2JQ9A

Vps4a mit-chmp1a complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
71
structure length
71
Chain Sequence
TLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associating protein 4A
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 71
sequence length 71
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jq9A00
2MPKA 3EABA 4ZEYA 4CN1A 2V6XA 2V6YA 1WFDA 2XZEA 5CJ5A 4P1NA 4WZXA 4A5XA 2V6YB 2DL1A 2JQ9A 4U3CA 2CRBA 1WCRA 3K1SA 4U7YA 4U2YA 2WY2A 2JQHA 2A9UA 4U7IA 3ZSSA 4CN6A 3ZT7A 2CPTA 4NIQA 5LB7B 3ZT6A 5FVKA 4U33A 2LRKA 3ZT5A 3ZSTA 5FVLA 1WR0A 2RPAA 2K3WA 1YXRA 2LRLA 2WWVA 5CGMA 2W2UA 4CN4A 2JQKA 4U31A 4U2ZA 4IT4A
chains in the Genus database with same CATH superfamily
3RIAA 5F8PA 4CXWA 2ZM2A 1HTJF 4UVBB 4QXHB 2PFVA 3N9NA 2IC9A 5CA0E 3ZKRA 1WR0A 1CHUA 1ZKEA 4B6XA 3TLVA 4JI4T 2XAQB 2AE9A 1KEYA 1ZOYA 2JMHA 3UULA 4COFA 1ZEEA 3IHRA 3UFEA 3P8CD 3ZCJA 2HPLA 4YXDA 4ZZCA 4ILUA 1XMQT 1G8XA 5TAOA 4PJLA 5AQFB 2Y48B 4NUVA 3SS1A 4CXXA 3LDQB 4JI1T 1Z0PA 2BBJA 4JBWF 2YK0A 5JDGA 4U33A 5AQQB 1BR1A 2GK9A 3ONJA 4HWIB 2Q9QA 1UX4A 3I1AA 3OPCA 2WSSV 3P4QA 1HG2A 2LOPA 4QX7B 3KFWX 4UVCB 4YHJA 5FP3A 4QWNB 2YU1A 2IIUA 1YW0A 5FVLA 4NXNT 3OTOT 2CWOA 4GK5E 1M7KA 3N9LA 2X66A 4ZHQE 5JQGE 3RI5A 2V5CA 1KF6A 3PUSA 2V6YB 3UU8A 5L4EA 4BAYB 5LBQB 4L5GA 5J1GA 1ZP0A 4TV8E 2UXCT 3EUHA 5JR9A 5DQWA 4ILCA 4IDOA 2W67A 3OYZA 3O1IA 2HH7A 2DLRA 2BG9B 2XQYA 3I0OA 3NKZA 4DMWA 1XDPA 3S4UA 2N1GA 2VL8A 2R6GF 4EEBA 3JCFA 2I0MA 5LJNA 1IJ5A 1BR2A 4CI1B 1D1CA 3AE7A 3CX7B 2VURA 1J5ET 4UV8B 5AQGB 2IC6A 2W62A 2XSBA 2I59A 2W61A 3Q5EA 4A5XA 4WYVA 2Q9QD 5LA6E 3K8PC 3PUWF 1QLBA 3SFDA 4AKHA 3NZPA 2OA5A 1W9RA 2KXPB 4IREA 2XQ9A 2JRKA 2A2FX 4DR3T 4CI3B 4PK4A 4O4HE 3J9X1 2XAJB 2JIWA 4IDNA 2YEVC 4BJMA 2E5LT 4G2AA 2CBJA 3NWIA 4P0AA 2CXFA 3K3QC 4HWFA 4CXYA 3JAEA 1SHZC 4QXBB 1OWAA 3DP7A 2ES0A 5FXZA 1HNXT 2FJDA 2XHEB 4ERRA 5JDHA 4PJMA 4B3ST 5EK2A 4H63H 5L3CB 5C3JA 3KV5A 4YJ3E 3QNUA 1FIOA 4B3TT 2WU5A 2NW7A 1WYBA 2WM9A 3I9YA 3EDVA 5LGNB 2M6IA 1LVKA 4O4LE 3E0ZA 4EAHA 1MIYA 2UUCT 3UUBA 4YT0A 4I55E 3ETUA 4HFVA 2OLTA 5LXTE 4H9PC 4AKLA 2CBIA 3L8RA 4UVAB 3X1DA 5AQHB 2BS2A 2H7VC 5JRCA 1IBLT 2J47A 3L39A 2LOSA 2XQ5A 5KMGP 3ZMVB 2WWUA 3NVOA 4XAXB 4L9IA 2IMLA 2YU2A 2XM2A 3EHZA 2KZ7B 5HEOA 3EVYA 2LRKA 4HGAA 3OJAA 5HXHA 1NWMX 3VHLA 3UTKA 3T1YT 5AQRB 4C91A 2BG9A 3AECA 1U5PA 2K24A 2WZHA 3AXJA 1HF8A 3KINB 2ZM6T 3MJXA 4H9OC 5L3EB 4G63A 2E9XB 2E2AA 4U31A 2IUBA 1OEDC 4CN1A 3UQ7A 3IEEA 2YOEA 4IE7A 4O4JE 2NTXA 4O2AE 4X1KE 3ZC1A 3KV6A 3UU4A 2JMKA 4M1PA 1JNZA 4HWDA 2MBGA 3RGLA 4LFAT 2WQYA 1W09A 4AXPA 5M4YA 2Q9QC 2B76A 3MZKB 2M6BA 2PJQA 3PUZF 5EK3A 3MK7C 2LE8A 4I4TE 4YHHT 3PUGA 4F8HA 4X20E 1FJGT 3LK3B 5FXWA 4P1NA 3NRYA 1FMWA 2W4XA 3ZMUB 3RIFA 1O3XA 2X9YA 2CHNA 2V7MA 5BR8T 2X0YA 3ZJ2A 3F57A 4AKRB 2RPAA 5HEUA 5FXVA 5CA1E 3AVSA 4DR6T 1HCIA 4IGUA 3M3ZB 2LKHA 