2JQ9A

Vps4a mit-chmp1a complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
71
structure length
71
Chain Sequence
b'TLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associating protein 4A
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 31
structure length 71
sequence length 71
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jq9A00
1WR0A 5FVKA 4U31A 2MPKA 5CJ5A 4WZXA 3ZSSA 2V6YB 4U7YA 5LB7B 2CPTA 3EABA 1WFDA 2V6YA 2RPAA 4U2ZA 4ZEYA 2V6XA 4U33A 4U3CA 2DL1A 4P1NA 2XZEA 2JQKA 3K1SA 4IT4A 4NIQA 4A5XA 2JQ9A 4CN1A 2JQHA 2CRBA 2WY2A 3ZSTA 2LRKA 5CGMA 1WCRA 1YXRA 2LRLA 3ZT7A 4U2YA 2WWVA 4CN4A 5FVLA 2W2UA 4CN6A 2A9UA 3ZT5A 2K3WA 4U7IA 3ZT6A
chains in the Genus database with same CATH superfamily
4EAHA 4L0RA 4HWIB 2HPLA 2KXPB 3FXDB 3UFEA 5JDMA 5AQJB 3R84B 4CXXA 3NZPA 5M4YA 5FNVE 4UEMA 5HEUA 2BS4A 2I59A 3F2EA 3VR9A 3RX6A 1BR0A 3UU6A 1DU2A 5C8YE 2J47A 2JJ9A 4U72A 5LYJE 1G8XA 2EHOA 2V1DB 3C64A 1SA0E 4A56A 4DMWA 2LT3A 2WDVA 2IC9A 2V7LA 1D0ZA 5ETWA 4JI1T 1SE7A 4X1KE 5LG4A 5FY1A 2WY2A 4QWNB 4JEHB 4ZS2A 3LBXA 2A9UA 2N2NA 3T1HT 2AXDS 4PNIA 1WRDA 4Q25A 4DNDA 3K3NA 3ZMSB 2ZM8A 2WCAA 3RIUA 4WNKA 2WS3A 4KP3C 2L3LA 1AJ3A 3LDQB 2CXLA 1YXRA 2KMFA 4QKNA 1X9BA 1XDPA 1D1CA 4KUMB 2CA5A 3EUHA 4ZI3D 2BG9C 3L8RA 4B3MT 2X51A 2YKSA 1I94T 3PURA 3ZT7A 4O4LE 2E9XB 2YN6A 5LJMA 2XTLA 4L5GA 4AISA 3MA9A 1FJGT 4DIDB 2UUBT 2V6YA 2NTYA 4XAXB 3BK9A 4PFOA 3OBVE 4GKJT 3K3OA 1IBKT 1YW0A 4TNVA 1WLXA 3CX7B 1ZEEA 2ODUA 1HS7A 2LSIA 4DUZT 4OYJA 1FEWA 3TLSA 3SWHA 2UXBT 5JRCA 1X79A 1G73A 2CWYA 1VRBA 4IE5A 4AKRB 4IL9A 3M65A 3AAIA 4H63V 4BJNA 2M67A 2IW5B 2H89A 3N9PA 2LE8A 3TLUA 1YKHB 2JQQA 5LHGB 4HTEA 3ZSSA 2H7OA 4U2ZA 4E7SA 4DV0T 5JDGA 5LGNB 3UT5E 3EDVA 1M7KA 2LJLA 5JDNA 4B3ST 3LSVA 4TNWA 2DI4A 2KWIB 4WBOA 5FY0A 3RHWA 1JNZA 2Q9QB 5LBQB 1J5WA 4HFCA 1Z8UA 2JQHA 1T98A 5LBMA 2CCQA 4CN4A 2D0TA 2XQ9A 5H6RB 1L0VA 2PFVA 1LVFA 2PJQA 2E5VA 5AFUL 4EOZB 4EEBA 5HXSA 3SS1A 4NXMT 2HN2A 3FZMB 4YJ3E 4PFPA 1W0BA 4DUYT 2B1EA 2XSBA 2Y6XA 5LMNT 5FL0A 2G0UA 4CXWA 4LMJA 2BG9B 5FXWA 4ILUA 1ZOYA 3KBUA 3JCFA 3OTOT 4TN7B 4HFEA 2BS3A 4DO0A 2LRKA 3RKGA 2WWVA 3UUBA 2EHOC 3ANWB 5CB4E 3ZT5A 3AAAB 3AXJA 1H7CA 5HEJA 1UK5A 3MZKB 3I9YA 2JQ9A 2XAHB 1OWAA 1SUMB 1OXZA 3MACA 4MLKA 3UUXB 1HTJF 4HFVA 2VL8A 3UU3A 4X1IE 4UF0B 2CPTA 3GN5B 4GYRA 4HE8A 4YT0A 4HGAA 4C91A 2XM2A 1OEDB 3J9X1 3RIUC 3AE8A 2DNXA 2IHR1 3PJAJ 4YXDA 5F3JA 3ZN0B 4QXBB 2XASB 2XQ8A 1HNZT 1IBMT 4NIQA 3ZMZB 2HN1A 2CRBA 4IDOA 2BVLA 3AEFA 3H37A 4DVDA 2XQ6A 2KSRA 4NPPA 2NW7A 3N9QA 5HCMA 4DR3T 5CA0E 2LM2A 4KHPT 2AE9A 1MMAA 2LHNA 2MYSA 3ZJ1A 2MOZA 5FVLA 3SFDA 3C98B 5H6QB 1UCUA 5JDQA 3UQ7A 2NTXA 4Z91A 3I0OA 1KFYA 2PTFA 3L39A 3PUSA 2XQ4A 5AQPB 3JADA 3VHLA 4ILBA 4QH5A 4I0UA 2RA1A 5E0OA 4TV8E 3AE9A 5CJ5A 5HEOA 2V6XA 3JAEA 3K3QC 2CBJA 4ERRA 5L47A 4B3RT 2EHOB 4JI4T 4EYYR 4WZXA 4J2CA 1ZV4X 2X68A 4P0AA 