2JQ9A

Vps4a mit-chmp1a complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
71
structure length
71
Chain Sequence
TLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associating protein 4A
total genus 31
structure length 71
sequence length 71
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jq9A00
2RPAA 4U33A 4NIQA 1WR0A 2LRLA 2LRKA 2WWVA 2A9UA 2CPTA 2K3WA 4ZEYA 4WZXA 3ZSTA 1WCRA 2W2UA 3ZT7A 2V6YA 4A5XA 2WY2A 2JQ9A 5CJ5A 4U3CA 3ZSSA 2JQHA 4IT4A 4U31A 1WFDA 2CRBA 3ZT5A 2JQKA 4CN1A 4U2YA 2DL1A 2XZEA 2V6YB 4P1NA 4U2ZA 5FVKA 3K1SA 5FVLA 3EABA 3ZT6A 4CN6A 2MPKA 2V6XA 1YXRA 4U7IA 4CN4A 5LB7B 4U7YA 5CGMA
chains in the Genus database with same CATH superfamily
2H7OA 2IC6A 3PURA 2LHRA 5JDMA 2XQ7A 1XDPA 4N78D 4ILBA 2CA5A 2BG9A 4B3TT 3A5XA 4X65T 3AAAB 4DR4T 4IDNA 5ABFA 4PW8A 1HTJF 1UCUA 2KXPB 5IUXA 2LE8A 5HXHA 3QNUA 5CJ5A 2DNXA 4Q25A 4IGUA 4AQYT 1M62A 4U31A 3HKEE 5L3FB 2L8KA 4JI8T 4Z8XA 3LG7A 4DVDA 5HEUA 2LOSA 4TNVA 2BKOA 3ZYMA 2BG9E 2WU5A 3FZFB 2XQ8A 5AQTB 3ZT6A 5FXXA 1S35A 4PK6A 1LKXA 4JI7T 4NUVA 4IDQA 2FJEA 2PFVA 3AA7B 3E0ZA 3MK7C 2H89A 3VR8A 5DQVA 5JVDE 4DV4T 3ZMUB 1FJGT 1FMVA 2D9DA 3CPZA 3RLFF 3N2OA 4HFEA 2VURA 1CHUA 3P7IA 4NIQA 2OV9A 5HYAA 2QGSA 2Q9QC 1IJ5A 1MIVA 3FXEB 4IE0A 1KK7A 3HKBE 4MALA 2X0LB 2YDSA 4CZZB 5AFUL 2CCQA 3ZN1B 5J2TE 3AAEB 2V7LA 2Z6EA 2V5CA 2AE9A 3Q5XA 2E9XC 1LVKA 2QA7A 3EVYA 4DNDA 5J0ZA 1US7B 1KNZA 2FUPA 3RC3A 2IHR1 5HXRA 1MMGA 4B3ST 1AJ3A 1OEDB 1IBLT 5L4EA 2LSJA 3KVBA 3LDQB 1UUSA 5ABFB 1EZ3A 3AEBA 2BS3A 3I1AA 3SS1A 4QXCB 4DR3T 3N9LA 3AE9A 3F57A 1HCIA 3AB3B 4P09A 2LHNA 4BAYB 4YT0A 2ODUA 4NUUA 3C51A 4YSYA 5JDHA 2B76A 2VB6A 4OHFA 1E2AA 2L9QA 2LKHA 2RPAA 3NRXA 4IE7A 4QXHB 4U33A 5L3DB 2LT3A 1SE7A 2ACZA 3M65A 4O2BE 5LNKA 5CA1E 4CXWA 3PU3A 5LMNT 2PTFA 4ZI3C 4E7ZA 1SUMB 3B57A 2I59A 3I9WA 2V26A 3HL6A 3TLSA 4DR7T 2JRKA 2NOXA 5HWXA 2ZM8A 4WNKA 5AQHB 3ZN0B 4U3CA 2XQ4A 3GN5B 1J5ET 4OFZA 5LOVE 4LF9T 1T72A 1ZV4X 3AXJB 3ZT5A 1U4QA 2F4VT 5C8YE 3C64A 4AKGA 2HN2A 2MAWA 3UU5A 3ZC0A 1UX5A 1W0BA 2DI4A 3RX6A 3PUWF 3TLTA 3RKOA 4CQIA 3EABA 4ZI3D 1XWMA 2E9XB 1IBMT 4P0BA 4QX8B 2VVNA 2W4XA 4GK5E 3JADA 3QK6A 5LBQB 2WS3A 1OEDA 3PJAJ 3ZMTB 4UXNB 3U78A 4IDOA 2LSGA 4G2AA 1X79A 2FJDA 3SOLA 4C90A 2Q9QB 2X9YA 2W63A 3N9PA 1N33T 1YW0A 2NWBA 2XAFB 3ZJ1A 2WDRA 2YDRA 3U3IA 3VRAA 4X1IE 4DO0A 1ZP0A 3LBXB 4QH5A 2FBWA 1UK5A 4LFAT 4X64T 4Z90A 3PV0F 3TLVA 1Y64B 2XQYA 5ABGA 3SRZA 2KLQA 2HPJA 4I55E 3L39A 4FJOA 4UF0B 1ZHCA 2M6IA 3ZLIA 3ONLC 1BR2A 1KEYA 4ASKA 3CIRA 1VCSA 4ZI2D 3ANWB 3C4XA 4JI2T 2JQKA 4XAXB 2YU2A 3DTOA 3ZMZB 3AE6A 3K3OA 3N5LA 1FEWA 3AA1B 4UV8B 2V1DB 1HG5A 4PFPA 2XAQB 3K3QC 4DIDB 3AE2A 3N9QA 2PG8A 4JI0T 2CHNA 2NP9A 4UIGA 5L3EB 2X9HA 2HN1A 4DV2T 5FXVA 2BG9B 4YTMA 1V9DA 3M3ZB 4DV6T 3BQLA 3LJCA 3P4PA 4K0UA 4PJLA 3SFDA 3WI3A 2KZ7B 2BZBA 4JI4T 4TV8E 5H6QB 1CUNA 4JEHB 1QLBA 5AQQB 1MMDA 