2JQ9A

Vps4a mit-chmp1a complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
71
structure length
71
Chain Sequence
TLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associating protein 4A
total genus 31
structure length 71
sequence length 71
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jq9A00
2LRKA 3ZT5A 4U3CA 4U2YA 2DL1A 4P1NA 4U2ZA 4WZXA 2CRBA 4ZEYA 5CGMA 2W2UA 4CN6A 2MPKA 2V6XA 1WR0A 2CPTA 2LRLA 2A9UA 1WFDA 2V6YB 1WCRA 4CN1A 5CJ5A 2JQHA 2JQKA 2WY2A 2V6YA 3EABA 4U33A 2JQ9A 5FVLA 2WWVA 4NIQA 1YXRA 5FVKA 3ZSTA 2XZEA 3K1SA 4U7YA 4A5XA 4U7IA 4CN4A 5LB7B 2RPAA 2K3WA 4U31A 3ZT6A 3ZT7A 4IT4A 3ZSSA
chains in the Genus database with same CATH superfamily
4ZS3A 3ZN1B 3F2EA 4O4LE 3ZMTB 1OEDE 2XAFB 3LG7A 4QXHB 3S4UA 4DV7T 1IBLT 3LK3B 2XQYA 3PUGA 4QH4A 3V5SA 4EZ4A 4DUZT 3LSVA 3TKLB 4AQFC 3C4WA 3I0QA 3AXJA 1W09A 5HAXA 5HWYA 2G0UA 2VVSA 3ABVA 4DV0T 4HWFA 4DV5T 4JI8T 5JVDE 3L09A 2X66A 4EEBA 2UXBT 4UEMA 4HFBA 2KSRA 1G8XA 3EDUA 4F8HA 1BR2A 4E7ZA 5L47A 4DV1T 2J62A 2NW8A 1Y64B 3OJAA 3PUZF 4KMCA 2CA5A 2XJ7A 4EAHA 1D0ZA 4ILAA 3N9PA 1MMDA 1WRDA 3MXZA 3WAJA 3PTRB 3C4ZA 3CX8B 2HN1A 3AA7B 4UVBB 4DMWA 5DJQC 3A7MA 4X1KE 5AQIB 1M7KA 3KBUA 3IHRA 3NVOA 5GONE 2X9WA 3MA9A 3TLWA 3VR9A 4LF5T 2ZLYA 3RGLA 2OV9A 4TWHA 4Z8XA 3B13A 1VRBA 2V5CA 4UV8B 5HEOA 5KXJA 4B3RT 1T72A 2NTYA 5FXVA 3KV6A 2BZBA 2ZMAA 3E0ZA 4O4JE 4WZXA 3NRYA 3SFEA 2XQAA 2IC6A 3HKDE 3DJBA 3FZKB 4PAGA 2WDQA 5FMNA 2E5LT 4DR3T 4X62T 2JJ9A 3CIRA 2NR4A 4UF0B 2WS3A 1KK7A 3FXDB 3ONJA 1SUMB 4AQFA 4YXDA 4LF7T 3FZMB 1LKXA 3HA4A 2JQ9A 2YOEA 3QB5A 1IZNB 2A72A 4AIUA 3PUXF 4HGAA 5FVKA 4DV2T 3PJAJ 4JI6T 1HR0T 4OFZA 1W0AA 3GN5B 3ZEFB 3RHWA 1L0VA 2K3WA 5AQLB 3AE5A 1YQ3A 2BKOA 2BVLA 2E9XC 2JQQA 4H9QC 4HFIA 4IREA 5J1GA 4LF4T 3QOFA 2XASB 5ABFB 4JI7T 5F8PA 4YHJA 5LMUT 2E9XB 2CCQA 3FBLA 1XWMA 2WU5A 3O1IA 5C8YE 5FY7A 2H3RA 4I0UA 3CQGB 3ZCIA 2LKHA 2MBGA 4JEUB 2ZM0A 3KINB 3PE0A 4LMLA 3NZQA 4G63A 3SWHA 5IUXA 4GKKT 2UXDT 5LA6E 1U4QA 1KNPA 2WAUA 3DP7A 3EHZA 4BA9A 2D0TA 3QK6A 1AJ3A 3J9X1 5HEJA 2DNXA 2XM2A 1W0BA 3AEEA 1T7SA 2VKDA 2PFVA 1D1AA 3LDQB 2QYWA 1DU2A 2WY2A 2LSIA 5HWXA 2GK9A 1VOMA 2Y48B 4NPPA 2FJBA 4GK0E 4C91A 3T8OA 4A98A 3UU8A 3ZMVB 4PFPA 1XMQT 1XNRT 4HWIB 4X66T 2K48A 4ILUA 2FBWA 4A56A 3E08A 5CB4E 4UVCB 4C90A 3HL6A 3JADA 5LJNA 3ZT5A 1LVKA 3CWZB 3NZPA 4PJNA 3FZLB 5AQSB 1FIOA 3VU7H 5AQPB 4E7SA 5L3CB 2HH7A 3E22E 4ZEYA 3AAAB 1V9DA 5CA0E 5E0OA 2JRKA 3F57A 3QB5K 4G2AA 2YDQA 3X1DA 4ZI2D 3RQWA 5LXTE 3RH3A 2CBJA 2RP4A 3L3PA 1YD8G 3AVSA 2UUAT 4U72A 4AQGA 1R8IA 4QKNA 5H6RB 3UU6A 3CX7B 3N9LA 5C2TA 3SOLA 5ADXL 4ZXLA 5ABEA 4UELA 5HCJA 2XQ4A 3T1YT 4GKJT 5HXRA 1HX1B 3ZJ1A 5AQTB 3RI5A 4IE0A 2CHOA 5L3DB 5HXEA 2W61A 2IDOB 4TWDA 2PTFA 2W00A 4X64T 1D1BA 2MAWA 4XBFB 2H7OA 4LF8T 2OA5A 4MHCA 4X20E 4EXTA 2AE9A 1NEKA 2CXLA 2LEHA 2LHNA 2XQ8A 2M6BA 4U2YA 4IDNA 2L8KA 4YSYA 