3PU3A 1N34T 4K0UA 3E22E 3NBXX 3ONJA 3LBXB 4QH4A 3N9NA 2LOPA 3MXZA 4U7YA 1IJ6A 3QB5A 3HKBE 5FYMA 3Q9DA 4JLEA 2HPJA 5LA6E 2J1DG 4QX7B 4O4HE 2ZLYA 3CQCB 4AXPA 3ZCJA 2LKGA 1HX8A 2YOEA 2XUEA 4DV5T 3N5LA 3RGLA 2QVAA 2NOXA 1O3XA 4QH1A 5AQTB 1D0YA 5HEHA 4IT4A 4HWDA 3RYHE 4YHJA 1U4QA 4AKIA 1T8BA 2W4XA 2C0SA 3RYFE 4UVAB 3WAJA 2V6YB 2N9DA 3VRAA 5JH7E 3U3IA 1N33T 5LGTB 2MBGA 4JBWF 1YD8G 1KNPA 2X66A 4DBQA 4DR7T 4ANJA 5AQFB 5DQWA 2FJAA 3LFMA 3FB2A 4ZI3C 4MALA 2QYWA 2X9WA 1MIVA 2V7IA 3IF8B 4P09A 3P50A 4LFBT 2DCFA 2RP4A 4O2AE 3FBLA 4JI8T 1J5ET 1Z0PA 3BQKA 2Y48B 2KT9A 3UFGA 4QXCB 3RC3A 4IE0A 4TWFA 3ZC1A 3P4QA 3ZPOA 4LF8T 4DV7T 4CXYA 3T8OA 3AE7A 4OX9T 3KV5A 1WFDA 4KX6A 1CHUA 2CHNA 2SPCA 2IUBA 3KDSE 5L3CB 1XNRT 2JPFA 3AVRA 3FZFB 4TV9E 3CWZB 5FP3A 4PJMA 5L4HA 2A72A 3TKLB 4JEUB 5EK4A 3EI0A 3EHZA 5JDHA 3CK6A 3DTOA 3EVYA 2KNDA 5LMUT 4ILAA 2Q9QC 4TX5A 4EV6A 2QGSA 3VRBA 4PJNA 2LRLA 5KDMC 3G06A 5L4EA 3RF1A 3GA8A 3I9WA 4DR4T 2CLYC 2X0YA 3P4SA 2W0GA 4BA9A 3RRCA 1IAPA 3P7IA 3TLVA 3B13A 5ABGA 1HCIA 3PU8A 2WU2A 3ZYKA 2QA7A 3ZMVB 4IHJE 1MIYA 2WSSV 3L09A 3JAFA 5DQVA 3N2OA 5HXHA 2CWOA 5FY7A 3OVUA 1UX4A 3O1JA 4ZI2C 2XQ5A 4WBNE 2BKPA 2C5IT 4ZXLA 3A7MA 4L9IA 2CBIA 3AXJB 3C4WA 3H3AA 2IC6A 4EZHA 4X66T 4LMLA 3VKGA 3PUWF 2XAGB 4DR5T 3RYCE 4AI6A 4HEAA 2LSYA 2ACZA 3VKHA 2V8SV 3P4PA 4ILCA 3VU7H 3KVBA 2XQ7A 4JI6T 2BG9E 2W2UA 3RH3A 5JREA 3W15B 2CEAA 4IL4A 3FZKB 1FMVA 4LFAT 4HFDA 3UTKA 1NEKA 5FMNA 1LVKA 3AEDA 3O9XA 3CX6B 1OEDC 2XPKA 5FXXA 2DWKA 3I1AA 3JC6D 4EZ4A 5AQKB 3AA6B 5DJQC 4EB6E 4V1Av 1ZKEA 4AQYT 3ONLC 5HXRA 4AKHA 3PUGA 4JV5T 3ZMUB 4GKKT 3U78A 2CXFA 3QB5K 3HKDE 3OKQA 2BVMA 3AVSA 3WAKA 5TAOA 1OEDE 4EYUA 1WYBA 3Q5EA 2QRXA 5KMGP 3AE4A 2UU9T 2YK0A 3N9OA 3ZSTA 5AQUB 2XQYA 4O4IE 3FZHB 4DV4T 2CLYB 4A97A 2C5JA 4WYVA 3OJAA 4AKLA 2YDQA 2UXNB 2LSJA 2V7JA 2ACXA 2WB5A 2F4VT 2P9BA 1HG2A 3AE3A 3ZT6A 3ZN1B 3UU8A 5ABHA 4CZZB 2V7KA 4AIUA 1LRZA 3PE0A 3NKZA 3NRXA 3MJXA 5C3JA 4X1YE 4LMKA 4UXNB 3HKEE 4AQFA 5LP6E 4DMVA 4G2AA 3N9LA 5FL1A 3CQGB 3PUAA 2UXDT 2K3WA 1NENA 3P4WA 3AE2A 5IYZE 3CMLA 3CVRA 5FXZA 3UULA 2W66A 4QHOA 2XQAA 3O4XE 5F5WA 2VVNA 2H3RA 4YTPA 3X1DA 4G63A 3AE6A 4H9OC 4IIJE 5LG3A 2FUPA 4I55E 2N1GA 2XJ7A 4ZS3A 3F57A 4HKAA 4A98A 5DABA 3J7Yq 2VKHA 4H9NC 4NUUA 2A3DA 3LK3B 3Q5WA 2IIUA 4U31A 2ES0A 4ZZCA 3LG7A 5LB7B 3UQ4A 3BQIA 5EK3A 2YINA 3C50A 4H9QC 1S94A 4F6RC 2E2AA 4E7ZA 4EXTA 2A2FX 2J4GA 1N36T 5L2LA 2B76A 4JYAT 4GK0E 4DV6T 4U3CA 4TWHA 3S4UA 4HN9A 1E2AA 1QUUA 3PUQA 4IE7A 1YQ4A 5FXVA 2W61A 2VQET 3ZYLA 2WDRA 1U5PA 3C51A 4CI2B 1UUSA 4KHZF 2WP9A 3AEBA 4KBMB 4PK5A 2WWUA 5J2UE 4PJLA 4YSYA 2LEHA 4AKGA 1QSDA 3I0QA 2PBIA 2VASA 1NWMX 4X62T 4EGWA 1J1JA 3LK42 4GOUA 3ZMTB 3ZLIA 3RQUA 5JR9A 5J2TE 4IDPA 1T72A 5CA1E 3CKDA 4IDNA 3DP7A 5LHHB 2NR4A 2K9AA 2VQFT 2LSGA 4EIWA 1BR4A 2VVSA 3AA0B 2E8IA 4ADZA 5JDFA 2LHRA 2YU1A 4ISTA 4DV1T 4NXNT 3L3PA 5HWXA 