1W0AA

Solution structure of the trans form of the human alpha-hemoglobin stabilizing protein (ahsp)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
b'LLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-HEMOGLOBIN STABILIZING PROTEIN
publication title NMR structure of the alpha-hemoglobin stabilizing protein: insights into conformational heterogeneity and binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 32
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1w0aA00
3QNUA 3QOFA 3X1DA 1Z8UA 3OVUA 4IDPA 4IDOA 1XZYA 1W0AA 4IDQA 1W09A 4IDNA 3Q5EA 3Q5DA 1Y01A 3IA3A 1W0BA
chains in the Genus database with same CATH superfamily
3ZMUB 4CQIA 4ZI2D 5DABA 4E7ZA 4ZI3D 3RIFA 2ZM0A 4H9RC 3UU4A 3ZN1B 4EEDA 2W00A 3ZSTA 5L3CB 2BS2A 2ODVA 3TLTA 1UUSA 4HFIA 5LHGB 5GONE 2ZM8A 2LSKA 3N5LA 3AVSA 2VL0A 3K8PC 5L4HA 3PUVF 3AE1A 5E0OA 4X62T 5FVLA 1NENA 5LG4A 3UULA 1ZV4X 2IMLA 5FP3A 3E22E 3TLSA 1XMOT 1WRDA 3FXEB 3SS1A 1XMQT 5LGUB 3UU3A 3ZC1A 4GYSA 1E7PA 1US7B 3ZMTB 4MFRA 4LFCT 3UQ4A 1HNXT 2XM1A 3UU6A 3NRXA 3ZN0B 5LBMA 4DBRA 2ODUA 1ZHCA 3KBUA 3VKHA 4ILBA 2K5BB 1XWMA 3KINB 5HEUA 3ZJ2A 4X1IE 5KXJA 2CLYC 3V5UA 2IUBA 5DQWA 3KVBA 1KNRA 4UIGA 1XZYA 4LF6T 3C4WA 3P4PA 4MALA 1M62A 5LYJE 4PAGA 2W67A 5CGMA 2CBJA 4B3TT 3ZEFB 2KZ7B 4B3MT 3HI2A 1MNDA 1X79A 3I0OA 4DR7T 2I0MA 4E7SA 1HFAA 2WDVA 3ZLIA 2N2NA 3SFEA 5HXHA 2MBGA 1D0YA 4EYYR 3S4UA 4IE7A 2LLYA 3VKGA 3UUBA 4F6RC 3ZKRA 2A2FX 5C3JA 5L3DB 4QXCB 1YKHB 4ISSA 4AI6A 1JNZA 2LSJA 5ETWA 2UUAT 3ZCIA 5J0ZA 3F57A 3ZT6A 5ABFA 4FI5A 4DMVA 3O9XA 5JREA 3KV5A 4UF0B 3LK42 5HXEA 2LT3A 3P7IA 4LF4T 4UV9B 2L9QA 4AKIA 3VU7H 1N34T 2M6IA 4JEUB 4OYJA 4EB6E 4JI2T 1G73A 4UF0A 4GKKT 3HKEE 3OBVE 2CE7A 3ONXA 5LOVE 3A8YC 4B6XA 2JQKA 3Q5XA 4I43B 3ABVA 3RQUA 2V8SV 3L3PA 3P4WA 4U7YA 4TWDA 5HEHA 5AFUL 5A1LA 1LKXA 3GA8A 1UK5A 5FXVA 2CXLA 2YDRA 2V7LA 3LBXB 3HA4A 3L39A 2JQQA 2C0SA 2CWYA 3KVAA 4L9IA 1D1BA 3LFMA 1ZP0A 2WY2A 5FL1A 1VRBA 4EAHA 1JNRA 3PDYA 4NUVA 4DR2T 3AEFA 4HFBA 2E9XC 1HNZT 3IEEA 2X0YA 2D9DA 2W4XA 3RIAA 2WMOA 2LKGA 3C50A 3PV0F 2KINB 3RC8A 3FZHB 4IE6A 3LDQB 4IT4A 2BKPA 3KV4A 4CN4A 3ZT5A 3VR8A 3RQWA 4HTEA 3EUHA 1N36T 3CMLA 5ABHA 5HXSA 2ES0A 3DP7A 3IF8B 5JVDE 3NZQA 2V5DA 4G2AA 3ZYLA 4LFAT 4EYUA 1H7CA 4KHZF 3PUYF 2NTYA 4DUZT 2V7KA 3PUXF 4DV2T 2KLQA 4ADZA 2PBIA 2NOXA 2NR4A 3ZJ1A 5DQVA 4HFEA 4KX6A 5EK3A 5JDNA 5JDQA 3AEGA 3PUAA 5H6QB 2EHOC 3EDVA 5FXZA 2UUBT 1UX4A 2E2AA 2ZMAA 3CIRA 3CX7B 1SA0E 3EHZA 5JH7E 4TWFA 2J4GA 1YXRA 4IDQA 4KP3C 3QOFA 1IJ6A 3G06A 5AQKB 1MNEA 1MMAA 2K48A 1BR2A 4DV6T 3NVOA 1WR6A 1SHZC 2DNXA 2PFVA 3KV9A 5JDFA 4WW0A 4L5GA 5LG3A 2M6BA 2XAHB 2X68A 3ZCJA 2XUEA 1OXZA 3TLUA 4PFOA 1AJ3A 1FMWA 4B3RT 3R84B 1I94T 2EHOB 5FKYA 3WAKA 2VK9A 2CHOA 2QGSA 3LK2B 1DU2A 