2DL1A 3CK6A 5TAOA 3UU3A 3UUBA 4COFA 3J7Yq 2ACXA 3EI0A 4YJ3E 3UULA 3AE3A 2CM0A 5EK4A 1J5ET 2CE7A 2DHRA 2J4GA 3PU3A 4DVDA 1SE7A 2DI4A 2R6GF 3BK9A 3NKZA 2V6YB 3PUSA 4WBOA 5EZYE 3ETVA 3BQKA 2KWHA 5FY0A 5LG3A 4JV5T 3P4SA 3C51A 1ZEEA 1OEDB 3IBPA 5LGUB 4P0AA 4MBQA 4B3TT 3ZMUB 4K0UA 1X79A 3KDSE 3K1SA 4GOUA 4WNKA 2YKSA 4CN4A 2RPAA 5J2TE 2OLTA 1HTJF 1BR1A 4ZOLE 3VRAA 3IF8B 3PU8A 3Q9DA 3HR0A 2BDEA 1O3XA 3K3QC 4IT4A 4L0RA 4UXNB 2CWOA 2WSSV 5AQNB 2VK9A 2ODVA 4AKIA 4I55E 3I9YA 5IYZE 5JR9B 1Y01A 4ZI2C 2DWGA 2J47A 4HE8A 3LK42 2B1EA 2CRBA 4PJJA 4O4HE 2PBIA 2CWYA 2LLYA 2X0HA 3NWIA 2ES0A 4P09A 3P4PA 2VVNA 4DR4T 2QVAA 4LFBT 4YLHA 5HEUA 5FL0A 3JC6D 3GN5A 1JNRA 3P7IA 2BBHA 3PDYA 3AE8A 4IDQA 4M1PA 5KX5E 3IA3A 1HNXT 1S35A 2LOPA 1XDOA 3VRBA 2JQHA 1XMOT 4U74A 2V6YA 2VQFT 4HWDA 4OX9T 2XQ7A 4HTEA 5AQKB 4EYYR 5LNKA 2LT3A 5IWAT 2FUPA 1UURA 2HN2A 4YY3T 2C5KT 5IHYA 5JRCB 3ZYLA 2UXCT 4TNVA 1ZKEA 2EHOA 1HF8A 5AQGB 2XQ9A 3O1HA 3RYIE 2PG8A 3ZCJA 3ZT7A 4DR6T 4UR9A 5KMGP 2LRKA 3PUAA 3MACA 3VHLA 2LE8A 3PV0F 5CA1E 2WZIA 2VKOA 4GYSA 5H6QB 5L2LA 2Z6EA 4EOZB 3RYHE 2HPLA 1QLBA 3I0OA 2MOZA 2XSAA 3N9OA 2V6XA 5JR9A 4CI2B 2WB5A 2IC9A 5FKYA 4CZZB 5J0ZA 4KBMB 1WCRA 1XDPA 3CMLA 3KV5A 2VKJA 5EK2A 3I1AA 2CBIA 4DO0A 1I6ZA 1I94T 2XHEB 3RIAA 5AQJB 5LMNT 2WWVA 4B3ST 2X9YA 2W67A 2DCFA 4PK5A 4TNWA 2NTXA 2UXXB 3RYCE 3AE6A 3ANWA 2W66A 5AQUB 3SS1A 5AQFB 2CLYB 2K5BB 2V26A 2H89A 3UUNA 4FJOA 1H7CA 4I4TE 1X9BA 3CQCB 2XQ6A 1T8BA 2FJAA 2QA7A 4U31A 2X68A 4I43B 3UFEA 2XM1A 4AQYT 3QUJA 2V7IA 3QC9A 2PJQA 4LF6T 4JI0T 2AXDS 1MIVA 3NRXA 3N2OA 1KEYA 3FBZA 3AA6B 2IW5B 2UXNB 2EHOC 2WU2A 4QH5A 1E2AA 4JI2T 3ZC1A 5CGMA 5F3JA 2SPCA 5L4EA 5LJMA 4GIWA 2HPJA 2CPTA 4KI0F 2CXDA 4H63H 4LMJA 5LGNB 3PUVF 4AXPA 2YEVC 2KNDA 3RQUA 2XAQB 3R84B 3M65A 4ZZCA 3M3ZB 3AEFA 1OEDC 1OWAA 1IBKT 2N9DA 1WR6A 1GQEA 3PURA 1ZOYA 4XAXB 4PW8A 4HFEA 2Q9QD 1U5PA 4QXCB 1BR4A 2ZM8A 3L8RA 5C3JA 5JQGE 1CHUA 3H3MA 3K3NA 3FZFB 3H3AA 4WW0A 2ZM6T 2BS2A 4ILBA 4HN9A 5LOVE 3RIUC 4BJMA 5CFBA 1MIWA 3KBTA 2Q9QB 3C64A 2N1GA 3Q5XA 3ZKRA 3HKCE 2IUBA 3OKQA 1SA0E 4ERRA 3MJXA 1J1JA 4GK5E 2KT9A 3B5MA 2K24A 4GYRA 3ZSTA 3AAEB 2EHOD 3GMIA 2WP9A 4WYVA 4JI5T 5AFUL 1HNWT 3C4XA 3KFWX 3FXEB 1OEDA 2NWBA 4ZI7E 2V7KA 4AISA 2P9BA 4HKAA 4Q25A 4YJ2E 2B76A 1IJ6A 3ZJ2A 1WR0A 1US7B 2VWAA 2ZM2A 3OBVE 4DR5T 4YHHT 2BKPA 2IHR1 4X1YE 1N36T 3TLUA 3LBXB 5AQOB 3UTKA 4H63V 2MTQA 3ESLA 3OPCA 4KUMB 4U33A 2D5UA 1YKEB 4LFCT 5JDHA 4QX7B 5HXCA 1Z8UA 5LGTB 4DUYT 5J2UE 3QNUA 1T98A 3AEAA 1FMWA 5JDQA 3OYXA 1HG5A 5DQVA 3AAIA 4DV4T 4OHFA 4IDZA 3IEEA 3HI2A 1FEWA 2L3LA 2VKHA 5L3FB 2KMFA 3U78A 1NENA 4IDPA 4QX8B 4QWNB 4UVAB 5LYJE 2D0UA 3AE7A 1E1HB 5KDMC 4DR2T 3UT5E 2X9HA 4U2ZA 4PJLA 3D0TA 1NWMX 4IE7A 1ZP0A 2FJEA 2W0GA 3HKEE 4PK6A 4UV9B 4JUYA 3ZPOA 2I0MA 2LSJA 4EEDA 2YINA 4O2AE 4YTNA 3UUMA 4XZCA 3CKDA 1YQ4A 2BG9B 2WCAA 2WBLA 3ONLC 1D1CA 3P8CD 3PJAA 