2E5VA 2KMFA 2VKJA 2V6YA 2XQ6A 1Y01A 3HKCE 4A5XA 4GKJT 4JV5T 4PJMA 4U74A 4AISA 1N36T 2UUCT 4CI2B 4EEDA 3RRCA 1DU2A 4YXDA 4LMKA 2LM2A 2ES0A 5LCYA 3UUXB 3ONJA 2W66A 2YU1A 4LMJA 4DBQA 4CXYA 2HHHT 4AI6A 4QH1A 5KMGP 2BBJA 5JR9B 4U2ZA 2X68A 4YLHA 4MFRA 4O4JE 3ZCJA 3CVRA 2WZHA 4DR1T 2D0UA 2JPFA 3OVUA 2E9XD 3F2EA 5JREA 4CI1B 1MIYA 4WBOA 4HGAA 5IHYA 2WDQA 1WLXA 3A8YC 3D0TA 3KV4A 5JDNA 1SA0E 3ETVA 3GN5A 3LK42 4EZ4A 4ILCA 3CQXC 3UTKA 4H63V 2WWVA 3FBZA 5CA0E 5J2UE 2CLYB 3P4RA 4DV0T 3OBVE 4TX5A 4JEUB 5FKYA 2D0TA 4PK5A 3ZT7A 1IJ6A 5LGTB 3AE3A 3AE5A 4H63H 5JQGE 4B3RT 2IIUA 3LSVA 2SPCA 1OEDE 2HH7A 4GK0E 3R84B 4F8HA 4DUYT 5H6RB 1T8BA 3ZSSA 5CFBA 1X9BA 5BR8T 2FJAA 4ZI2C 2N9DA 5LHGB 4HKAA 2H7VC 3KBUA 3PUXF 4X20E 2D2SA 3B5MA 4XZCA 4PJNA 2LOPA 2V6YB 2I0MA 3MJXA 3ZCIA 5L3BB 4YSXA 5LBMA 2VKOA 3FB2A 3RC8A 3BK9A 4LFBT 5JDLA 4HWCA 4QHOA 1NENA 4KX6A 3R6NA 4CN4A 4A97A 4AQGA 5HXEA 4KI0F 5ABEA 4TN7B 2BKNA 3RHWA 3N2GE 5JDGA 2LSYA 4IE4A 3LK2B 4TV9E 5EK3A 3T8OA 2XSAA 1G8XA 5JTGA 2VKDA 3RQWA 3PUVF 2XPKA 4MBQA 4PFOA 2JQQA 4EOZB 5AQVB 3PUSA 3LK3B 5L3CB 4WW0A 1NWMX 3H3AA 4O4IE 3BQKA 4C91A 3NZQA 4YY3T 3EAMA 2V7KA 3ABVA 3CWZB 2XQ5A 3IF8B 4GIWA 4IE5A 4I4TE 4AKLA 1FMWA 4DR5T 4AKIA 3SFEA 5L3GB 4IDZA 4OX9T 4H9RC 5LYJE 4CN1A 5HXSA 2X67A 4JYAT 1QUUA 4KBMB 3K1SA 4Z91A 1WRDA 5LXTE 3QB5A 3OYXA 3OYZA 3MZKB 2G0UA 3IBPA 3RQUA 3ZC1A 2WP9A 3C98B 1WYCA 2NW8A 3JAEA 4HN9A 4MLKA 3UU3A 2CBIA 2Q9QA 3PTRB 2KWHA 4B3MT 3RYIE 2PJQA 4U7YA 2WZIA 3OTOT 1WR6A 1OEDC 2L3LA 4HE8A 2XQ9A 2CLYC 2JMHA 2XJ7A 3FZHB 3AEGA 2UXNB 4O4LE 3IEEA 4NXNT 2K24A 2YK0A 1KNPA 4TUYE 3NWIA 1U5PA 4KUMB 1HR0T 4WZXA 2ZM0A 5HEJA 4X66T 1D1BA 2BVMA 2CE7A 5AQLB 5AQGB 5F3JA 2R6GF 3HA4A 2LLYA 3PU8A 4UELA 2WDVA 3GWHA 2J1DG 4HFHA 4YJ3E 4I43B 2CRBA 3AE1A 3QOFA 4COFA 4YSZA 3N2KE 2NW7A 2MTQA 5DQWA 1HNZT 1D0XA 1ZEEA 2IDOB 1HNWT 5FVKA 3VRBA 4LF5T 2XUEA 4J2CA 2XAGB 4E7SA 5L2LA 4DV1T 2BDEA 2MPKA 4LF7T 4XBFB 5A1LA 5ADXL 3CK6A 2UU9T 5FYMA 4EV6A 3P4SA 4PK4A 3T1HT 3GA8A 2RP4A 3EI0A 3NZPA 3WAJA 4WYVA 4O4HE 5AQRB 3CMLA 4HWFA 5KDMC 3AE7A 4KMCA 5F8PA 5FP3A 1N34T 4JI1T 3P4QA 5AQKB 5LHHB 3HKDE 4JI5T 5AQMB 3L8RA 3RYFE 1W9RA 2JMKA 5LGNB 5FL1A 2BKPA 4LF8T 1WCRA 2VL0A 1T98A 2W2UA 1YD8G 3LBXA 2YEVC 4ISSA 5DJQC 3RIAA 4EXTA 5BMVE 2J47A 1J1JA 1I94T 4YFSA 2UXCT 1KF6A 5LG4A 4DMVA 3VKGA 1MNEA 2XM1A 3N9OA 4GYSA 3UU4A 1W0AA 4GOUA 4AIUA 3ANWA 4EYYR 3FBLA 1YQ3A 2H88A 4IDPA 3RI5A 3Q5WA 1HFAA 2A72A 1MIWA 2UXBT 2Y6XA 3AECA 1H7CA 4H9QC 3KINB 4CN6A 4PJJA 4H9SE 2V6XA 4OYJA 5FL0A 3OKQA 5ABHA 2K48A 1MMAA 1XZYA 2BG9C 4O8SA 3AXJA 2UXXB 2WBLA 3EHZA 1KNRA 3C50A 3B13A 4H9NC 4MHCA 4YHJA 5HEGA 5EK2A 1HS7A 2WQYA 3PE0A 3IHRA 1XDOA 2N1GA 2LSKA 2WMNA 1WYBA 3O1IA 4UVAB 5AQOB 1GQEA 4HWHA 3AVRA 5C2TA 1ZOYA 3MXZA 4DBRA 5JR9A 2BVLA 2WB5A 3AEEA 2VK9A 4IE6A 2XM2A 2X51A 3OPCA 2JQ9A 3MKDA 3MACA 4AKRB 3HR0A 4JUYA 3CKDA 5HXCA 3RPUA 3TKLB 