2MYSA 3RLFF 2QA7A 4DV0T 4LF4T 2X0LB 1E7PA 2WDRA 3RPUA 4IE5A 3P50A 3C50A 3TLTA 4BA9A 3LSVA 1SA0E 1MMNA 4ZXLA 2LEHA 4DR4T 5JDQA 3ZN1B 2LRLA 5JR9C 2BBHA 1X79A 3FXEB 3Q5DA 5BMVE 4KP3C 2EHOB 3Q5XA 4TX5A 3MA9A 4JI3T 4FJOA 4TWHA 3ZMZB 1IAPA 3AE5A 5JDMA 3AEBA 2WAUA 1KNRA 3J7Yq 5FKYA 1N33T 2BZBA 3NZQA 2XJ7A 5DJQC 1V9DA 2CCQA 2QVAA 3CQGB 3C4ZA 5C2TA 4KMCA 5L4HA 2D2SA 2MPKA 3AEFA 4O8SA 3BQKA 3HKCE 1OEDE 3PDYA 3SWHA 3W15B 2E9XA 1N32T 2X9XA 5LHIB 3AAEB 2E5VA 1HR0T 5IHYA 4DBRA 1N36T 1UGOA 5HXRA 2W00A 2XUEA 5LP6E 2KINB 4HFCA 4TWDA 4Z8XA 3IA3A 1HNZT 1QSDA 3T1HT 5HYAA 2DI4A 4ASKA 1XNQT 2NW8A 2XAGB 2BKOA 4ILAA 3AA1B 3MKDA 2XM1A 2MOZA 5HEHA 2K5BB 2H89A 3U78A 5L47A 5HXCA 3GWHA 3QB5A 5LGTB 4GIWA 4X65T 2BKPA 3BQLA 5FY1A 2X51A 1OEDA 4J2CA 3F31A 2KMFA 1LVFA 3IF8B 2PG8A 1YXRA 3OYXA 3O9XA 1S35A 4LFBT 2LHRA 3K3NA 5LHGB 2XQAA 4ZI7E 3EABA 3FZLB 3UU5A 4JV5T 2KNDA 2C5JA 3ONLC 4BJNA 4LF7T 3FBZA 3C64A 3PUYF 2WDQA 2BS4A 1IZNB 5C8YE 2FJAA 3NRXA 2WWVA 2EHOA 3VKGA 1WR6A 3O1HA 2BG9C 4OHFA 4X62T 2VVSA 2LHNA 4KHZF 5LG3A 1MMDA 3V5SA 2JQQA 2E9XD 4DV6T 5FL0A 2X67A 4UELA 4H9QC 1XMOT 3PJAA 4AISA 3O1JA 3PV0F 4GYSA 3KVBA 1WRDA 3GN5B 4WBOA 2RP4A 4O2BE 2WU2A 4AIUA 1G73A 4OFZA 2L3LA 4HKAA 4QKNA 2CM0A 3CPZA 4IDPA 1D1AA 4WW0A 3LK42 4KBMB 2ZM0A 2DHRA 3HKDE 1S94A 4JI6T 2VKJA 5ETWA 3VU7H 4AQYT 3C4WA 2KWHA 3A5XA 4MALA 2ODUA 5HWYA 4DVDA 4YSXA 4PFOA 3WAJA 1IJ6A 2ODVA 3E08A 4PFPA 4DV4T 4V1Av 2LSIA 2WCAA 2UXBT 3AAAB 5AFUL 3JC6C 4UV9B 4YSZA 4CN4A 1VCTA 2WP9A 4PJNA 4PNIA 4DUYT 3UU6A 4MHCA 2CEAA 4XBFB 2EHOD 2CA5A 3RYCE 2LSKA 2NTYA 2CPTA 3M65A 4A97A 4WBNE 3OBVE 3KVAA 2AXDS 2HPJA 1E2AA 3MXZA 4ILBA 1D1BA 3VRBA 2WS3A 3QOFA 3C98B 3ZYKA 2CMRA 3ZT7A 3QK6A 4HEAA 3ZT6A 1SUMB 3TLSA 2K48A 4OYKA 1ZHCA 3FZMB 5LYJE 2VQET 5L3DB 3TKLB 4HTEA 3UU3A 4DV3T 4YLHA 5LNKA 1I6ZA 2BG9E 4U7IA 4AQFA 2K9AA 2VASA 1KFYA 3I9WA 4I43B 2Z6EA 5ABHA 1AJ3A 1J1JA 4LF8T 5AQLB 3AE8A 2CHOA 2LSJA 2E9XC 1ZV4X 3LBXB 5HWXA 3DTOA 4ADZA 3ZN0B 5KX5E 4U72A 2F4VT 3A7MA 1MMGA 2WMNA 2UXNB 2V6YA 2LSGA 2C0SA 3RQUA 2JJ9A 3AA0B 2DWGA 3AEDA 4WNKA 5LHHB 3H3AA 5H6RB 2XSAA 3UT5E 5ADXL 2C5IT 3CMLA 1HX8A 2YDRA 1CUNA 3RYFE 3AE2A 3WI3A 4K0KT 4O4IE 2VKOA 4YSYA 5LOVE 3QUJA 2W0GA 5JDFA 2FJEA 4UF0B 5E0OA 2LM2A 5KDMC 4ZS2A 5J2TE 3LK2B 3HR0A 1HFAA 4FI5A 2XQ3A 4QH4A 2N2NA 4L0RA 1VRBA 2OV9A 3AB3B 3PJAJ 1Y01A 4X1YE 1KK7A 4EYYR 5JDNA 1SE7A 4GKKT 3JAFA 1U4QA 4EZ4A 2W2UA 4HFIA 4ZS3A 5FY0A 4YTNA 4DO0A 4XZCA 1YQ4A 3RIUC 1E1HB 4OX9T 5HXSA 5FMNA 3L09A 3VR8A 5L2LA 2EHOC 4HE8A 2A72A 3AAIA 5FL1A 3RX6A 2HN1A 5FXXA 3PUQA 3UQ4A 4EYUA 5AQIB 2IW5B 5IWAT 5F5WA 2Y8DA 4Z90A 2L9QA 3P7IA 2HN2A 3AEEA 3ZYLA 2A9UA 4HN9A 2W66A 4E7ZA 3B13A 3UUMA 4HFEA 4QH5A 3RKGA 3QC9A 3CX8B 4PAGA 4EIWA 2DL1A 3P4PA 4NUUA 1N34T 4LFCT 2UXXB 1FEWA 4P0BA 4DV7T 3HA4A 2V7JA 3D0TA 1NEKA 3LBXA 1FMVA 3E22E 4LMKA 2V5DA 5LMUT 2CRBA 4OYJA 5JREA 2IAKA 3AE1A 3PU8A 