5CJ5A 2MYSA 2KINB 3LBXA 3AA0B 3UUXB 5JDGA 3ZLIA 2BS3A 1OXZA 2E5VA 2E9XA 5FY1A 3F31A 4KHZF 4TV9E 3MK7C 4X5TA 2XZEA 4DBQA 1SHZC 1M62A 2KLQA 1FJGT 1WYBA 1KNRA 2KXPB 2YU1A 4UF0A 2WQYA 3UQ7A 3ZYMA 4EGWA 1MMNA 5FXZA 3UU4A 1ZV4X 3LK2B 2CMRA 1HG2A 4IE4A 4IL9A 4H9PC 5F5WA 3U3IA 1QSDA 3O4XE 1IBMT 1JNZA 2W62A 5HXSA 2E2AA 3AEGA 3P4WA 2VURA 2V1DB 5FXWA 3RC3A 2V7JA 1UX5A 4YTMA 4DV6T 1HCIA 5A1LA 3LJCA 1UK5A 4KX6A 4X65T 1MMGA 2XAGB 3P4QA 4HEAA 3SFDA 4KP3C 2IIUA 3SRZA 1MIYA 4H9OC 5JDMA 3O9XA 2ODUA 4HFVA 3RKGA 4IE6A 3V5UA 5ABFA 4FI5A 4OYKA 3EDVA 2HHHT 2XPKA 4NIQA 4ASKA 2YK0A 4H9RC 5FYMA 5AQHB 4MFRA 2X0LB 5HEHA 3RX6A 1Z0PA 2H88A 2Q9QC 1IAPA 3KV9A 4A5XA 3AE4A 4EV6A 4AKRB 3ZMZB 4JEHB 2BKNA 3AB3B 5JR9C 4J2CA 5JRCA 1E7PA 2YDRA 2IAKA 3N9MA 2QGSA 3AE2A 5LHHB 2BG9E 4TUYE 2NW7A 2WWUA 3ZN0B 4ZHQE 4JI4T 2C5JA 4KHPT 4DNDA 4YFSA 5DQWA 3N9NA 4PFOA 2NW9A 1HX8A 4TV8E 5JDLA 1HFAA 1UGOA 2A9UA 3EAMA 2LJLA 2VQET 4AKHA 2KWIB 2Q9QA 3C98B 3PUQA 5FP3A 2CHNA 5LP6E 3VR8A 4L5GA 4TX5A 3UFGA 2V5DA 5FVLA 5ABHA 4AI6A 4LF9T 2XY8B 1UUSA 1YXRA 3N5LA 2W63A 4EZHA 3Q5DA 3JC6C 3BQLA 1KF6A 1J5WA 4U7YA 1YW0A 4V1Av 4NXNT 3AE1A 4PNIA 5JTGA 2DWKA 1KFYA 2YDSA 3ANWB 3G06A 4O2BE 3R6NA 3RYFE 4WBNE 1HS7A 4DMVA 5L3EB 2UUBT 3VKHA 2VL0A 4AKLA 3PUWF 3ONXA 4UIGA 3ZYKA 4EYUA 4TWFA 4ISSA 2XQ5A 3KVBA 3TLTA 3FHNA 4ZI3D 1XZYA 4L9IA 4BAYB 4X1IE 5LBMA 2MPKA 3TLSA 3CQXC 2E9XD 3RRCA 2LHRA 3FB2A 2LSKA 4IIJE 4ADZA 1D0XA 5FL1A 1LVFA 5LHIB 2BG9C 2QRXA 2K9AA 5LBQB 4QH1A 3CVRA 2YN6A 2FJDA 3AEBA 5EK3A 4H9NC 4OYJA 4CN1A 2XUEA 5FNVE 4YSZA 3AECA 3N2KE 4YT0A 2F4VT 5LG4A 2KZ7B 2X9XA 3FZHB 2VB6A 1MNEA 2CXFA 2LSYA 5HEGA 3AXJB 2LKGA 3L39A 3AVRA 1W9RA 3RF1A 3KV4A 3W15B 3JAFA 2XQ3A 3KVAA 2A2FX 1XNQT 4TZ4C 4K0KT 2IMLA 4I50E 4O4IE 3NBXX 3ZSSA 2BS4A 1G73A 2BG9A 2C0SA 2WZHA 4P0BA 2JPFA 4QXBB 4P1NA 3MKDA 2D2SA 3CX6B 5LCYA 3RIFA 4TN7B 5HYAA 4DV3T 2W2UA 4CI1B 1UCUA 2C5IT 2JMKA 1BR0A 2JMHA 5JH7E 2VASA 3P50A 4HFDA 4JI1T 1MMAA 4CXYA 4MLKA 3OYZA 3UU5A 4IDOA 2JQKA 3JAEA 4JBWF 1N32T 4LMKA 3VKGA 2LSGA 3AEDA 4DR1T 4B6XA 3ETUA 4N78D 1KNZA 4ZI3C 2V8SV 4CXWA 1CUNA 4F6RC 2YU2A 2DLRA 5M4YA 4AKGA 4CQIA 2V7LA 2XAHB 3CPZA 3A8YC 2NOXA 3EUHA 3H37A 1WYCA 3WI3A 4EIWA 2N2NA 2A3DA 1FMVA 3RIUA 3RRWA 4EB6E 2X51A 4PJMA 4QHOA 5JDFA 2WDRA 3I9WA 5JREA 1VCSA 3LFMA 3O1JA 2J1DG 5HCMA 3K3OA 2EHOB 1IJ5A 1MNDA 1NAFA 2I6HA 2RA1A 1N33T 3GA8A 5L4HA 3N2GE 4HWCA 4ANJA 1YKHB 3AE9A 1N34T 2BVMA 2I59A 1WFDA 2Y8DA 4HFHA 5ETWA 4YSXA 1UX4A 1B7TA 3Q5WA 2BBJA 4HWHA 4NUUA 4ZS2A 3RPUA 4Z91A 4OK0A 4IHJE 5HXHA 3C50A 4A97A 2V7MA 2X0YA 3ZC0A 3N9QA 2CEAA 1VCTA 2LM2A 4JYAT 3OTOT 3ZMSB 1D0YA 1QUUA 2WMNA 5LB7B 3AA1B 1WLXA 5JDNA 5L3GB 3A5XA 5BR8T 3P4RA 4PK4A 2W4XA 1EZ3A 3DTOA 2WMOA 3Q2MA 4H9SE 3RLFF 3WAKA 4U3CA 3RKOA 3UQ4A 3MZKB 2X67A 4ISTA 2VL8A 5AQRB 5AQQB 3JCFA 4BJNA 2H7VC 2WDVA 4CI3B 3Q5EA 4CN6A 5FXXA 2UU9T 2XTLA 2L9QA 2LOSA 2LRLA 3PUYF 3BQIA 4IGUA 5AQMB 4Z90A 3TLVA 4DIDB 5ABGA 4DBRA 4DR7T 4IE5A 2NP9A 3HKBE 2UUCT 3GWHA 5AQVB 2M6IA 4CXXA 4NXMT 5L3BB 3EABA 2XAJB 2ACZA 4ZZBA 3T1HT 1S94A 2JIWA 2Y6XA 3B57A 2CLYC 1ZHCA 4MALA 4NUVA 2WM9A 5BMVE 4JI3T 4U7IA 3OVUA 4JLEA 2LM9A 3K8PC 4O8SA 5DABA 4YTPA 1HNZT 3RC8A 1LRZA 3EVYA 4ILCA 2XSBA 3ZT6A 4LFAT 4IL4A 4B3MT 5LHGB 2E8IA 2D9DA 4HFCA 2M67A