3BQLA 4YTNA 3LK2B 2WAUA 2LM9A 2RPAA 2MTQA 2IDOB 5LHIB 2LLYA 3ETVA 2UUAT 4JI2T 5AQOB 3P8CD 2XAFB 4YSXA 2XM1A 5L3GB 2XHEB 4H63H 4ZEYA 5EZYE 5LOVE 3AA7B 1FMWA 4PW8A 4JI5T 3KV9A 5LCYA 4XZCA 2H88A 2MPKA 2VURA 4IREA 5HEGA 2CHOA 2KWHA 5JRCB 2XAQB 5JQGE 3PDYA 5C2TA 1ZP0A 2K48A 2DWGA 5LXTE 5L3FB 2J62A 2V5CA 3RYIE 3H3MA 2OLTA 2ZMAA 1MIWA 4TUYE 1V9DA 4PK4A 2KLQA 1QLBA 3IEEA 3UUNA 1R8IA 3NWIA 3UUMA 2L9QA 3HA4A 3RC8A 5AQLB 1WYCA 4AQGA 4U74A 2NP9A 4BJMA 4FJOA 4B3TT 5KX5E 1D1BA 2ZM2A 4IDQA 4PAGA 3KV4A 1M62A 2VWAA 4X20E 2YDRA 3Q5DA 3NVOA 4CI3B 3KV6A 3PJAA 3KBTA 4UR9A 2DL1A 3RIAA 1US7B 2FJDA 3JC6C 4CN1A 1HG5A 5J1GA 3MKDA 5HXEA 4ISSA 3M3ZB 3AEGA 2FJEA 2XQ3A 1HR0T 2D2SA 5EK2A 1IJ5A 3FXEB 2GK9A 5ADXL 3C4ZA 3B57A 3C4XA 4LF6T 2UXCT 3V5SA 4UIGA 4BAYB 1MNDA 5KXJA 5CFBA 3K1SA 1HF8A 2Y8DA 2KINB 1MMDA 4YJ2E 3PTRB 2D9DA 3O1IA 2M6IA 5ABFA 4LF9T 4CI1B 3NZQA 2PG8A 3RKOA 5FVKA 1EZ3A 3EAMA 4HFBA 4ZOLE 1S35A 3TLTA 2VKDA 4O8SA 3UU5A 2XAJB 2E9XD 4HWCA 3CX8B 3WI3A 3O1HA 4A5XA 4P0BA 3E08A 4IDZA 2BBHA 2I0MA 3FBZA 2NW8A 4GYSA 4U7IA 4KMCA 3OYZA 3NRYA 4OFZA 5L3BB 4LFCT 5AQMB 5JR9C 2D5UA 1Y01A 2BKNA 2UXXB 5HWYA 2BDEA 2WBLA 3SOLA 4JI7T 3RQWA 4H9SE 1HNWT 3HKCE 5AQSB 4XBFB 4MHCA 3TLWA 2OV9A 4O4JE 5CGMA 5JDLA 2NW9A 5AQVB 1JNRA 2VB6A 4OK0A 1YKEB 3ZYMA 3Q5XA 4H9PC 5L3DB 4P1NA 5LNKA 2DLRA 2VKOA 5BMVE 4C90A 3KVAA 4MFRA 1LKXA 2Q9QD 4PJJA 2LSKA 2CE7A 3PUZF 3SRZA 4LF5T 3RPUA 4X64T 3SFEA 2BKOA 3ZEFB 1HX1B 4YY3T 1VOMA 1WR6A 4YFSA 2X67A 2X9HA 5AQRB 4GK5E 3ETUA 3PUYF 1XNQT 3PUVF 4YTMA 3RIFA 1XDOA 2YU2A 3GMIA 2WMOA 2CMRA 3QOFA 3FZLB 3ZJ2A 2ZM6T 2BBJA 2D0UA 4ZI2D 2H7VC 4U2YA 4LF4T 2BS2A 3ZC0A 1XMQT 2YDSA 1WR0A 3ONXA 2JRKA 3CIRA 3HI2A 4X5TA 1D0XA 2JIWA 2WQYA 1KF6A 2E5LT 2L8KA 1KNZA 1ZHCA 4X65T 2VKJA 2FJBA 5HCJA 1XMOT 4I50E 3A5XA 3OYXA 3D0TA 2X0HA 4IE6A 1IBLT 3MK7C 4UELA 3FHNA 2X0LB 4UVBB 3GWHA 4B6XA 2K24A 1T7SA 1KK7A 4JI3T 4HWFA 3ZCIA 5ABEA 3KFWX 1W09A 2LKHA 3AB3B 2WDQA 5JR9B 1MNEA 2Z6EA 5BR8T 2V26A 3HL6A 3N2KE 2E9XA 4DV2T 4TWDA 3T1YT 3ABVA 4IGUA 4DR1T 1IZNB 3QNUA 3CQXC 4N78D 3ESLA 4DR2T 4YLHA 2ZM0A 3Q2MA 3QUJA 5HYAA 4ASKA 1VCSA 4ZZBA 3IHRA 1KEYA 5FKYA 1VCTA 1CUNA 2M6BA 5AQHB 3CPZA 1UX5A 2VK9A 4WW0A 2KZ7B 5J0ZA 1I6ZA 2WMNA 4H9RC 1GQEA 1XWMA 4HWHA 3LJCA 3AEEA 2XZEA 3AAEB 5LJNA 4ZI7E 1W9RA 1YQ3A 1XZYA 2FBWA 3VR8A 1N32T 3PUXF 5A1LA 1MMNA 5LGUB 4COFA 2Q9QA 1B7TA 2ODVA 4EEDA 4UVCB 2HHHT 4MBQA 2JMHA 4DBRA 3AEAA 2K5BB 4QXHB 4UV9B 4LF7T 1NAFA 2EHOD 4DV3T 5AQNB 3OPCA 3PV0F 3RRWA 2IMLA 5HAXA 2UUCT 1WCRA 3KINB 3HR0A 3QK6A 4M1PA 2XSAA 4IE4A 4JUYA 3ZKRA 5GONE 3EABA 3AECA 1E7PA 2BG9A 2BZBA 1D1AA 2DHRA 5AQIB 2JQKA 3AE5A 2W62A 2IAKA 3IBPA 4TZ4C 2C5KT 4I43B 1HFAA 1UURA 2W63A 2WM9A 3ANWA 4HFIA 4UV8B 4Z8XA 2CM0A 3RLFF 5IUXA 3AA1B 3K8PC 3V5UA 3DJBA 2HH7A 3UU4A 3R6NA 2OA5A 4CQIA 2W00A 4DR6T 4QX8B 2V5DA 4PK6A 3AE1A 1UGOA 5L3EB 4F8HA 1SHZC 5ABFB 2NWBA 4NUVA 2WZIA 4O2BE 2MAWA 3A8YC 3P4RA 1BR1A 4UF0A 3GN5A 1OEDA 4Z90A 1E1HB 2XY8B 3E0ZA 3N2GE 5JTGA 4ZHQE 3QC9A 1BR2A 2JMKA 2VL0A 4FI5A 5JVDE 1HNXT 5AQGB 3N9MA 5HXCA 3F31A 2WZHA 4OYKA 3B5MA 4U33A 3EDUA 4AQFC 4JI0T 5IWAT 3RI5A 2YEVC 2CXDA 4I4TE 5AQQB 4OHFA 4YSZA 4YHHT 1MMGA 3IA3A 4GIWA 2E9XC 2WU5A 2R6GF 2I6HA 1Y64B 2X9YA 1FIOA 1KNRA 2X9XA 2LOSA 4HFHA 2W67A 4K0KT 1W0AA 5IHYA 4KI0F 2V7MA 5F8PA 4CN6A
