2JQ9A

Vps4a mit-chmp1a complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
71
structure length
71
Chain Sequence
TLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associating protein 4A
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 31
structure length 71
sequence length 71
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jq9A00
3ZT6A 2JQ9A 4U2YA 1WR0A 4U2ZA 5CGMA 2V6YA 4CN1A 2LRLA 2LRKA 5FVLA 1WFDA 2JQHA 4CN4A 4A5XA 2JQKA 2WWVA 2DL1A 2MPKA 5CJ5A 2V6XA 4NIQA 4U33A 4U7IA 4U7YA 4P1NA 2V6YB 4IT4A 4WZXA 3ZSSA 2RPAA 2XZEA 2CPTA 3ZSTA 2WY2A 2A9UA 4ZEYA 4U31A 1YXRA 3K1SA 1WCRA 3ZT5A 5LB7B 3ZT7A 5FVKA 2K3WA 4CN6A 3EABA 2W2UA 4U3CA 2CRBA
chains in the Genus database with same CATH superfamily
3E0ZA 5LJNA 2X51A 4IE6A 4DR7T 2YOEA 2BVLA 2BS4A 3LK42 3KV5A 3M65A 2OLTA 2CA5A 2X66A 3RKGA 4MALA 1XNRT 3L3PA 2JMKA 2C5IT 5JRCA 1MMGA 5DABA 3A7MA 3PE0A 3ZMTB 2ZM0A 2XQ8A 5L3EB 2XQ5A 3QNUA 4LF5T 5E0OA 1UX5A 3PURA 4UR9A 3AE6A 2K24A 4YFSA 2CE7A 3N2KE 4C90A 2WM9A 3N9PA 4AQGA 3P4PA 3C4XA 4EZ4A 2X0LB 4JI5T 4IT4A 1W9RA 3PUZF 4JI7T 3RHWA 2KT9A 3RYHE 4IDNA 4HWIB 2XQ3A 3LJCA 3FZMB 4ZI3C 2WMNA 5JDGA 4IIJE 1WLXA 4QH4A 2V7LA 3C98B 2VASA 4ISSA 3UU6A 4ZHQE 4EEBA 3AA0B 4P0AA 5KXJA 3QOFA 2XAGB 2LSGA 4OYKA 4ZOLE 4AKRB 3IF8B 2IDOB 3OJAA 2ACZA 2Y6XA 2Z6EA 2Q9QD 2V8SV 5LMUT 4TN7B 2WDRA 5FL1A 2DNXA 5LGNB 3EI0A 5FY0A 4MHCA 2IIUA 3UULA 3MXZA 4DMWA 4A5XA 2JRKA 3R84B 1MNEA 2XM2A 1D0YA 2W62A 2XJ7A 4JBWF 4DR4T 5FXXA 2XQ7A 2CBIA 3H37A 4AKHA 4TWHA 5CA1E 4QH5A 1XZYA 5AQMB 2ZM8A 4DV2T 1J5WA 2XQAA 3ZSTA 5AQJB 3AEDA 2CHNA 2IC6A 2XAQB 4KBMB 2CCQA 5JR9B 5A1LA 2DL1A 3NVOA 4OX9T 4X65T 3LK2B 1SHZC 2YINA 3ZC0A 4UV9B 2CLYB 5ADXL 1W09A 3N9QA 2L9QA 2OV9A 3IEEA 4U72A 2LRLA 3UU3A 3TLUA 2MAWA 3ZLIA 2W0GA 4H9PC 3VKGA 2MOZA 3Q5EA 2VL8A 2WBLA 2V5DA 4ANJA 5LP6E 3P8CD 3JC6C 3RLFF 4JI2T 3LBXB 3HR0A 4YSZA 5LCYA 4QH1A 4YSYA 3RX6A 5L3GB 2UXBT 1OEDE 5J2TE 5LB7B 1IBKT 4XBFB 3GA8A 2VB6A 2QYWA 1MMNA 3QB5K 3RPUA 4DR3T 1ZHCA 2JQHA 4X1KE 3PJAJ 3Q9DA 1I6ZA 2X0HA 5LHIB 2KINB 2BBHA 5EK2A 5DQVA 2KLQA 3AEEA 5LGUB 2F4VT 4HN9A 2X9XA 3PUYF 5L3CB 2KMFA 5AQFB 2V6YA 3PUAA 3MZKB 4UVBB 4ZI2D 4AKLA 2V26A 4DV5T 5CJ5A 3B57A 2N1GA 2LKHA 4Z90A 4O2AE 1WCRA 4YY3T 4I50E 2N9DA 4IE0A 2Y48B 5LMNT 2FJBA 4Z91A 2MTQA 1SA0E 5FY1A 3NKZA 4KHPT 3F2EA 3MJXA 2LM2A 1XMQT 3C51A 1YQ4A 3AA7B 3BQKA 4WW0A 1WR6A 3RYIE 3NRYA 4HFVA 1IAPA 4X64T 3SWHA 3VU7H 2BG9E 4TUYE 2CWYA 4O4LE 1IBMT 2UU9T 1G73A 5LBQB 3OVUA 2VWAA 3AEBA 1W0BA 5HXSA 4B3RT 3PU8A 2WAUA 5HEJA 3CQGB 2XHEB 1HX8A 3D0TA 4LF6T 2XTLA 3J9X1 2PJQA 4ILBA 1M7KA 1OXZA 3RIUA 3CMLA 4I0UA 3CQCB 1W0AA 3Q5WA 4DV0T 4ZS2A 2WCAA 1HG5A 4GK0E 5JTGA 1MMAA 2XAFB 1QSDA 5JREA 4H9NC 1G8XA 4CI2B 5HXHA 4NIQA 4PJNA 2P9BA 5F8PA 1LRZA 2ODVA 1BR2A 3EVYA 2AE9A 5LJMA 3AE3A 3Q5XA 4HTEA 5HXEA 3FB2A 2V7KA 4HKAA 1N34T 2Q9QB 4MBQA 5LXTE 2XPKA 1E7PA 3FZHB 