chains in the Genus database with same CATH topology
2LRKA 3ZT5A 4U3CA 4U2YA 2DL1A 4P1NA 4U2ZA 4WZXA 2CRBA 4ZEYA 5CGMA 2W2UA 4CN6A 2MPKA 2V6XA 1WR0A 2CPTA 2LRLA 2A9UA 1WFDA 2V6YB 1WCRA 4CN1A 5CJ5A 2JQHA 2JQKA 2WY2A 2V6YA 3EABA 4U33A 2JQ9A 5FVLA 2WWVA 4NIQA 1YXRA 5FVKA 3ZSTA 2XZEA 3K1SA 4U7YA 4A5XA 4U7IA 4CN4A 5LB7B 2RPAA 2K3WA 4U31A 3ZT6A 3ZT7A 4IT4A 3ZSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRK A;  3ZT5 A;  4U3C A;  4U2Y A;  2DL1 A;  4P1N A;  4U2Z A;  4WZX A;  2CRB A;  4ZEY A;  5CGM A;  2W2U A;  4CN6 A;  2MPK A;  2V6X A;  1WR0 A;  2CPT A;  2LRL A;  2A9U A;  1WFD A;  2V6Y B;  1WCR A;  4CN1 A;  5CJ5 A;  2JQH A;  2JQK A;  2WY2 A;  2V6Y A;  3EAB A;  4U33 A;  2JQ9 A;  5FVL A;  2WWV A;  4NIQ A;  1YXR A;  5FVK A;  3ZST A;  2XZE A;  3K1S A;  4U7Y A;  4A5X A;  4U7I A;  4CN4 A;  5LB7 B;  2RPA A;  2K3W A;  4U31 A;  3ZT6 A;  3ZT7 A;  4IT4 A;  3ZSS A; 
#chains in the Genus database with same CATH topology
 4ZS3 A;  3ZN1 B;  3F2E A;  4O4L E;  3ZMT B;  1OED E;  2XAF B;  3LG7 A;  4QXH B;  3S4U A;  4DV7 T;  1IBL T;  3LK3 B;  2XQY A;  3PUG A;  4QH4 A;  3V5S A;  4EZ4 A;  4DUZ T;  3LSV A;  3TKL B;  4AQF C;  3C4W A;  3I0Q A;  3AXJ A;  1W09 A;  5HAX A;  5HWY A;  2G0U A;  2VVS A;  3ABV A;  4DV0 T;  4HWF A;  4DV5 T;  4JI8 T;  5JVD E;  3L09 A;  2X66 A;  4EEB A;  2UXB T;  4UEM A;  4HFB A;  2KSR A;  1G8X A;  3EDU A;  4F8H A;  1BR2 A;  4E7Z A;  5L47 A;  4DV1 T;  2J62 A;  2NW8 A;  1Y64 B;  3OJA A;  3PUZ F;  4KMC A;  2CA5 A;  2XJ7 A;  4EAH A;  1D0Z A;  4ILA A;  3N9P A;  1MMD A;  1WRD A;  3MXZ A;  3WAJ A;  3PTR B;  3C4Z A;  3CX8 B;  2HN1 A;  3AA7 B;  4UVB B;  4DMW A;  5DJQ C;  3A7M A;  4X1K E;  5AQI B;  1M7K A;  3KBU A;  3IHR A;  3NVO A;  5GON E;  2X9W A;  3MA9 A;  3TLW A;  3VR9 A;  4LF5 T;  2ZLY A;  3RGL A;  2OV9 A;  4TWH A;  4Z8X A;  3B13 A;  1VRB A;  2V5C A;  4UV8 B;  5HEO A;  5KXJ A;  4B3R T;  1T72 A;  2NTY A;  5FXV A;  3KV6 A;  2BZB A;  2ZMA A;  3E0Z A;  4O4J E;  4WZX A;  3NRY A;  3SFE A;  2XQA A;  2IC6 A;  3HKD E;  3DJB A;  3FZK B;  4PAG A;  2WDQ A;  5FMN A;  2E5L T;  4DR3 T;  4X62 T;  2JJ9 A;  3CIR A;  2NR4 A;  4UF0 B;  2WS3 A;  1KK7 A;  3FXD B;  3ONJ A;  1SUM B;  4AQF A;  4YXD A;  4LF7 T;  3FZM B;  1LKX A;  3HA4 A;  2JQ9 A;  2YOE A;  3QB5 A;  1IZN B;  2A72 A;  4AIU A;  3PUX F;  4HGA A;  5FVK A;  4DV2 T;  3PJA J;  4JI6 T;  1HR0 T;  4OFZ A;  1W0A A;  3GN5 B;  3ZEF B;  3RHW A;  1L0V A;  2K3W A;  5AQL B;  3AE5 A;  1YQ3 A;  2BKO A;  2BVL