2G0UA 3TLUA 5CB4E 2VKDA 5LJMA 5JVDE 4IDQA 4NPPA 2FUPA 4GYRA 3SOLA 2BVLA 4DV1T 4DR1T 2XQ7A 4IL4A 1MIWA 3R84B 2H88A 2NP9A 1UUSA 2ZM8A 3WAKA 2CLYB 4PW8A 2RA1A 4H9SE 4X66T 4GK0E 3HKEE 4X64T 2NOXA 3B57A 5LB7B 1IBMT 2MAWA 3F2EA 4JYAT 3CQXC 3ZEFB 2XASB 5FNVE 3HI2A 4B3RT 3IBPA 1WFDA 5LG4A 4QH1A 4U74A 3H37A 2SPCA 2JQHA 2KWIB 4CN6A 5EZYE 3H3MA 2J4GA 1BR4A 3EAMA 5EK4A 2LSYA 5DABA 3JC6D 3O4XE 2VQFT 5FYMA 4ISTA 1J5WA 4AKIA 1UCUA 2NW9A 4AQFC 4DR5T 3FZKB 4HFBA 5HAXA 4PK5A 2M67A 4ZI2D 2VL0A 3ZLIA 3ZC0A 5AQNB 4TZ4C 1WCRA 4A98A 4U7YA 3VR9A 2D0UA 3C4XA 2FJBA 4F6RC 2X68A 4ZI3D 2DCFA 2K3WA 5HEJA 2WMOA 3FBLA 3AA6B 3AEGA 3SRZA 5L3BB 1XWMA 2KLQA 3FZFB 2WDVA 3NBXX 4HWHA 3RRWA 3KBTA 3RIUA 4PJJA 3B5MA 1MNDA 4C90A 1OXZA 4YTPA 4UIGA 3OKQA 2A3DA 1XDOA 5AQUB 4Z91A 1T8BA 2V6XA 4AI6A 4B3MT 2YDQA 2J1DG 4DR7T 2XQ4A 5KXJA 5FVKA 4AKGA 2C5KT 3CWZB 3ETVA 2X9HA 3BQIA 4JI8T 3ZJ1A 4KI0F 3AA7B 3GA8A 3AVRA 1R8IA 1T98A 4UEMA 3HL6A 5IUXA 2LKGA 3Q5WA 3LG7A 3ZCIA 3P4SA 5J2UE 4QX8B 2CE7A 4IDZA 2HHHT 3ZT5A 1D0YA 2X9WA 3N9MA 2MTQA 1B7TA 4KHPT 3RC8A 1MNEA 3C51A 4IHJE 2BKNA 2D0TA 3CQCB 5LCYA 5JRCB 2D9DA 2VK9A 4GOUA 5AQTB 2ZMAA 5CJ5A 3FHNA 1JNRA 4JI2T 1D0XA 4KX6A 1XNRT 3TLWA 3CVRA 3N2KE 3RF1A 5IYZE 2J62A 3LFMA 3I0QA 3DJBA 3LJCA 4EB6E 2CXLA 2V8SV 4CQIA 2XAHB 2Y6XA 5AQJB 4Q25A 3RQWA 3BK9A 4EGWA 3UUXB 4TN7B 2KT9A 3FXDB 2L8KA 5JDLA 4GKJT 3ZSSA 4JI5T 3N9OA 2QYWA 3AXJB 2UUAT 2V7KA 1M62A 2P9BA 3P4RA 3PU3A 4LMLA 2YN6A 2WBLA 2LT3A 2LJLA 4NIQA 4KUMB 4EOZB 1UK5A 1D0ZA 1YKEB 4ZI2C 2VVNA 3N5LA 3FB2A 1T72A 2CXDA 5AQKB 2VWAA 5ABFB 2NR4A 5FY7A 1Y64B 4LF9T 2XZEA 3AEAA 4H9RC 4IE0A 3RKOA 4LF6T 1W0BA 4MBQA 5H6QB 1NAFA 3A8YC 4HFHA 2ACXA 4JUYA 3L3PA 2X0HA 4TUYE 4ZI3C 3KBUA 4DR2T 1EZ3A 3EDUA 1QUUA 2JQKA 1X9BA 1UX5A 2YDSA 1LRZA 3G06A 3UUNA 4U2YA 4EEDA 3PUVF 4OK0A 4JI0T 3K3OA 2V26A 3N2OA 1BR0A 3AE4A 3RRCA 4JEHB 3PURA 2WB5A 2XY8B 4U2ZA 3KV4A 4ZEYA 4I50E 1Z8UA 3Q9DA 2XQ6A 3JADA 2ACZA 3CKDA 4DBQA 5HCMA 3GN5A 3ONXA 2PBIA 3KDSE 2IHR1 3Q2MA 5ABEA 4TNWA 3RH3A 4IE4A 4PK6A 3KV9A 4WZXA 4YFSA 1YKHB 1DU2A 3RHWA 5JTGA 3CK6A 4UXNB 4H63V 3ANWB 2LM9A 1L0VA 2UXDT 2N9DA 2V7LA 2V1DB 5F3JA 2JQ9A 4ANJA 4I0UA 1H7CA 3MACA 4K0UA 3SFEA 3OVUA 2KSRA 5LBMA 3PE0A 2FBWA 1VCSA 5LMNT 2YKSA 3CIRA 4LMJA 3P4WA 4TWFA 2PTFA 1YQ3A 3RC3A 3V5UA 4LF5T 3PTRB 5L3GB 2XPKA 3T8OA 5L3FB 4IE6A 2VB6A 3VKHA 3RYHE 1YD8G 5AQOB 3N9PA 2DWKA 4DV5T 1KNPA 5A1LA 4CZZB 5AQVB 2XQ8A 2BDEA 1XZYA 3GMIA 1T7SA 3PUAA 4DMVA 4DV2T 5ABFA 3AE3A 4P09A 5HEGA 3N9QA 2QGSA 4EV6A 5DQVA 4H9NC 5HXEA 2W63A 4IIJE 4JEUB 4ISSA 2V7IA 4TNVA 1KNZA 1NENA 4QHOA 3PUXF 2BVMA 4DUZT 4MFRA 5LGUB 2XTLA 4U3CA 1W0AA 5AQMB 2CLYC 5ABGA 1OEDB 1MMAA 4JI7T 4IT4A 3UFGA 2VKHA 5CFBA 4N78D 5AQPB 2XAFB 1WYCA 3AE9A 4EXTA 2IDOB 2UU9T 4JLEA 1HNWT 1WLXA 4YY3T 3ZMSB 4HFDA 2Q9QB 2ZLYA 4NXMT 3CX6B 2WY2A 2UUBT 3ANWA 4ZZBA 3EI0A 3ZSTA 4DIDB 2H3RA 1IBKT 5AQSB 3ESLA 1VOMA 1UURA 4EZHA 4AQGA 4E7SA 2H7OA 5GONE 2DNXA 2BS3A 3ABVA 4MLKA 3AE6A 3U3IA 2CWYA 4YTMA 1HS7A 1MIVA 2E8IA 4UF0A 2LLYA 4HWCA 5J0ZA 4IL9A 3N2GE 3R6NA 2I6HA 4UR9A 3HKBE 2NWBA 3K1SA 5JR9B 2B1EA 2QRXA 5JH7E 3ZYMA 1I94T 4TV9E 2YINA 3RYIE 4DNDA 4YJ2E 3ZPOA 4X1IE 2D5UA 4QXCB 3VRAA 4X5TA 1LKXA 3FZHB 1US7B 4CI2B 1HG5A 4A56A 1GQEA 2WZIA 5HCJA 3ZMTB 1HX1B 3QB5K 5CGMA 4ZOLE 2JPFA