1KK7A 3ZMZB 3AE4A 3PUGA 3RQWA 4LMKA 4CXXA 1N33T 4E7SA 2YDQA 2BS2A 2X0YA 4H9QC 2V1DB 3ESLA 3N2OA 3ANWB 5AQPB 1WYCA 3QK6A 5AQGB 4IE5A 4B3TT 3UU5A 1BR4A 4DUZT 1KF6A 3LBXA 3RKOA 4QX7B 2IHR1 3UQ7A 2YKSA 4B3ST 3OYXA 4EZHA 2XSBA 2FBWA 4OHFA 2JJ9A 1MIVA 2WB5A 3HKCE 3GN5B 1QLBA 4WZXA 3CQXC 3SS1A 4ZEYA 4HFIA 3VRAA 3NZPA 1YKHB 2E5LT 4WBNE 5AQOB 1WYBA 3TKLB 1HS7A 3CK6A 2XQYA 3KFWX 3LSVA 1WFDA 2ES0A 4YJ3E 3SFDA 1FMWA 3FXDB 2V6XA 4XZCA 4IL4A 3K8PC 1UCUA 2WMOA 2HHHT 3UUXB 2BZBA 4QXHB 3ZC1A 3O1JA 3I1AA 1D1BA 3FBZA 3R6NA 2XQ6A 5LBMA 2V5CA 2OA5A 2H88A 5KX5E 4AIUA 3E08A 2WY2A 5KMGP 4JI0T 3UTKA 2LT3A 4ZZBA 1U5PA 3ZT6A 3ZCIA 3O1HA 4CQIA 2WQYA 2JIWA 3AEFA 5C8YE 1YQ3A 4JI8T 4UF0A 4DV4T 3VHLA 2C0SA 1ZEEA 3I9YA 3ABVA 2BKPA 5HXRA 4F8HA 4YHJA 5H6RB 3MA9A 4H9RC 2UXCT 3KDSE 4PFPA 2W61A 3UFGA 2NW8A 4LFCT 5M4YA 5ETWA 2UXNB 2YDSA 3AAAB 5IYZE 2CHOA 3P50A 4IE7A 5HEHA 5AQUB 1MIWA 1HTJF 1N36T 5IUXA 4U33A 3AXJB 4LFBT 5FYMA 2JPFA 4YHHT 1KEYA 2IUBA 2VL0A 3KVAA 1IJ5A 3RIFA 3VRBA 1LKXA 2YEVC 1VRBA 2D5UA 1IJ6A 2V7MA 3UUMA 4K0UA 3MK7C 1NENA 4X1IE 3ZJ2A 5CFBA 4MFRA 3VKHA 2RA1A 3RYFE 3RC3A 5KDMC 5JQGE 4GYSA 4KHZF 4UELA 3PUVF 5L4HA 4NUVA 4IREA 5AQLB 2LSJA 3CKDA 1LVKA 3UU4A 4U31A 3FBLA 5IHYA 4FI5A 3EABA 4U3CA 4QHOA 4PFOA 3TLTA 4ZZCA 3N9LA 1YD8G 4NXMT 4NPPA 3LK3B 4CXWA 5FMNA 4ZI3D 3LFMA 1KFYA 2A72A 3SFEA 3G06A 3L39A 3K1SA 2EHOC 3F31A 4HWDA 4DV6T 2HN1A 1HF8A 2EHOA 5ABEA 2WZIA 1H7CA 3ETUA 3F57A 4X62T 3K3NA 4GKKT 4LF7T 2JMHA 3HI2A 1IBLT 2V7JA 1XWMA 3M3ZB 3AAIA 3TLWA 4UXNB 5ABFB 3RGLA 4U74A 1JNZA 4EB6E 2NTXA 2H7OA 3FZLB 4Z8XA 4EXTA 3ZT7A 3FZKB 4EYUA 5LG4A 1Z8UA 4DVDA 4YLHA 2K48A 2JQKA 5HEOA 4COFA 2J4GA 2QGSA 2ACXA 5AQTB 4WBOA 2UXDT 1B7TA 3P4SA 4GK5E 2MBGA 1J5ET 2BBJA 3RIAA 2AXDS 2WU5A 1BR1A 2E2AA 2C5JA 4PW8A 4DR1T 5AFUL 4I43B 2SPCA 4TV9E 5AQNB 4NUUA 4QWNB 1KNPA 1I94T 4YTMA 1R8IA 3KINB 4X1YE 5ABGA 2E9XB 3C50A 3T1HT 4PK6A 2W66A 5J0ZA 5F3JA 2UUCT 4CN1A 3DTOA 2CXLA 2MYSA 3P4WA 2H89A 2CXDA 2H7VC 3GWHA 3I9WA 2XAJB 3ZMUB 1OEDB 2CM0A 2W4XA 4J2CA 2HN2A 2W2UA 5J1GA 4UVCB 4DIDB 1ZP0A 5JVDE 2PFVA 4JUYA 4XAXB 3O1IA 2CEAA 2WZHA 2I0MA 3V5UA 2L8KA 5H6QB 4YTPA 3QUJA 3JAEA 2CXFA 4IL9A 1Y64B 2DWGA 4LMJA 4IHJE 4JI3T 5ABHA 3EAMA 2LHNA 4DNDA 3WAJA 3ZN0B 2R6GF 2HH7A 4BJMA 5HWYA 1XDOA 3NZQA 4KMCA 5L4EA 4PJLA 2WDQA 4ZI7E 1XNQT 4IDQA 1VCTA 3CWZB 1Z0PA 1AJ3A 4G2AA 5HWXA 2RPAA 2CPTA 2ZM6T 2LM9A 3QB5A 4G63A 4TNWA 1UX4A 2DCFA 1HG2A 2WWVA 2YU1A 2BG9B 2A2FX 5JRCB 4HE8A 2X9WA 5HEUA 3H3AA 4O2BE 4M1PA 3HL6A 3N5LA 1UUSA 3VR9A 4A97A 2D0UA 2PBIA 3C64A 5AQIB 3UUBA 5JR9C 1KNRA 4UIGA 4P1NA 2XSAA 3KV9A 4CXYA 3BQLA 3CX8B 4PNIA 5HCJA 2LHRA 2CLYC 5JR9A 3RI5A 3IBPA 3H3MA 3ZJ1A 3C4ZA 1T98A 2WWUA 5JDFA 5CGMA 4AXPA 3MKDA 5C2TA 5FVLA 5JDHA 5BMVE 2LSYA 5FP3A 4C91A 5CA0E 2CWOA 4WYVA 3UU8A 4JI4T 4O8SA 3KV6A 3QC9A 2CRBA 4EAHA 2LSIA 1VCSA 2NOXA 3O4XE 5JDNA 1LVFA 4O4HE 1D1CA 5EK4A 2LEHA 