A;  2E9X C;  2JQQ A;  4H9Q C;  4HFI A;  4IRE A;  5J1G A;  4LF4 T;  3QOF A;  2XAS B;  5ABF B;  4JI7 T;  5F8P A;  4YHJ A;  5LMU T;  2E9X B;  2CCQ A;  3FBL A;  1XWM A;  2WU5 A;  3O1I A;  5C8Y E;  5FY7 A;  2H3R A;  4I0U A;  3CQG B;  3ZCI A;  2LKH A;  2MBG A;  4JEU B;  2ZM0 A;  3KIN B;  3PE0 A;  4LML A;  3NZQ A;  4G63 A;  3SWH A;  5IUX A;  4GKK T;  2UXD T;  5LA6 E;  1U4Q A;  1KNP A;  2WAU A;  3DP7 A;  3EHZ A;  4BA9 A;  2D0T A;  3QK6 A;  1AJ3 A;  3J9X 1;  5HEJ A;  2DNX A;  2XM2 A;  1W0B A;  3AEE A;  1T7S A;  2VKD A;  2PFV A;  1D1A A;  3LDQ B;  2QYW A;  1DU2 A;  2WY2 A;  2LSI A;  5HWX A;  2GK9 A;  1VOM A;  2Y48 B;  4NPP A;  2FJB A;  4GK0 E;  4C91 A;  3T8O A;  4A98 A;  3UU8 A;  3ZMV B;  4PFP A;  1XMQ T;  1XNR T;  4HWI B;  4X66 T;  2K48 A;  4ILU A;  2FBW A;  4A56 A;  3E08 A;  5CB4 E;  4UVC B;  4C90 A;  3HL6 A;  3JAD A;  5LJN A;  3ZT5 A;  1LVK A;  3CWZ B;  3NZP A;  4PJN A;  3FZL B;  5AQS B;  1FIO A;  3VU7 H;  5AQP B;  4E7S A;  5L3C B;  2HH7 A;  3E22 E;  4ZEY A;  3AAA B;  1V9D A;  5CA0 E;  5E0O A;  2JRK A;  3F57 A;  3QB5 K;  4G2A A;  2YDQ A;  3X1D A;  4ZI2 D;  3RQW A;  5LXT E;  3RH3 A;  2CBJ A;  2RP4 A;  3L3P A;  1YD8 G;  3AVS A;  2UUA T;  4U72 A;  4AQG A;  1R8I A;  4QKN A;  5H6R B;  3UU6 A;  3CX7 B;  3N9L A;  5C2T A;  3SOL A;  5ADX L;  4ZXL A;  5ABE A;  4UEL A;  5HCJ A;  2XQ4 A;  3T1Y T;  4GKJ T;  5HXR A;  1HX1 B;  3ZJ1 A;  5AQT B;  3RI5 A;  4IE0 A;  2CHO A;  5L3D B;  5HXE A;  2W61 A;  2IDO B;  4TWD A;  2PTF A;  2W00 A;  4X64 T;  1D1B A;  2MAW A;  4XBF B;  2H7O A;  4LF8 T;  2OA5 A;  4MHC A;  4X20 E;  4EXT A;  2AE9 A;  1NEK A;  2CXL A;  2LEH A;  2LHN A;  2XQ8 A;  2M6B A;  4U2Y A;  4IDN A;  2L8K A;  4YSY A;  2DL1 A;  3CK6 A;  5TAO A;  3UU3 A;  3UUB A;  4COF A;  3J7Y q;  2ACX A;  3EI0 A;  4YJ3 E;  3UUL A;  3AE3 A;  2CM0 A;  5EK4 A;  1J5E T;  2CE7 A;  2DHR A;  2J4G A;  3PU3 A;  4DVD A;  1SE7 A;  2DI4 A;  2R6G F;  3BK9 A;  3NKZ A;  2V6Y B;  3PUS A;  4WBO A;  5EZY E;  3ETV A;  3BQK A;  2KWH A;  5FY0 A;  5LG3 A;  4JV5 T;  3P4S A;  3C51 A;  1ZEE A;  1OED B;  3IBP A;  5LGU B;  4P0A A;  4MBQ A;  4B3T T;  3ZMU B;  4K0U A;  1X79 A;  3KDS E;  3K1S A;  4GOU A;  4WNK A;  2YKS A;  4CN4 A;  2RPA A;  5J2T E;  2OLT A;  1HTJ F;  1BR1 A;  4ZOL E;  3VRA A;  3IF8 B;  3PU8 A;  3Q9D A;  3HR0 A;  2BDE A;  1O3X A;  3K3Q C;  4IT4 A;  4L0R A;  4UXN B;  2CWO A;  2WSS V;  5AQN B;  2VK9 A;  2ODV A;  4AKI A;  4I55 E;  3I9Y A;  5IYZ E;  5JR9 B;  1Y01 A;  4ZI2 C;  2DWG A;  2J47 A;  4HE8 A;  3LK4 2;  2B1E A;  2CRB A;  4PJJ A;  4O4H E;  2PBI A;  2CWY A;  2LLY A;  2X0H A;  3NWI A;  2ES0 A;  4P09 A;  3P4P A;  2VVN A;  4DR4 T;  2QVA A;  4LFB T;  4YLH A;  5HEU A;  5FL0 A;  3JC6 D;  3GN5 A;  1JNR A;  3P7I A;  2BBH A;  3PDY A;  3AE8 A;  4IDQ A;  4M1P A;  5KX5 E;  3IA3 A;  1HNX T;  1S35 A;  2LOP A;  1XDO A;  3VRB A;  2JQH A;  