5JRCB 3JCFA 2JMHA 2RPAA 1MIYA 2FJDA 4DV1T 3ZYMA 4JI8T 2KXPB 4YLHA 4YTNA 3AA6B 4LF8T 1UX5A 2ZM2A 5C2TA 1Z0PA 3Q5WA 3QC9A 5JRCA 5JR9C 2KT9A 3ETVA 4OHFA 4PJMA 2BKNA 3IA3A 3MJXA 4EV6A 4C90A 2Q9QB 3P50A 2HN1A 1HX8A 2LJLA 2JJ9A 2OV9A 1X9BA 4H9OC 2NW9A 5AQQB 1YW0A 3CX8B 3FZLB 3U3IA 3AE4A 2WSSV 3OTOT 5IUXA 2E8IA 4YSXA 2JRKA 2WM9A 2Q9QA 5FY7A 5L3FB 1VCSA 4MLKA 3C4ZA 5FY0A 3JAFA 3PUSA 3IHRA 4O2AE 1YD8G 4ILCA 2X9YA 3RIUA 4LF9T 2R6GF 3ZYKA 1T7SA 2KWIB 4C91A 3EVYA 2XASB 1IJ5A 4O2BE 3RGLA 5LXTE 2BS4A 1SUMB 3PURA 4ZXLA 4GK5E 1WYCA 3RYHE 1FJGT 2XHEB 2K9AA 4TV9E 2YK0A 5CA1E 2I59A 1WYBA 3RLFF 4U72A 2RA1A 1HG5A 2XPKA 4BA9A 2WQYA 2BDEA 5LP6E 5AQHB 3UUNA 2WU5A 3AB3B 1IAPA 2X0LB 1KFYA 3AAEB 3X1DA 3CQCB 4IL4A 2A72A 2CM0A 2PJQA 4PJJA 2WP9A 4I0UA 4U2YA 3GMIA 2V6YB 3AAIA 4ZS2A 4PJNA 5IHYA 5HEGA 5FVKA 3FZMB 5LBQB 3QK6A 2UXCT 2H7VC 1BR1A 1FEWA 4ZEYA 2V1DB 4H9PC 5IYZE 2V6YA 3HR0A 5F5WA 3RYIE 4K0KT 4P0BA 1KEYA 2J47A 4LF5T 3SWHA 2H7OA 1U4QA 3RX6A 3ZMVB 1LRZA 1OEDE 2WB5A 2J62A 1W9RA 4X65T 1W0BA 4X5TA 3B5MA 4QWNB 4QH1A 5AQGB 2N1GA 1OEDC 5LMUT 2QA7A 2W66A 4QX8B 1E2AA 3P8CD 4DNDA 2V7JA 2CXDA 5KDMC 3JADA 3ZC0A 4AKRB 1CHUA 2XJ7A 3AE9A 4WBOA 4LMJA 5FMNA 2YU1A 4GKJT 2CHNA 2UUCT 1IZNB 3I9YA 3EDUA 4X64T 2CPTA 4Z90A 2CA5A 3Q5DA 1LVFA 1UURA 4H9SE 4HEAA 4JI4T 5AQSB 5AQJB 1IBKT 1XNQT 2CXFA 3RHWA 4HFHA 1FMVA 2AXDS 2YDSA 2XQ7A 2XTLA 2UXXB 4HWDA 2GK9A 2CLYB 3Q5EA 3BQLA 3V5SA 3LJCA 1NAFA 3MKDA 2A3DA 1NEKA 2BZBA 3ANWB 2KNDA 2ZLYA 2WZHA 4JBWF 4X20E 3VRAA 3K1SA 3GWHA 1UCUA 1MMGA 4DV3T 2LOPA 3U78A 3B57A 4H63V 3ANWA 3M65A 1Y64B 3NRYA 4OX9T 5F8PA 5J2UE 3ONJA 4DR4T 2XSBA 2WMNA 4O4LE 3RF1A 4YSYA 4A56A 2BG9E 3CVRA 3PJAJ 3UUXB 2VASA 5LJMA 4ERRA 5FXXA 1XNRT 4KBMB 2HPLA 2KSRA 5LB7B 2VQET 3N2OA 4BJMA 4AISA 4OK0A 2LSYA 1VCTA 4YJ2E 3AEEA 3BQKA 2FUPA 2BG9C 2Y48B 1B7TA 3MXZA 3K3QC 4J2CA 1MMNA 3W15B 4A98A 2HH7A 4YFSA 3OYZA 2WU2A 4DIDB 1R8IA 3LBXA 3NZPA 4IIJE 4DR6T 2L8KA 2JQ9A 3O1JA 4OFZA 3HKDE 3Q9DA 2BKOA 5AQOB 2LSGA 3FBZA 5CJ5A 3K3OA 2MTQA 2LRKA 1WFDA 1HX1B 2F4VT 4DV5T 3C98B 2D0UA 4HKAA 4CXWA 2A9UA 2MAWA 3UFEA 5LA6E 2WBLA 5JDMA 4X66T 1MMDA 4Z8XA 2V26A 4TV8E 1WLXA 2JIWA 5DJQC 3AVRA 2WAUA 4H63H 2X66A 4YHHT 3L09A 3ZT7A 4PFPA 2BVMA 4HWIB 3OVUA 3GN5B 2XZEA 4CI2B 1IBMT 1O3XA 4CXXA 1N32T 2YN6A 4IREA 1WCRA 5J1GA 2E5LT 2JMKA 3H3AA 5JTGA 4ILAA 2HN2A 2V5CA 4DBQA 5AQRB 4CI1B 4HE8A 4ZI2C 3SFDA 2W61A 4ZI3C 2VB6A 2OLTA 2Y8DA 4X1KE 2N9DA 4GOUA 2VQFT 3H3MA 2W62A 2E9XB 4I50E 4U31A 4AQFC 4TWHA 3OYXA 2QYWA 1D0XA 3I0QA 4LMLA 2VVNA 4Q25A 2CCQA 2YOEA 2P9BA 4KMCA 3OKQA 3MA9A 4JI3T 3JC6D 1SE7A 4JI0T 3F2EA 4LMKA 2LE8A 1T98A 5AQNB 1CUNA 3FHNA 4JI1T 3ONLC 4ANJA 3KV6A 2XM2A 4PJLA 5EZYE 2LEHA 3AE2A 2KMFA 3FB2A 5HXRA 4DR3T 2MOZA 5BR8T 2PG8A 2ZM6T 2Y6XA 1HTJF 4P1NA 5AQIB 