chains in the Genus database with same CATH topology
2MPKA 3EABA 4ZEYA 4CN1A 2V6XA 2V6YA 1WFDA 2XZEA 5CJ5A 4P1NA 4WZXA 4A5XA 2V6YB 2DL1A 2JQ9A 4U3CA 2CRBA 1WCRA 3K1SA 4U7YA 4U2YA 2WY2A 2JQHA 2A9UA 4U7IA 3ZSSA 4CN6A 3ZT7A 2CPTA 4NIQA 5LB7B 3ZT6A 5FVKA 4U33A 2LRKA 3ZT5A 3ZSTA 5FVLA 1WR0A 2RPAA 2K3WA 1YXRA 2LRLA 2WWVA 5CGMA 2W2UA 4CN4A 2JQKA 4U31A 4U2ZA 4IT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPK A;  3EAB A;  4ZEY A;  4CN1 A;  2V6X A;  2V6Y A;  1WFD A;  2XZE A;  5CJ5 A;  4P1N A;  4WZX A;  4A5X A;  2V6Y B;  2DL1 A;  2JQ9 A;  4U3C A;  2CRB A;  1WCR A;  3K1S A;  4U7Y A;  4U2Y A;  2WY2 A;  2JQH A;  2A9U A;  4U7I A;  3ZSS A;  4CN6 A;  3ZT7 A;  2CPT A;  4NIQ A;  5LB7 B;  3ZT6 A;  5FVK A;  4U33 A;  2LRK A;  3ZT5 A;  3ZST A;  5FVL A;  1WR0 A;  2RPA A;  2K3W A;  1YXR A;  2LRL A;  2WWV A;  5CGM A;  2W2U A;  4CN4 A;  2JQK A;  4U31 A;  4U2Z A;  4IT4 A; 
#chains in the Genus database with same CATH topology
 3RIA A;  5F8P A;  4CXW A;  2ZM2 A;  1HTJ F;  4UVB B;  4QXH B;  2PFV A;  3N9N A;  2IC9 A;  5CA0 E;  3ZKR A;  1WR0 A;  1CHU A;  1ZKE A;  4B6X A;  3TLV A;  4JI4 T;  2XAQ B;  2AE9 A;  1KEY A;  1ZOY A;  2JMH A;  3UUL A;  4COF A;  1ZEE A;  3IHR A;  3UFE A;  3P8C D;  3ZCJ A;  2HPL A;  4YXD A;  4ZZC A;  4ILU A;  1XMQ T;  1G8X A;  5TAO A;  4PJL A;  5AQF B;  2Y48 B;  4NUV A;  3SS1 A;  4CXX A;  3LDQ B;  4JI1 T;  1Z0P A;  2BBJ A;  4JBW F;  2YK0 A;  5JDG A;  4U33 A;  5AQQ B;  1BR1 A;  2GK9 A;  3ONJ A;  4HWI B;  2Q9Q A;  1UX4 A;  3I1A A;  3OPC A;  2WSS V;  3P4Q A;  1HG2 A;  2LOP A;  4QX7 B;  3KFW X;  4UVC B;  4YHJ A;  5FP3 A;  4QWN B;  2YU1 A;  2IIU A;  1YW0 A;  5FVL A;  4NXN T;  3OTO T;  2CWO A;  4GK5 E;  1M7K A;  3N9L A;  2X66 A;  4ZHQ E;  5JQG E;  3RI5 A;  2V5C A;  1KF6 A;  3PUS A;  2V6Y B;  3UU8 A;  5L4E A;  4BAY B;  5LBQ B;  4L5G A;  5J1G A;  1ZP0 A;  4TV8 E;  2UXC T;  3EUH A;  5JR9 A;  5DQW A;  4ILC A;  4IDO A;  2W67 A;  3OYZ A;  3O1I A;  2HH7 A;  2DLR A;  2BG9 B;  2XQY A;  3I0O A;  3NKZ A;  4DMW A;  1XDP A;  3S4U A;  2N1G A;  2VL8 A;  2R6G F;  4EEB A;  3JCF A;  2I0M A;  5LJN A;  1IJ5 A;  1BR2 A;  4CI1 B;  1D1C A;  3AE7 A;  3CX7 B;  2VUR A;  1J5E T;  4UV8 B;  5AQG B;  2IC6 A;  2W62 A;  2XSB A;  2I59 A;  2W61 A;  3Q5E A;  4A5X A;  4WYV A;  2Q9Q D;  5LA6 E;  3K8P C;  3PUW F;  1QLB A;  3SFD A;  4AKH A;  3NZP A;  2OA5 A;  1W9R A;  2KXP B;  4IRE A;  2XQ9 A;  2JRK A;  2A2F X;  4DR3 T;  4CI3 B;  4PK4 A;  4O4H E;  3J9X 1;  2XAJ B;  2JIW A;  4IDN A;  2YEV C;  4BJM A;  2E5L T;  4G2A A;  2CBJ A;  3NWI A;  4P0A A;  2CXF A;  3K3Q C;  4HWF A;  4CXY A;  3JAE A;  1SHZ C;  4QXB B;  1OWA A;  3DP7 A;  2ES0 A;  5FXZ A;  1HNX T;  2FJD A;  2XHE B;  4ERR A;  5JDH A;  4PJM A;  4B3S T;  5EK2 A;  4H63 H;  5L3C B;  5C3J A;  3KV5 A;  4YJ3 E;  3QNU A;  1FIO A;  4B3T T;  2WU5 A;  2NW7 A;  1WYB A;  2WM9 A;  3I9Y A;  3EDV A;  5LGN B;  2M6I A;  1LVK A;  4O4L E;  3E0Z A;  4EAH A;  1MIY A;  2UUC T;  3UUB A;  4YT0 A;  4I55 E;  3ETU A;  4HFV A;  2OLT A;  5LXT E;  4H9P C;  4AKL A;  2CBI A;  3L8R A;  4UVA B;  3X1D A;  5AQH B;  2BS2 A;  2H7V C;  5JRC A;  1IBL T;  2J47 A;  3L39 A;  2LOS A;  2XQ5 A;  5KMG P;  3ZMV B;  2WWU A;  3NVO A;  4XAX B;  4L9I A;  2IML A;  2YU2 A;  2XM2 A;  3EHZ A;  2KZ7 B;  5HEO A;  3EVY A;  2LRK A;  4HGA A;  3OJA A;  5HXH A;  1NWM X;  3VHL A;  3UTK A;  3T1Y T;  5AQR B;  4C91 A;  2BG9 A;  3AEC A;  1U5P A;  2K24 A;  2WZH A;  3AXJ A;  1HF8 A;  3KIN B;  2ZM6 T;  3MJX A;  4H9O C;  5L3E B;  4G63 A;  2E9X B;  2E2A A;  4U31 A;  2IUB A;  1OED C;  4CN1 A;  3UQ7 A;  3IEE A;  2YOE A;  4IE7 A;  4O4J E;  2NTX A;  4O2A E;  4X1K E;  3ZC1 A;  3KV6 A;  3UU4 A;  2JMK A;  4M1P A;  1JNZ A;  4HWD A;  2MBG A;  3RGL A;  4LFA T;  2WQY A;  1W09 A;  4AXP A;  5M4Y A;  2Q9Q C;  2B76 A;  3MZK B;  2M6B A;  2PJQ A;  3PUZ F;  5EK3 A;  3MK7 C;  2LE8 A;  4I4T E;  4YHH T;  3PUG A;  4F8H A;  4X20 E;  1FJG T;  3LK3 B;  5FXW A;  4P1N A;  3NRY A;  1FMW A;  2W4X A;  3ZMU B;  3RIF A;  1O3X A;  2X9Y A;  2CHN A;  2V7M A;  5BR8 T;  2X0Y A;  3ZJ2 A;  3F57 A;  4AKR B;  2RPA A;  5HEU A;  5FXV A;  5CA1 E;  3AVS A;  4DR6 T;  1HCI A;  4IGU A;  3M3Z B;  2LKH A;  2MYS A;  3RLF F;  2QA7 A;  4DV0 T;  4LF4 T;  2X0L B;  1E7P A;  2WDR A;  3RPU A;  4IE5 A;  3P50 A;  3C50 A;  3TLT A;  4BA9 A;  3LSV A;  1SA0 E;  1MMN A;  4ZXL A;  2LEH A;  4DR4 T;  5JDQ A;  3ZN1 B;  2LRL A;  5JR9 C;  2BBH A;  1X79 A;  3FXE B;  3Q5D A;  5BMV E;  4KP3 C;  2EHO B;  3Q5X A;  4TX5 A;  3MA9 A;  4JI3 T;  4FJO A;  4TWH A;  3ZMZ B;  1IAP A;  3AE5 A;  5JDM A;  3AEB A;  2WAU A;  1KNR A;  3J7Y q;  5FKY A;  1N33 T;  2BZB A;  3NZQ A;  2XJ7 A;  5DJQ C;  1V9D A;  2CCQ A;  2QVA A;  3CQG B;  3C4Z A;  5C2T A;  4KMC A;  5L4H A;  2D2S A;  2MPK A;  3AEF A;  4O8S A;  3BQK A;  3HKC E;  1OED E;  3PDY A;  3SWH A;  3W15 B;  2E9X A;  1N32 T;  2X9X A;  5LHI B;  3AAE B;  2E5V A;  1HR0 T;  5IHY A;  4DBR A;  1N36 T;  1UGO A;  5HXR A;  2W00 A;  2XUE A;  5LP6 E;  2KIN B;  4HFC A;  4TWD A;  4Z8X A;  3IA3 A;  1HNZ T;  1QSD A;  3T1H T;  5HYA A;  2DI4 A;  4ASK A;  1XNQ T;  2NW8 A;  2XAG B;  2BKO A;  4ILA A;  3AA1 B;  3MKD A;  2XM1 A;  2MOZ A;  5HEH A;  2K5B B;  2H89 A;  3U78 A;  5L47 A;  5HXC A;  3GWH A;  3QB5 A;  5LGT B;  4GIW A;  4X65 T;  2BKP A;  3BQL A;  5FY1 A;  2X51 A;  1OED A;  4J2C A;  3F31 A;  2KMF A;  1LVF A;  