1XMO T;  4U74 A;  2V6Y A;  2VQF T;  4HWD A;  4OX9 T;  2XQ7 A;  4HTE A;  5AQK B;  4EYY R;  5LNK A;  2LT3 A;  5IWA T;  2FUP A;  1UUR A;  2HN2 A;  4YY3 T;  2C5K T;  5IHY A;  5JRC B;  3ZYL A;  2UXC T;  4TNV A;  1ZKE A;  2EHO A;  1HF8 A;  5AQG B;  2XQ9 A;  3O1H A;  3RYI E;  2PG8 A;  3ZCJ A;  3ZT7 A;  4DR6 T;  4UR9 A;  5KMG P;  2LRK A;  3PUA A;  3MAC A;  3VHL A;  2LE8 A;  3PV0 F;  5CA1 E;  2WZI A;  2VKO A;  4GYS A;  5H6Q B;  5L2L A;  2Z6E A;  4EOZ B;  3RYH E;  2HPL A;  1QLB A;  3I0O A;  2MOZ A;  2XSA A;  3N9O A;  2V6X A;  5JR9 A;  4CI2 B;  2WB5 A;  2IC9 A;  5FKY A;  4CZZ B;  5J0Z A;  4KBM B;  1WCR A;  1XDP A;  3CML A;  3KV5 A;  2VKJ A;  5EK2 A;  3I1A A;  2CBI A;  4DO0 A;  1I6Z A;  1I94 T;  2XHE B;  3RIA A;  5AQJ B;  5LMN T;  2WWV A;  4B3S T;  2X9Y A;  2W67 A;  2DCF A;  4PK5 A;  4TNW A;  2NTX A;  2UXX B;  3RYC E;  3AE6 A;  3ANW A;  2W66 A;  5AQU B;  3SS1 A;  5AQF B;  2CLY B;  2K5B B;  2V26 A;  2H89 A;  3UUN A;  4FJO A;  1H7C A;  4I4T E;  1X9B A;  3CQC B;  2XQ6 A;  1T8B A;  2FJA A;  2QA7 A;  4U31 A;  2X68 A;  4I43 B;  3UFE A;  2XM1 A;  4AQY T;  3QUJ A;  2V7I A;  3QC9 A;  2PJQ A;  4LF6 T;  4JI0 T;  2AXD S;  1MIV A;  3NRX A;  3N2O A;  1KEY A;  3FBZ A;  3AA6 B;  2IW5 B;  2UXN B;  2EHO C;  2WU2 A;  4QH5 A;  1E2A A;  4JI2 T;  3ZC1 A;  5CGM A;  5F3J A;  2SPC A;  5L4E A;  5LJM A;  4GIW A;  2HPJ A;  2CPT A;  4KI0 F;  2CXD A;  4H63 H;  4LMJ A;  5LGN B;  3PUV F;  4AXP A;  2YEV C;  2KND A;  3RQU A;  2XAQ B;  3R84 B;  3M65 A;  4ZZC A;  3M3Z B;  3AEF A;  1OED C;  1OWA A;  1IBK T;  2N9D A;  1WR6 A;  1GQE A;  3PUR A;  1ZOY A;  4XAX B;  4PW8 A;  4HFE A;  2Q9Q D;  1U5P A;  4QXC B;  1BR4 A;  2ZM8 A;  3L8R A;  5C3J A;  5JQG E;  1CHU A;  3H3M A;  3K3N A;  3FZF B;  3H3A A;  4WW0 A;  2ZM6 T;  2BS2 A;  4ILB A;  4HN9 A;  5LOV E;  3RIU C;  4BJM A;  5CFB A;  1MIW A;  3KBT A;  2Q9Q B;  3C64 A;  2N1G A;  3Q5X A;  3ZKR A;  3HKC E;  2IUB A;  3OKQ A;  1SA0 E;  4ERR A;  3MJX A;  1J1J A;  4GK5 E;  2KT9 A;  3B5M A;  2K24 A;  4GYR A;  3ZST A;  3AAE B;  2EHO D;  3GMI A;  2WP9 A;  4WYV A;  4JI5 T;  5AFU L;  1HNW T;  3C4X A;  3KFW X;  3FXE B;  1OED A;  2NWB A;  4ZI7 E;  2V7K A;  4AIS A;  2P9B A;  4HKA A;  4Q25 A;  4YJ2 E;  2B76 A;  1IJ6 A;  3ZJ2 A;  1WR0 A;  1US7 B;  2VWA A;  2ZM2 A;  3OBV E;  4DR5 T;  4YHH T;  2BKP A;  2IHR 1;  4X1Y E;  1N36 T;  3TLU A;  3LBX B;  5AQO B;  3UTK A;  4H63 V;  2MTQ A;  3ESL A;  3OPC A;  4KUM B;  4U33 A;  2D5U A;  1YKE B;  4LFC T;  5JDH A;  4QX7 B;  5HXC A;  1Z8U A;  5LGT B;  4DUY T;  5J2U E;  3QNU A;  1T98 A;  3AEA A;  1FMW A;  5JDQ A;  3OYX A;  1HG5 A;  5DQV A;  3AAI A;  4DV4 T;  4OHF A;  4IDZ A;  3IEE A;  3HI2 A;  1FEW A;  2L3L A;  2VKH A;  5L3F B;  2KMF A;  3U78 A;  1NEN A;  4IDP A;  4QX8 B;  4QWN B;  4UVA B;  5LYJ E;  2D0U A;  3AE7 A;  1E1H B;  5KDM C;  4DR2 T;  3UT5 E;  2X9H A;  4U2Z