1W0AA

Solution structure of the trans form of the human alpha-hemoglobin stabilizing protein (ahsp)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
LLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ALPHA-HEMOGLOBIN STABILIZING PROTEIN
publication title NMR structure of the alpha-hemoglobin stabilizing protein: insights into conformational heterogeneity and binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1w0aA00
1XZYA 1W0AA 1Z8UA 3QNUA 3X1DA 4IDOA 1W09A 3Q5DA 3IA3A 4IDNA 3Q5EA 3OVUA 3QOFA 1Y01A 4IDPA 1W0BA 4IDQA
chains in the Genus database with same CATH superfamily
3KV4A 3E0ZA 4EIWA 5ABFA 5ABHA 2CXLA 3A8YC 3PUAA 2XAGB 2C0SA 1Y64B 1XZYA 4CXWA 4QWNB 4DMVA 3EDUA 3ANWA 2AE9A 2IHR1 4X66T 2AXDS 2XSBA 2XQAA 2XTLA 4O2BE 1B7TA 3Q5WA 2UXDT 2MYSA 3HKEE 4LF5T 4ZZBA 2QYWA 1YQ3A 5JR9A 3FZKB 2WB5A 2X9YA 2DHRA 3VU7H 4ILAA 2MBGA 3AEDA 1MMAA 3SFDA 2LJLA 3ZMSB 4ZZCA 1IJ5A 2HPLA 2HPJA 2JPFA 4GYSA 4QHOA 4QH4A 4JI3T 5JR9C 2YDRA 2FJEA 3UUXB 4DR1T 3ZMTB 2XAHB 2I59A 5AQGB 4DIDB 5AQLB 3HKCE 3UTKA 4JI1T 3IA3A 3I1AA 2LRKA 5FVKA 3RIUA 4B3TT 2WCAA 4HEAA 5M4YA 3U3IA 1X9BA 3UULA 3X1DA 2XHEB 4CI1B 4WNKA 1E2AA 2X9WA 3L09A 1FMVA 5LB7B 2W4XA 5JRCB 3H37A 3B57A 2Q9QA 2K9AA 4K0UA 1Z8UA 3PJAA 2D0UA 1D1BA 5BR8T 4YLHA 1YD8G 5JQGE 5LHGB 4HFHA 3LG7A 1XDOA 5E0OA 2XZEA 2CMRA 4IE5A 2WMOA 2YEVC 3PU3A 3TLUA 2VURA 2Q9QC 4P09A 3Q5DA 5LJMA 5HEOA 4DBQA 4HWIB 2NWBA 3C64A 2RPAA 1WRDA 2LM9A 4ZEYA 5L3DB 4KP3C 2LOPA 1HNWT 5DQVA 1HX8A 1KEYA 1LRZA 3RIAA 5LG4A 4IE0A 1QSDA 5FXZA 5J2UE 3KFWX 2FJAA 2KLQA 4HWHA 3GA8A 2VB6A 4HFIA 1Y01A 2BG9A 3PUYF 4U2ZA 4UXNB 5JVDE 3AA6B 4EYYR 2NW8A 2WWUA 3PUVF 3AA0B 4P1NA 1IBMT 4YSZA 2D5UA 5L3EB 3P50A 2BS3A 1JNRA 3V5SA 2EHOA 3KBUA 4DNDA 2KMFA 3N9NA 3GWHA 2BG9C 5KDMC 1WYBA 2H7VC 3PURA 4A5XA 4YJ3E 4ZXLA 4LF9T 2KINB 4JUYA 3ZCIA 2ZM0A 1S94A 2VL0A 3EI0A 1SE7A 4ZI2C 3R6NA 3AB3B 1JNZA 2CBJA 2Y48B 3QK6A 4F8HA 3RYHE 5F5WA 2MPKA 2JJ9A 2V26A 2H3RA 2XM1A 3VR9A 1LVKA 4CN4A 3BQLA 5HCJA 2LSYA 4QXBB 4U33A 4BJNA 3FZLB 2UXCT 3W15B 2V7IA 1D0ZA 4O4JE 4CXXA 3DJBA 3EDVA 3WAJA 4HN9A 3ETVA 4Z8XA 4YTPA 3RF1A 4COFA 5FVLA 3QUJA 1OEDC 3ETUA 2W00A 4WZXA 5IYZE 4TV8E 2V1DB 3HKDE 2YN6A 4IE7A 4DR4T 3CX8B 2IDOB 2JRKA 4B6XA 3LK2B 3E22E 2SPCA 4H9PC 3AEEA 2WZIA 4YFSA 2FBWA 1VRBA 5LJNA 3AEBA 2A72A 5FY7A 4EZHA 3Q2MA 3UFEA 2G0UA 4TUYE 4AQFA 4O2AE 2V7KA 2BZBA 4HTEA 3UFGA 1XDPA 1ZP0A 4CZZB 4IIJE 4X64T 3OYXA 5LA6E 4EGWA 3RHWA 1OEDE 3CX6B 2BBHA 3MA9A 5DQWA 4AQFC 2X0YA 2PG8A 2WDQA 4HWCA 1CUNA 1WCRA 4KX6A 2KZ7B 5AQNB 5HEHA 5JDFA 4JV5T 5KX5E 3RYFE 4PJNA 2LSGA 4AKLA 1I6ZA 3OYZA 3AE1A 5AQOB 4AQGA 1BR1A 2XY8B 3LJCA 3AEFA 1YKHB 1UCUA 3ONJA 4LF4T 4PJJA 3LFMA 3PV0F 4HFDA 1N34T 1T7SA 3SS1A 2XQ9A 2LHNA 2ODVA 3ZN1B 2A3DA 3AAIA 