3IF8 B;  2PG8 A;  1YXR A;  3OYX A;  3O9X A;  1S35 A;  4LFB T;  2LHR A;  3K3N A;  5LHG B;  2XQA A;  4ZI7 E;  3EAB A;  3FZL B;  3UU5 A;  4JV5 T;  2KND A;  2C5J A;  3ONL C;  4BJN A;  4LF7 T;  3FBZ A;  3C64 A;  3PUY F;  2WDQ A;  2BS4 A;  1IZN B;  5C8Y E;  2FJA A;  3NRX A;  2WWV A;  2EHO A;  3VKG A;  1WR6 A;  3O1H A;  2BG9 C;  4OHF A;  4X62 T;  2VVS A;  2LHN A;  4KHZ F;  5LG3 A;  1MMD A;  3V5S A;  2JQQ A;  2E9X D;  4DV6 T;  5FL0 A;  2X67 A;  4UEL A;  4H9Q C;  1XMO T;  3PJA A;  4AIS A;  3O1J A;  3PV0 F;  4GYS A;  3KVB A;  1WRD A;  3GN5 B;  4WBO A;  2RP4 A;  4O2B E;  2WU2 A;  4AIU A;  1G73 A;  4OFZ A;  2L3L A;  4HKA A;  4QKN A;  2CM0 A;  3CPZ A;  4IDP A;  1D1A A;  4WW0 A;  3LK4 2;  4KBM B;  2ZM0 A;  2DHR A;  3HKD E;  1S94 A;  4JI6 T;  2VKJ A;  5ETW A;  3VU7 H;  4AQY T;  3C4W A;  2KWH A;  3A5X A;  4MAL A;  2ODU A;  5HWY A;  4DVD A;  4YSX A;  4PFO A;  3WAJ A;  1IJ6 A;  2ODV A;  3E08 A;  4PFP A;  4DV4 T;  4V1A v;  2LSI A;  2WCA A;  2UXB T;  3AAA B;  5AFU L;  3JC6 C;  4UV9 B;  4YSZ A;  4CN4 A;  1VCT A;  2WP9 A;  4PJN A;  4PNI A;  4DUY T;  3UU6 A;  4MHC A;  2CEA A;  4XBF B;  2EHO D;  2CA5 A;  3RYC E;  2LSK A;  2NTY A;  2CPT A;  3M65 A;  4A97 A;  4WBN E;  3OBV E;  3KVA A;  2AXD S;  2HPJ A;  1E2A A;  3MXZ A;  4ILB A;  1D1B A;  3VRB A;  2WS3 A;  3QOF A;  3C98 B;  3ZYK A;  2CMR A;  3ZT7 A;  3QK6 A;  4HEA A;  3ZT6 A;  1SUM B;  3TLS A;  2K48 A;  4OYK A;  1ZHC A;  3FZM B;  5LYJ E;  2VQE T;  5L3D B;  3TKL B;  4HTE A;  3UU3 A;  4DV3 T;  4YLH A;  5LNK A;  1I6Z A;  2BG9 E;  4U7I A;  4AQF A;  2K9A A;  2VAS A;  1KFY A;  3I9W A;  4I43 B;  2Z6E A;  5ABH A;  1AJ3 A;  1J1J A;  4LF8 T;  5AQL B;  3AE8 A;  2CHO A;  2LSJ A;  2E9X C;  1ZV4 X;  3LBX B;  5HWX A;  3DTO A;  4ADZ A;  3ZN0 B;  5KX5 E;  4U72 A;  2F4V T;  3A7M A;  1MMG A;  2WMN A;  2UXN B;  2V6Y A;  2LSG A;  2C0S A;  3RQU A;  2JJ9 A;  3AA0 B;  2DWG A;  3AED A;  4WNK A;  5LHH B;  3H3A A;  5H6R B;  2XSA A;  3UT5 E;  5ADX L;  2C5I T;  3CML A;  1HX8 A;  2YDR A;  1CUN A;  3RYF E;  3AE2 A;  3WI3 A;  4K0K T;  4O4I E;  2VKO A;  4YSY A;  5LOV E;  3QUJ A;  2W0G A;  5JDF A;  2FJE A;  4UF0 B;  5E0O A;  2LM2 A;  5KDM C;  4ZS2 A;  5J2T E;  3LK2 B;  3HR0 A;  1HFA A;  4FI5 A;  2XQ3 A;  4QH4 A;  2N2N A;  4L0R A;  1VRB A;  2OV9 A;  3AB3 B;  3PJA J;  1Y01 A;  4X1Y E;  1KK7 A;  4EYY R;  5JDN A;  1SE7 A;  4GKK T;  3JAF A;  1U4Q A;  4EZ4 A;  2W2U A;  4HFI A;  4ZS3 A;  5FY0 A;  4YTN A;  4DO0 A;  4XZC A;  1YQ4 A;  3RIU C;  1E1H B;  4OX9 T;  5HXS A;  5FMN A;  3L09 A;  3VR8 A;  5L2L A;  2EHO C;  4HE8 A;  2A72 A;  3AAI A;  5FL1 A;  3RX6 A;  2HN1 A;  5FXX A;  3PUQ A;  3UQ4 A;  4EYU A;  5AQI B;  2IW5 B;  5IWA T;  5F5W A;  2Y8D A;  4Z90 A;  2L9Q A;  3P7I A;  2HN2 A;  3AEE A;  3ZYL A;  2A9U A;  4HN9 A;  2W66 A;  4E7Z A;  3B13 A;  3UUM A;  4HFE A;  4QH5 A;  3RKG A;  3QC9 A;  3CX8 B;  