A;  4PJL A;  3D0T A;  1NWM X;  4IE7 A;  1ZP0 A;  2FJE A;  2W0G A;  3HKE E;  4PK6 A;  4UV9 B;  4JUY A;  3ZPO A;  2I0M A;  2LSJ A;  4EED A;  2YIN A;  4O2A E;  4YTN A;  3UUM A;  4XZC A;  3CKD A;  1YQ4 A;  2BG9 B;  2WCA A;  2WBL A;  3ONL C;  1D1C A;  3P8C D;  3PJA A;  5CJ5 A;  2MYS A;  2KIN B;  3LBX A;  3AA0 B;  3UUX B;  5JDG A;  3ZLI A;  2BS3 A;  1OXZ A;  2E5V A;  2E9X A;  5FY1 A;  3F31 A;  4KHZ F;  4TV9 E;  3MK7 C;  4X5T A;  2XZE A;  4DBQ A;  1SHZ C;  1M62 A;  2KLQ A;  1FJG T;  1WYB A;  1KNR A;  2KXP B;  2YU1 A;  4UF0 A;  2WQY A;  3UQ7 A;  3ZYM A;  4EGW A;  1MMN A;  5FXZ A;  3UU4 A;  1ZV4 X;  3LK2 B;  2CMR A;  1HG2 A;  4IE4 A;  4IL9 A;  4H9P C;  5F5W A;  3U3I A;  1QSD A;  3O4X E;  1IBM T;  1JNZ A;  2W62 A;  5HXS A;  2E2A A;  3AEG A;  3P4W A;  2VUR A;  2V1D B;  5FXW A;  3RC3 A;  2V7J A;  1UX5 A;  4YTM A;  4DV6 T;  1HCI A;  5A1L A;  3LJC A;  1UK5 A;  4KX6 A;  4X65 T;  1MMG A;  2XAG B;  3P4Q A;  4HEA A;  3SFD A;  4KP3 C;  2IIU A;  3SRZ A;  1MIY A;  4H9O C;  5JDM A;  3O9X A;  2ODU A;  4HFV A;  3RKG A;  4IE6 A;  3V5U A;  5ABF A;  4FI5 A;  4OYK A;  3EDV A;  2HHH T;  2XPK A;  4NIQ A;  4ASK A;  2YK0 A;  4H9R C;  5FYM A;  5AQH B;  4MFR A;  2X0L B;  5HEH A;  3RX6 A;  1Z0P A;  2H88 A;  2Q9Q C;  1IAP A;  3KV9 A;  4A5X A;  3AE4 A;  4EV6 A;  4AKR B;  3ZMZ B;  4JEH B;  2BKN A;  3AB3 B;  5JR9 C;  4J2C A;  5JRC A;  1E7P A;  2YDR A;  2IAK A;  3N9M A;  2QGS A;  3AE2 A;  5LHH B;  2BG9 E;  4TUY E;  2NW7 A;  2WWU A;  3ZN0 B;  4ZHQ E;  4JI4 T;  2C5J A;  4KHP T;  4DND A;  4YFS A;  5DQW A;  3N9N A;  4PFO A;  2NW9 A;  1HX8 A;  4TV8 E;  5JDL A;  1HFA A;  1UGO A;  2A9U A;  3EAM A;  2LJL A;  2VQE T;  4AKH A;  2KWI B;  2Q9Q A;  3C98 B;  3PUQ A;  5FP3 A;  2CHN A;  5LP6 E;  3VR8 A;  4L5G A;  4TX5 A;  3UFG A;  2V5D A;  5FVL A;  5ABH A;  4AI6 A;  4LF9 T;  2XY8 B;  1UUS A;  1YXR A;  3N5L A;  2W63 A;  4EZH A;  3Q5D A;  3JC6 C;  3BQL A;  1KF6 A;  1J5W A;  4U7Y A;  1YW0 A;  4V1A v;  4NXN T;  3AE1 A;  4PNI A;  5JTG A;  2DWK A;  1KFY A;  2YDS A;  3ANW B;  3G06 A;  4O2B E;  3R6N A;  3RYF E;  4WBN E;  1HS7 A;  4DMV A;  5L3E B;  2UUB T;  3VKH A;  2VL0 A;  4AKL A;  3PUW F;  3ONX A;  4UIG A;  3ZYK A;  4EYU A;  4TWF A;  4ISS A;  2XQ5 A;  3KVB A;  3TLT A;  3FHN A;  4ZI3 D;  1XZY A;  4L9I A;  4BAY B;  4X1I E;  5LBM A;  2MPK A;  3TLS A;  3CQX C;  2E9X D;  3RRC A;  2LHR A;  3FB2 A;  2LSK A;  4IIJ E;  4ADZ A;  1D0X A;  5FL1 A;  1LVF A;  5LHI B;  2BG9 C;  2QRX A;  2K9A A;  5LBQ B;  4QH1 A;  3CVR A;  2YN6 A;  2FJD A;  3AEB A;  5EK3 A;  4H9N C;  4OYJ A;  4CN1 A;  2XUE A;  5FNV E;  4YSZ A;  3AEC A;  3N2K E;  4YT0 A;  2F4V T;  5LG4 A;  2KZ7 B;  2X9X A;  3FZH B;  2VB6 A;  1MNE A;  2CXF A;  2LSY A;  5HEG A;  3AXJ B;  2LKG A;  3L39 A;  3AVR A;  1W9R A;  3RF1 A;  3KV4 A;  3W15 B;  3JAF A;  2XQ3 A;  3KVA A;  2A2F X;  1XNQ T;  4TZ4 C;  