5AQHB 2M67A 1VOMA 2NW7A 1X79A 2VQFT 4DUYT 3EDVA 3KV4A 2X9HA 5J2UE 3RRCA 2K9AA 5JDLA 4LF8T 3GMIA 5FXWA 3SRZA 4YXDA 4BAYB 1FMVA 4JEHB 4QX8B 4L9IA 1D0XA 1DU2A 5AQKB 4F6RC 3CIRA 5EK3A 2E9XD 3AVRA 4U2YA 2W63A 2BKOA 4EYYR 2ODUA 2XY8B 1FJGT 1CUNA 2X67A 1IZNB 5HEGA 5C3JA 2PG8A 2ZMAA 4L5GA 3N9OA 4JEUB 1HX1B 1QUUA 4HGAA 3AAEB 1U4QA 2V7IA 5F5WA 3RF1A 4X66T 4TWDA 5HXCA 4QXBB 2Y8DA 4I4TE 3AB3B 4MLKA 1HFAA 3IHRA 4O4IE 4DMVA 3SOLA 4B6XA 3KVBA 3KBTA 4I55E 4PJJA 3JADA 2FJAA 4HEAA 2A3DA 4YTNA 2LE8A 1T7SA 4GIWA 4ZXLA 2E5VA 1X9BA 3DP7A 4AQFC 3TLVA 2J62A 2NW9A 3OTOT 2BG9C 1UK5A 4UV8B 3KBUA 2FJEA 5FVKA 2HPLA 4AQFA 2BG9A 4GKJT 4YSXA 2YDRA 4JI1T 4ZS3A 1ZKEA 2L3LA 2WP9A 4O4JE 2I6HA 3PJAA 3T8OA 3NRXA 5AQSB 2VKJA 2NR4A 4KP3C 3PTRB 4AI6A 2YN6A 4DR6T 1HNXT 3IA3A 2Q9QC 2V6YB 2VURA 4N78D 3RRWA 2BS3A 1YKEB 2Q9QA 2KSRA 5FL0A 2VKHA 2XQ9A 5JH7E 4V1Av 3U78A 3ZMVB 1KNZA 3K3QC 3AE9A 4AISA 4KUMB 1T72A 4U7YA 3AE1A 2JQQA 3A8YC 3OBVE 3TLSA 5AQVB 2WU2A 2UXXB 4TWFA 2LSKA 3ANWA 2XUEA 4IDOA 1HR0T 5EZYE 3S4UA 4HFHA 1Y01A 1CHUA 2ZM2A 3DJBA 2D9DA 4DV3T 4HWCA 1D1AA 4EIWA 1XMOT 4LF4T 4UEMA 5FKYA 4CZZB 4CI1B 2M6BA 3C4WA 1XDPA 1YW0A 3T1YT 3GN5A 2LJLA 2XM1A 3PDYA 4KX6A 4LMLA 3FHNA 5LYJE 5IWAT 5DJQC 2WSSV 1N32T 3BQIA 1M62A 3I0QA 3P7IA 2K5BB 2XASB 4BJNA 3N9NA 3EDUA 3VR8A 3U3IA 3EUHA 3RQUA 3PUQA 1S94A 2W00A 4ILUA 2NTYA 2EHOD 3PV0F 2VK9A 2D2SA 5JDQA 2H3RA 2W67A 1HNWT 2E8IA 4JI6T 2IC9A 2I59A 5HAXA 4IGUA 3ZSSA 1SE7A 4AKIA 1EZ3A 3AECA 3ZT5A 3PU3A 4A56A 3B5MA 1ZV4X 1WR0A 4UVAB 3P4RA 2VVNA 2C5KT 1T8BA 1V9DA 2B1EA 5LGTB 4DBQA 3N9MA 4PAGA 4A98A 5FXVA 4DBRA 4HFBA 2QA7A 3CVRA 4ZI2C 3HKDE 3AEGA 2KWIB 5L3FB 3AE5A 4YJ2E 1BR0A 2B76A 2WDVA 1YXRA 1D0ZA 3RC8A 3HA4A 1JNRA 5AQQB 2D0TA 2KWHA 2XQ4A 3WI3A 4JLEA 4ISTA 2BKNA 5FY7A 3AXJA 2X68A 3E22E 4ERRA 3JC6D 2QVAA 1UURA 2IMLA 2LKGA 1E2AA 3HKEE 4U7IA 1MMDA 3NBXX 3CPZA 4IDPA 3X1DA 4GOUA 4EOZB 1UGOA 5FXZA 4E7ZA 4B3MT 3WAKA 3ZYMA 3UQ4A 3HKBE 4ASKA 2VVSA 1US7B 2MPKA 3RYCE 3JAFA 3FZFB 3P4QA 3MACA 2PTFA 3CX6B 4OK0A 3Q5DA 4QKNA 3AVSA 2VKOA 2J47A 3I0OA 3UUNA 2HPJA 2UUAT 4HFCA 3AEAA 3K3OA 4X5TA 5DQWA 5HCMA 4ILCA 4L0RA 5L3DB 1L0VA 4IDZA 3B13A 4K0KT 5FNVE 1WRDA 2ZLYA 4DV1T 3AA6B 5LHGB 2FUPA 4WNKA 4P0BA 2LLYA 3BK9A 2LOSA 4UF0B 4H63V 4NXNT 2DWKA 4LF9T 5CB4E 2CMRA 1SUMB 2YK0A 4PK5A 3ZMSB 4PJMA 1NWMX 3RH3A 1E1HB 3PUWF 2VKDA 4TV8E 4TZ4C 3J7Yq 1J1JA 4HWFA 3AE7A 2QRXA 1MNDA 3NWIA 3RIUC 4TX5A 4LFAT 3V5SA 4H63H 4AQYT 5ABFA 3OYZA 3ETVA 4Q25A 1MIYA 3AA1B 3W15B 2JQ9A 3UT5E 4JV5T 2RP4A 4EGWA 3ZKRA 5JDMA 2XAHB 1FEWA 5LNKA 1FIOA 3ZN1B 4DR2T 3EHZA 1OWAA 4P09A 3ZCJA 4HFDA 1NAFA 4FJOA 2FJDA 2KZ7B 3ONJA 2NWBA 3ZEFB 3O9XA 4KI0F 4BA9A 3LG7A 3CX7B 2E9XC 4CN6A 1HCIA 4EEDA 5HYAA 4U2ZA 3FXEB 4H9SE 2E9XA 4DO0A 4IE4A 4OYJA 4AKGA 2NP9A 2IAKA 4DR5T 2KNDA 2IW5B 3ONLC 3L09A 2LOPA 2DLRA 2BDEA 1OEDC 5L47A 4CI3B 4TNVA 4PK4A 3Q2MA 4EV6A 2CBJA 3AE2A 1OEDA 3ZYLA 3ONXA 5TAOA 2EHOB 2X9YA 2YU2A 3UFEA 2N2NA 4JYAT 1O3XA 3N2GE 3AE8A 2LRKA 3ZPOA 1GQEA 4HFEA 5AQRB 4ADZA 5LG3A 4CN4A 3L8RA 4ILAA 2G0UA 2KXPB 2M6IA 3PUSA 1HNZT 3A5XA 3OKQA 5GONE 2A9UA 4OFZA 2DI4A 1S35A 4H9OC 3LDQB 5LA6E 5LHHB 2K3WA 2VQET 5LOVE 5L2LA 2UUBT 4DV7T 2J1DG 2DHRA 5L3BB 2WS3A 4GYRA 4X20E 4QXCB 4HWHA 1NEKA 3OPCA 3PUXF 2BVMA 3ZYKA 2XZEA 5BR8T 1ZOYA 3JCFA 4YT0A 2GK9A