2DWKA 1L0VA 2UXBT 3IBPA 4TX5A 5AQVB 2D2SA 5EK2A 3R6NA 3EABA 3VHLA 1HG2A 1D0ZA 2J1DG 2B76A 3EAMA 3M3ZB 3MZKB 3RKOA 4AKGA 1KK7A 4IE5A 2IHR1 3MK7C 3HL6A 2EHOA 3QUJA 2JQHA 4YY3T 1FIOA 4JEHB 2H89A 2YEVC 3RYCE 4U3CA 5JDLA 2K24A 5EK4A 2X9WA 1W09A 4YXDA 1KNZA 4EEBA 4UXNB 4MBQA 4GIWA 2XAQB 4NPPA 4WZXA 3RC3A 5BMVE 4JLEA 4F8HA 5CFBA 4NIQA 2FBWA 3RKGA 3N9PA 4DO0A 1VOMA 1D1AA 4OYKA 3AEAA 4TNWA 2C5KT 5KMGP 3WAJA 5FYMA 3RH3A 5HCMA 5LGTB 2X9XA 2BS3A 2FJAA 3WI3A 2D0TA 1MIVA 5LCYA 3FZFB 3CWZB 4TNVA 2VKJA 3LK3B 1ZOYA 4COFA 3DJBA 4O4HE 1GQEA 4DVDA 3PUQA 3E08A 4O8SA 2XQ6A 4U2ZA 4JUYA 4IGUA 5JR9B 2X67A 1UGOA 1HNWT 2VURA 4IDPA 4ZOLE 2CMRA 1S35A 5HAXA 3CQGB 2LKHA 2XQ3A 3AE7A 3I1AA 1W0AA 3C4XA 3AAAB 2K3WA 1XDPA 4TUYE 4O4JE 5HEJA 3AE3A 2XQYA 1I6ZA 2XQ9A 2V6XA 2WDRA 3SRZA 2EHOD 3UU8A 3PU8A 1XDOA 4YTPA 2DI4A 1YKEB 4YSZA 3A5XA 3A7MA 4U74A 5ABGA 3EI0A 2W63A 2BVLA 3BK9A 3QNUA 4PK5A 1M7KA 5JDHA 4PNIA 4UR9A 3PJAA 5LMNT 1J5ET 4B3ST 3T1HT 3B13A 2D5UA 2CEAA 4YT0A 1WR0A 3FBLA 3OPCA 2UU9T 1IBLT 2I6HA 4NUUA 2NW8A 5JQGE 3T8OA 4ILUA 3N9OA 4DV4T 2Q9QD 3TKLB 2MYSA 5AQFB 4AXPA 2RP4A 3PUZF 1N33T 4IL9A 2WWUA 2DL1A 2IC6A 5HXCA 4IE4A 4CXYA 1EZ3A 4QH4A 2BBHA 4DR5T 5F3JA 1OWAA 1KF6A 4TN7B 4ZI7E 2UXDT 4JYAT 3RPUA 4WYVA 2X51A 1HS7A 4HWHA 4IDNA 2XAGB 2VKOA 2AE9A 2VL8A 4YTMA 4BJNA 1QSDA 3JC6C 2DCFA 3HKCE 1HF8A 2E5VA 4HWFA 1LVKA 3ETUA 2Z6EA 1T8BA 3FXDB 2VWAA 4AKLA 4QH5A 2LSIA 2VKDA 1J5WA 4DV0T 1E1HB 2X9HA 1HCIA 3F31A 4HFVA 1OEDB 3CK6A 5ABFB 1KNPA 3AA1B 3L8RA 3JAEA 5L2LA 4U33A 2LM2A 2KWHA 4A97A 3T1YT 2DWGA 4DV7T 4O4IE 2C5IT 3D0TA 4QXHB 2HHHT 2QVAA 3NKZA 5AQUB 3UFGA 2PTFA 1G8XA 1OEDA 4CI3B 4H9QC 4ZZCA 3N2KE 4G63A 1NWMX 3AA0B 3TLWA 2UXNB 5HWYA 5HWXA 5AQLB 1S94A 4XBFB 3OJAA 4AQGA 4EZHA 4JI5T 5HEOA 5LHIB 2WWVA 3N9MA 3RYFE 3UQ7A 2LOSA 2B1EA 5C8YE 4JI7T 4ZHQE 4CN6A 2YINA 4IE0A 5LNKA 2CBIA 3PE0A 2WS3A 2WDQA 4N78D 2NWBA 3Q2MA 5ABEA 3UU5A 2IW5B 2VVSA 3TLVA 3KDSE 3LSVA 4BAYB 1BR4A 5AQPB 2OA5A 3CQXC 3RRCA 3N9QA 2IAKA 4AQYT 4FJOA 4HGAA 3QB5A 3RRWA 3NBXX 3DTOA 4MHCA 2V7MA 2FJEA 3AA7B 2LHNA 3C51A 2QRXA 4UVBB 4JV5T 1QLBA 4Z91A 2WCAA 2M67A 2YU2A 4U7IA 3PUGA 1J1JA 2YKSA 4IDZA 5LJNA 3PU3A 4ASKA 3I9WA 2XAFB 3AECA 2LHRA 3RI5A 3AEDA 3MACA 3ZPOA 3HKBE 5CB4E 2H3RA 3J9X1 3J7Yq 3GN5A 2BG9B 2IIUA 3AE8A 5IWAT 3LG7A 3ZSSA 4P09A 4X1YE 4IHJE 2BBJA 2BG9A 4JI6T 2WZIA 4EXTA 3AXJB 2SPCA 4EIWA 2C5JA 5L4EA 3UUMA 2E9XA 5FXWA 4ISTA 4LFBT 2LRLA 5FL0A 4DR1T 4AKHA 5LHHB 3CPZA 4DUYT 2JPFA 4UEMA 2XQ4A 4QKNA 3VR9A 4EGWA 3P4RA 4QXBB 4UV8B 5HYAA 3AXJA 4ZZBA 3H37A 5ADXL 4YHJA 4WBNE 3SOLA 3NWIA 4P0AA 1ZKEA 4PK4A 4I4TE 3PTRB 4YJ3E 1HR0T 4UELA 2Q9QC 1Y01A 2VKHA 2W2UA 4K0UA 4PW8A 4KUMB 3UTKA 2IDOB 3FZKB 3RIUC 4GYRA 4WNKA 3C64A 3AE5A 4KI0F 4V1Av 4XAXB 3PUWF 4I55E 4DMWA 5FY1A 