2Z6EA 4J2CA 2K3WA 1FMWA 1HF8A 3RYCE 3ZJ1A 3ZSTA 1XNQT 2CEAA 2WY2A 4B3ST 2Y8DA 3ZT5A 2W61A 1BR0A 4IDNA 4O4IE 5HEUA 2VL8A 2XAQB 1US7B 4OX9T 2HH7A 4NXMT 4HFEA 3MXZA 3KV5A 4X5TA 1HX1B 4PFPA 5AQHB 4DVDA 3SOLA 3RLFF 1WLXA 3QNUA 2A9UA 3AE9A 3ZMZB 2CHNA 4H9RC 4HFVA 5LOVE 5IWAT 1U5PA 4PAGA 4ZI7E 4AKHA 1J5ET 1UK5A 1YKEB 5CB4E 4A97A 4F6RC 3ZCJA 3I9WA 3HL6A 5DJQC 3PUSA 2JQKA 3ZT6A 3SWHA 3AEAA 4HKAA 5FXXA 3HKBE 1KNRA 3I0OA 3ZC0A 2J1DG 2D0TA 3ZN0B 2A2FX 4DV4T 1FJGT 2CLYC 2IAKA 5HXCA 2B76A 5JDHA 2K48A 3VKHA 2FJDA 4IGUA 3LSVA 1NWMX 2KT9A 4BA9A 4JLEA 1G8XA 3K3QC 4GK5E 4AKGA 4BAYB 3PUQA 1AJ3A 3UU6A 4TZ4C 5HXEA 4MLKA 5F3JA 4DV0T 2VVSA 5BMVE 2X9XA 4C91A 1J5WA 2LSIA 3N9LA 2JQQA 2Q9QD 3A7MA 2JQ9A 2CXDA 4IHJE 1HG5A 2DNXA 5H6QB 5AQFB 3O9XA 3IBPA 4CN6A 2VK9A 5LGTB 4LFBT 1HTJF 3UU8A 1ZOYA 3OKQA 1UX4A 4ZOLE 4AIUA 4UIGA 2LKHA 4DV7T 2V8SV 1SHZC 4TWDA 4U31A 3P8CD 5FXVA 1FEWA 3GMIA 2X66A 4I43B 3TLSA 2YDSA 2RA1A 4PNIA 5AQTB 2D9DA 3ZKRA 3AE5A 2GK9A 3S4UA 4WBNE 3RC8A 4HE8A 4UR9A 3N9MA 4ANJA 2JMKA 3DTOA 2LM2A 2WU2A 4YTMA 4G2AA 4EEDA 5FY1A 2WP9A 2W2UA 3I0QA 4OYKA 5L3FB 4I0UA 1MMNA 2LKGA 3F2EA 3CWZB 2BKNA 5A1LA 3TLWA 5KMGP 3QB5K 4NUUA 2KWIB 3Q5XA 5FYMA 4E7SA 4TWFA 3RIUC 1XMOT 3GN5A 4ZI2D 5KXJA 2ZM2A 3ZYMA 3ONXA 1MMGA 3O1IA 1MNEA 3H3MA 2ES0A 1XNRT 4QX8B 5L2LA 4AKIA 1H7CA 1W0AA 2V6YA 1D1CA 4LFCT 2X67A 3RKGA 2LRLA 4N78D 4GKKT 3MZKB 2ZM6T 1HG2A 4DR5T 3KINB 2H88A 1V9DA 5ABEA 2N1GA 2VKHA 5CJ5A 1IBLT 4L0RA 4BJMA 3PE0A 2LOSA 4HWFA 5AFUL 1Z0PA 3B5MA 4LF8T 1U4QA 4MFRA 3O1HA 4AXPA 3L3PA 4U7IA 3R84B 4O4LE 2B1EA 3RH3A 1D0YA 2LE8A 2E9XA 5CA1E 3UT5E 3UU4A 2NTXA 3CX7B 3OTOT 4UF0A 2CWOA 4JEHB 2L3LA 4QXHB 3PDYA 3ZYKA 1KF6A 2KSRA 3CVRA 4DUYT 4LF6T 3RQWA 1UURA 4B3MT 5LHIB 2E9XC 2CPTA 4UVCB 5JH7E 4ILUA 1KK7A 4U72A 2CCQA 3NKZA 2M6IA 4JBWF 3JC6C 2ODUA 5JDLA 1VCSA 3ABVA 2UU9T 1R8IA 2EHOC 2W66A 1E7PA 1VOMA 2CBIA 3A5XA 4ZI3C 2X51A 4V1Av 2LSKA 3B13A 4C90A 3C50A 4CQIA 3ANWB 5HEGA 4Z90A 1HNZT 1UGOA 3RRCA 1HS7A 4IDOA 1W09A 4FI5A 3UUBA 4ILCA 5HYAA 3AVRA 2WMNA 3KDSE 5JR9B 2ACXA 5AQQB 2BG9E 4IL9A 5GONE 3AXJB 2BKPA 3UQ7A 3T8OA 1UX5A 4GKJT 2FUPA 2FJBA 3JAEA 4JI2T 2XASB 4HWDA 5AQMB 4I55E 5C8YE 2J4GA 4L5GA 2IW5B 1ZV4X 3HR0A 4KI0F 4QX7B 3HI2A 3I9YA 3RQUA 5L3GB 3K8PC 2YINA 4QH5A 3K3OA 2LSJA 4U2YA 1HFAA 2LT3A 2OLTA 4TNWA 4JI0T 3FBZA 1KFYA 3H3AA 3TLTA 2NR4A 3QOFA 5HXHA 4X1IE 5JDQA 2V7JA 4JYAT 2PJQA 3K1SA 4ILBA 4JI5T 4DMWA 4ISTA 4I50E 5HWYA 4YY3T 5LG3A 5J0ZA 3EVYA 3Q9DA 2I0MA 1YW0A 2L8KA 1BR4A 5FY0A 3LK3B 5LCYA 4ZS3A 4DV1T 3PJAJ 3CKDA 2NW7A 3OVUA 2N9DA 4PW8A 4IREA 5HAXA 2XQ6A 2ZMAA 3FZMB 2Q9QB 4Z91A 2D2SA 3NZPA 3F57A 4HFBA 3C4WA 3P4PA 4EYUA 2J47A 4KBMB 4I4TE 2ZLYA 3UU5A 4H9NC 4CXYA 5AQPB 5TAOA 3AE6A 4MBQA 3NVOA 2VKOA 3N2GE 2X0LB 3ZYLA 2WU5A 4TNVA 5HCMA 2K24A 3CMLA 2DCFA 4K0KT 4TN7B 3RPUA 4EXTA 4TV9E 3P4SA 3KVBA 2E5LT 1O3XA 1NAFA 2OA5A 3ZPOA 5J2TE 5JRCA 1M62A 1NENA 4IE6A 3WI3A 1OWAA 5AQUB 4EZ4A 3F31A 3EAMA 5AQIB 4G63A 5C2TA 4JI8T 3J7Yq 3MJXA 5LXTE 2NP9A 1WYCA 1HNXT 5L4HA 2BG9B 4L9IA 5LBMA 2WWVA 4EEBA 1HR0T 2BBJA 5L47A 4CN1A 3AECA 5AQRB 3CQXC 3FBLA 2BVMA 3KBTA 2OV9A 4X1YE 2W62A 4XAXB 5DABA 4EOZB 1MIVA 3RC3A 4YHJA 3AEGA 4PK4A 5ADXL 5HWXA 3VKGA 2VQFT 4IDZA 2DLRA 2K5BB 3AE8A 4H9SE 4YHHT 4QH1A 4A56A 4UV8B 4LMLA 4EB6E 2ZM8A 3N5LA 1IJ6A 4UELA 3L39A 3J9X1 3NBXX 3PUXF 3P7IA 1OEDB 3N2OA 1IBKT 3BQIA 4NIQA 2YKSA 3U78A 3VR8A 5AQJB 3RX6A 1M7KA 4NXNT 2IMLA 2L9QA 1G73A 4H63V 4B3RT 3PUZF 5ETWA 4DR2T 5C3JA 2XQYA 2VWAA 3HA4A 4QKNA 3ZC1A 4A98A 4WW0A 4YT0A 4JI4T 4DV5T 3ZSSA 1L0VA 2XQ7A 3C51A 2JIWA 3AE4A 2W67A 3IEEA 2MOZA 3G06A 5HXRA 5LGUB 2PTFA 1CHUA 3AXJA 3AVSA 2JMHA 2CRBA 2C5KT 4QXCB 1XMQT 3OBVE 2KWHA 4TX5A 2J62A 5L3CB 5LGNB 1YXRA 4KUMB 3ZMUB 2DWGA 3NRYA 3UUMA 2LEHA 3C4ZA 3MACA 5EK4A 4KHPT 5FNVE 1MNDA 2WM9A 4IE4A 5LBQB 2XQ8A 3QB5A 2E9XD 2XSAA 1E1HB 2X9HA 2XUEA 3CQCB 2M67A 3BQKA 2V7MA 4LMJA 4P0BA 3LDQB 5LHHB 4AISA 1J1JA 4XZCA 4KMCA 2WDRA 1EZ3A 3JC6D 3T1HT 2EHOD 3NRXA 2PBIA 4WBOA 5LYJE 4O8SA 4ZI3D 3IHRA 4DR6T 4EV6A 1OXZA 4ZS2A 3UUNA 3ZLIA 3PUGA 3TLVA 5IHYA 3AA1B 1KNPA 1WFDA 3M65A 1ZEEA 4YJ2E 2UUCT 2LHRA 3RYIE 2QRXA 4UVAB 3P4WA 1LKXA 2NTYA 2XPKA 4IDPA 4AQYT 2CHOA 2UUAT 1IZNB 4YXDA 3LBXB 3ESLA 3UU3A 2YU1A 3RIFA 3RGLA 3ZMVB 5L4EA 3ONLC 1MMDA 3CIRA 3KV6A 5CFBA 4PJMA 2XQ4A 5LNKA 4M1PA 4X20E 5AQVB 3C4XA 1T98A 3RI5A 2IUBA 2WS3A 2CM0A 3AE3A 3KVAA 4LMKA 1LVFA 2CLYB 2CXFA 4ADZA 1XWMA 3PU8A 3DP7A 3FZFB 3K3NA 4PFOA 2WZHA 2V7LA 4LF7T 3EABA 2UXXB 2XJ7A 3AA7B 3JAFA 1YQ4A 1T72A 4GIWA 4TWHA 2W0GA 4ZHQE 5LMUT 4PK6A 2E5VA 3VRBA 2UXNB 1BR2A 4AKRB 5FL1A 1ZKEA 1KNZA 3FXDB 3EHZA 3M3ZB 5FXWA 3EUHA 4U7YA 2R6GF 5ABFB 4DV3T 2WQYA 2H7OA 1T8BA 4PK5A 4KHZF 3CK6A 4H9OC 3KV9A 4OYJA 1UUSA 1ZHCA 3CQGB 2HN2A 1SUMB 4LFAT 2M6BA 4PJLA 3FB2A 3LK42 4H9QC 1D0XA 4WYVA 1WR0A 2VVNA 4DV6T 2MAWA 5CGMA 1W0BA 1N36T 4DR7T 1FIOA 2QA7A 1D1AA 2I6HA 2YK0A 2X68A 4IL4A 2WDVA 3FHNA 3IF8B 4YSXA 5JDNA 2KNDA 4YSYA 2C5IT 1WR6A 4DV2T 5HEJA 2BS2A 5ABGA 3SRZA 1OEDA 5IUXA 4X62T 4GK0E 4X65T 1GQEA 1W9RA 2RP4A 4P0AA 2DI4A 5FL0A 4JI6T 5L3BB 1NEKA 1HCIA 3OPCA 5F8PA 4UVBB 4OK0A 5JDGA 2VASA 1QLBA 3O4XE 3QC9A 4JEUB 3FXEB 3RRWA 3RKOA 4OHFA 4EAHA 1S35A 2ACZA 4HGAA 3L8RA 3C98B 2UUBT 3N2KE 3AAEB 4FJOA 4AI6A 4ISSA 2QVAA 2X0HA 2IIUA 2Y6XA 4E7ZA 5JDMA 2XAJB 2KXPB 2V5DA 4DBRA 3VRAA 2CE7A 3JADA 1QUUA 2UXBT 2BDEA 3GN5B 3N9PA 4ASKA 3PTRB 2PFVA 5EK2A 2V5CA 5LP6E 1N32T 3VHLA 1MIYA 3D0TA 4U3CA 2V6YB 2WBLA 2MTQA 2P9BA 3MK7C 2E2AA 4IT4A 1X79A 2IC6A 1MIWA 3TKLB 2VQET 5JREA 4MHCA 3FZHB 2C5JA 2BVLA 2QGSA 2HHHT 