chains in the Genus database with same CATH topology
3ZT6A 2JQ9A 4U2YA 1WR0A 4U2ZA 5CGMA 2V6YA 4CN1A 2LRLA 2LRKA 5FVLA 1WFDA 2JQHA 4CN4A 4A5XA 2JQKA 2WWVA 2DL1A 2MPKA 5CJ5A 2V6XA 4NIQA 4U33A 4U7IA 4U7YA 4P1NA 2V6YB 4IT4A 4WZXA 3ZSSA 2RPAA 2XZEA 2CPTA 3ZSTA 2WY2A 2A9UA 4ZEYA 4U31A 1YXRA 3K1SA 1WCRA 3ZT5A 5LB7B 3ZT7A 5FVKA 2K3WA 4CN6A 3EABA 2W2UA 4U3CA 2CRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT6 A;  2JQ9 A;  4U2Y A;  1WR0 A;  4U2Z A;  5CGM A;  2V6Y A;  4CN1 A;  2LRL A;  2LRK A;  5FVL A;  1WFD A;  2JQH A;  4CN4 A;  4A5X A;  2JQK A;  2WWV A;  2DL1 A;  2MPK A;  5CJ5 A;  2V6X A;  4NIQ A;  4U33 A;  4U7I A;  4U7Y A;  4P1N A;  2V6Y B;  4IT4 A;  4WZX A;  3ZSS A;  2RPA A;  2XZE A;  2CPT A;  3ZST A;  2WY2 A;  2A9U A;  4ZEY A;  4U31 A;  1YXR A;  3K1S A;  1WCR A;  3ZT5 A;  5LB7 B;  3ZT7 A;  5FVK A;  2K3W A;  4CN6 A;  3EAB A;  2W2U A;  4U3C A;  2CRB A; 
#chains in the Genus database with same CATH topology
 3E0Z A;  5LJN A;  2X51 A;  4IE6 A;  4DR7 T;  2YOE A;  2BVL A;  2BS4 A;  3LK4 2;  3KV5 A;  3M65 A;  2OLT A;  2CA5 A;  2X66 A;  3RKG A;  4MAL A;  1XNR T;  3L3P A;  2JMK A;  2C5I T;  5JRC A;  1MMG A;  5DAB A;  3A7M A;  3PE0 A;  3ZMT B;  2ZM0 A;  2XQ8 A;  5L3E B;  2XQ5 A;  3QNU A;  4LF5 T;  5E0O A;  1UX5 A;  3PUR A;  4UR9 A;  3AE6 A;  2K24 A;  4YFS A;  2CE7 A;  3N2K E;  4C90 A;  2WM9 A;  3N9P A;  4AQG A;  3P4P A;  3C4X A;  4EZ4 A;  2X0L B;  4JI5 T;  4IT4 A;  1W9R A;  3PUZ F;  4JI7 T;  3RHW A;  2KT9 A;  3RYH E;  4IDN A;  4HWI B;  2XQ3 A;  3LJC A;  3FZM B;  4ZI3 C;  2WMN A;  5JDG A;  4IIJ E;  1WLX A;  4QH4 A;  2V7L A;  3C98 B;  2VAS A;  4ISS A;  3UU6 A;  4ZHQ E;  4EEB A;  3AA0 B;  4P0A A;  5KXJ A;  3QOF A;  2XAG B;  2LSG A;  4OYK A;  4ZOL E;  4AKR B;  3IF8 B;  2IDO B;  3OJA A;  2ACZ A;  2Y6X A;  2Z6E A;  2Q9Q D;  2V8S V;  5LMU T;  4TN7 B;  2WDR A;  5FL1 A;  2DNX A;  5LGN B;  3EI0 A;  5FY0 A;  4MHC A;  2IIU A;  3UUL A;  3MXZ A;  4DMW A;  4A5X A;  2JRK A;  3R84 B;  1MNE A;  2XM2 A;  1D0Y A;  2W62 A;  2XJ7 A;  4JBW F;  4DR4 T;  5FXX A;  2XQ7 A;  2CBI A;  3H37 A;  4AKH A;  4TWH A;  5CA1 E;  4QH5 A;  1XZY A;  5AQM B;  2ZM8 A;  4DV2 T;  1J5W A;  2XQA A;  3ZST A;  5AQJ B;  3AED A;  2CHN A;  2IC6 A;  2XAQ B;  4KBM B;  2CCQ A;  5JR9 B;  5A1L A;  2DL1 A;  3NVO A;  4OX9 T;  4X65 T;  3LK2 B;  1SHZ C;  2YIN A;  3ZC0 A;  4UV9 B;  2CLY B;  5ADX L;  1W09 A;  3N9Q A;  2L9Q A;  2OV9 A;  3IEE A;  4U72 A;  2LRL A;  3UU3 A;  3TLU