5FNVE 4HWCA 2NW7A 3KFWX 5AQMB 4HFCA 5LGNB 3CKDA 3VRBA 4AQFA 2XQ5A 2H88A 1ZEEA 4ZS3A 5CA0E 3AEBA 5L47A 3P4SA 5L3GB 4QHOA 3N9LA 5H6RB 3KBTA 3ZMZB 3N9NA 3O1IA 3BQIA 4PK6A 2W0GA 4NXNT 2CWOA 4TZ4C 5HCJA 2HPJA 2XQ8A 3P4QA 4GK0E 1MIWA 1V9DA 2G0UA 4CN1A 5M4YA 4UVAB 2CRBA 1U5PA 2NP9A 2NTXA 5L3BB 1BR0A 4HFDA 3AE6A 2ACXA 5KX5E 2XSAA 5L3EB 2E9XD 4LF7T 3O4XE 2XQAA 4H9NC 2ACZA 5TAOA 2DLRA 1D1CA 1QUUA 1YQ4A 4A5XA 4NXMT 1YQ3A 1T72A 4EZ4A 4KHPT 3O1HA 2IC9A 4CZZB 3N2GE 3QB5K 1Z8UA 4XZCA 2X0HA 4UVCB 3ZMSB 4L0RA 3ESLA 3CX6B 5AQTB 2FJBA 3UT5E 5JR9A 4EOZB 2LM9A 5JDGA 4AIUA 2L3LA 4HN9A 2XAJB 2XY8B 4M1PA 4IDOA 2DHRA 3K3NA 2V7IA 2MPKA 4QX7B 3E0ZA 2YDQA 5J2TE
chains in the Genus database with same CATH topology
3QNUA 3QOFA 3X1DA 1Z8UA 3OVUA 4IDPA 4IDOA 1XZYA 1W0AA 4IDQA 1W09A 4IDNA 3Q5EA 3Q5DA 1Y01A 3IA3A 1W0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNU A;  3QOF A;  3X1D A;  1Z8U A;  3OVU A;  4IDP A;  4IDO A;  1XZY A;  1W0A A;  4IDQ A;  1W09 A;  4IDN A;  3Q5E A;  3Q5D A;  1Y01 A;  3IA3 A;  1W0B A; 
#chains in the Genus database with same CATH topology
 3ZMU B;  4CQI A;  4ZI2 D;  5DAB A;  4E7Z A;  4ZI3 D;  3RIF A;  2ZM0 A;  4H9R C;  3UU4 A;  3ZN1 B;  4EED A;  2W00 A;  3ZST A;  5L3C B;  2BS2 A;  2ODV A;  3TLT A;  1UUS A;  4HFI A;  5LHG B;  5GON E;  2ZM8 A;  2LSK A;  3N5L A;  3AVS A;  2VL0 A;  3K8P C;  5L4H A;  3PUV F;  3AE1 A;  5E0O A;  4X62 T;  5FVL A;  1NEN A;  5LG4 A;  3UUL A;  1ZV4 X;  2IML A;  5FP3 A;  3E22 E;  3TLS A;  1XMO T;  1WRD A;  3FXE B;  3SS1 A;  1XMQ T;  5LGU B;  3UU3 A;  3ZC1 A;  4GYS A;  1E7P A;  1US7 B;  3ZMT B;  4MFR A;  4LFC T;  3UQ4 A;  1HNX T;  2XM1 A;  3UU6 A;  3NRX A;  3ZN0 B;  5LBM A;  4DBR A;  2ODU A;  1ZHC A;  3KBU A;  3VKH A;  4ILB A;  2K5B B;  1XWM A;  3KIN B;  5HEU A;  3ZJ2 A;  4X1I E;  5KXJ A;  2CLY C;  3V5U A;  2IUB A;  5DQW A;  3KVB A;  1KNR A;  4UIG A;  1XZY A;  4LF6 T;  3C4W A;  3P4P A;  4MAL A;  1M62 A;  5LYJ E;  4PAG A;  2W67 A;  5CGM A;  2CBJ A;  4B3T T;  3ZEF B;  2KZ7 B;  4B3M T;  3HI2 A;  1MND A;  1X79 A;  3I0O A;  4DR7 T;  2I0M A;  4E7S A;  1HFA A;  2WDV A;  3ZLI A;  2N2N A;  3SFE A;  5HXH A;  2MBG A;  1D0Y A;  4EYY R;  3S4U A;  4IE7 A;  2LLY A;  3VKG A;  3UUB A;  4F6R C;  3ZKR A;  2A2F X;  5C3J A;  5L3D B;  4QXC B;  1YKH B;  4ISS A;  4AI6 A;  1JNZ A;  2LSJ A;  5ETW A;  2UUA T;  3ZCI A;  5J0Z A;  3F57 A;  3ZT6 A;  5ABF A;  4FI5 A;  4DMV A;  3O9X A;  5JRE A;  3KV5 A;  4UF0 B;  3LK4 2;  5HXE A;  2LT3 A;  3P7I A;  4LF4 T;  4UV9 B;  2L9Q A;  4AKI A;  3VU7 H;  1N34 T;  2M6I A;  4JEU B;  4OYJ A;  4EB6 E;  4JI2 T;  1G73 A;  4UF0 A;  4GKK T;  3HKE E;  3OBV E;  2CE7 A;  3ONX A;  5LOV E;  3A8Y C;  4B6X A;  2JQK A;  3Q5X A;  4I43 B;  3ABV A;  3RQU A;  2V8S