4EB6E 4EAHA 3FZLB 2YKSA 5FY1A 3H3MA 2PBIA 5AQIB 4P1NA 3L09A 3CQGB 2LKGA 5C3JA 3I0QA 2V7JA 4L5GA 2H3RA 3PUGA 4P0AA 1J5WA 1UGOA 3KVAA 1HX1B 2CMRA 5AQPB 5HAXA 2WU2A 4YTPA 1M7KA 3OJAA 3P4WA 1LRZA 3VHLA 2C5KT 2CXDA 2IAKA 2LM9A 2UXDT 4BA9A 2GK9A 3V5UA 1NAFA 2V5DA 4PNIA 3ZSTA 4DMWA 5KXJA 2DWKA 4EGWA 1XMQT 2CEAA 2KWIB 2V7IA 2M67A 2XAJB 1VRBA 3JCFA 4X1YE 2XQAA 1YQ4A 4IT4A 1VCTA 3ZKRA 4GYRA 1UX4A 4DV7T 2QVAA 2ZLYA 2X0HA 3O4XE 5DABA 4QXBB 4ISTA 4U2YA 3W15B 5JRCB 4KHZF 3SWHA 3K3NA 2P9BA 5IYZE 2VWAA 3N9MA 2KNDA 2KINB 2VQFT 1W09A 2ODVA 1D0YA 1D1CA 2MOZA 3S4UA 3UFGA 5FNVE 3TLUA 5LHIB 2MYSA 3RYHE 2VVSA 3I9YA 2M6BA 3ZYKA 1R8IA 4TWHA 2W0GA 4OK0A 5ETWA 3P8CD 4YHHT 5GONE 1WR0A 4FI5A 1JNRA 2LRLA 3V5SA 2XSBA 4UVCB 2JJ9A 2IW5B 3PUQA 1ZKEA 4QX7B 5M4YA 1XNRT 3N9NA 1BR0A 2LSIA 1O3XA 4AQFC 3BQIA 2YINA 4K0KT 5AQJB 1BR4A 3P50A 3C4WA 1LVFA 2WY2A 4G63A 4O2AE 3T1YT 3ESLA 5L4HA 4EIWA 4ZZBA 4B6XA 2K9AA 3JC6D 1NEKA 2E8IA 3UUNA 4AXPA 4BJMA 3UQ7A 2IC9A 2XHEB 3EDUA 2QYWA 2NTYA 2ZM2A 5FY0A 5FY7A 1XMOT 4WBNE 2XZEA 4X62T 3WAKA 3PUAA 2QRXA 4NXMT 2X9XA 4ZXLA 3UU8A 1QSDA 3O1HA 3KV9A 2B1EA 2CWOA 2XASB 3Q9DA 4BJNA 5AQFB 3AA6B 2VQET 1B7TA 2E2AA 2J62A 3AE4A 4ERRA 2NTXA 1E1HB 4LF4T 2LEHA 3KV5A 3QC9A 2ACXA 2XQ3A 2KSRA 5HCJA 5JDQA 2IUBA 3NRYA 4LF6T 4DV5T 3KDSE 4HFBA 3AE8A 3G06A 4LMLA 2VASA 2CXLA 2X0YA 3FZMB 4M1PA 5HEHA 4AQFA 4YTNA 2DHRA 3PUZF 4HFVA 2EHOC 4TZ4C 1BR1A 2V7MA 3QUJA 4H9PC 2MBGA 4EEBA 3KFWX 2A3DA 1D0ZA 3Q5DA 4CI3B 5F5WA 5FXZA 4IL4A 1VOMA 4JBWF 4ZZCA 3CX7B 2C5JA 2C5IT 3RIFA 3TLWA 1G73A 2DWGA 3J7Yq 2X9WA 2BS4A 5AQNB 1YKEB 3RIUA 1D1AA 2E5LT 3RGLA 4IHJE 3AEFA 4PAGA 3GMIA 3FXDB 4JLEA 5JDFA 4U7IA 1UURA 3ZJ2A 5JRCA 2EHOD 2J4GA 2XY8B 5LGUB 1XNQT 2CM0A 1OWAA 5LJNA 2CWYA 2EHOB 4UV9B 3HI2A 5CGMA 4ILAA 2Y48B 5TAOA 1N32T 3Q5EA 2AXDS 4JI6T 2RA1A 5AQSB 2LRKA 2WMOA 3I0OA 3Q2MA 5J1GA 3UQ4A 4H9OC 4EZHA 4HFDA 1IBKT 2VKHA 4I50E 4ZOLE 3UUMA 3VU7H 3CX8B 3AA0B 4ZS3A 1E7PA 4HWDA 3RYCE 3AEDA 3JC6C 3AEAA 4TWDA 4AKHA 3UUBA 3F31A 5FXWA 3E22E 3PUYF 1WFDA 4KHPT 5LMUT 4IIJE 3NBXX 3K8PC 2X66A 2A2FX 4NPPA 4A98A 4JI3T 5HCMA 3IA3A 4L9IA 3RIUC 2NW9A 2W67A 4DR6T 1FIOA 1IZNB 2FJBA 4V1Av 3ZYLA 1YXRA 3MA9A 3PJAA 5LB7B 4QWNB 5LJMA 5CB4E 3AVSA 3RRWA 2CHOA 3KBTA 2BBHA 3O9XA 4ANJA 2WSSV 4HTEA 4HFCA 4A56A 5KX5E 1I6ZA 4HEAA 5LG3A 1Z8UA 3ZMSB 3ZPOA 3J9X1 1MNDA 3L3PA 2E9XA 2ZMAA 5AQUB 2HPLA 2WWUA 3DJBA 2K3WA 2VL8A 4F6RC 1T7SA 3ZEFB 3C4ZA 5IWAT 2V8SV 4IREA 4UR9A 2YOEA 5E0OA 3VKHA 3VR9A 3NVOA 4ZI7E 2XTLA 5LP6E 2WCAA 3E08A 2LJLA 3AAIA 4U72A 5LA6E 2CXFA 4ZHQE 2WAUA 1YKHB 4QKNA 2YN6A 2ZM6T 4ILUA 2WM9A 3FHNA 3RKGA 5FVLA 5HEOA 3ZMVB 5EK4A 2XAHB 3ETUA 4EYUA 1L0VA 4KP3C 2NR4A 5L47A 2OLTA 3FZKB 4ADZA 1KFYA 1Z0PA 4DR2T 3RH3A 2W61A 1HF8A 2BS2A 2IMLA 4OYKA 3O1JA 5JR9C 4X5TA 4UEMA 4I0UA 2W00A 3CQCB 3ONXA 2D5UA 4HWIB 4TWFA 3NKZA 2OA5A 5HWYA 1MMNA 2A9UA 2I6HA 2Q9QD 2W62A 4IL9A 3UT5E 2CPTA 3EUHA 4ZEYA 4DUZT 1HNXT 2UUAT 2N2NA 3A7MA 3LFMA 3X1DA 4YJ2E 4ZS2A 4TNWA 1HX8A 3DP7A 2K5BB 2KT9A 4X1KE 2DCFA 2JQHA 3UULA 3CX6B 4L0RA 4UVBB 4GKKT 4QH4A 2EHOA 2DLRA 4CXXA 2DL1A 4HFIA 3QB5K 3KV6A 4DV3T 3RF1A 1SHZC 3UU6A 3H37A 4UF0A 5JH7E 2UUBT 2C0SA 4LFCT 2CBJA 5FMNA 2YDQA 3EDVA 2JIWA 2Y8DA 3PDYA 1JNZA 3JAFA 1S94A 3UFEA 5EZYE 1IAPA 1HG2A 1OXZA
