2E9XC

The crystal structure of human gins core complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
186
Chain Sequence
GPHMSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA replication complex GINS protein PSF1
publication title Structure of the human GINS complex and its assembly and functional interface in replication initiation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 59
structure length 186
sequence length 195
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05916 Sld5 GINS complex protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2e9xC00
3ANWB 2Q9QD 2E9XC 3JC6C 2EHOD
chains in the Genus database with same CATH superfamily
1KNPA 3A8YC 3PU8A 3EDUA 3FZLB 5LBQB 2NWBA 2JIWA 1ZOYA 2XAHB 2JJ9A 4DR1T 2BG9A 3LBXA 2WY2A 3ETUA 3ZCIA 3PUWF 4NUVA 2I59A 3PUYF 5AQOB 3RPUA 1N32T 3TLTA 2UXCT 3NBXX 4IDNA 4TV9E 3I1AA 3D0TA 4NXMT 2CXFA 4LFBT 2C5IT 3KVAA 3N9MA 3RYHE 5ADXL 3AE2A 5LHGB 1HTJF 1XDPA 2N9DA 3QB5A 2AE9A 3SS1A 3KV6A 3AAAB 4O8SA 3EUHA 3KDSE 4CN6A 5DJQC 3PUXF 4Q25A 4YJ2E 4JI3T 4UEMA 5KMGP 4A97A 2FBWA 2LKGA 1LVFA 2XQ3A 4TNVA 4HWFA 4DNDA 2CM0A 3UTKA 5ABGA 2LHNA 2BDEA 2ZLYA 1Y64B 3I9WA 2LSKA 2PJQA 1KNRA 1LRZA 5C3JA 4U2ZA 4FI5A 3UFGA 3VR8A 1Z8UA 2J1DG 1FIOA 3N2OA 4LF4T 4TUYE 4QH1A 3AA0B 1UUSA 3E0ZA 3EHZA 3KV4A 4B6XA 3NWIA 2H7OA 4IE7A 5JDHA 2WDRA 3AEEA 2YDRA 2E9XC 5HXEA 1J5ET 1V9DA 2XAQB 3P8CD 4HGAA 5F8PA 4AQFC 5LB7B 2VQFT 1VCTA 2XQ4A 3KBTA 2E9XD 3AECA 1UX5A 3JAFA 1J5WA 4X20E 2PTFA 3ZSTA 3FBLA 3B5MA 5CB4E 2UXXB 2XHEB 4UIGA 3DTOA 2V7IA 2CHOA 2ZM6T 2V8SV 1NEKA 4UV8B 4ERRA 2V6XA 4N78D 2V7LA 4X64T 1QUUA 1WYCA 1D1CA 2VVNA 3OKQA 4ZS3A 4L5GA 3RI5A 3AVSA 4A56A 2IC6A 3AA7B 2D0TA 2Y6XA 4ZOLE 4E7ZA 3Q5DA 2W00A 5JH7E 1HX1B 1IZNB 3Q2MA 3UU4A 3ONLC 2VVSA 3Q9DA 5LG4A 5FY7A 3RQUA 2H3RA 4GK0E 3U3IA 1IJ5A 4YJ3E 3C51A 3S4UA 4GKJT 5JRCA 3PUZF 4IE6A 4BJMA 1MNDA 3ZT5A 1I6ZA 4DMVA 2HPLA 4X1YE 1N36T 5JDLA 2WM9A 4BA9A 3UT5E 3E08A 3T1HT 2LE8A 3CKDA 2IW5B 2N1GA 2LSJA 2WS3A 1SE7A 2VQET 3MKDA 3O1IA 4TV8E 4CI2B 2BKPA 2WDQA 3RYCE 2BG9B 5HCMA 3V5SA 3LBXB 4DMWA 4HFEA 4ILAA 3B13A 4OHFA 4QXBB 3I9YA 4GYRA 4ZI7E 4TWHA 4IDZA 1KFYA 4DV3T 4H9RC 2W2UA 5HEOA 3HKBE 4PJJA 2DLRA 5EK4A 5IHYA 