A;  2MAW A;  3ZLI A;  2W0G A;  4H9P C;  3VKG A;  2MOZ A;  3Q5E A;  2VL8 A;  2WBL A;  2V5D A;  4ANJ A;  5LP6 E;  3P8C D;  3JC6 C;  3RLF F;  4JI2 T;  3LBX B;  3HR0 A;  4YSZ A;  5LCY A;  4QH1 A;  4YSY A;  3RX6 A;  5L3G B;  2UXB T;  1OED E;  5J2T E;  5LB7 B;  1IBK T;  4XBF B;  3GA8 A;  2VB6 A;  2QYW A;  1MMN A;  3QB5 K;  3RPU A;  4DR3 T;  1ZHC A;  2JQH A;  4X1K E;  3PJA J;  3Q9D A;  1I6Z A;  2X0H A;  5LHI B;  2KIN B;  2BBH A;  5EK2 A;  5DQV A;  2KLQ A;  3AEE A;  5LGU B;  2F4V T;  4HN9 A;  2X9X A;  3PUY F;  5L3C B;  2KMF A;  5AQF B;  2V6Y A;  3PUA A;  3MZK B;  4UVB B;  4ZI2 D;  4AKL A;  2V26 A;  4DV5 T;  5CJ5 A;  3B57 A;  2N1G A;  2LKH A;  4Z90 A;  4O2A E;  1WCR A;  4YY3 T;  4I50 E;  2N9D A;  4IE0 A;  2Y48 B;  5LMN T;  2FJB A;  4Z91 A;  2MTQ A;  1SA0 E;  5FY1 A;  3NKZ A;  4KHP T;  3F2E A;  3MJX A;  2LM2 A;  1XMQ T;  3C51 A;  1YQ4 A;  3AA7 B;  3BQK A;  4WW0 A;  1WR6 A;  3RYI E;  3NRY A;  4HFV A;  1IAP A;  4X64 T;  3SWH A;  3VU7 H;  2BG9 E;  4TUY E;  2CWY A;  4O4L E;  1IBM T;  2UU9 T;  1G73 A;  5LBQ B;  3OVU A;  2VWA A;  3AEB A;  1W0B A;  5HXS A;  4B3R T;  3PU8 A;  2WAU A;  5HEJ A;  3CQG B;  2XHE B;  1HX8 A;  3D0T A;  4LF6 T;  2XTL A;  3J9X 1;  2PJQ A;  4ILB A;  1M7K A;  1OXZ A;  3RIU A;  3CML A;  4I0U A;  3CQC B;  1W0A A;  3Q5W A;  4DV0 T;  4ZS2 A;  2WCA A;  1HG5 A;  4GK0 E;  5JTG A;  1MMA A;  2XAF B;  1QSD A;  5JRE A;  4H9N C;  1G8X A;  4CI2 B;  5HXH A;  4NIQ A;  4PJN A;  2P9B A;  5F8P A;  1LRZ A;  2ODV A;  1BR2 A;  3EVY A;  2AE9 A;  5LJM A;  3AE3 A;  3Q5X A;  4HTE A;  5HXE A;  3FB2 A;  2V7K A;  4HKA A;  1N34 T;  2Q9Q B;  4MBQ A;  5LXT E;  2XPK A;  1E7P A;  3FZH B;  1KK7 A;  3ZMZ B;  3AE4 A;  3PUG A;  3RQW A;  4LMK A;  4CXX A;  1N33 T;  4E7S A;  2YDQ A;  2BS2 A;  2X0Y A;  4H9Q C;  2V1D B;  3ESL A;  3N2O A;  3ANW B;  5AQP B;  1WYC A;  3QK6 A;  5AQG B;  4IE5 A;  4B3T T;  3UU5 A;  1BR4 A;  4DUZ T;  1KF6 A;  3LBX A;  3RKO A;  4QX7 B;  2IHR 1;  3UQ7 A;  2YKS A;  4B3S T;  3OYX A;  4EZH A;  2XSB A;  2FBW A;  4OHF A;  2JJ9 A;  1MIV A;  2WB5 A;  3HKC E;  3GN5 B;  1QLB A;  4WZX A;  3CQX C;  3SS1 A;  4ZEY A;  4HFI A;  3VRA A;  3NZP A;  1YKH B;  2E5L T;  4WBN E;  5AQO B;  1WYB A;  3TKL B;  1HS7 A;  3CK6 A;  2XQY A;  3KFW X;  3LSV A;  1WFD A;  2ES0 A;  4YJ3 E;  3SFD A;  1FMW A;  3FXD B;  2V6X A;  4XZC A;  4IL4 A;  3K8P C;  1UCU A;  2WMO A;  2HHH T;  3UUX B;  2BZB A;  4QXH B;  3ZC1 A;  3O1J A;  3I1A A;  1D1B A;  3FBZ A;  3R6N A;  2XQ6 A;  5LBM A;  2V5C A;  2OA5 A;  2H88 A;  5KX5 E;  4AIU A;  3E08 A;  2WY2 A;  5KMG P;  4JI0 T;  3UTK A;  2LT3 A;  4ZZB A;  1U5P A;  3ZT6 A;  3ZCI A;  3O1H A;  4CQI A;  2WQY A;  2JIW A;  3AEF A;  5C8Y E;  1YQ3 A;  4JI8 T;  4UF0 A;  4DV4 T;  3VHL A;  2C0S A;  1ZEE A;  3I9Y A;  3ABV A;  2BKP A;  5HXR A;  4F8H A;  4YHJ A;  5H6R B;  3MA9 A;  4H9R C;  2UXC T;  3KDS E;  4PFP