4K0K T;  2IML A;  4I50 E;  4O4I E;  3NBX X;  3ZSS A;  2BS4 A;  1G73 A;  2BG9 A;  2C0S A;  2WZH A;  4P0B A;  2JPF A;  4QXB B;  4P1N A;  3MKD A;  2D2S A;  3CX6 B;  5LCY A;  3RIF A;  4TN7 B;  5HYA A;  4DV3 T;  2W2U A;  4CI1 B;  1UCU A;  2C5I T;  2JMK A;  1BR0 A;  2JMH A;  5JH7 E;  2VAS A;  3P50 A;  4HFD A;  4JI1 T;  1MMA A;  4CXY A;  4MLK A;  3OYZ A;  3UU5 A;  4IDO A;  2JQK A;  3JAE A;  4JBW F;  1N32 T;  4LMK A;  3VKG A;  2LSG A;  3AED A;  4DR1 T;  4B6X A;  3ETU A;  4N78 D;  1KNZ A;  4ZI3 C;  2V8S V;  4CXW A;  1CUN A;  4F6R C;  2YU2 A;  2DLR A;  5M4Y A;  4AKG A;  4CQI A;  2V7L A;  2XAH B;  3CPZ A;  3A8Y C;  2NOX A;  3EUH A;  3H37 A;  1WYC A;  3WI3 A;  4EIW A;  2N2N A;  2A3D A;  1FMV A;  3RIU A;  3RRW A;  4EB6 E;  2X51 A;  4PJM A;  4QHO A;  5JDF A;  2WDR A;  3I9W A;  5JRE A;  1VCS A;  3LFM A;  3O1J A;  2J1D G;  5HCM A;  3K3O A;  2EHO B;  1IJ5 A;  1MND A;  1NAF A;  2I6H A;  2RA1 A;  1N33 T;  3GA8 A;  5L4H A;  3N2G E;  4HWC A;  4ANJ A;  1YKH B;  3AE9 A;  1N34 T;  2BVM A;  2I59 A;  1WFD A;  2Y8D A;  4HFH A;  5ETW A;  4YSX A;  1UX4 A;  1B7T A;  3Q5W A;  2BBJ A;  4HWH A;  4NUU A;  4ZS2 A;  3RPU A;  4Z91 A;  4OK0 A;  4IHJ E;  5HXH A;  3C50 A;  4A97 A;  2V7M A;  2X0Y A;  3ZC0 A;  3N9Q A;  2CEA A;  1VCT A;  2LM2 A;  4JYA T;  3OTO T;  3ZMS B;  1D0Y A;  1QUU A;  2WMN A;  5LB7 B;  3AA1 B;  1WLX A;  5JDN A;  5L3G B;  3A5X A;  5BR8 T;  3P4R A;  4PK4 A;  2W4X A;  1EZ3 A;  3DTO A;  2WMO A;  3Q2M A;  4H9S E;  3RLF F;  3WAK A;  4U3C A;  3RKO A;  3UQ4 A;  3MZK B;  2X67 A;  4IST A;  2VL8 A;  5AQR B;  5AQQ B;  3JCF A;  4BJN A;  2H7V C;  2WDV A;  4CI3 B;  3Q5E A;  4CN6 A;  5FXX A;  2UU9 T;  2XTL A;  2L9Q A;  2LOS A;  2LRL A;  3PUY F;  3BQI A;  4IGU A;  5AQM B;  4Z90 A;  3TLV A;  4DID B;  5ABG A;  4DBR A;  4DR7 T;  4IE5 A;  2NP9 A;  3HKB E;  2UUC T;  3GWH A;  5AQV B;  2M6I A;  4CXX A;  4NXM T;  5L3B B;  3EAB A;  2XAJ B;  2ACZ A;  4ZZB A;  3T1H T;  1S94 A;  2JIW A;  2Y6X A;  3B57 A;  2CLY C;  1ZHC A;  4MAL A;  4NUV A;  2WM9 A;  5BMV E;  4JI3 T;  4U7I A;  3OVU A;  4JLE A;  2LM9 A;  3K8P C;  4O8S A;  5DAB A;  4YTP A;  1HNZ T;  3RC8 A;  1LRZ A;  3EVY A;  4ILC A;  2XSB A;  3ZT6 A;  4LFA T;  4IL4 A;  4B3M T;  5LHG B;  2E8I A;  2D9D A;  4HFC A;  2M67 A; 
#chains in the Genus database with same CATH homology
 2LRK A;  3ZT5 A;  4U3C A;  4U2Y A;  2DL1 A;  4P1N A;  4U2Z A;  4WZX A;  2CRB A;  4ZEY A;  5CGM A;  2W2U A;  4CN6 A;  2MPK A;  2V6X A;  1WR0 A;  2CPT A;  2LRL A;  2A9U A;  1WFD A;  2V6Y B;  1WCR A;  4CN1 A;  5CJ5 A;  2JQH A;  2JQK A;  2WY2 A;  2V6Y A;  3EAB A;  4U33 A;  2JQ9 A;  5FVL A;  2WWV A;  4NIQ A;  1YXR A;  5FVK A;  3ZST A;  2XZE A;  3K1S A;  4U7Y A;  4A5X A;  4U7I A;  4CN4 A;  5LB7 B;  2RPA A;  2K3W A;  4U31 A;  3ZT6 A;  3ZT7 A;  4IT4 A;  3ZSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...