  2BKP A;  1SHZ C;  2RA1 A;  3LDQ B;  2Q9Q A;  3O4X E;  1IAP A;  3N2G E;  3AAA B;  4HWI B;  4B3T T;  2D0T A;  2V5C A;  2CBJ A;  1HTJ F;  3AAI A;  4IDN A;  3EDV A;  4IE0 A;  2WU2 A;  5FXW A;  1T72 A;  5GON E;  4YHH T;  4CI3 B;  2FJE A;  2VK9 A;  3SRZ A;  2CA5 A;  2L8K A;  2V7J A;  1WYC A;  2V7M A;  4UVC B;  1N32 T;  3A7M A;  1OED B;  1D1A A;  2W0G A;  3VR8 A;  4DV7 T;  4O4I E;  1HG5 A;  5HCJ A;  3JAD A;  4P0A A;  2ZM2 A;  1MND A;  3HL6 A;  4NXN T;  3FB2 A;  2VKO A;  3ETU A;  4JBW F;  4TZ4 C;  4UEM A;  2K5B B;  4Q25 A;  4DV4 T;  3GWH A;  3O1H A;  3BQL A;  4IIJ E;  1KNR A;  4HFI A;  4MHC A;  2WCA A;  4IE5 A;  4WBO A;  3PUW F;  3RYC E;  4A56 A;  3TLU A;  4IDZ A;  3PUQ A;  4LMJ A;  4A97 A;  4QX8 B;  5HXR A;  1JNZ A;  4ZZC A;  4U7I A;  2MPK A;  4AQY T;  4MBQ A;  1J5W A;  5CA0 E;  4EZ4 A;  5FL0 A;  3S4U A;  3RRW A;  3JC6 D;  1YD8 G;  3K1S A;  4HKA A;  3RX6 A;  2W4X A;  4P09 A;  4PFO A;  4PFP A;  1V9D A;  5DQV A;  2K9A A;  2ACZ A;  2LKH A;  2W00 A;  4TNV A;  4YSZ A;  4DV5 T;  2Y48 B;  3RYH E;  1R8I A;  4HFV A;  4P1N A;  4ZI7 E;  4AKL A;  3O9X A;  3FXE B;  3AA0 B;  2V26 A;  3ZT5 A;  1Z0P A;  4X66 T;  3TKL B;  4KHZ F;  2QYW A;  5FYM A;  4YHJ A;  3J7Y q;  2LM2 A;  4ADZ A;  4GKK T;  3EAB A;  3ANW A;  3JC6 C;  2NWB A;  3AVR A;  5JH7 E;  2ZMA A;  2WWV A;  2XM1 A;  3G06 A;  1W9R A;  4QH5 A;  4YJ3 E;  3KVB A;  2AE9 A;  1UGO A;  2CXF A;  5ADX L;  3HKE E;  5J2T E;  4DV2 T;  4WNK A;  5DAB A;  3T1H T;  4DVD A;  3UQ7 A;  4A98 A;  4PJJ A;  3CX6 B;  3HKD E;  4IE6 A;  2OLT A;  4KP3 C;  4AKR B;  2BS4 A;  5FMN A;  5JDF A;  3CX8 B;  4HFB A;  2YN6 A;  3MK7 C;  4ZS3 A;  5L4E A;  5LNK A;  1ZEE A;  4JI0 T;  1CUN A;  5AQI B;  1YQ4 A;  3EUH A;  5LHI B;  2C5J A;  2WSS V;  3M3Z B;  3OYX A;  4DR4 T;  3UU8 A;  2JMH A;  4CN1 A;  3VRA A;  2W66 A;  3SWH A;  5FVL A;  3QUJ A;  1YXR A;  3AB3 B;  2OA5 A;  3ZMV B;  1Z8U A;  3HKB E;  3IHR A;  2X67 A;  4QX7 B;  5F5W A;  3L3P A;  5C8Y E;  2V7K A;  2IW5 B;  2BBH A;  4AQF A;  2LLY A;  2YDR A;  4LFB T;  3EHZ A;  4PK6 A;  3FZK B;  3P7I A;  5F8P A;  2KND A;  4E7Z A;  2CE7 A;  4ZOL E;  3ZMS B;  4IRE