V;  3L3P A;  3P4W A;  4U7Y A;  4TWD A;  5HEH A;  5AFU L;  5A1L A;  1LKX A;  3GA8 A;  1UK5 A;  5FXV A;  2CXL A;  2YDR A;  2V7L A;  3LBX B;  3HA4 A;  3L39 A;  2JQQ A;  2C0S A;  2CWY A;  3KVA A;  4L9I A;  1D1B A;  3LFM A;  1ZP0 A;  2WY2 A;  5FL1 A;  1VRB A;  4EAH A;  1JNR A;  3PDY A;  4NUV A;  4DR2 T;  3AEF A;  4HFB A;  2E9X C;  1HNZ T;  3IEE A;  2X0Y A;  2D9D A;  2W4X A;  3RIA A;  2WMO A;  2LKG A;  3C50 A;  3PV0 F;  2KIN B;  3RC8 A;  3FZH B;  4IE6 A;  3LDQ B;  4IT4 A;  2BKP A;  3KV4 A;  4CN4 A;  3ZT5 A;  3VR8 A;  3RQW A;  4HTE A;  3EUH A;  1N36 T;  3CML A;  5ABH A;  5HXS A;  2ES0 A;  3DP7 A;  3IF8 B;  5JVD E;  3NZQ A;  2V5D A;  4G2A A;  3ZYL A;  4LFA T;  4EYU A;  1H7C A;  4KHZ F;  3PUY F;  2NTY A;  4DUZ T;  2V7K A;  3PUX F;  4DV2 T;  2KLQ A;  4ADZ A;  2PBI A;  2NOX A;  2NR4 A;  3ZJ1 A;  5DQV A;  4HFE A;  4KX6 A;  5EK3 A;  5JDN A;  5JDQ A;  3AEG A;  3PUA A;  5H6Q B;  2EHO C;  3EDV A;  5FXZ A;  2UUB T;  1UX4 A;  2E2A A;  2ZMA A;  3CIR A;  3CX7 B;  1SA0 E;  3EHZ A;  5JH7 E;  4TWF A;  2J4G A;  1YXR A;  4IDQ A;  4KP3 C;  3QOF A;  1IJ6 A;  3G06 A;  5AQK B;  1MNE A;  1MMA A;  2K48 A;  1BR2 A;  4DV6 T;  3NVO A;  1WR6 A;  1SHZ C;  2DNX A;  2PFV A;  3KV9 A;  5JDF A;  4WW0 A;  4L5G A;  5LG3 A;  2M6B A;  2XAH B;  2X68 A;  3ZCJ A;  2XUE A;  1OXZ A;  3TLU A;  4PFO A;  1AJ3 A;  1FMW A;  4B3R T;  3R84 B;  1I94 T;  2EHO B;  5FKY A;  3WAK A;  2VK9 A;  2CHO A;  2QGS A;  3LK2 B;  1DU2 A;  5JRC B;  3JCF A;  2JMH A;  2RPA A;  1MIY A;  2FJD A;  4DV1 T;  3ZYM A;  4JI8 T;  2KXP B;  4YLH A;  4YTN A;  3AA6 B;  4LF8 T;  1UX5 A;  2ZM2 A;  5C2T A;  1Z0P A;  3Q5W A;  3QC9 A;  5JRC A;  5JR9 C;  2KT9 A;  3ETV A;  4OHF A;  4PJM A;  2BKN A;  3IA3 A;  3MJX A;  4EV6 A;  4C90 A;  2Q9Q B;  3P50 A;  2HN1 A;  1HX8 A;  2LJL A;  2JJ9 A;  2OV9 A;  1X9B A;  4H9O C;  2NW9 A;  5AQQ B;  1YW0 A;  3CX8 B;  3FZL B;  3U3I A;  3AE4 A;  2WSS V;  3OTO T;  5IUX A;  2E8I A;  4YSX A;  2JRK A;  2WM9 A;  2Q9Q A;  5FY7 A;  5L3F B;  1VCS A;  4MLK A;  3C4Z A;  5FY0 A;  3JAF A;  3PUS A;  3IHR A;  4O2A E;  1YD8 G;  4ILC A;  2X9Y A;  3RIU A;  4LF9 T;  2R6G F;  3ZYK A;  1T7S A;  2KWI B;  4C91 A;  3EVY A;  2XAS B;  1IJ5 A;  4O2B E;  3RGL A;  5LXT E;  2BS4 A;  1SUM B;  3PUR A;  4ZXL A;  4GK5 E;  1WYC A;  3RYH E;  1FJG T;  2XHE B;  2K9A A;  4TV9 E;  2YK0 A;  5CA1 E;  2I59 A;  1WYB A;  3RLF F;  4U72 A;  2RA1 A;  1HG5 A;  2XPK A;  4BA9 A;  2WQY A;  2BDE A;  5LP6 E;  5AQH B;  3UUN A;  2WU5 A;  3AB3 B;  1IAP A;  2X0L B;  1KFY A;  3AAE B;  3X1D A;  3CQC B;  4IL4 A;  2A72 A;  2CM0 A;  2PJQ A;  4PJJ A;  2WP9 A;  4I0U A;  4U2Y A;  3GMI A;  2V6Y B;  3AAI A;  4ZS2 A;  4PJN A;  5IHY A;  5HEG A;  5FVK A;  3FZM B;  5LBQ B;  3QK6 A;  2UXC T;  2H7V C;  1BR1 