4PAG A;  4EIW A;  2DL1 A;  3P4P A;  4NUU A;  1N34 T;  4LFC T;  2UXX B;  1FEW A;  4P0B A;  4DV7 T;  3HA4 A;  2V7J A;  3D0T A;  1NEK A;  3LBX A;  1FMV A;  3E22 E;  4LMK A;  2V5D A;  5LMU T;  2CRB A;  4OYJ A;  5JRE A;  2IAK A;  3AE1 A;  3PU8 A;  2G0U A;  3TLU A;  5CB4 E;  2VKD A;  5LJM A;  5JVD E;  4IDQ A;  4NPP A;  2FUP A;  4GYR A;  3SOL A;  2BVL A;  4DV1 T;  4DR1 T;  2XQ7 A;  4IL4 A;  1MIW A;  3R84 B;  2H88 A;  2NP9 A;  1UUS A;  2ZM8 A;  3WAK A;  2CLY B;  4PW8 A;  2RA1 A;  4H9S E;  4X66 T;  4GK0 E;  3HKE E;  4X64 T;  2NOX A;  3B57 A;  5LB7 B;  1IBM T;  2MAW A;  3F2E A;  4JYA T;  3CQX C;  3ZEF B;  2XAS B;  5FNV E;  3HI2 A;  4B3R T;  3IBP A;  1WFD A;  5LG4 A;  4QH1 A;  4U74 A;  3H37 A;  2SPC A;  2JQH A;  2KWI B;  4CN6 A;  5EZY E;  3H3M A;  2J4G A;  1BR4 A;  3EAM A;  5EK4 A;  2LSY A;  5DAB A;  3JC6 D;  3O4X E;  2VQF T;  5FYM A;  4IST A;  1J5W A;  4AKI A;  1UCU A;  2NW9 A;  4AQF C;  4DR5 T;  3FZK B;  4HFB A;  5HAX A;  4PK5 A;  2M67 A;  4ZI2 D;  2VL0 A;  3ZLI A;  3ZC0 A;  5AQN B;  4TZ4 C;  1WCR A;  4A98 A;  4U7Y A;  3VR9 A;  2D0U A;  3C4X A;  2FJB A;  4F6R C;  2X68 A;  4ZI3 D;  2DCF A;  2K3W A;  5HEJ A;  2WMO A;  3FBL A;  3AA6 B;  3AEG A;  3SRZ A;  5L3B B;  1XWM A;  2KLQ A;  3FZF B;  2WDV A;  3NBX X;  4HWH A;  3RRW A;  3KBT A;  3RIU A;  4PJJ A;  3B5M A;  1MND A;  4C90 A;  1OXZ A;  4YTP A;  4UIG A;  3OKQ A;  2A3D A;  1XDO A;  5AQU B;  4Z91 A;  1T8B A;  2V6X A;  4AI6 A;  4B3M T;  2YDQ A;  2J1D G;  4DR7 T;  2XQ4 A;  5KXJ A;  5FVK A;  4AKG A;  2C5K T;  3CWZ B;  3ETV A;  2X9H A;  3BQI A;  4JI8 T;  3ZJ1 A;  4KI0 F;  3AA7 B;  3GA8 A;  3AVR A;  1R8I A;  1T98 A;  4UEM A;  3HL6 A;  5IUX A;  2LKG A;  3Q5W A;  3LG7 A;  3ZCI A;  3P4S A;  5J2U E;  4QX8 B;  2CE7 A;  4IDZ A;  2HHH T;  3ZT5 A;  1D0Y A;  2X9W A;  3N9M A;  2MTQ A;  1B7T A;  4KHP T;  3RC8 A;  1MNE A;  3C51 A;  4IHJ E;  2BKN A;  2D0T A;  3CQC B;  5LCY A;  5JRC B;  2D9D A;  2VK9 A;  4GOU A;  5AQT B;  2ZMA A;  5CJ5 A;  3FHN A;  1JNR A;  4JI2 T;  1D0X A;  4KX6 A;  1XNR T;  3TLW A;  3CVR A;  3N2K E;  3RF1 A;  5IYZ E;  2J62 A;  3LFM A;  3I0Q A;  3DJB A;  3LJC A;  4EB6 E;  2CXL A;  2V8S V;  4CQI A;  2XAH B;  2Y6X A;  5AQJ B;  4Q25 A;  3RQW A;  3BK9 A;  4EGW A;  3UUX B;  4TN7 B;  2KT9 A;  3FXD B;  2L8K A;  5JDL A;  4GKJ T;  3ZSS A;  4JI5 T;  3N9O A;  2QYW A;  3AXJ B;  2UUA T;  2V7K A;  1M62 A;  2P9B A;  3P4R A;  3PU3 A;  4LML A;  2YN6 A;  2WBL A;  2LT3 A;  2LJL A;  4NIQ A;  4KUM B;  4EOZ B;  1UK5 A;  1D0Z A;  1YKE B;  4ZI2 C;  2VVN A;  3N5L A;  3FB2 A;  1T72 A;  2CXD A;  5AQK B;  2VWA A;  5ABF B;  2NR4 A;  5FY7 A;  1Y64 B;  4LF9 T;  2XZE A;  3AEA A;  4H9R C;  4IE0 A;  3RKO A;  4LF6 T;  1W0B A;  4MBQ A;  5H6Q B;  1NAF A;  3A8Y C;  4HFH A;  2ACX A;  4JUY A;  3L3P A;  2X0H A;  4TUY E;  4ZI3 C;  3KBU A;  4DR2 T;  1EZ3 A;  3EDU A;  1QUU A;  2JQK A;  