chains in the Genus database with same CATH topology
1WR0A 5FVKA 4U31A 2MPKA 5CJ5A 4WZXA 3ZSSA 2V6YB 4U7YA 5LB7B 2CPTA 3EABA 1WFDA 2V6YA 2RPAA 4U2ZA 4ZEYA 2V6XA 4U33A 4U3CA 2DL1A 4P1NA 2XZEA 2JQKA 3K1SA 4IT4A 4NIQA 4A5XA 2JQ9A 4CN1A 2JQHA 2CRBA 2WY2A 3ZSTA 2LRKA 5CGMA 1WCRA 1YXRA 2LRLA 3ZT7A 4U2YA 2WWVA 4CN4A 5FVLA 2W2UA 4CN6A 2A9UA 3ZT5A 2K3WA 4U7IA 3ZT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR0 A;  5FVK A;  4U31 A;  2MPK A;  5CJ5 A;  4WZX A;  3ZSS A;  2V6Y B;  4U7Y A;  5LB7 B;  2CPT A;  3EAB A;  1WFD A;  2V6Y A;  2RPA A;  4U2Z A;  4ZEY A;  2V6X A;  4U33 A;  4U3C A;  2DL1 A;  4P1N A;  2XZE A;  2JQK A;  3K1S A;  4IT4 A;  4NIQ A;  4A5X A;  2JQ9 A;  4CN1 A;  2JQH A;  2CRB A;  2WY2 A;  3ZST A;  2LRK A;  5CGM A;  1WCR A;  1YXR A;  2LRL A;  3ZT7 A;  4U2Y A;  2WWV A;  4CN4 A;  5FVL A;  2W2U A;  4CN6 A;  2A9U A;  3ZT5 A;  2K3W A;  4U7I A;  3ZT6 A; 
#chains in the Genus database with same CATH topology
 4EAH A;  4L0R A;  4HWI B;  2HPL A;  2KXP B;  3FXD B;  3UFE A;  5JDM A;  5AQJ B;  3R84 B;  4CXX A;  3NZP A;  5M4Y A;  5FNV E;  4UEM A;  5HEU A;  2BS4 A;  2I59 A;  3F2E A;  3VR9 A;  3RX6 A;  1BR0 A;  3UU6 A;  1DU2 A;  5C8Y E;  2J47 A;  2JJ9 A;  4U72 A;  5LYJ E;  1G8X A;  2EHO A;  2V1D B;  3C64 A;  1SA0 E;  4A56 A;  4DMW A;  2LT3 A;  2WDV A;  2IC9 A;  2V7L A;  1D0Z A;  5ETW A;  4JI1 T;  1SE7 A;  4X1K E;  5LG4 A;  5FY1 A;  2WY2 A;  4QWN B;  4JEH B;  4ZS2 A;  3LBX A;  2A9U A;  2N2N A;  3T1H T;  2AXD S;  4PNI A;  1WRD A;  4Q25 A;  4DND A;  3K3N A;  3ZMS B;  2ZM8 A;  2WCA A;  3RIU A;  4WNK A;  2WS3 A;  4KP3 C;  2L3L A;  1AJ3 A;  3LDQ B;  2CXL A;  1YXR A;  2KMF A;  4QKN A;  1X9B A;  1XDP A;  1D1C A;  4KUM B;  2CA5 A;  3EUH A;  4ZI3 D;  2BG9 C;  3L8R A;  4B3M T;  2X51 A;  2YKS A;  1I94 T;  3PUR A;  3ZT7 A;  4O4L E;  2E9X B;  2YN6 A;  5LJM A;  2XTL A;  4L5G A;  4AIS A;  3MA9 A;  1FJG T;  4DID B;  2UUB T;  2V6Y A;  2NTY A;  4XAX B;  3BK9 A;  4PFO A;  3OBV E;  4GKJ T;  3K3O A;  1IBK T;  1YW0 A;  4TNV A;  1WLX A;  3CX7 B;  1ZEE A;  2ODU A;  1HS7 A;  2LSI A;  4DUZ T;  4OYJ A;  1FEW A;  3TLS A;  3SWH A;  2UXB T;  5JRC A;  1X79 A;  1G73 A;  2CWY A;  1VRB A;  4IE5 A;  4AKR B;  4IL9 A;  3M65 A;  3AAI A;  4H63 V;  4BJN A;  2M67 A;  2IW5 B;  2H89 A;  3N9P A;  2LE8 A;  3TLU A;  1YKH B;  2JQQ A;  5LHG B;  4HTE A;  3ZSS A;  2H7O A;  4U2Z A;  4E7S A;  4DV0 T;  5JDG A;  5LGN B;  3UT5 E;  3EDV A;  1M7K A;  2LJL A;  5JDN A;  