A;  2W61 A;  3UFG A;  2NW8 A;  4LFC T;  5M4Y A;  5ETW A;  2UXN B;  2YDS A;  3AAA B;  5IYZ E;  2CHO A;  3P50 A;  4IE7 A;  5HEH A;  5AQU B;  1MIW A;  1HTJ F;  1N36 T;  5IUX A;  4U33 A;  3AXJ B;  4LFB T;  5FYM A;  2JPF A;  4YHH T;  1KEY A;  2IUB A;  2VL0 A;  3KVA A;  1IJ5 A;  3RIF A;  3VRB A;  1LKX A;  2YEV C;  1VRB A;  2D5U A;  1IJ6 A;  2V7M A;  3UUM A;  4K0U A;  3MK7 C;  1NEN A;  4X1I E;  3ZJ2 A;  5CFB A;  4MFR A;  3VKH A;  2RA1 A;  3RYF E;  3RC3 A;  5KDM C;  5JQG E;  4GYS A;  4KHZ F;  4UEL A;  3PUV F;  5L4H A;  4NUV A;  4IRE A;  5AQL B;  2LSJ A;  3CKD A;  1LVK A;  3UU4 A;  4U31 A;  3FBL A;  5IHY A;  4FI5 A;  3EAB A;  4U3C A;  4QHO A;  4PFO A;  3TLT A;  4ZZC A;  3N9L A;  1YD8 G;  4NXM T;  4NPP A;  3LK3 B;  4CXW A;  5FMN A;  4ZI3 D;  3LFM A;  1KFY A;  2A72 A;  3SFE A;  3G06 A;  3L39 A;  3K1S A;  2EHO C;  3F31 A;  4HWD A;  4DV6 T;  2HN1 A;  1HF8 A;  2EHO A;  5ABE A;  2WZI A;  1H7C A;  3ETU A;  3F57 A;  4X62 T;  3K3N A;  4GKK T;  4LF7 T;  2JMH A;  3HI2 A;  1IBL T;  2V7J A;  1XWM A;  3M3Z B;  3AAI A;  3TLW A;  4UXN B;  5ABF B;  3RGL A;  4U74 A;  1JNZ A;  4EB6 E;  2NTX A;  2H7O A;  3FZL B;  4Z8X A;  4EXT A;  3ZT7 A;  3FZK B;  4EYU A;  5LG4 A;  1Z8U A;  4DVD A;  4YLH A;  2K48 A;  2JQK A;  5HEO A;  4COF A;  2J4G A;  2QGS A;  2ACX A;  5AQT B;  4WBO A;  2UXD T;  1B7T A;  3P4S A;  4GK5 E;  2MBG A;  1J5E T;  2BBJ A;  3RIA A;  2AXD S;  2WU5 A;  1BR1 A;  2E2A A;  2C5J A;  4PW8 A;  4DR1 T;  5AFU L;  4I43 B;  2SPC A;  4TV9 E;  5AQN B;  4NUU A;  4QWN B;  1KNP A;  1I94 T;  4YTM A;  1R8I A;  3KIN B;  4X1Y E;  5ABG A;  2E9X B;  3C50 A;  3T1H T;  4PK6 A;  2W66 A;  5J0Z A;  5F3J A;  2UUC T;  4CN1 A;  3DTO A;  2CXL A;  2MYS A;  3P4W A;  2H89 A;  2CXD A;  2H7V C;  3GWH A;  3I9W A;  2XAJ B;  3ZMU B;  1OED B;  2CM0 A;  2W4X A;  4J2C A;  2HN2 A;  2W2U A;  5J1G A;  4UVC B;  4DID B;  1ZP0 A;  5JVD E;  2PFV A;  4JUY A;  4XAX B;  3O1I A;  2CEA A;  2WZH A;  2I0M A;  3V5U A;  2L8K A;  5H6Q B;  4YTP A;  3QUJ A;  3JAE A;  2CXF A;  4IL9 A;  1Y64 B;  2DWG A;  4LMJ A;  4IHJ E;  4JI3 T;  5ABH A;  3EAM A;  2LHN A;  4DND A;  3WAJ A;  3ZN0 B;  2R6G F;  2HH7 A;  4BJM A;  5HWY A;  1XDO A;  3NZQ A;  4KMC A;  5L4E A;  4PJL A;  2WDQ A;  4ZI7 E;  1XNQ T;  4IDQ A;  1VCT A;  3CWZ B;  1Z0P A;  1AJ3 A;  4G2A A;  5HWX A;  2RPA A;  2CPT A;  2ZM6 T;  2LM9 A;  3QB5 A;  4G63 A;  4TNW A;  1UX4 A;  2DCF A;  1HG2 A;  2WWV A;  2YU1 A;  2BG9 B;  2A2F X;  5JRC B;  4HE8 A;  2X9W A;  5HEU A;  3H3A A;  4O2B E;  4M1P A;  3HL6 A;  3N5L A;  1UUS A;  3VR9 A;  4A97 A;  2D0U A;  2PBI A;  3C64 A;  5AQI B;  3UUB A;  5JR9 C;  1KNR A;  4UIG A;  4P1N A;  2XSA A;  3KV9 A;  4CXY A;  3BQL A;  3CX8 B;  4PNI A;  5HCJ A;  2LHR A;  2CLY C;  5JR9 A;  3RI5 A;  3IBP A;  3H3M A;  3ZJ1 A;  3C4Z A;  1T98 A;  2WWU A;  5JDF A;  5CGM A;  4AXP A;  3MKD A;  5C2T A;  5FVL