A;  1FEW A;  4ZEY A;  2V1D B;  4H9P C;  5IYZ E;  2V6Y A;  3HR0 A;  5F5W A;  3RYI E;  4K0K T;  4P0B A;  1KEY A;  2J47 A;  4LF5 T;  3SWH A;  2H7O A;  1U4Q A;  3RX6 A;  3ZMV B;  1LRZ A;  1OED E;  2WB5 A;  2J62 A;  1W9R A;  4X65 T;  1W0B A;  4X5T A;  3B5M A;  4QWN B;  4QH1 A;  5AQG B;  2N1G A;  1OED C;  5LMU T;  2QA7 A;  2W66 A;  4QX8 B;  1E2A A;  3P8C D;  4DND A;  2V7J A;  2CXD A;  5KDM C;  3JAD A;  3ZC0 A;  4AKR B;  1CHU A;  2XJ7 A;  3AE9 A;  4WBO A;  4LMJ A;  5FMN A;  2YU1 A;  4GKJ T;  2CHN A;  2UUC T;  1IZN B;  3I9Y A;  3EDU A;  4X64 T;  2CPT A;  4Z90 A;  2CA5 A;  3Q5D A;  1LVF A;  1UUR A;  4H9S E;  4HEA A;  4JI4 T;  5AQS B;  5AQJ B;  1IBK T;  1XNQ T;  2CXF A;  3RHW A;  4HFH A;  1FMV A;  2AXD S;  2YDS A;  2XQ7 A;  2XTL A;  2UXX B;  4HWD A;  2GK9 A;  2CLY B;  3Q5E A;  3BQL A;  3V5S A;  3LJC A;  1NAF A;  3MKD A;  2A3D A;  1NEK A;  2BZB A;  3ANW B;  2KND A;  2ZLY A;  2WZH A;  4JBW F;  4X20 E;  3VRA A;  3K1S A;  3GWH A;  1UCU A;  1MMG A;  4DV3 T;  2LOP A;  3U78 A;  3B57 A;  4H63 V;  3ANW A;  3M65 A;  1Y64 B;  3NRY A;  4OX9 T;  5F8P A;  5J2U E;  3ONJ A;  4DR4 T;  2XSB A;  2WMN A;  4O4L E;  3RF1 A;  4YSY A;  4A56 A;  2BG9 E;  3CVR A;  3PJA J;  3UUX B;  2VAS A;  5LJM A;  4ERR A;  5FXX A;  1XNR T;  4KBM B;  2HPL A;  2KSR A;  5LB7 B;  2VQE T;  3N2O A;  4BJM A;  4AIS A;  4OK0 A;  2LSY A;  1VCT A;  4YJ2 E;  3AEE A;  3BQK A;  2FUP A;  2BG9 C;  2Y48 B;  1B7T A;  3MXZ A;  3K3Q C;  4J2C A;  1MMN A;  3W15 B;  4A98 A;  2HH7 A;  4YFS A;  3OYZ A;  2WU2 A;  4DID B;  1R8I A;  3LBX A;  3NZP A;  4IIJ E;  4DR6 T;  2L8K A;  2JQ9 A;  3O1J A;  4OFZ A;  3HKD E;  3Q9D A;  2BKO A;  5AQO B;  2LSG A;  3FBZ A;  5CJ5 A;  3K3O A;  2MTQ A;  2LRK A;  1WFD A;  1HX1 B;  2F4V T;  4DV5 T;  3C98 B;  2D0U A;  4HKA A;  4CXW A;  2A9U A;  2MAW A;  3UFE A;  5LA6 E;  2WBL A;  5JDM A;  4X66 T;  1MMD A;  4Z8X A;  2V26 A;  4TV8 E;  1WLX A;  2JIW A;  5DJQ C;  3AVR A;  2WAU A;  4H63 H;  2X66 A;  4YHH T;  3L09 A;  3ZT7 A;  4PFP A;  2BVM A;  4HWI B;  3OVU A;  3GN5 B;  2XZE A;  4CI2 B;  1IBM T;  1O3X A;  4CXX A;  1N32 T;  2YN6 A;  4IRE A;  1WCR A;  5J1G A;  2E5L T;  2JMK A;  3H3A A;  5JTG A;  4ILA A;  2HN2 A;  2V5C A;  4DBQ A;  5AQR B;  4CI1 B;  4HE8 A;  4ZI2 C;  3SFD A;  2W61 A;  4ZI3 C;  2VB6 A;  2OLT A;  2Y8D A;  4X1K E;  2N9D A;  4GOU A;  2VQF T;  3H3M A;  2W62 A;  2E9X B;  4I50 E;  4U31 A;  4AQF C;  4TWH A;  3OYX A;  2QYW A;  1D0X A;  3I0Q A;  4LML A;  2VVN A;  4Q25 A;  2CCQ A;  2YOE A;  2P9B A;  4KMC A;  3OKQ A;  3MA9 A;  4JI3 T;  3JC6 D;  1SE7 A;  4JI0 T;  3F2E A;  4LMK A;  2LE8 A;  1T98 A;  5AQN B;  1CUN A;  3FHN A;  4JI1 T;  3ONL C;  4ANJ A;  3KV6 A;  2XM2 A;  4PJL A;  5EZY E;  2LEH A;  3AE2 A;  2KMF A;  3FB2 A;  