4B3S T;  3LSV A;  4TNW A;  2DI4 A;  2KWI B;  4WBO A;  5FY0 A;  3RHW A;  1JNZ A;  2Q9Q B;  5LBQ B;  1J5W A;  4HFC A;  1Z8U A;  2JQH A;  1T98 A;  5LBM A;  2CCQ A;  4CN4 A;  2D0T A;  2XQ9 A;  5H6R B;  1L0V A;  2PFV A;  1LVF A;  2PJQ A;  2E5V A;  5AFU L;  4EOZ B;  4EEB A;  5HXS A;  3SS1 A;  4NXM T;  2HN2 A;  3FZM B;  4YJ3 E;  4PFP A;  1W0B A;  4DUY T;  2B1E A;  2XSB A;  2Y6X A;  5LMN T;  5FL0 A;  2G0U A;  4CXW A;  4LMJ A;  2BG9 B;  5FXW A;  4ILU A;  1ZOY A;  3KBU A;  3JCF A;  3OTO T;  4TN7 B;  4HFE A;  2BS3 A;  4DO0 A;  2LRK A;  3RKG A;  2WWV A;  3UUB A;  2EHO C;  3ANW B;  5CB4 E;  3ZT5 A;  3AAA B;  3AXJ A;  1H7C A;  5HEJ A;  1UK5 A;  3MZK B;  3I9Y A;  2JQ9 A;  2XAH B;  1OWA A;  1SUM B;  1OXZ A;  3MAC A;  4MLK A;  3UUX B;  1HTJ F;  4HFV A;  2VL8 A;  3UU3 A;  4X1I E;  4UF0 B;  2CPT A;  3GN5 B;  4GYR A;  4HE8 A;  4YT0 A;  4HGA A;  4C91 A;  2XM2 A;  1OED B;  3J9X 1;  3RIU C;  3AE8 A;  2DNX A;  2IHR 1;  3PJA J;  4YXD A;  5F3J A;  3ZN0 B;  4QXB B;  2XAS B;  2XQ8 A;  1HNZ T;  1IBM T;  4NIQ A;  3ZMZ B;  2HN1 A;  2CRB A;  4IDO A;  2BVL A;  3AEF A;  3H37 A;  4DVD A;  2XQ6 A;  2KSR A;  4NPP A;  2NW7 A;  3N9Q A;  5HCM A;  4DR3 T;  5CA0 E;  2LM2 A;  4KHP T;  2AE9 A;  1MMA A;  2LHN A;  2MYS A;  3ZJ1 A;  2MOZ A;  5FVL A;  3SFD A;  3C98 B;  5H6Q B;  1UCU A;  5JDQ A;  3UQ7 A;  2NTX A;  4Z91 A;  3I0O A;  1KFY A;  2PTF A;  3L39 A;  3PUS A;  2XQ4 A;  5AQP B;  3JAD A;  3VHL A;  4ILB A;  4QH5 A;  4I0U A;  2RA1 A;  5E0O A;  4TV8 E;  3AE9 A;  5CJ5 A;  5HEO A;  2V6X A;  3JAE A;  3K3Q C;  2CBJ A;  4ERR A;  5L47 A;  4B3R T;  2EHO B;  4JI4 T;  4EYY R;  4WZX A;  4J2C A;  1ZV4 X;  2X68 A;  4P0A A;  3PU3 A;  1N34 T;  4K0U A;  3E22 E;  3NBX X;  3ONJ A;  3LBX B;  4QH4 A;  3N9N A;  2LOP A;  3MXZ A;  4U7Y A;  1IJ6 A;  3QB5 A;  3HKB E;  5FYM A;  3Q9D A;  4JLE A;  2HPJ A;  5LA6 E;  2J1D G;  4QX7 B;  4O4H E;  2ZLY A;  3CQC B;  4AXP A;  3ZCJ A;  2LKG A;  1HX8 A;  2YOE A;  2XUE A;  4DV5 T;  3N5L A;  3RGL A;  2QVA A;  2NOX A;  1O3X A;  4QH1 A;  5AQT B;  1D0Y A;  5HEH A;  4IT4 A;  4HWD A;  3RYH E;  4YHJ A;  1U4Q A;  4AKI A;  1T8B A;  2W4X A;  2C0S A;  3RYF E;  4UVA B;  3WAJ A;  2V6Y B;  2N9D A;  3VRA A;  5JH7 E;  3U3I A;  1N33 T;  5LGT B;  2MBG A;  4JBW F;  1YD8 G;  1KNP A;  2X66 A;  4DBQ A;  4DR7 T;  4ANJ A;  5AQF B;  5DQW A;  2FJA A;  3LFM A;  3FB2 A;  4ZI3 C;  4MAL A;  2QYW A;  2X9W A;  1MIV A;  2V7I A;  3IF8 B;  4P09 A;  3P50 A;  4LFB T;  2DCF A;  2RP4 A;  4O2A E;  3FBL A;  4JI8 T;  1J5E T;  1Z0P A;  3BQK A;  2Y48 B;  2KT9 A;  3UFG A;  4QXC B;  3RC3 A;  4IE0 A;  4TWF A;  3ZC1 A;  3P4Q A;  3ZPO A;  4LF8 T;  4DV7 T;  4CXY A;  3T8O A;  3AE7 A;  4OX9 T;  3KV5 A;  1WFD A;  4KX6 A;  1CHU A;  2CHN A;  2SPC A;  2IUB A;  3KDS E;  5L3C B;  1XNR T;  2JPF A;  3AVR A;  3FZF B;  4TV9 E;  3CWZ B;  5FP3 A;  4PJM A;  5L4H A;  2A72 A;  3TKL