A;  5JDH A;  5BMV E;  2LSY A;  5FP3 A;  4C91 A;  5CA0 E;  2CWO A;  4WYV A;  3UU8 A;  4JI4 T;  4O8S A;  3KV6 A;  3QC9 A;  2CRB A;  4EAH A;  2LSI A;  1VCS A;  2NOX A;  3O4X E;  5JDN A;  1LVF A;  4O4H E;  1D1C A;  5EK4 A;  2LEH A;  5AQH B;  2M67 A;  1VOM A;  2NW7 A;  1X79 A;  2VQF T;  4DUY T;  3EDV A;  3KV4 A;  2X9H A;  5J2U E;  3RRC A;  2K9A A;  5JDL A;  4LF8 T;  3GMI A;  5FXW A;  3SRZ A;  4YXD A;  4BAY B;  1FMV A;  4JEH B;  4QX8 B;  4L9I A;  1D0X A;  1DU2 A;  5AQK B;  4F6R C;  3CIR A;  5EK3 A;  2E9X D;  3AVR A;  4U2Y A;  2W63 A;  2BKO A;  4EYY R;  2ODU A;  2XY8 B;  1FJG T;  1CUN A;  2X67 A;  1IZN B;  5HEG A;  5C3J A;  2PG8 A;  2ZMA A;  4L5G A;  3N9O A;  4JEU B;  1HX1 B;  1QUU A;  4HGA A;  3AAE B;  1U4Q A;  2V7I A;  5F5W A;  3RF1 A;  4X66 T;  4TWD A;  5HXC A;  4QXB B;  2Y8D A;  4I4T E;  3AB3 B;  4MLK A;  1HFA A;  3IHR A;  4O4I E;  4DMV A;  3SOL A;  4B6X A;  3KVB A;  3KBT A;  4I55 E;  4PJJ A;  3JAD A;  2FJA A;  4HEA A;  2A3D A;  4YTN A;  2LE8 A;  1T7S A;  4GIW A;  4ZXL A;  2E5V A;  1X9B A;  3DP7 A;  4AQF C;  3TLV A;  2J62 A;  2NW9 A;  3OTO T;  2BG9 C;  1UK5 A;  4UV8 B;  3KBU A;  2FJE A;  5FVK A;  2HPL A;  4AQF A;  2BG9 A;  4GKJ T;  4YSX A;  2YDR A;  4JI1 T;  4ZS3 A;  1ZKE A;  2L3L A;  2WP9 A;  4O4J E;  2I6H A;  3PJA A;  3T8O A;  3NRX A;  5AQS B;  2VKJ A;  2NR4 A;  4KP3 C;  3PTR B;  4AI6 A;  2YN6 A;  4DR6 T;  1HNX T;  3IA3 A;  2Q9Q C;  2V6Y B;  2VUR A;  4N78 D;  3RRW A;  2BS3 A;  1YKE B;  2Q9Q A;  2KSR A;  5FL0 A;  2VKH A;  2XQ9 A;  5JH7 E;  4V1A v;  3U78 A;  3ZMV B;  1KNZ A;  3K3Q C;  3AE9 A;  4AIS A;  4KUM B;  1T72 A;  4U7Y A;  3AE1 A;  2JQQ A;  3A8Y C;  3OBV E;  3TLS A;  5AQV B;  2WU2 A;  2UXX B;  4TWF A;  2LSK A;  3ANW A;  2XUE A;  4IDO A;  1HR0 T;  5EZY E;  3S4U A;  4HFH A;  1Y01 A;  1CHU A;  2ZM2 A;  3DJB A;  2D9D A;  4DV3 T;  4HWC A;  1D1A A;  4EIW A;  1XMO T;  4LF4 T;  4UEM A;  5FKY A;  4CZZ B;  4CI1 B;  2M6B A;  3C4W A;  1XDP A;  1YW0 A;  3T1Y T;  3GN5 A;  2LJL A;  2XM1 A;  3PDY A;  4KX6 A;  4LML A;  3FHN A;  5LYJ E;  5IWA T;  5DJQ C;  2WSS V;  1N32 T;  3BQI A;  1M62 A;  3I0Q A;  3P7I A;  2K5B B;  2XAS B;  4BJN A;  3N9N A;  3EDU A;  3VR8 A;  3U3I A;  3EUH A;  3RQU A;  3PUQ A;  1S94 A;  2W00 A;  4ILU A;  2NTY A;  2EHO D;  3PV0 F;  2VK9 A;  2D2S A;  5JDQ A;  2H3R A;  2W67 A;  1HNW T;  2E8I A;  4JI6 T;  2IC9 A;  2I59 A;  5HAX A;  4IGU A;  3ZSS A;  1SE7 A;  4AKI A;  1EZ3 A;  3AEC A;  3ZT5 A;  3PU3 A;  4A56 A;  3B5M A;  1ZV4 X;  1WR0 A;  4UVA B;  3P4R A;  2VVN A;  2C5K T;  1T8B A;  1V9D A;  2B1E A;  5LGT B;  4DBQ A;  3N9M A;  4PAG A;  4A98 A;  5FXV A;  4DBR A;  4HFB A;  2QA7 A;  3CVR A;  4ZI2 C;  3HKD E;  3AEG A;  2KWI B;  5L3F B;  3AE5 A;  4YJ2 E;  1BR0 A;  2B76 A;  2WDV A;  1YXR A;  1D0Z A;  3RC8 A;  3HA4 A;  1JNR A;  5AQQ B;  2D0T A;  2KWH A;  2XQ4 A;  3WI3 A;  4JLE A;  4IST