5HXR A;  4DR3 T;  2MOZ A;  5BR8 T;  2PG8 A;  2ZM6 T;  2Y6X A;  1HTJ F;  4P1N A;  5AQI B;  2DWK A;  1L0V A;  2UXB T;  3IBP A;  4TX5 A;  5AQV B;  2D2S A;  5EK2 A;  3R6N A;  3EAB A;  3VHL A;  1HG2 A;  1D0Z A;  2J1D G;  2B76 A;  3EAM A;  3M3Z B;  3MZK B;  3RKO A;  4AKG A;  1KK7 A;  4IE5 A;  2IHR 1;  3MK7 C;  3HL6 A;  2EHO A;  3QUJ A;  2JQH A;  4YY3 T;  1FIO A;  4JEH B;  2H89 A;  2YEV C;  3RYC E;  4U3C A;  5JDL A;  2K24 A;  5EK4 A;  2X9W A;  1W09 A;  4YXD A;  1KNZ A;  4EEB A;  4UXN B;  4MBQ A;  4GIW A;  2XAQ B;  4NPP A;  4WZX A;  3RC3 A;  5BMV E;  4JLE A;  4F8H A;  5CFB A;  4NIQ A;  2FBW A;  3RKG A;  3N9P A;  4DO0 A;  1VOM A;  1D1A A;  4OYK A;  3AEA A;  4TNW A;  2C5K T;  5KMG P;  3WAJ A;  5FYM A;  3RH3 A;  5HCM A;  5LGT B;  2X9X A;  2BS3 A;  2FJA A;  3WI3 A;  2D0T A;  1MIV A;  5LCY A;  3FZF B;  3CWZ B;  4TNV A;  2VKJ A;  3LK3 B;  1ZOY A;  4COF A;  3DJB A;  4O4H E;  1GQE A;  4DVD A;  3PUQ A;  3E08 A;  4O8S A;  2XQ6 A;  4U2Z A;  4JUY A;  4IGU A;  5JR9 B;  2X67 A;  1UGO A;  1HNW T;  2VUR A;  4IDP A;  4ZOL E;  2CMR A;  1S35 A;  5HAX A;  3CQG B;  2LKH A;  2XQ3 A;  3AE7 A;  3I1A A;  1W0A A;  3C4X A;  3AAA B;  2K3W A;  1XDP A;  4TUY E;  4O4J E;  5HEJ A;  3AE3 A;  2XQY A;  1I6Z A;  2XQ9 A;  2V6X A;  2WDR A;  3SRZ A;  2EHO D;  3UU8 A;  3PU8 A;  1XDO A;  4YTP A;  2DI4 A;  1YKE B;  4YSZ A;  3A5X A;  3A7M A;  4U74 A;  5ABG A;  3EI0 A;  2W63 A;  2BVL A;  3BK9 A;  3QNU A;  4PK5 A;  1M7K A;  5JDH A;  4PNI A;  4UR9 A;  3PJA A;  5LMN T;  1J5E T;  4B3S T;  3T1H T;  3B13 A;  2D5U A;  2CEA A;  4YT0 A;  1WR0 A;  3FBL A;  3OPC A;  2UU9 T;  1IBL T;  2I6H A;  4NUU A;  2NW8 A;  5JQG E;  3T8O A;  4ILU A;  3N9O A;  4DV4 T;  2Q9Q D;  3TKL B;  2MYS A;  5AQF B;  4AXP A;  2RP4 A;  3PUZ F;  1N33 T;  4IL9 A;  2WWU A;  2DL1 A;  2IC6 A;  5HXC A;  4IE4 A;  4CXY A;  1EZ3 A;  4QH4 A;  2BBH A;  4DR5 T;  5F3J A;  1OWA A;  1KF6 A;  4TN7 B;  4ZI7 E;  2UXD T;  4JYA T;  3RPU A;  4WYV A;  2X51 A;  1HS7 A;  4HWH A;  4IDN A;  2XAG B;  2VKO A;  2AE9 A;  2VL8 A;  4YTM A;  4BJN A;  1QSD A;  3JC6 C;  2DCF A;  3HKC E;  1HF8 A;  2E5V A;  4HWF A;  1LVK A;  3ETU A;  2Z6E A;  1T8B A;  3FXD B;  2VWA A;  4AKL A;  4QH5 A;  2LSI A;  2VKD A;  1J5W A;  4DV0 T;  1E1H B;  2X9H A;  1HCI A;  3F31 A;  4HFV A;  1OED B;  3CK6 A;  5ABF B;  1KNP A;  3AA1 B;  3L8R A;  3JAE A;  5L2L A;  4U33 A;  2LM2 A;  2KWH A;  4A97 A;  3T1Y T;  2DWG A;  4DV7 T;  4O4I E;  2C5I T;  3D0T A;  4QXH B;  2HHH T;  2QVA A;  3NKZ A;  5AQU B;  3UFG A;  2PTF A;  1G8X A;  1OED A;  4CI3 B;  4H9Q C;  4ZZC A;  3N2K E;  4G63 A;  1NWM X;  3AA0 B;  3TLW A;  2UXN B;  5HWY A;  5HWX A;  5AQL B;  1S94 A;  4XBF B;  3OJA A;  4AQG A;  4EZH A;  4JI5 T;  5HEO A;  5LHI B;  2WWV A;  3N9M A;  