B;  4JEU B;  5EK4 A;  3EI0 A;  3EHZ A;  5JDH A;  3CK6 A;  3DTO A;  3EVY A;  2KND A;  5LMU T;  4ILA A;  2Q9Q C;  4TX5 A;  4EV6 A;  2QGS A;  3VRB A;  4PJN A;  2LRL A;  5KDM C;  3G06 A;  5L4E A;  3RF1 A;  3GA8 A;  3I9W A;  4DR4 T;  2CLY C;  2X0Y A;  3P4S A;  2W0G A;  4BA9 A;  3RRC A;  1IAP A;  3P7I A;  3TLV A;  3B13 A;  5ABG A;  1HCI A;  3PU8 A;  2WU2 A;  3ZYK A;  2QA7 A;  3ZMV B;  4IHJ E;  1MIY A;  2WSS V;  3L09 A;  3JAF A;  5DQV A;  3N2O A;  5HXH A;  2CWO A;  5FY7 A;  3OVU A;  1UX4 A;  3O1J A;  4ZI2 C;  2XQ5 A;  4WBN E;  2BKP A;  2C5I T;  4ZXL A;  3A7M A;  4L9I A;  2CBI A;  3AXJ B;  3C4W A;  3H3A A;  2IC6 A;  4EZH A;  4X66 T;  4LML A;  3VKG A;  3PUW F;  2XAG B;  4DR5 T;  3RYC E;  4AI6 A;  4HEA A;  2LSY A;  2ACZ A;  3VKH A;  2V8S V;  3P4P A;  4ILC A;  3VU7 H;  3KVB A;  2XQ7 A;  4JI6 T;  2BG9 E;  2W2U A;  3RH3 A;  5JRE A;  3W15 B;  2CEA A;  4IL4 A;  3FZK B;  1FMV A;  4LFA T;  4HFD A;  3UTK A;  1NEK A;  5FMN A;  1LVK A;  3AED A;  3O9X A;  3CX6 B;  1OED C;  2XPK A;  5FXX A;  2DWK A;  3I1A A;  3JC6 D;  4EZ4 A;  5AQK B;  3AA6 B;  5DJQ C;  4EB6 E;  4V1A v;  1ZKE A;  4AQY T;  3ONL C;  5HXR A;  4AKH A;  3PUG A;  4JV5 T;  3ZMU B;  4GKK T;  3U78 A;  2CXF A;  3QB5 K;  3HKD E;  3OKQ A;  2BVM A;  3AVS A;  3WAK A;  5TAO A;  1OED E;  4EYU A;  1WYB A;  3Q5E A;  2QRX A;  5KMG P;  3AE4 A;  2UU9 T;  2YK0 A;  3N9O A;  3ZST A;  5AQU B;  2XQY A;  4O4I E;  3FZH B;  4DV4 T;  2CLY B;  4A97 A;  2C5J A;  4WYV A;  3OJA A;  4AKL A;  2YDQ A;  2UXN B;  2LSJ A;  2V7J A;  2ACX A;  2WB5 A;  2F4V T;  2P9B A;  1HG2 A;  3AE3 A;  3ZT6 A;  3ZN1 B;  3UU8 A;  5ABH A;  4CZZ B;  2V7K A;  4AIU A;  1LRZ A;  3PE0 A;  3NKZ A;  3NRX A;  3MJX A;  5C3J A;  4X1Y E;  4LMK A;  4UXN B;  3HKE E;  4AQF A;  5LP6 E;  4DMV A;  4G2A A;  3N9L A;  5FL1 A;  3CQG B;  3PUA A;  2UXD T;  2K3W A;  1NEN A;  3P4W A;  3AE2 A;  5IYZ E;  3CML A;  3CVR A;  5FXZ A;  3UUL A;  2W66 A;  4QHO A;  2XQA A;  3O4X E;  5F5W A;  2VVN A;  2H3R A;  4YTP A;  3X1D A;  4G63 A;  3AE6 A;  4H9O C;  4IIJ E;  5LG3 A;  2FUP A;  4I55 E;  2N1G A;  2XJ7 A;  4ZS3 A;  3F57 A;  4HKA A;  4A98 A;  5DAB A;  3J7Y q;  2VKH A;  4H9N C;  4NUU A;  2A3D A;  3LK3 B;  3Q5W A;  2IIU A;  4U31 A;  2ES0 A;  4ZZC A;  3LG7 A;  5LB7 B;  3UQ4 A;  3BQI A;  5EK3 A;  2YIN A;  3C50 A;  4H9Q C;  1S94 A;  4F6R C;  2E2A A;  4E7Z A;  4EXT A;  2A2F X;  2J4G A;  1N36 T;  5L2L A;  2B76 A;  4JYA T;  4GK0 E;  4DV6 T;  4U3C A;  4TWH A;  3S4U A;  4HN9 A;  1E2A A;  1QUU A;  3PUQ A;  4IE7 A;  1YQ4 A;  5FXV A;  2W61 A;  2VQE T;  3ZYL A;  2WDR A;  1U5P A;  3C51 A;  4CI2 B;  1UUS A;  4KHZ F;  2WP9 A;  3AEB A;  4KBM B;  4PK5 A;  2WWU A;  5J2U E;  4PJL A;  4YSY A;  2LEH A;  4AKG A;  1QSD A;  3I0Q A;  2PBI A;  2VAS A;  1NWM X;  4X62 T;  4EGW A;  1J1J A;  3LK4 2;  4GOU A;  3ZMT B;  3ZLI A;  3RQU A;  5JR9 A;  5J2T E;  4IDP