chains in the Genus database with same CATH topology
2RPAA 4U33A 4NIQA 1WR0A 2LRLA 2LRKA 2WWVA 2A9UA 2CPTA 2K3WA 4ZEYA 4WZXA 3ZSTA 1WCRA 2W2UA 3ZT7A 2V6YA 4A5XA 2WY2A 2JQ9A 5CJ5A 4U3CA 3ZSSA 2JQHA 4IT4A 4U31A 1WFDA 2CRBA 3ZT5A 2JQKA 4CN1A 4U2YA 2DL1A 2XZEA 2V6YB 4P1NA 4U2ZA 5FVKA 3K1SA 5FVLA 3EABA 3ZT6A 4CN6A 2MPKA 2V6XA 1YXRA 4U7IA 4CN4A 5LB7B 4U7YA 5CGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPA A;  4U33 A;  4NIQ A;  1WR0 A;  2LRL A;  2LRK A;  2WWV A;  2A9U A;  2CPT A;  2K3W A;  4ZEY A;  4WZX A;  3ZST A;  1WCR A;  2W2U A;  3ZT7 A;  2V6Y A;  4A5X A;  2WY2 A;  2JQ9 A;  5CJ5 A;  4U3C A;  3ZSS A;  2JQH A;  4IT4 A;  4U31 A;  1WFD A;  2CRB A;  3ZT5 A;  2JQK A;  4CN1 A;  4U2Y A;  2DL1 A;  2XZE A;  2V6Y B;  4P1N A;  4U2Z A;  5FVK A;  3K1S A;  5FVL A;  3EAB A;  3ZT6 A;  4CN6 A;  2MPK A;  2V6X A;  1YXR A;  4U7I A;  4CN4 A;  5LB7 B;  4U7Y A;  5CGM A; 
#chains in the Genus database with same CATH topology
 2H7O A;  2IC6 A;  3PUR A;  2LHR A;  5JDM A;  2XQ7 A;  1XDP A;  4N78 D;  4ILB A;  2CA5 A;  2BG9 A;  4B3T T;  3A5X A;  4X65 T;  3AAA B;  4DR4 T;  4IDN A;  5ABF A;  4PW8 A;  1HTJ F;  1UCU A;  2KXP B;  5IUX A;  2LE8 A;  5HXH A;  3QNU A;  5CJ5 A;  2DNX A;  4Q25 A;  4IGU A;  4AQY T;  1M62 A;  4U31 A;  3HKE E;  5L3F B;  2L8K A;  4JI8 T;  4Z8X A;  3LG7 A;  4DVD A;  5HEU A;  2LOS A;  4TNV A;  2BKO A;  3ZYM A;  2BG9 E;  2WU5 A;  3FZF B;  2XQ8 A;  5AQT B;  3ZT6 A;  5FXX A;  1S35 A;  4PK6 A;  1LKX A;  4JI7 T;  4NUV A;  4IDQ A;  2FJE A;  2PFV A;  3AA7 B;  3E0Z A;  3MK7 C;  2H89 A;  3VR8 A;  5DQV A;  5JVD E;  4DV4 T;  3ZMU B;  1FJG T;  1FMV A;  2D9D A;  3CPZ A;  3RLF F;  3N2O A;  4HFE A;  2VUR A;  1CHU A;  3P7I A;  4NIQ A;  2OV9 A;  5HYA A;  2QGS A;  2Q9Q C;  1IJ5 A;  1MIV A;  3FXE B;  4IE0 A;  1KK7 A;  3HKB E;  4MAL A;  2X0L B;  2YDS A;  4CZZ B;  5AFU L;  2CCQ A;  3ZN1 B;  5J2T E;  3AAE B;  2V7L A;  2Z6E A;  2V5C A;  2AE9 A;  3Q5X A;  2E9X C;  1LVK A;  2QA7 A;  3EVY A;  4DND A;  5J0Z A;  1US7 B;  1KNZ A;  2FUP A;  3RC3 A;  2IHR 1;  5HXR A;  1MMG A;  4B3S T;  1AJ3 A;  1OED B;  1IBL T;  5L4E A;  2LSJ A;  3KVB A;  3LDQ B;  1UUS A;  5ABF B;  1EZ3 A;  3AEB A;  2BS3 A;  3I1A A;  3SS1 A;  4QXC B;  4DR3 T;  3N9L A;  3AE9 A;  3F57 A;  1HCI A;  3AB3 B;  4P09 A;  2LHN A;  4BAY B;  4YT0 A;  2ODU A;  4NUU A;  3C51 A;  4YSY A;  5JDH A;  2B76 A;  2VB6 A;  4OHF A;  1E2A A;  2L9Q A;  2LKH A;  2RPA A;  3NRX A;  4IE7 A;  4QXH B;  4U33 A;  5L3D B;  2LT3 