A;  2BKN A;  5FY7 A;  3AXJ A;  2X68 A;  3E22 E;  4ERR A;  3JC6 D;  2QVA A;  1UUR A;  2IML A;  2LKG A;  1E2A A;  3HKE E;  4U7I A;  1MMD A;  3NBX X;  3CPZ A;  4IDP A;  3X1D A;  4GOU A;  4EOZ B;  1UGO A;  5FXZ A;  4E7Z A;  4B3M T;  3WAK A;  3ZYM A;  3UQ4 A;  3HKB E;  4ASK A;  2VVS A;  1US7 B;  2MPK A;  3RYC E;  3JAF A;  3FZF B;  3P4Q A;  3MAC A;  2PTF A;  3CX6 B;  4OK0 A;  3Q5D A;  4QKN A;  3AVS A;  2VKO A;  2J47 A;  3I0O A;  3UUN A;  2HPJ A;  2UUA T;  4HFC A;  3AEA A;  3K3O A;  4X5T A;  5DQW A;  5HCM A;  4ILC A;  4L0R A;  5L3D B;  1L0V A;  4IDZ A;  3B13 A;  4K0K T;  5FNV E;  1WRD A;  2ZLY A;  4DV1 T;  3AA6 B;  5LHG B;  2FUP A;  4WNK A;  4P0B A;  2LLY A;  3BK9 A;  2LOS A;  4UF0 B;  4H63 V;  4NXN T;  2DWK A;  4LF9 T;  5CB4 E;  2CMR A;  1SUM B;  2YK0 A;  4PK5 A;  3ZMS B;  4PJM A;  1NWM X;  3RH3 A;  1E1H B;  3PUW F;  2VKD A;  4TV8 E;  4TZ4 C;  3J7Y q;  1J1J A;  4HWF A;  3AE7 A;  2QRX A;  1MND A;  3NWI A;  3RIU C;  4TX5 A;  4LFA T;  3V5S A;  4H63 H;  4AQY T;  5ABF A;  3OYZ A;  3ETV A;  4Q25 A;  1MIY A;  3AA1 B;  3W15 B;  2JQ9 A;  3UT5 E;  4JV5 T;  2RP4 A;  4EGW A;  3ZKR A;  5JDM A;  2XAH B;  1FEW A;  5LNK A;  1FIO A;  3ZN1 B;  4DR2 T;  3EHZ A;  1OWA A;  4P09 A;  3ZCJ A;  4HFD A;  1NAF A;  4FJO A;  2FJD A;  2KZ7 B;  3ONJ A;  2NWB A;  3ZEF B;  3O9X A;  4KI0 F;  4BA9 A;  3LG7 A;  3CX7 B;  2E9X C;  4CN6 A;  1HCI A;  4EED A;  5HYA A;  4U2Z A;  3FXE B;  4H9S E;  2E9X A;  4DO0 A;  4IE4 A;  4OYJ A;  4AKG A;  2NP9 A;  2IAK A;  4DR5 T;  2KND A;  2IW5 B;  3ONL C;  3L09 A;  2LOP A;  2DLR A;  2BDE A;  1OED C;  5L47 A;  4CI3 B;  4TNV A;  4PK4 A;  3Q2M A;  4EV6 A;  2CBJ A;  3AE2 A;  1OED A;  3ZYL A;  3ONX A;  5TAO A;  2EHO B;  2X9Y A;  2YU2 A;  3UFE A;  2N2N A;  4JYA T;  1O3X A;  3N2G E;  3AE8 A;  2LRK A;  3ZPO A;  1GQE A;  4HFE A;  5AQR B;  4ADZ A;  5LG3 A;  4CN4 A;  3L8R A;  4ILA A;  2G0U A;  2KXP B;  2M6I A;  3PUS A;  1HNZ T;  3A5X A;  3OKQ A;  5GON E;  2A9U A;  4OFZ A;  2DI4 A;  1S35 A;  4H9O C;  3LDQ B;  5LA6 E;  5LHH B;  2K3W A;  2VQE T;  5LOV E;  5L2L A;  2UUB T;  4DV7 T;  2J1D G;  2DHR A;  5L3B B;  2WS3 A;  4GYR A;  4X20 E;  4QXC B;  4HWH A;  1NEK A;  3OPC A;  3PUX F;  2BVM A;  3ZYK A;  2XZE A;  5BR8 T;  1ZOY A;  3JCF A;  4YT0 A;  2GK9 A; 
#chains in the Genus database with same CATH homology
 3ZT6 A;  2JQ9 A;  4U2Y A;  1WR0 A;  4U2Z A;  5CGM A;  2V6Y A;  4CN1 A;  2LRL A;  2LRK A;  5FVL A;  1WFD A;  2JQH A;  4CN4 A;  4A5X A;  2JQK A;  2WWV A;  2DL1 A;  2MPK A;  5CJ5 A;  2V6X A;  4NIQ A;  4U33 A;  4U7I A;  4U7Y A;  4P1N A;  2V6Y B;  4IT4 A;  4WZX A;  3ZSS A;  2RPA A;  2XZE A;  2CPT A;  3ZST A;  2WY2 A;  2A9U A;  4ZEY A;  4U31 A;  1YXR A;  3K1S A;  1WCR A;  3ZT5 A;  5LB7 B;  3ZT7 A;  5FVK A;  2K3W A;  4CN6 A;  3EAB A;  2W2U A;  4U3C A;  2CRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...