A;  3HKC E;  3P4W A;  3MAC A;  5TAO A;  1HCI A;  5IUX A;  4TX5 A;  4YSY A;  3N9Q A;  2V6X A;  3AA6 B;  4Z91 A;  4ZS2 A;  3ZMZ B;  2WMO A;  4LF6 T;  2NW9 A;  4BJM A;  2C5I T;  2WB5 A;  4WZX A;  4HGA A;  3CX7 B;  4GYR A;  4OYK A;  4AIS A;  1ZHC A;  1N33 T;  1NEN A;  4CXW A;  2PTF A;  4HFC A;  2UXC T;  3HI2 A;  4JI1 T;  3VKG A;  5HEH A;  1IZN B;  2PJQ A;  3PUA A;  2HPJ A;  2JQ9 A;  2WAU A;  3CWZ B;  1G8X A;  2SPC A;  1E1H B;  1EZ3 A;  3RIF A;  3ZST A;  3WAK A;  3ZCJ A;  2NW8 A;  2ZM8 A;  4F8H A;  5FL1 A;  4LF9 T;  3ZT7 A;  4OX9 T;  4LF4 T;  2CHO A;  2YOE A;  3I1A A;  5FY0 A;  2XUE A;  1M62 A;  3AE4 A;  2H7O A;  3ESL A;  1N34 T;  1T7S A;  4ZXL A;  1WFD A;  4QWN B;  2UUC T;  3A5X A;  2NR4 A;  3AE3 A;  5AQO B;  1I6Z A;  1VCS A;  2XJ7 A;  4CN6 A;  2E9X A;  5LG3 A;  3TLW A;  3V5U A;  2IIU A;  4EB6 E;  4B6X A;  4XBF B;  5HWY A;  3IF8 B;  3OTO T;  2XAQ B;  1WR6 A;  2HN2 A;  3AAE B;  3P8C D;  4X65 T;  3UT5 E;  2UXD T;  2WU5 A;  3JCF A;  4IDQ A;  3KVA A;  5LOV E;  2CWO A;  3LFM A;  2D2S A;  5EK2 A;  5L3D B;  5L3F B;  4IL9 A;  4JEH B;  4DR5 T;  2LSG A;  3MJX A;  5JDQ A;  4X62 T;  1JNR A;  1HNX T;  4HWC A;  3AE6 A;  2CPT A;  2L9Q A;  1FMV A;  3ZYK A;  1SUM B;  3CKD A;  4HEA A;  2WS3 A;  4IL4 A;  2LKG A;  3P4P A;  4YY3 T;  4JV5 T;  1LRZ A;  4M1P A;  3PTR B;  4O4J E;  2IML A;  2W2U A;  4TWF A;  5JQG E;  4OYJ A;  3O1I A;  2X68 A;  3TLV A;  4O8S A;  3N2O A;  5JDN A;  2FJD A;  5ABF B;  5EZY E;  5LHH B;  3MKD A;  5LHG B;  5IWA T;  1YKE B;  4O2B E;  2WZI A;  4YLH A;  4EYU A;  5CFB A;  2E9X D;  4CZZ B;  3H3M A;  1WCR A;  3RQW A;  2WDV A;  4PJM A;  2CCQ A;  1D0X A;  1X79 A;  2DI4 A;  2J62 A;  1T8B A;  3EI0 A;  3KFW X;  4YT0 A;  5JDM A;  1WRD A;  3K3Q C;  4C91 A;  1IJ5 A;  2ES0 A;  4ZHQ E;  3AE1 A;  3AE2 A;  4JI2 T;  3UFE A;  3AEC A;  3DTO A;  3KV4 A;  4H9Q C;  4AI6 A;  3Q2M A;  2E9X B;  3C51 A;  3ETV A;  5JRC A;  1UX4 A;  3ONJ A;  4GK5 E;  4U2Z A;  1LVF A;  4AIU A;  2IDO B;  2YIN A;  1E7P A;  1G73 A;  2M6I A;  4BA9 A;  3U3I A;  4ISS A;  2BKN A;  2V5D A;  3NKZ A;  4X20 E;  4U31 A;  1SA0 E;  2EHO C;  2LSY A;  3I9W A;  5KMG