1X9B A;  1UX5 A;  2YDS A;  1LRZ A;  3G06 A;  3UUN A;  4U2Y A;  4EED A;  3PUV F;  4OK0 A;  4JI0 T;  3K3O A;  2V26 A;  3N2O A;  1BR0 A;  3AE4 A;  3RRC A;  4JEH B;  3PUR A;  2WB5 A;  2XY8 B;  4U2Z A;  3KV4 A;  4ZEY A;  4I50 E;  1Z8U A;  3Q9D A;  2XQ6 A;  3JAD A;  2ACZ A;  3CKD A;  4DBQ A;  5HCM A;  3GN5 A;  3ONX A;  2PBI A;  3KDS E;  2IHR 1;  3Q2M A;  5ABE A;  4TNW A;  3RH3 A;  4IE4 A;  4PK6 A;  3KV9 A;  4WZX A;  4YFS A;  1YKH B;  1DU2 A;  3RHW A;  5JTG A;  3CK6 A;  4UXN B;  4H63 V;  3ANW B;  2LM9 A;  1L0V A;  2UXD T;  2N9D A;  2V7L A;  2V1D B;  5F3J A;  2JQ9 A;  4ANJ A;  4I0U A;  1H7C A;  3MAC A;  4K0U A;  3SFE A;  3OVU A;  2KSR A;  5LBM A;  3PE0 A;  2FBW A;  1VCS A;  5LMN T;  2YKS A;  3CIR A;  4LMJ A;  3P4W A;  4TWF A;  2PTF A;  1YQ3 A;  3RC3 A;  3V5U A;  4LF5 T;  3PTR B;  5L3G B;  2XPK A;  3T8O A;  5L3F B;  4IE6 A;  2VB6 A;  3VKH A;  3RYH E;  1YD8 G;  5AQO B;  3N9P A;  2DWK A;  4DV5 T;  1KNP A;  5A1L A;  4CZZ B;  5AQV B;  2XQ8 A;  2BDE A;  1XZY A;  3GMI A;  1T7S A;  3PUA A;  4DMV A;  4DV2 T;  5ABF A;  3AE3 A;  4P09 A;  5HEG A;  3N9Q A;  2QGS A;  4EV6 A;  5DQV A;  4H9N C;  5HXE A;  2W63 A;  4IIJ E;  4JEU B;  4ISS A;  2V7I A;  4TNV A;  1KNZ A;  1NEN A;  4QHO A;  3PUX F;  2BVM A;  4DUZ T;  4MFR A;  5LGU B;  2XTL A;  4U3C A;  1W0A A;  5AQM B;  2CLY C;  5ABG A;  1OED B;  1MMA A;  4JI7 T;  4IT4 A;  3UFG A;  2VKH A;  5CFB A;  4N78 D;  5AQP B;  2XAF B;  1WYC A;  3AE9 A;  4EXT A;  2IDO B;  2UU9 T;  4JLE A;  1HNW T;  1WLX A;  4YY3 T;  3ZMS B;  4HFD A;  2Q9Q B;  2ZLY A;  4NXM T;  3CX6 B;  2WY2 A;  2UUB T;  3ANW A;  4ZZB A;  3EI0 A;  3ZST A;  4DID B;  2H3R A;  1IBK T;  5AQS B;  3ESL A;  1VOM A;  1UUR A;  4EZH A;  4AQG A;  4E7S A;  2H7O A;  5GON E;  2DNX A;  2BS3 A;  3ABV A;  4MLK A;  3AE6 A;  3U3I A;  2CWY A;  4YTM A;  1HS7 A;  1MIV A;  2E8I A;  4UF0 A;  2LLY A;  4HWC A;  5J0Z A;  4IL9 A;  3N2G E;  3R6N A;  2I6H A;  4UR9 A;  3HKB E;  2NWB A;  3K1S A;  5JR9 B;  2B1E A;  2QRX A;  5JH7 E;  3ZYM A;  1I94 T;  4TV9 E;  2YIN A;  3RYI E;  4DND A;  4YJ2 E;  3ZPO A;  4X1I E;  2D5U A;  4QXC B;  3VRA A;  4X5T A;  1LKX A;  3FZH B;  1US7 B;  4CI2 B;  1HG5 A;  4A56 A;  1GQE A;  2WZI A;  5HCJ A;  3ZMT B;  1HX1 B;  3QB5 K;  5CGM A;  4ZOL E;  2JPF A; 
#chains in the Genus database with same CATH homology
 2MPK A;  3EAB A;  4ZEY A;  4CN1 A;  2V6X A;  2V6Y A;  1WFD A;  2XZE A;  5CJ5 A;  4P1N A;  4WZX A;  4A5X A;  2V6Y B;  2DL1 A;  2JQ9 A;  4U3C A;  2CRB A;  1WCR A;  3K1S A;  4U7Y A;  4U2Y A;  2WY2 A;  2JQH A;  2A9U A;  4U7I A;  3ZSS A;  4CN6 A;  3ZT7 A;  2CPT A;  4NIQ A;  5LB7 B;  3ZT6 A;  5FVK A;  4U33 A;  2LRK A;  3ZT5 A;  3ZST A;  5FVL A;  1WR0 A;  2RPA A;  2K3W A;  1YXR A;  2LRL A;  2WWV A;  5CGM A;  2W2U A;  4CN4 A;  2JQK A;  4U31 A;  4U2Z A;  4IT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...