4YTNA 2DL1A 5JTGA 3P4RA 2LLYA 2WSSV 2JQHA 1I94T 4ERRA 5CA0E 1SA0E 2XAFB 4UV9B 5EK3A 3Q5EA 1VCTA 1IAPA 2E9XB 5AQSB 3O1JA 4UF0B 4GYRA 5HXSA 5LMNT 3AAAB 4MALA 2XM2A 2N2NA 5AQKB 4DR3T 3OJAA 2NOXA 3AE7A 4HFCA 3UQ4A 4Q25A 2V6XA 3ZJ2A 2BS4A 2W63A 4H63H 2XQ5A 3N9QA 2EHOB 4GOUA 3LBXA 2H89A 2WAUA 5J1GA 4U74A 3E08A 4UEMA 4CI3B 2F4VT 1DU2A 4DO0A 3AE2A 5FP3A 4NUVA 5FKYA 4JI7T 2YU2A 4NPPA 2YDQA 2VKJA 4X1KE 3PUWF 3NZQA 3ZT7A 2IC9A 2XQ3A 4DUZT 3NWIA 3BK9A 4O4HE 5H6RB 3P4QA 3ZEFB 3V5UA 3WAKA 2BKOA 5EZYE 4XBFB 3SFEA 3MKDA 3JCFA 3N9OA 2E8IA 4OFZA 1N33T 2YOEA 3T1YT 4CI2B 2VKDA 4IDQA 5FMNA 2NW9A 2DWKA 2CWYA 2HN1A 2CA5A 3CPZA
chains in the Genus database with same CATH topology
1XZYA 1W0AA 1Z8UA 3QNUA 3X1DA 4IDOA 1W09A 3Q5DA 3IA3A 4IDNA 3Q5EA 3OVUA 3QOFA 1Y01A 4IDPA 1W0BA 4IDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZY A;  1W0A A;  1Z8U A;  3QNU A;  3X1D A;  4IDO A;  1W09 A;  3Q5D A;  3IA3 A;  4IDN A;  3Q5E A;  3OVU A;  3QOF A;  1Y01 A;  4IDP A;  1W0B A;  4IDQ A; 
#chains in the Genus database with same CATH topology
 3KV4 A;  3E0Z A;  4EIW A;  5ABF A;  5ABH A;  2CXL A;  3A8Y C;  3PUA A;  2XAG B;  2C0S A;  1Y64 B;  1XZY A;  4CXW A;  4QWN B;  4DMV A;  3EDU A;  3ANW A;  2AE9 A;  2IHR 1;  4X66 T;  2AXD S;  2XSB A;  2XQA A;  2XTL A;  4O2B E;  1B7T A;  3Q5W A;  2UXD T;  2MYS A;  3HKE E;  4LF5 T;  4ZZB A;  2QYW A;  1YQ3 A;  5JR9 A;  3FZK B;  2WB5 A;  2X9Y A;  2DHR A;  3VU7 H;  4ILA A;  2MBG A;  3AED A;  1MMA A;  3SFD A;  2LJL A;  3ZMS B;  4ZZC A;  1IJ5 A;  2HPL A;  2HPJ A;  2JPF A;  4GYS A;  4QHO A;  4QH4 A;  4JI3 T;  5JR9 C;  2YDR A;  2FJE A;  3UUX B;  4DR1 T;  3ZMT B;  2XAH B;  2I59 A;  5AQG B;  4DID B;  5AQL B;  3HKC E;  3UTK A;  4JI1 T;  3IA3 A;  3I1A A;  2LRK A;  5FVK A;  3RIU A;  4B3T T;  2WCA A;  4HEA A;  5M4Y A;  3U3I A;  1X9B A;  3UUL A;  3X1D A;  2XHE B;  4CI1 B;  4WNK A;  1E2A A;  2X9W A;  3L09 A;  1FMV A;  5LB7 B;  2W4X A;  5JRC B;  3H37 A;  3B57 A;  2Q9Q A;  2K9A A;  4K0U A;  1Z8U A;  3PJA A;  2D0U A;  1D1B A;  5BR8 T;  4YLH A;  1YD8 G;  5JQG E;  5LHG B;  4HFH A;  3LG7 A;  1XDO A;  5E0O A;  2XZE A;  2CMR A;  4IE5 A;  2WMO A;  2YEV C;  3PU3 A;  3TLU A;  2VUR A;  2Q9Q C;  4P09 A;  3Q5D A;  5LJM A;  5HEO A;  4DBQ A;  4HWI B;  2NWB A;  3C64 A;  2RPA A;  1WRD A;  2LM9 A;  4ZEY A;  5L3D B;  4KP3 C;  2LOP A;  1HNW T;  5DQV A;  1HX8 A;  1KEY A;  1LRZ A;  3RIA A;  5LG4 A;  4IE0 A;  1QSD A;  5FXZ A;  5J2U E;  3KFW X;  2FJA A;  2KLQ A;  4HWH A;  3GA8 A;  2VB6 A;  4HFI A;  1Y01 A;  2BG9 A;  3PUY F;  4U2Z A;  4UXN B;  5JVD E;  3AA6 B;  4EYY R;  2NW8 A;  2WWU A;  3PUV F;  3AA0 B;  4P1N A;  1IBM T;  4YSZ A;  2D5U A;  5L3E B;  3P50 A;  2BS3 A;  1JNR A;  3V5S A;  2EHO A;  3KBU A;  4DND