A;  1T72 A;  5CA1 E;  3CKD A;  4IDN A;  3DP7 A;  5LHH B;  2NR4 A;  2K9A A;  2VQF T;  2LSG A;  4EIW A;  1BR4 A;  2VVS A;  3AA0 B;  2E8I A;  4ADZ A;  5JDF A;  2LHR A;  2YU1 A;  4IST A;  4DV1 T;  4NXN T;  3L3P A;  5HWX A;  3BQL A;  4YTN A;  3LK2 B;  2WAU A;  2LM9 A;  2RPA A;  2MTQ A;  2IDO B;  5LHI B;  2LLY A;  3ETV A;  2UUA T;  4JI2 T;  5AQO B;  3P8C D;  2XAF B;  4YSX A;  2XM1 A;  5L3G B;  2XHE B;  4H63 H;  4ZEY A;  5EZY E;  5LOV E;  3AA7 B;  1FMW A;  4PW8 A;  4JI5 T;  3KV9 A;  5LCY A;  4XZC A;  2H88 A;  2MPK A;  2VUR A;  4IRE A;  5HEG A;  2CHO A;  2KWH A;  5JRC B;  2XAQ B;  5JQG E;  3PDY A;  5C2T A;  1ZP0 A;  2K48 A;  2DWG A;  5LXT E;  5L3F B;  2J62 A;  2V5C A;  3RYI E;  3H3M A;  2OLT A;  2ZMA A;  1MIW A;  4TUY E;  1V9D A;  4PK4 A;  2KLQ A;  1QLB A;  3IEE A;  3UUN A;  1R8I A;  3NWI A;  3UUM A;  2L9Q A;  3HA4 A;  3RC8 A;  5AQL B;  1WYC A;  4AQG A;  4U74 A;  2NP9 A;  4BJM A;  4FJO A;  4B3T T;  5KX5 E;  1D1B A;  2ZM2 A;  4IDQ A;  4PAG A;  3KV4 A;  1M62 A;  2VWA A;  4X20 E;  2YDR A;  3Q5D A;  3NVO A;  4CI3 B;  3KV6 A;  3PJA A;  3KBT A;  4UR9 A;  2DL1 A;  3RIA A;  1US7 B;  2FJD A;  3JC6 C;  4CN1 A;  1HG5 A;  5J1G A;  3MKD A;  5HXE A;  4ISS A;  3M3Z B;  3AEG A;  2FJE A;  2XQ3 A;  1HR0 T;  2D2S A;  5EK2 A;  1IJ5 A;  3FXE B;  2GK9 A;  5ADX L;  3C4Z A;  3B57 A;  3C4X A;  4LF6 T;  2UXC T;  3V5S A;  4UIG A;  4BAY B;  1MND A;  5KXJ A;  5CFB A;  3K1S A;  1HF8 A;  2Y8D A;  2KIN B;  1MMD A;  4YJ2 E;  3PTR B;  2D9D A;  3O1I A;  2M6I A;  5ABF A;  4LF9 T;  4CI1 B;  3NZQ A;  2PG8 A;  3RKO A;  5FVK A;  1EZ3 A;  3EAM A;  4HFB A;  4ZOL E;  1S35 A;  3TLT A;  2VKD A;  4O8S A;  3UU5 A;  2XAJ B;  2E9X D;  4HWC A;  3CX8 B;  3WI3 A;  3O1H A;  4A5X A;  4P0B A;  3E08 A;  4IDZ A;  2BBH A;  2I0M A;  3FBZ A;  2NW8 A;  4GYS A;  4U7I A;  4KMC A;  3OYZ A;  3NRY A;  4OFZ A;  5L3B B;  4LFC T;  5AQM B;  5JR9 C;  2D5U A;  1Y01 A;  2BKN A;  2UXX B;  5HWY A;  2BDE A;  2WBL A;  3SOL A;  4JI7 T;  3RQW A;  4H9S E;  1HNW T;  3HKC E;  5AQS B;  4XBF B;  4MHC A;  3TLW A;  2OV9 A;  4O4J E;  5CGM A;  5JDL A;  2NW9 A;  5AQV B;  1JNR A;  2VB6 A;  4OK0 A;  1YKE B;  3ZYM A;  3Q5X A;  4H9P C;  5L3D B;  4P1N A;  5LNK A;  2DLR A;  2VKO A;  5BMV E;  4C90 A;  3KVA A;  4MFR A;  1LKX A;  2Q9Q D;  4PJJ A;  2LSK A;  2CE7 A;  3PUZ F;  3SRZ A;  4LF5 T;  3RPU A;  4X64 T;  3SFE A;  2BKO A;  3ZEF B;  1HX1 B;  4YY3 T;  1VOM A;  1WR6 A;  4YFS A;  2X67 A;  2X9H A;  5AQR B;  4GK5 E;  3ETU A;  3PUY F;  1XNQ T;  3PUV F;  4YTM A;  3RIF A;  1XDO A;  2YU2 A;  3GMI A;  2WMO A;  2CMR A;  3QOF A;  3FZL B;  3ZJ2 A;  2ZM6 T;  2BBJ A;  2D0U A;  4ZI2 D;  2H7V C;  4U2Y A;  4LF4 T;  2BS2 A;  3ZC0 A;  1XMQ T;  2YDS A;  1WR0 A;  3ONX A;  2JRK A;  3CIR A;  3HI2 A;  4X5T A;  1D0X A;  2JIW A;  2WQY A;  1KF6 A;  2E5L T;  2L8K A;  1KNZ A;  1ZHC A;  4X65 T;  2VKJ A;  2FJB