3RYF E;  3UQ7 A;  2LOS A;  2B1E A;  5C8Y E;  4JI7 T;  4ZHQ E;  4CN6 A;  2YIN A;  4IE0 A;  5LNK A;  2CBI A;  3PE0 A;  2WS3 A;  2WDQ A;  4N78 D;  2NWB A;  3Q2M A;  5ABE A;  3UU5 A;  2IW5 B;  2VVS A;  3TLV A;  3KDS E;  3LSV A;  4BAY B;  1BR4 A;  5AQP B;  2OA5 A;  3CQX C;  3RRC A;  3N9Q A;  2IAK A;  4AQY T;  4FJO A;  4HGA A;  3QB5 A;  3RRW A;  3NBX X;  3DTO A;  4MHC A;  2V7M A;  2FJE A;  3AA7 B;  2LHN A;  3C51 A;  2QRX A;  4UVB B;  4JV5 T;  1QLB A;  4Z91 A;  2WCA A;  2M67 A;  2YU2 A;  4U7I A;  3PUG A;  1J1J A;  2YKS A;  4IDZ A;  5LJN A;  3PU3 A;  4ASK A;  3I9W A;  2XAF B;  3AEC A;  2LHR A;  3RI5 A;  3AED A;  3MAC A;  3ZPO A;  3HKB E;  5CB4 E;  2H3R A;  3J9X 1;  3J7Y q;  3GN5 A;  2BG9 B;  2IIU A;  3AE8 A;  5IWA T;  3LG7 A;  3ZSS A;  4P09 A;  4X1Y E;  4IHJ E;  2BBJ A;  2BG9 A;  4JI6 T;  2WZI A;  4EXT A;  3AXJ B;  2SPC A;  4EIW A;  2C5J A;  5L4E A;  3UUM A;  2E9X A;  5FXW A;  4IST A;  4LFB T;  2LRL A;  5FL0 A;  4DR1 T;  4AKH A;  5LHH B;  3CPZ A;  4DUY T;  2JPF A;  4UEM A;  2XQ4 A;  4QKN A;  3VR9 A;  4EGW A;  3P4R A;  4QXB B;  4UV8 B;  5HYA A;  3AXJ A;  4ZZB A;  3H37 A;  5ADX L;  4YHJ A;  4WBN E;  3SOL A;  3NWI A;  4P0A A;  1ZKE A;  4PK4 A;  4I4T E;  3PTR B;  4YJ3 E;  1HR0 T;  4UEL A;  2Q9Q C;  1Y01 A;  2VKH A;  2W2U A;  4K0U A;  4PW8 A;  4KUM B;  3UTK A;  2IDO B;  3FZK B;  3RIU C;  4GYR A;  4WNK A;  3C64 A;  3AE5 A;  4KI0 F;  4V1A v;  4XAX B;  3PUW F;  4I55 E;  4DMW A;  5FY1 A;  5FNV E;  4HWC A;  2NW7 A;  3KFW X;  5AQM B;  4HFC A;  5LGN B;  3CKD A;  3VRB A;  4AQF A;  2XQ5 A;  2H88 A;  1ZEE A;  4ZS3 A;  5CA0 E;  3AEB A;  5L47 A;  3P4S A;  5L3G B;  4QHO A;  3N9L A;  5H6R B;  3KBT A;  3ZMZ B;  3N9N A;  3O1I A;  3BQI A;  4PK6 A;  2W0G A;  4NXN T;  2CWO A;  4TZ4 C;  5HCJ A;  2HPJ A;  2XQ8 A;  3P4Q A;  4GK0 E;  1MIW A;  1V9D A;  2G0U A;  4CN1 A;  5M4Y A;  4UVA B;  2CRB A;  1U5P A;  2NP9 A;  2NTX A;  5L3B B;  1BR0 A;  4HFD A;  3AE6 A;  2ACX A;  5KX5 E;  2XSA A;  5L3E B;  2E9X D;  4LF7 T;  3O4X E;  2XQA A;  4H9N C;  2ACZ A;  5TAO A;  2DLR A;  1D1C A;  1QUU A;  1YQ4 A;  4A5X A;  4NXM T;  1YQ3 A;  1T72 A;  4EZ4 A;  4KHP T;  3O1H A;  2IC9 A;  4CZZ B;  3N2G E;  3QB5 K;  1Z8U A;  4XZC A;  2X0H A;  4UVC B;  3ZMS B;  4L0R A;  3ESL A;  3CX6 B;  5AQT B;  2FJB A;  3UT5 E;  5JR9 A;  4EOZ B;  2LM9 A;  5JDG A;  4AIU A;  2L3L A;  4HN9 A;  2XAJ B;  2XY8 B;  4M1P A;  4IDO A;  2DHR A;  3K3N A;  2V7I A;  2MPK A;  4QX7 B;  3E0Z A;  2YDQ A;  5J2T E; 
#chains in the Genus database with same CATH homology
 3QNU A;  3QOF A;  3X1D A;  1Z8U A;  3OVU A;  4IDP A;  4IDO A;  1XZY A;  1W0A A;  4IDQ A;  1W09 A;  4IDN A;  3Q5E A;  3Q5D A;  1Y01 A;  3IA3 A;  1W0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...