A;  2KMF A;  3N9N A;  3GWH A;  2BG9 C;  5KDM C;  1WYB A;  2H7V C;  3PUR A;  4A5X A;  4YJ3 E;  4ZXL A;  4LF9 T;  2KIN B;  4JUY A;  3ZCI A;  2ZM0 A;  1S94 A;  2VL0 A;  3EI0 A;  1SE7 A;  4ZI2 C;  3R6N A;  3AB3 B;  1JNZ A;  2CBJ A;  2Y48 B;  3QK6 A;  4F8H A;  3RYH E;  5F5W A;  2MPK A;  2JJ9 A;  2V26 A;  2H3R A;  2XM1 A;  3VR9 A;  1LVK A;  4CN4 A;  3BQL A;  5HCJ A;  2LSY A;  4QXB B;  4U33 A;  4BJN A;  3FZL B;  2UXC T;  3W15 B;  2V7I A;  1D0Z A;  4O4J E;  4CXX A;  3DJB A;  3EDV A;  3WAJ A;  4HN9 A;  3ETV A;  4Z8X A;  4YTP A;  3RF1 A;  4COF A;  5FVL A;  3QUJ A;  1OED C;  3ETU A;  2W00 A;  4WZX A;  5IYZ E;  4TV8 E;  2V1D B;  3HKD E;  2YN6 A;  4IE7 A;  4DR4 T;  3CX8 B;  2IDO B;  2JRK A;  4B6X A;  3LK2 B;  3E22 E;  2SPC A;  4H9P C;  3AEE A;  2WZI A;  4YFS A;  2FBW A;  1VRB A;  5LJN A;  3AEB A;  2A72 A;  5FY7 A;  4EZH A;  3Q2M A;  3UFE A;  2G0U A;  4TUY E;  4AQF A;  4O2A E;  2V7K A;  2BZB A;  4HTE A;  3UFG A;  1XDP A;  1ZP0 A;  4CZZ B;  4IIJ E;  4X64 T;  3OYX A;  5LA6 E;  4EGW A;  3RHW A;  1OED E;  3CX6 B;  2BBH A;  3MA9 A;  5DQW A;  4AQF C;  2X0Y A;  2PG8 A;  2WDQ A;  4HWC A;  1CUN A;  1WCR A;  4KX6 A;  2KZ7 B;  5AQN B;  5HEH A;  5JDF A;  4JV5 T;  5KX5 E;  3RYF E;  4PJN A;  2LSG A;  4AKL A;  1I6Z A;  3OYZ A;  3AE1 A;  5AQO B;  4AQG A;  1BR1 A;  2XY8 B;  3LJC A;  3AEF A;  1YKH B;  1UCU A;  3ONJ A;  4LF4 T;  4PJJ A;  3LFM A;  3PV0 F;  4HFD A;  1N34 T;  1T7S A;  3SS1 A;  2XQ9 A;  2LHN A;  2ODV A;  3ZN1 B;  2A3D A;  3AAI A;  2Z6E A;  4J2C A;  2K3W A;  1FMW A;  1HF8 A;  3RYC E;  3ZJ1 A;  3ZST A;  1XNQ T;  2CEA A;  2WY2 A;  4B3S T;  2Y8D A;  3ZT5 A;  2W61 A;  1BR0 A;  4IDN A;  4O4I E;  5HEU A;  2VL8 A;  2XAQ B;  1US7 B;  4OX9 T;  2HH7 A;  4NXM T;  4HFE A;  3MXZ A;  3KV5 A;  4X5T A;  1HX1 B;  4PFP A;  5AQH B;  4DVD A;  3SOL A;  3RLF F;  1WLX A;  3QNU A;  2A9U A;  3AE9 A;  3ZMZ B;  2CHN A;  4H9R C;  4HFV A;  5LOV E;  5IWA T;  1U5P A;  4PAG A;  4ZI7 E;  4AKH A;  1J5E T;  1UK5 A;  1YKE B;  5CB4 E;  4A97 A;  4F6R C;  3ZCJ A;  3I9W A;  3HL6 A;  5DJQ C;  3PUS A;  2JQK A;  3ZT6 A;  3SWH A;  3AEA A;  4HKA A;  5FXX A;  3HKB E;  1KNR A;  3I0O A;  3ZC0 A;  2J1D G;  2D0T A;  3ZN0 B;  2A2F X;  4DV4 T;  1FJG T;  2CLY C;  2IAK A;  5HXC A;  2B76 A;  5JDH A;  2K48 A;  3VKH A;  2FJD A;  4IGU A;  3LSV A;  1NWM X;  2KT9 A;  4BA9 A;  4JLE A;  1G8X A;  3K3Q C;  4GK5 E;  4AKG A;  4BAY B;  3PUQ A;  1AJ3 A;  3UU6 A;  4TZ4 C;  5HXE A;  4MLK A;  5F3J A;  4DV0 T;  2VVS A;  5BMV E;  2X9X A;  4C91 A;  1J5W A;  2LSI A;  3N9L A;  2JQQ A;  2Q9Q D;  3A7M A;  2JQ9 A;  2CXD A;  4IHJ E;  1HG5 A;  2DNX A;  5H6Q B;  5AQF B;  3O9X A;  3IBP A;  4CN6 A;  2VK9 A;  5LGT B;  4LFB T;  1HTJ F;  3UU8 A;  1ZOY A;  3OKQ A;  1UX4 