A;  1SE7 A;  2ACZ A;  3M65 A;  4O2B E;  5LNK A;  5CA1 E;  4CXW A;  3PU3 A;  5LMN T;  2PTF A;  4ZI3 C;  4E7Z A;  1SUM B;  3B57 A;  2I59 A;  3I9W A;  2V26 A;  3HL6 A;  3TLS A;  4DR7 T;  2JRK A;  2NOX A;  5HWX A;  2ZM8 A;  4WNK A;  5AQH B;  3ZN0 B;  4U3C A;  2XQ4 A;  3GN5 B;  1J5E T;  4OFZ A;  5LOV E;  4LF9 T;  1T72 A;  1ZV4 X;  3AXJ B;  3ZT5 A;  1U4Q A;  2F4V T;  5C8Y E;  3C64 A;  4AKG A;  2HN2 A;  2MAW A;  3UU5 A;  3ZC0 A;  1UX5 A;  1W0B A;  2DI4 A;  3RX6 A;  3PUW F;  3TLT A;  3RKO A;  4CQI A;  3EAB A;  4ZI3 D;  1XWM A;  2E9X B;  1IBM T;  4P0B A;  4QX8 B;  2VVN A;  2W4X A;  4GK5 E;  3JAD A;  3QK6 A;  5LBQ B;  2WS3 A;  1OED A;  3PJA J;  3ZMT B;  4UXN B;  3U78 A;  4IDO A;  2LSG A;  4G2A A;  1X79 A;  2FJD A;  3SOL A;  4C90 A;  2Q9Q B;  2X9Y A;  2W63 A;  3N9P A;  1N33 T;  1YW0 A;  2NWB A;  2XAF B;  3ZJ1 A;  2WDR A;  2YDR A;  3U3I A;  3VRA A;  4X1I E;  4DO0 A;  1ZP0 A;  3LBX B;  4QH5 A;  2FBW A;  1UK5 A;  4LFA T;  4X64 T;  4Z90 A;  3PV0 F;  3TLV A;  1Y64 B;  2XQY A;  5ABG A;  3SRZ A;  2KLQ A;  2HPJ A;  4I55 E;  3L39 A;  4FJO A;  4UF0 B;  1ZHC A;  2M6I A;  3ZLI A;  3ONL C;  1BR2 A;  1KEY A;  4ASK A;  3CIR A;  1VCS A;  4ZI2 D;  3ANW B;  3C4X A;  4JI2 T;  2JQK A;  4XAX B;  2YU2 A;  3DTO A;  3ZMZ B;  3AE6 A;  3K3O A;  3N5L A;  1FEW A;  3AA1 B;  4UV8 B;  2V1D B;  1HG5 A;  4PFP A;  2XAQ B;  3K3Q C;  4DID B;  3AE2 A;  3N9Q A;  2PG8 A;  4JI0 T;  2CHN A;  2NP9 A;  4UIG A;  5L3E B;  2X9H A;  2HN1 A;  4DV2 T;  5FXV A;  2BG9 B;  4YTM A;  1V9D A;  3M3Z B;  4DV6 T;  3BQL A;  3LJC A;  3P4P A;  4K0U A;  4PJL A;  3SFD A;  3WI3 A;  2KZ7 B;  2BZB A;  4JI4 T;  4TV8 E;  5H6Q B;  1CUN A;  4JEH B;  1QLB A;  5AQQ B;  1MMD A;  2E5V A;  2KMF A;  2VKJ A;  2V6Y A;  2XQ6 A;  1Y01 A;  3HKC E;  4A5X A;  4GKJ T;  4JV5 T;  4PJM A;  4U74 A;  4AIS A;  1N36 T;  2UUC T;  4CI2 B;  4EED A;  3RRC A;  1DU2 A;  4YXD A;  4LMK A;  2LM2 A;  2ES0 A;  5LCY A;  3UUX B;  3ONJ A;  2W66 A;  2YU1 A;  4LMJ A;  4DBQ A;  4CXY A;  2HHH T;  4AI6 A;  4QH1 A;  5KMG P;  2BBJ A;  5JR9 B;  4U2Z A;  2X68 A;  4YLH A;  4MFR A;  4O4J E;  3ZCJ A;  3CVR A;  2WZH A;  4DR1 T;  2D0U A;  2JPF A;  3OVU A;  2E9X D;  3F2E A;  5JRE A;  4CI1 B;  1MIY A;  4WBO A;  4HGA A;  5IHY A;  2WDQ A;  1WLX A;  3A8Y C;  3D0T A;  3KV4 A;  5JDN A;  1SA0 E;  3ETV A;  3GN5 A;  3LK4 2;  4EZ4 A;  4ILC A;  3CQX C;  3UTK A;  4H63 V;  2WWV A;  3FBZ A;  5CA0 E;  5J2U E;  2CLY B;  3P4R A;  4DV0 T;  3OBV E;  4TX5 A;  4JEU B;  5FKY A;  2D0T A;  4PK5 A;  3ZT7 A;  1IJ6 A;  5LGT B;  3AE3 A;  3AE5 A;  4H63 H;  5JQG E;  4B3R T;  2IIU A;  3LSV A;  2SPC A;  1OED E;  2HH7 A;  4GK0 E;  3R84 B;  4F8H A;  4DUY T;  5H6R B;  1T8B A;  3ZSS A;  5CFB A;  1X9B A;  5BR8 T;  2FJA A;  4ZI2 C;  2N9D A;  5LHG B;  4HKA A;  2H7V C;  3KBU A;  3PUX F;  4X20 E;  2D2S A;  3B5M A;  4XZC A;  4PJN A;  2LOP A;  