A;  5HCJ A;  1XMO T;  4I50 E;  3A5X A;  3OYX A;  3D0T A;  2X0H A;  4IE6 A;  1IBL T;  3MK7 C;  4UEL A;  3FHN A;  2X0L B;  4UVB B;  3GWH A;  4B6X A;  2K24 A;  1T7S A;  1KK7 A;  4JI3 T;  4HWF A;  3ZCI A;  5ABE A;  3KFW X;  1W09 A;  2LKH A;  3AB3 B;  2WDQ A;  5JR9 B;  1MNE A;  2Z6E A;  5BR8 T;  2V26 A;  3HL6 A;  3N2K E;  2E9X A;  4DV2 T;  4TWD A;  3T1Y T;  3ABV A;  4IGU A;  4DR1 T;  1IZN B;  3QNU A;  3CQX C;  4N78 D;  3ESL A;  4DR2 T;  4YLH A;  2ZM0 A;  3Q2M A;  3QUJ A;  5HYA A;  4ASK A;  1VCS A;  4ZZB A;  3IHR A;  1KEY A;  5FKY A;  1VCT A;  1CUN A;  2M6B A;  5AQH B;  3CPZ A;  1UX5 A;  2VK9 A;  4WW0 A;  2KZ7 B;  5J0Z A;  1I6Z A;  2WMN A;  4H9R C;  1GQE A;  1XWM A;  4HWH A;  3LJC A;  3AEE A;  2XZE A;  3AAE B;  5LJN A;  4ZI7 E;  1W9R A;  1YQ3 A;  1XZY A;  2FBW A;  3VR8 A;  1N32 T;  3PUX F;  5A1L A;  1MMN A;  5LGU B;  4COF A;  2Q9Q A;  1B7T A;  2ODV A;  4EED A;  4UVC B;  2HHH T;  4MBQ A;  2JMH A;  4DBR A;  3AEA A;  2K5B B;  4QXH B;  4UV9 B;  4LF7 T;  1NAF A;  2EHO D;  4DV3 T;  5AQN B;  3OPC A;  3PV0 F;  3RRW A;  2IML A;  5HAX A;  2UUC T;  1WCR A;  3KIN B;  3HR0 A;  3QK6 A;  4M1P A;  2XSA A;  4IE4 A;  4JUY A;  3ZKR A;  5GON E;  3EAB A;  3AEC A;  1E7P A;  2BG9 A;  2BZB A;  1D1A A;  2DHR A;  5AQI B;  2JQK A;  3AE5 A;  2W62 A;  2IAK A;  3IBP A;  4TZ4 C;  2C5K T;  4I43 B;  1HFA A;  1UUR A;  2W63 A;  2WM9 A;  3ANW A;  4HFI A;  4UV8 B;  4Z8X A;  2CM0 A;  3RLF F;  5IUX A;  3AA1 B;  3K8P C;  3V5U A;  3DJB A;  2HH7 A;  3UU4 A;  3R6N A;  2OA5 A;  4CQI A;  2W00 A;  4DR6 T;  4QX8 B;  2V5D A;  4PK6 A;  3AE1 A;  1UGO A;  5L3E B;  4F8H A;  1SHZ C;  5ABF B;  2NWB A;  4NUV A;  2WZI A;  4O2B E;  2MAW A;  3A8Y C;  3P4R A;  1BR1 A;  4UF0 A;  3GN5 A;  1OED A;  4Z90 A;  1E1H B;  2XY8 B;  3E0Z A;  3N2G E;  5JTG A;  4ZHQ E;  3QC9 A;  1BR2 A;  2JMK A;  2VL0 A;  4FI5 A;  5JVD E;  1HNX T;  5AQG B;  3N9M A;  5HXC A;  3F31 A;  2WZH A;  4OYK A;  3B5M A;  4U33 A;  3EDU A;  4AQF C;  4JI0 T;  5IWA T;  3RI5 A;  2YEV C;  2CXD A;  4I4T E;  5AQQ B;  4OHF A;  4YSZ A;  4YHH T;  1MMG A;  3IA3 A;  4GIW A;  2E9X C;  2WU5 A;  2R6G F;  2I6H A;  1Y64 B;  2X9Y A;  1FIO A;  1KNR A;  2X9X A;  2LOS A;  4HFH A;  2W67 A;  4K0K T;  1W0A A;  5IHY A;  4KI0 F;  2V7M A;  5F8P A;  4CN6 A; 
#chains in the Genus database with same CATH homology
 1WR0 A;  5FVK A;  4U31 A;  2MPK A;  5CJ5 A;  4WZX A;  3ZSS A;  2V6Y B;  4U7Y A;  5LB7 B;  2CPT A;  3EAB A;  1WFD A;  2V6Y A;  2RPA A;  4U2Z A;  4ZEY A;  2V6X A;  4U33 A;  4U3C A;  2DL1 A;  4P1N A;  2XZE A;  2JQK A;  3K1S A;  4IT4 A;  4NIQ A;  4A5X A;  2JQ9 A;  4CN1 A;  2JQH A;  2CRB A;  2WY2 A;  3ZST A;  2LRK A;  5CGM A;  1WCR A;  1YXR A;  2LRL A;  3ZT7 A;  4U2Y A;  2WWV A;  4CN4 A;  5FVL A;  2W2U A;  4CN6 A;  2A9U A;  3ZT5 A;  2K3W A;  4U7I A;  3ZT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...