A;  4ZOL E;  4AIU A;  4UIG A;  2LKH A;  4DV7 T;  2V8S V;  1SHZ C;  4TWD A;  4U31 A;  3P8C D;  5FXV A;  1FEW A;  3GMI A;  2X66 A;  4I43 B;  3TLS A;  2YDS A;  2RA1 A;  4PNI A;  5AQT B;  2D9D A;  3ZKR A;  3AE5 A;  2GK9 A;  3S4U A;  4WBN E;  3RC8 A;  4HE8 A;  4UR9 A;  3N9M A;  4ANJ A;  2JMK A;  3DTO A;  2LM2 A;  2WU2 A;  4YTM A;  4G2A A;  4EED A;  5FY1 A;  2WP9 A;  2W2U A;  3I0Q A;  4OYK A;  5L3F B;  4I0U A;  1MMN A;  2LKG A;  3F2E A;  3CWZ B;  2BKN A;  5A1L A;  3TLW A;  5KMG P;  3QB5 K;  4NUU A;  2KWI B;  3Q5X A;  5FYM A;  4E7S A;  4TWF A;  3RIU C;  1XMO T;  3GN5 A;  4ZI2 D;  5KXJ A;  2ZM2 A;  3ZYM A;  3ONX A;  1MMG A;  3O1I A;  1MNE A;  3H3M A;  2ES0 A;  1XNR T;  4QX8 B;  5L2L A;  4AKI A;  1H7C A;  1W0A A;  2V6Y A;  1D1C A;  4LFC T;  2X67 A;  3RKG A;  2LRL A;  4N78 D;  4GKK T;  3MZK B;  2ZM6 T;  1HG2 A;  4DR5 T;  3KIN B;  2H88 A;  1V9D A;  5ABE A;  2N1G A;  2VKH A;  5CJ5 A;  1IBL T;  4L0R A;  4BJM A;  3PE0 A;  2LOS A;  4HWF A;  5AFU L;  1Z0P A;  3B5M A;  4LF8 T;  1U4Q A;  4MFR A;  3O1H A;  4AXP A;  3L3P A;  4U7I A;  3R84 B;  4O4L E;  2B1E A;  3RH3 A;  1D0Y A;  2LE8 A;  2E9X A;  5CA1 E;  3UT5 E;  3UU4 A;  2NTX A;  3CX7 B;  3OTO T;  4UF0 A;  2CWO A;  4JEH B;  2L3L A;  4QXH B;  3PDY A;  3ZYK A;  1KF6 A;  2KSR A;  3CVR A;  4DUY T;  4LF6 T;  3RQW A;  1UUR A;  4B3M T;  5LHI B;  2E9X C;  2CPT A;  4UVC B;  5JH7 E;  4ILU A;  1KK7 A;  4U72 A;  2CCQ A;  3NKZ A;  2M6I A;  4JBW F;  3JC6 C;  2ODU A;  5JDL A;  1VCS A;  3ABV A;  2UU9 T;  1R8I A;  2EHO C;  2W66 A;  1E7P A;  1VOM A;  2CBI A;  3A5X A;  4ZI3 C;  2X51 A;  4V1A v;  2LSK A;  3B13 A;  4C90 A;  3C50 A;  4CQI A;  3ANW B;  5HEG A;  4Z90 A;  1HNZ T;  1UGO A;  3RRC A;  1HS7 A;  4IDO A;  1W09 A;  4FI5 A;  3UUB A;  4ILC A;  5HYA A;  3AVR A;  2WMN A;  3KDS E;  5JR9 B;  2ACX A;  5AQQ B;  2BG9 E;  4IL9 A;  5GON E;  3AXJ B;  2BKP A;  3UQ7 A;  3T8O A;  1UX5 A;  4GKJ T;  2FUP A;  2FJB A;  3JAE A;  4JI2 T;  2XAS B;  4HWD A;  5AQM B;  4I55 E;  5C8Y E;  2J4G A;  4L5G A;  2IW5 B;  1ZV4 X;  3HR0 A;  4KI0 F;  4QX7 B;  3HI2 A;  3I9Y A;  3RQU A;  5L3G B;  3K8P C;  2YIN A;  4QH5 A;  3K3O A;  2LSJ A;  4U2Y A;  1HFA A;  2LT3 A;  2OLT A;  4TNW A;  4JI0 T;  3FBZ A;  1KFY A;  3H3A A;  3TLT A;  2NR4 A;  3QOF A;  5HXH A;  4X1I E;  5JDQ A;  2V7J A;  4JYA T;  2PJQ A;  3K1S A;  4ILB A;  4JI5 T;  4DMW A;  4IST A;  4I50 E;  5HWY A;  4YY3 T;  5LG3 A;  5J0Z A;  3EVY A;  3Q9D A;  2I0M A;  1YW0 A;  2L8K A;  1BR4 A;  5FY0 A;  3LK3 B;  5LCY A;  4ZS3 A;  4DV1 T;  3PJA J;  3CKD A;  2NW7 A;  3OVU A;  2N9D A;  4PW8 A;  4IRE A;  5HAX A;  2XQ6 A;  2ZMA A;  3FZM B;  2Q9Q B;  4Z91 A;  2D2S A;  3NZP A;  3F57 A;  4HFB A;  3C4W A;  3P4P A;  4EYU A;  2J47 A;  4KBM B;  4I4T