2V6Y B;  2I0M A;  3MJX A;  3ZCI A;  5L3B B;  4YSX A;  5LBM A;  2VKO A;  3FB2 A;  3RC8 A;  3BK9 A;  4LFB T;  5JDL A;  4HWC A;  4QHO A;  1NEN A;  4KX6 A;  3R6N A;  4CN4 A;  4A97 A;  4AQG A;  5HXE A;  4KI0 F;  5ABE A;  4TN7 B;  2BKN A;  3RHW A;  3N2G E;  5JDG A;  2LSY A;  4IE4 A;  3LK2 B;  4TV9 E;  5EK3 A;  3T8O A;  2XSA A;  1G8X A;  5JTG A;  2VKD A;  3RQW A;  3PUV F;  2XPK A;  4MBQ A;  4PFO A;  2JQQ A;  4EOZ B;  5AQV B;  3PUS A;  3LK3 B;  5L3C B;  4WW0 A;  1NWM X;  3H3A A;  4O4I E;  3BQK A;  4C91 A;  3NZQ A;  4YY3 T;  3EAM A;  2V7K A;  3ABV A;  3CWZ B;  2XQ5 A;  3IF8 B;  4GIW A;  4IE5 A;  4I4T E;  4AKL A;  1FMW A;  4DR5 T;  4AKI A;  3SFE A;  5L3G B;  4IDZ A;  4OX9 T;  4H9R C;  5LYJ E;  4CN1 A;  5HXS A;  2X67 A;  4JYA T;  1QUU A;  4KBM B;  3K1S A;  4Z91 A;  1WRD A;  5LXT E;  3QB5 A;  3OYX A;  3OYZ A;  3MZK B;  2G0U A;  3IBP A;  3RQU A;  3ZC1 A;  2WP9 A;  3C98 B;  1WYC A;  2NW8 A;  3JAE A;  4HN9 A;  4MLK A;  3UU3 A;  2CBI A;  2Q9Q A;  3PTR B;  2KWH A;  4B3M T;  3RYI E;  2PJQ A;  4U7Y A;  2WZI A;  3OTO T;  1WR6 A;  1OED C;  2L3L A;  4HE8 A;  2XQ9 A;  2CLY C;  2JMH A;  2XJ7 A;  3FZH B;  3AEG A;  2UXN B;  4O4L E;  3IEE A;  4NXN T;  2K24 A;  2YK0 A;  1KNP A;  4TUY E;  3NWI A;  1U5P A;  4KUM B;  1HR0 T;  4WZX A;  2ZM0 A;  5HEJ A;  4X66 T;  1D1B A;  2BVM A;  2CE7 A;  5AQL B;  5AQG B;  5F3J A;  2R6G F;  3HA4 A;  2LLY A;  3PU8 A;  4UEL A;  2WDV A;  3GWH A;  2J1D G;  4HFH A;  4YJ3 E;  4I43 B;  2CRB A;  3AE1 A;  3QOF A;  4COF A;  4YSZ A;  3N2K E;  2NW7 A;  2MTQ A;  5DQW A;  1HNZ T;  1D0X A;  1ZEE A;  2IDO B;  1HNW T;  5FVK A;  3VRB A;  4LF5 T;  2XUE A;  4J2C A;  2XAG B;  4E7S A;  5L2L A;  4DV1 T;  2BDE A;  2MPK A;  4LF7 T;  4XBF B;  5A1L A;  5ADX L;  3CK6 A;  2UU9 T;  5FYM A;  4EV6 A;  3P4S A;  4PK4 A;  3T1H T;  3GA8 A;  2RP4 A;  3EI0 A;  3NZP A;  3WAJ A;  4WYV A;  4O4H E;  5AQR B;  3CML A;  4HWF A;  5KDM C;  3AE7 A;  4KMC A;  5F8P A;  5FP3 A;  1N34 T;  4JI1 T;  3P4Q A;  5AQK B;  5LHH B;  3HKD E;  4JI5 T;  5AQM B;  3L8R A;  3RYF E;  1W9R A;  2JMK A;  5LGN B;  5FL1 A;  2BKP A;  4LF8 T;  1WCR A;  2VL0 A;  1T98 A;  2W2U A;  1YD8 G;  3LBX A;  2YEV C;  4ISS A;  5DJQ C;  3RIA A;  4EXT A;  5BMV E;  2J47 A;  1J1J A;  1I94 T;  4YFS A;  2UXC T;  1KF6 A;  5LG4 A;  4DMV A;  3VKG A;  1MNE A;  2XM1 A;  3N9O A;  4GYS A;  3UU4 A;  1W0A A;  4GOU A;  4AIU A;  3ANW A;  4EYY R;  3FBL A;  1YQ3 A;  2H88 A;  4IDP A;  3RI5 A;  3Q5W A;  1HFA A;  2A72 A;  1MIW A;  2UXB T;  2Y6X A;  3AEC A;  1H7C A;  4H9Q C;  3KIN B;  4CN6 A;  4PJJ A;  4H9S E;  2V6X A;  4OYJ A;  5FL0 A;  3OKQ A;  5ABH A;  2K48 A;  1MMA A;  1XZY A;  2BG9 C;  4O8S A;  3AXJ A;  2UXX B;  2WBL A;  3EHZ A;  1KNR A;  3C50 A;  3B13 A;  4H9N C;  4MHC A;  4YHJ A;  5HEG A;  5EK2 A;  1HS7 A;  2WQY A;  3PE0 A;  3IHR A;  1XDO A;  2N1G A;  2LSK A;  2WMN A;  1WYB A;  3O1I A;  4UVA B;  5AQO B;  1GQE A;  4HWH A;  3AVR A;  5C2T A;  1ZOY A;  3MXZ A;  4DBR A;  5JR9 A;  2BVL A;  2WB5 A;  3AEE A;  2VK9 A;  4IE6 A;  2XM2 A;  2X51 A;  3OPC A;  2JQ9 A;  3MKD A;  3MAC A;  4AKR B;  3HR0 A;  4JUY A;  3CKD A;  5HXC A;  3RPU A;  3TKL B;  4EB6 E;  4EAH A;  3FZL B;  2YKS A;  5FY1 A;  3H3M A;  2PBI A;  5AQI B;  4P1N A;  3L09 A;  3CQG B;  2LKG A;  5C3J A;  3I0Q A;  2V7J A;  4L5G A;  2H3R A;  3PUG A;  4P0A A;  1J5W A;  1UGO A;  3KVA A;  1HX1 B;  2CMR A;  5AQP B;  5HAX A;  2WU2 A;  4YTP A;  1M7K A;  3OJA A;  3P4W A;  1LRZ A;  3VHL A;  2C5K T;  2CXD A;  2IAK A;  2LM9 A;  2UXD T;  4BA9 A;  2GK9 A;  3V5U A;  1NAF A;  2V5D A;  4PNI A;  3ZST A;  4DMW A;  5KXJ A;  2DWK A;  4EGW A;  1XMQ T;  2CEA A;  2KWI B;  2V7I A;  2M67 A;  2XAJ B;  1VRB A;  3JCF A;  4X1Y E;  2XQA A;  1YQ4 A;  4IT4 A;  1VCT A;  3ZKR A;  4GYR A;  1UX4 A;  4DV7 T;  2QVA A;  2ZLY A;  2X0H A;  3O4X E;  5DAB A;  4QXB B;  4IST A;  4U2Y A;  3W15 B;  5JRC B;  4KHZ F;  3SWH A;  3K3N A;  2P9B A;  5IYZ E;  2VWA A;  3N9M A;  2KND A;  2KIN B;  2VQF T;  1W09 A;  2ODV A;  1D0Y A;  1D1C A;  2MOZ A;  3S4U A;  3UFG A;  5FNV E;  3TLU A;  5LHI B;  2MYS A;  3RYH E;  2VVS A;  3I9Y A;  2M6B A;  3ZYK A;  1R8I A;  4TWH A;  2W0G A;  4OK0 A;  5ETW A;  3P8C D;  4YHH T;  5GON E;  1WR0 A;  4FI5 A;  1JNR A;  2LRL A;  3V5S A;  2XSB A;  4UVC B;  2JJ9 A;  2IW5 B;  3PUQ A;  1ZKE A;  4QX7 B;  5M4Y A;  1XNR T;  3N9N A;  1BR0 A;  2LSI A;  1O3X A;  4AQF C;  3BQI A;  2YIN A;  4K0K T;  5AQJ B;  1BR4 A;  3P50 A;  3C4W A;  1LVF A;  2WY2 A;  4G63 A;  4O2A E;  3T1Y T;  3ESL A;  5L4H A;  4EIW A;  4ZZB A;  4B6X A;  2K9A A;  3JC6 D;  1NEK A;  2E8I A;  3UUN A;  4AXP A;  4BJM A;  3UQ7 A;  2IC9 A;  2XHE B;  3EDU A;  2QYW A;  2NTY A;  2ZM2 A;  5FY0 A;  5FY7 A;  1XMO T;  4WBN E;  2XZE A;  4X62 T;  3WAK A;  3PUA A;  2QRX A;  4NXM T;  2X9X A;  4ZXL A;  3UU8 A;  1QSD A;  3O1H A;  3KV9 A;  2B1E A;  2CWO A;  2XAS B;  3Q9D A;  4BJN A;  5AQF B;  3AA6 B;  2VQE T;  1B7T A;  2E2A A;  2J62 A;  3AE4 A;  4ERR A;  2NTX A;  1E1H B;  4LF4 T;  2LEH A;  3KV5 A;  3QC9 A;  2ACX A;  2XQ3 A;  2KSR A;  5HCJ A;  5JDQ A;  2IUB A;  3NRY A;  4LF6 T;  4DV5 T;  3KDS E;  4HFB A;  3AE8 A;  3G06 A;  4LML A;  2VAS A;  2CXL A;  2X0Y A;  3FZM B;  4M1P A;  5HEH A;  4AQF A;  4YTN A;  2DHR A;  3PUZ F;  4HFV A;  2EHO C;  4TZ4 C;  1BR1 A;  2V7M A;  3QUJ A;  4H9P C;  2MBG A;  4EEB A;  3KFW X;  2A3D A;  1D0Z A;  3Q5D A;  4CI3 B;  5F5W A;  5FXZ A;  4IL4 A;  1VOM A;  4JBW F;  4ZZC A;  3CX7 B;  2C5J A;  2C5I T;  3RIF A;  3TLW A;  1G73 A;  2DWG A;  3J7Y q;  2X9W A;  2BS4 A;  5AQN B;  1YKE B;  3RIU A;  1D1A A;  2E5L T;  3RGL A;  4IHJ E;  3AEF A;  4PAG A;  3GMI A;  3FXD B;  4JLE A;  5JDF A;  4U7I A;  1UUR A;  3ZJ2 A;  5JRC A;  2EHO D;  2J4G A;  2XY8 B;  5LGU B;  1XNQ T;  2CM0 A;  1OWA A;  