P;  2UUB T;  3R6N A;  1XMO T;  1HFA A;  5L3B B;  4IGU A;  2XAS B;  3L39 A;  2XSB A;  3QOF A;  4GKJ T;  1CHU A;  3P50 A;  2IUB A;  4PJN A;  3F2E A;  3LBX A;  3C4W A;  5H6Q B;  4C90 A;  4PK4 A;  1MIW A;  1VOM A;  3I0O A;  1YQ3 A;  3NZP A;  4TUY E;  2IHR 1;  2KWI B;  3RKG A;  4I43 B;  4K0U A;  4PNI A;  1O3X A;  1UUS A;  3EVY A;  1MMA A;  2VKJ A;  5ABF A;  2UXB T;  3PDY A;  2OV9 A;  4HTE A;  3RIU A;  2FUP A;  3T8O A;  2QRX A;  3KV6 A;  4U7Y A;  3L8R A;  2M67 A;  3DJB A;  2VL8 A;  3CQX C;  2FJA A;  2CHN A;  3CQC B;  3N2K E;  2V1D B;  5HXH A;  3K3O A;  2N1G A;  3PE0 A;  3PUY F;  4QH1 A;  4WW0 A;  2BZB A;  5LJN A;  4G2A A;  3OJA A;  1LVK A;  2VAS A;  4GK0 E;  5LBQ B;  3RKO A;  1M7K A;  2BG9 A;  4PK5 A;  5EK3 A;  1U5P A;  2BG9 C;  2XY8 B;  2YKS A;  4U74 A;  4QXH B;  1IBK T;  1X9B A;  3GN5 A;  3PU8 A;  3P4R A;  5DJQ C;  3H37 A;  5L4H A;  3LK4 2;  3P4Q A;  4ZI3 D;  2W63 A;  3D0T A;  5LJM A;  2RPA A;  1SE7 A;  2NTY A;  2HHH T;  5CJ5 A;  1HNW T;  2P9B A;  4A5X A;  5KX5 E;  1D1C A;  4UV8 B;  2X0H A;  2IC9 A;  3CML A;  5AQT B;  2XQ7 A;  3N9P A;  1IBM T;  4DR6 T;  4JI4 T;  2D0U A;  4UF0 B;  3UUL A;  4EYY R;  4LML A;  2ZLY A;  3AEG A;  3RGL A;  4DV3 T;  1HR0 T;  3LJC A;  2H7V C;  2V7L A;  3EDU A;  2N2N A;  5HEU A;  4I0U A;  3GN5 B;  1KFY A;  1OWA A;  3SFE A;  4X5T A;  3SOL A;  4DMW A;  4KMC A;  1MMD A;  3UFG A;  4B3R T;  1U4Q A;  3SS1 A;  2K3W A;  4DUZ T;  2I0M A;  5HXS A;  4X1K E;  2X51 A;  2UXN B;  3GMI A;  2W67 A;  3FBZ A;  3L09 A;  2A72 A;  3ZJ1 A;  5AQP B;  4COF A;  3ANW B;  3MXZ A;  2LRK A;  5LA6 E;  2CXL A;  2WBL A;  2J4G A;  4AQG A;  4Z8X A;  4GYS A;  5LYJ E;  4TWH A;  2VQF T;  4UIG A;  2DWG A;  1KNZ A;  3K8P C;  4DO0 A;  4UVB B;  1BR2 A;  3Q9D A;  4TN7 B;  2UUA T;  3AA1 B;  4X64 T;  1NEK A;  5C3J A;  4HWF A;  5LCY A;  1KK7 A;  3ZLI A;  4JLE A;  5CB4 E; 
#chains in the Genus database with same CATH homology
 3Q5D A;  1W09 A;  4IDO A;  3OVU A;  3X1D A;  3IA3 A;  1XZY A;  1W0A A;  4IDP A;  1Y01 A;  3QNU A;  4IDN A;  3Q5E A;  1Z8U A;  1W0B A;  4IDQ A;  3QOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...