E;  2ZLY A;  3UU5 A;  4H9N C;  4CXY A;  5AQP B;  5TAO A;  3AE6 A;  4MBQ A;  3NVO A;  2VKO A;  3N2G E;  2X0L B;  3ZYL A;  2WU5 A;  4TNV A;  5HCM A;  2K24 A;  3CML A;  2DCF A;  4K0K T;  4TN7 B;  3RPU A;  4EXT A;  4TV9 E;  3P4S A;  3KVB A;  2E5L T;  1O3X A;  1NAF A;  2OA5 A;  3ZPO A;  5J2T E;  5JRC A;  1M62 A;  1NEN A;  4IE6 A;  3WI3 A;  1OWA A;  5AQU B;  4EZ4 A;  3F31 A;  3EAM A;  5AQI B;  4G63 A;  5C2T A;  4JI8 T;  3J7Y q;  3MJX A;  5LXT E;  2NP9 A;  1WYC A;  1HNX T;  5L4H A;  2BG9 B;  4L9I A;  5LBM A;  2WWV A;  4EEB A;  1HR0 T;  2BBJ A;  5L47 A;  4CN1 A;  3AEC A;  5AQR B;  3CQX C;  3FBL A;  2BVM A;  3KBT A;  2OV9 A;  4X1Y E;  2W62 A;  4XAX B;  5DAB A;  4EOZ B;  1MIV A;  3RC3 A;  4YHJ A;  3AEG A;  4PK4 A;  5ADX L;  5HWX A;  3VKG A;  2VQF T;  4IDZ A;  2DLR A;  2K5B B;  3AE8 A;  4H9S E;  4YHH T;  4QH1 A;  4A56 A;  4UV8 B;  4LML A;  4EB6 E;  2ZM8 A;  3N5L A;  1IJ6 A;  4UEL A;  3L39 A;  3J9X 1;  3NBX X;  3PUX F;  3P7I A;  1OED B;  3N2O A;  1IBK T;  3BQI A;  4NIQ A;  2YKS A;  3U78 A;  3VR8 A;  5AQJ B;  3RX6 A;  1M7K A;  4NXN T;  2IML A;  2L9Q A;  1G73 A;  4H63 V;  4B3R T;  3PUZ F;  5ETW A;  4DR2 T;  5C3J A;  2XQY A;  2VWA A;  3HA4 A;  4QKN A;  3ZC1 A;  4A98 A;  4WW0 A;  4YT0 A;  4JI4 T;  4DV5 T;  3ZSS A;  1L0V A;  2XQ7 A;  3C51 A;  2JIW A;  3AE4 A;  2W67 A;  3IEE A;  2MOZ A;  3G06 A;  5HXR A;  5LGU B;  2PTF A;  1CHU A;  3AXJ A;  3AVS A;  2JMH A;  2CRB A;  2C5K T;  4QXC B;  1XMQ T;  3OBV E;  2KWH A;  4TX5 A;  2J62 A;  5L3C B;  5LGN B;  1YXR A;  4KUM B;  3ZMU B;  2DWG A;  3NRY A;  3UUM A;  2LEH A;  3C4Z A;  3MAC A;  5EK4 A;  4KHP T;  5FNV E;  1MND A;  2WM9 A;  4IE4 A;  5LBQ B;  2XQ8 A;  3QB5 A;  2E9X D;  2XSA A;  1E1H B;  2X9H A;  2XUE A;  3CQC B;  2M67 A;  3BQK A;  2V7M A;  4LMJ A;  4P0B A;  3LDQ B;  5LHH B;  4AIS A;  1J1J A;  4XZC A;  4KMC A;  2WDR A;  1EZ3 A;  3JC6 D;  3T1H T;  2EHO D;  3NRX A;  2PBI A;  4WBO A;  5LYJ E;  4O8S A;  4ZI3 D;  3IHR A;  4DR6 T;  4EV6 A;  1OXZ A;  4ZS2 A;  3UUN A;  3ZLI A;  3PUG A;  3TLV A;  5IHY A;  3AA1 B;  1KNP A;  1WFD A;  3M65 A;  1ZEE A;  4YJ2 E;  2UUC T;  2LHR A;  3RYI E;  2QRX A;  4UVA B;  3P4W A;  1LKX A;  2NTY A;  2XPK A;  4IDP A;  4AQY T;  2CHO A;  2UUA T;  1IZN B;  4YXD A;  3LBX B;  3ESL A;  3UU3 A;  2YU1 A;  3RIF A;  3RGL A;  3ZMV B;  5L4E A;  3ONL C;  1MMD A;  3CIR A;  3KV6 A;  5CFB A;  4PJM A;  2XQ4 A;  5LNK A;  4M1P A;  4X20 E;  5AQV B;  3C4X A;  1T98 A;  3RI5 A;  2IUB A;  2WS3 A;  2CM0 A;  3AE3 A;  3KVA A;  4LMK A;  1LVF A;  2CLY B;  2CXF A;  4ADZ A;  1XWM A;  3PU8 A;  3DP7 A;  3FZF B;  3K3N A;  4PFO A;  2WZH A;  2V7L A;  4LF7 T;  3EAB A;  2UXX B;  2XJ7 A;  3AA7 B;  3JAF A;  1YQ4 A;  1T72 A;  4GIW A;  4TWH A;  2W0G A;  4ZHQ E;  5LMU T;  4PK6 A;  2E5V A;  3VRB A;  2UXN B;  1BR2 A;  4AKR B;  5FL1 A;  1ZKE A;  1KNZ A;  3FXD B;  3EHZ A;  3M3Z B;  5FXW A;  3EUH A;  4U7Y A;  2R6G F;  5ABF B;  4DV3 T;  2WQY A;  2H7O A;  1T8B A;  4PK5 A;  4KHZ F;  3CK6 A;  4H9O C;  3KV9 A;  4OYJ A;  1UUS A;  1ZHC A;  3CQG B;  2HN2 A;  1SUM B;  4LFA T;  2M6B A;  4PJL A;  3FB2 A;  3LK4 2;  4H9Q C;  1D0X A;  4WYV A;  1WR0 A;  2VVN A;  4DV6 T;  2MAW A;  5CGM A;  1W0B A;  1N36 T;  4DR7 T;  1FIO A;  2QA7 A;  1D1A A;  2I6H A;  2YK0 A;  2X68 A;  4IL4 A;  2WDV A;  3FHN A;  3IF8 B;  4YSX A;  5JDN A;  2KND A;  4YSY A;  2C5I T;  1WR6 A;  4DV2 T;  5HEJ A;  2BS2 A;  5ABG A;  3SRZ A;  1OED A;  5IUX A;  4X62 T;  4GK0 E;  4X65 T;  1GQE A;  1W9R A;  2RP4 A;  4P0A A;  2DI4 A;  5FL0 A;  4JI6 T;  5L3B B;  1NEK A;  1HCI A;  3OPC A;  5F8P A;  4UVB B;  4OK0 A;  5JDG A;  2VAS A;  1QLB A;  3O4X E;  3QC9 A;  4JEU B;  3FXE B;  3RRW A;  3RKO A;  4OHF A;  4EAH A;  1S35 A;  2ACZ A;  4HGA A;  3L8R A;  3C98 B;  2UUB T;  3N2K E;  3AAE B;  4FJO A;  4AI6 A;  4ISS A;  2QVA A;  2X0H A;  2IIU A;  2Y6X A;  4E7Z A;  5JDM A;  2XAJ B;  2KXP B;  2V5D A;  4DBR A;  3VRA A;  2CE7 A;  3JAD A;  1QUU A;  2UXB T;  2BDE A;  3GN5 B;  3N9P A;  4ASK A;  3PTR B;  2PFV A;  5EK2 A;  2V5C A;  5LP6 E;  1N32 T;  3VHL A;  1MIY A;  3D0T A;  4U3C A;  2V6Y B;  2WBL A;  2MTQ A;  2P9B A;  3MK7 C;  2E2A A;  4IT4 A;  1X79 A;  2IC6 A;  1MIW A;  3TKL B;  2VQE T;  5JRE A;  4MHC A;  3FZH B;  2C5J A;  2BVL A;  2QGS A;  2HHH T;  4YTN A;  2DL1 A;  5JTG A;  3P4R A;  2LLY A;  2WSS V;  2JQH A;  1I94 T;  4ERR A;  5CA0 E;  1SA0 E;  2XAF B;  4UV9 B;  5EK3 A;  3Q5E A;  1VCT A;  1IAP A;  2E9X B;  5AQS B;  3O1J A;  4UF0 B;  4GYR A;  5HXS A;  5LMN T;  3AAA B;  4MAL A;  2XM2 A;  2N2N A;  5AQK B;  4DR3 T;  3OJA A;  2NOX A;  3AE7 A;  4HFC A;  3UQ4 A;  4Q25 A;  2V6X A;  3ZJ2 A;  2BS4 A;  2W63 A;  4H63 H;  2XQ5 A;  3N9Q A;  2EHO B;  4GOU A;  3LBX A;  2H89 A;  2WAU A;  5J1G A;  4U74 A;  3E08 A;  4UEM A;  4CI3 B;  2F4V T;  1DU2 A;  4DO0 A;  3AE2 A;  5FP3 A;  4NUV A;  5FKY A;  4JI7 T;  2YU2 A;  4NPP A;  2YDQ A;  2VKJ A;  4X1K E;  3PUW F;  3NZQ A;  3ZT7 A;  2IC9 A;  2XQ3 A;  4DUZ T;  3NWI A;  3BK9 A;  4O4H E;  5H6R B;  3P4Q A;  3ZEF B;  3V5U A;  3WAK A;  2BKO A;  5EZY E;  4XBF B;  3SFE A;  3MKD A;  3JCF A;  3N9O A;  2E8I A;  4OFZ A;  1N33 T;  2YOE A;  3T1Y T;  4CI2 B;  2VKD A;  4IDQ A;  5FMN A;  2NW9 A;  2DWK A;  2CWY A;  2HN1 A;  2CA5 A;  3CPZ A; 
#chains in the Genus database with same CATH homology
 1XZY A;  1W0A A;  1Z8U A;  3QNU A;  3X1D A;  4IDO A;  1W09 A;  3Q5D A;  3IA3 A;  4IDN A;  3Q5E A;  3OVU A;  3QOF A;  1Y01 A;  4IDP A;  1W0B A;  4IDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...