5LJN A;  2CWY A;  2EHO B;  4UV9 B;  3HI2 A;  5CGM A;  4ILA A;  2Y48 B;  5TAO A;  1N32 T;  3Q5E A;  2AXD S;  4JI6 T;  2RA1 A;  5AQS B;  2LRK A;  2WMO A;  3I0O A;  3Q2M A;  5J1G A;  3UQ4 A;  4H9O C;  4EZH A;  4HFD A;  1IBK T;  2VKH A;  4I50 E;  4ZOL E;  3UUM A;  3VU7 H;  3CX8 B;  3AA0 B;  4ZS3 A;  1E7P A;  4HWD A;  3RYC E;  3AED A;  3JC6 C;  3AEA A;  4TWD A;  4AKH A;  3UUB A;  3F31 A;  5FXW A;  3E22 E;  3PUY F;  1WFD A;  4KHP T;  5LMU T;  4IIJ E;  3NBX X;  3K8P C;  2X66 A;  2A2F X;  4NPP A;  4A98 A;  4JI3 T;  5HCM A;  3IA3 A;  4L9I A;  3RIU C;  2NW9 A;  2W67 A;  4DR6 T;  1FIO A;  1IZN B;  2FJB A;  4V1A v;  3ZYL A;  1YXR A;  3MA9 A;  3PJA A;  5LB7 B;  4QWN B;  5LJM A;  5CB4 E;  3AVS A;  3RRW A;  2CHO A;  3KBT A;  2BBH A;  3O9X A;  4ANJ A;  2WSS V;  4HTE A;  4HFC A;  4A56 A;  5KX5 E;  1I6Z A;  4HEA A;  5LG3 A;  1Z8U A;  3ZMS B;  3ZPO A;  3J9X 1;  1MND A;  3L3P A;  2E9X A;  2ZMA A;  5AQU B;  2HPL A;  2WWU A;  3DJB A;  2K3W A;  2VL8 A;  4F6R C;  1T7S A;  3ZEF B;  3C4Z A;  5IWA T;  2V8S V;  4IRE A;  4UR9 A;  2YOE A;  5E0O A;  3VKH A;  3VR9 A;  3NVO A;  4ZI7 E;  2XTL A;  5LP6 E;  2WCA A;  3E08 A;  2LJL A;  3AAI A;  4U72 A;  5LA6 E;  2CXF A;  4ZHQ E;  2WAU A;  1YKH B;  4QKN A;  2YN6 A;  2ZM6 T;  4ILU A;  2WM9 A;  3FHN A;  3RKG A;  5FVL A;  5HEO A;  3ZMV B;  5EK4 A;  2XAH B;  3ETU A;  4EYU A;  1L0V A;  4KP3 C;  2NR4 A;  5L47 A;  2OLT A;  3FZK B;  4ADZ A;  1KFY A;  1Z0P A;  4DR2 T;  3RH3 A;  2W61 A;  1HF8 A;  2BS2 A;  2IML A;  4OYK A;  3O1J A;  5JR9 C;  4X5T A;  4UEM A;  4I0U A;  2W00 A;  3CQC B;  3ONX A;  2D5U A;  4HWI B;  4TWF A;  3NKZ A;  2OA5 A;  5HWY A;  1MMN A;  2A9U A;  2I6H A;  2Q9Q D;  2W62 A;  4IL9 A;  3UT5 E;  2CPT A;  3EUH A;  4ZEY A;  4DUZ T;  1HNX T;  2UUA T;  2N2N A;  3A7M A;  3LFM A;  3X1D A;  4YJ2 E;  4ZS2 A;  4TNW A;  1HX8 A;  3DP7 A;  2K5B B;  2KT9 A;  4X1K E;  2DCF A;  2JQH A;  3UUL A;  3CX6 B;  4L0R A;  4UVB B;  4GKK T;  4QH4 A;  2EHO A;  2DLR A;  4CXX A;  2DL1 A;  4HFI A;  3QB5 K;  3KV6 A;  4DV3 T;  3RF1 A;  1SHZ C;  3UU6 A;  3H37 A;  4UF0 A;  5JH7 E;  2UUB T;  2C0S A;  4LFC T;  2CBJ A;  5FMN A;  2YDQ A;  3EDV A;  2JIW A;  2Y8D A;  3PDY A;  1JNZ A;  3JAF A;  1S94 A;  3UFE A;  5EZY E;  1IAP A;  1HG2 A;  1OXZ A; 
#chains in the Genus database with same CATH homology
 2RPA A;  4U33 A;  4NIQ A;  1WR0 A;  2LRL A;  2LRK A;  2WWV A;  2A9U A;  2CPT A;  2K3W A;  4ZEY A;  4WZX A;  3ZST A;  1WCR A;  2W2U A;  3ZT7 A;  2V6Y A;  4A5X A;  2WY2 A;  2JQ9 A;  5CJ5 A;  4U3C A;  3ZSS A;  2JQH A;  4IT4 A;  4U31 A;  1WFD A;  2CRB A;  3ZT5 A;  2JQK A;  4CN1 A;  4U2Y A;  2DL1 A;  2XZE A;  2V6Y B;  4P1N A;  4U2Z A;  5FVK A;  3K1S A;  5FVL A;  3EAB A;  3ZT6 A;  4CN6 A;  2MPK A;  2V6X A;  1YXR A;  4U7I A;  4CN4 A;  5LB7 B;  4U7Y A;  5CGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...