4OFZA 3RX6A 2V7JA 2FUPA 3AXJA 2CA5A 3N9PA 4XZCA 1D1BA 4LMLA 3C4XA 5L4EA 4DV1T 4U31A 2UXNB 3AE9A 5FL1A 4H9PC 2KNDA 2VL0A 3CX6B 4QKNA 5IYZE 4IE0A 2CMRA 1VOMA 2X9YA 3HI2A 3RC3A 2K9AA 2J47A 3N9OA 4AQYT 3ZN1B 2H7VC 4DR5T 4O4IE 4YHHT 4TWFA 1JNRA 4HKAA 2CEAA 2X66A 1S94A 2LOPA 3AE7A 1J1JA 2VKDA 3ZYMA 3MXZA 1UX4A 2K48A 5AQHB 2AXDS 1UGOA 3KFWX 4O4LE 2M6IA 3H37A 4IIJE 2IIUA 2XSAA 1E7PA 2HN2A 2IHR1 3P4WA 5JVDE 4EB6E 2NW7A 4DV6T 4NPPA 2L9QA 3B57A 5LGNB 3ZPOA 4I55E 2V7MA 3H3MA 5CFBA 2OLTA 3WAKA 3RKGA 5AQIB 3L39A 3HL6A 2DI4A 3ONJA 5HEHA 3LSVA 3E22E 3ESLA 2BS4A 2XZEA 2D2SA 3LJCA 4HFHA 2K3WA 5LMNT 2JQ9A 3L8RA 5HEGA 2H89A 4IDPA 4MHCA 5HAXA 2HN1A 2WMNA 4HFIA 1B7TA 3RQWA 2J4GA 3VRAA 4JI5T 5LJNA 3AVRA 1OWAA 5H6RB 3OBVE 4QX8B 3FZFB 5JRCB 5KDMC 2M6BA 2Z6EA 3UUXB 4JYAT 1MMAA 1D1AA 3VKGA 5AQJB 3NVOA 2LSYA 3TKLB 2PFVA 3ZMUB 3NKZA 4DV7T 5CGMA 2BG9C 2X9WA 4LF8T 2KSRA 2KINB 2CPTA 2EHOD 3QOFA 4JLEA 1NAFA 5LGUB 3I0QA 1IJ6A 3SFDA 3RC8A 3JC6C 3LDQB 3MZKB 4UVBB 3G06A 5AQNB 2VWAA 1D0XA 4PK5A 3JC6D 4CXYA 4IE4A 4UXNB 4I50E 3AE6A 3JAEA 5ETWA 2VURA 1ZP0A 3NRYA 1HS7A 3TLVA 1YW0A 4EZ4A 3W15B 1XNQT 2NP9A 3UQ7A 4QH5A 3AXJB 2WAUA 4U7IA 2BVMA 2V5DA 4U72A 4OYJA 4U74A 2BG9E 2MPKA 1SHZC 3RYFE 2E8IA 2ACXA 2XQ5A 4ZI2C 5JDFA 2V26A 3ZSSA 1KNZA 1T98A 4CI3B 5F3JA 2WU2A 1U5PA 1OEDE 2C0SA 2M67A 2QGSA 1BR2A 5LG3A 2VK9A 3FHNA 2Y8DA 3I0OA 4YLHA 5DABA 3QC9A 1HCIA 4AQGA 4OX9T 2WWUA 4G63A 5L3BB 3UQ4A 2OA5A 3ONXA 2YOEA 5BR8T 2QA7A 2XUEA 2KMFA 5J2TE 2X0YA 4A98A 3QK6A 3CK6A 4KI0F 5FL0A 5LHIB 1XMOT 4TWDA 1ZHCA 3PUAA 5DQWA 2K5BB 2L8KA 4O4JE 3U78A 1WCRA 4X65T 5IUXA 4HN9A 4OK0A 3L3PA 1MIVA 4EV6A 4B3TT 5AQSB 3HR0A 3ZEFB 4DR4T 2ZM2A 4I43B 1NENA 2CXLA 3QUJA 5AQMB 4PW8A 5TAOA 3ZYLA 2X0LB 4TNWA 2LM2A 5JR9A 2XJ7A 3ZT6A 3AE5A 1FJGT 4OYKA 1LVKA 2VKOA 1BR0A 3ANWA 5HXSA 3HKDE 3RH3A 2UUBT 3FZHB 4KHPT 3VKHA 2V1DB 5FMNA 4WBNE 4JI0T 3V5UA 4TZ4C 5LP6E 3C98B 4WBOA 4AISA 2Q9QA 2KLQA 4U2YA 2DNXA 4UVAB 3BK9A 3N2KE 2YN6A 2DCFA 3AAEB 5JDNA 3CVRA 5LOVE 2BVLA 4Z8XA 2Y48B 5FXZA 2LRKA 3AEGA 2W63A 2LM9A 5AQLB 5HWXA 4CXWA 2DWGA 1M7KA 2MBGA 3CX8B 3RIUA 4WZXA 2D0UA 3C4WA 3UUNA 3KINB 5HEUA 3P4PA 2JMHA 2WWVA 4LMJA 5AQTB 1JNZA 2WB5A 3AE3A 2JMKA 4LFAT 1ZV4X 5L3DB 4I0UA 1YD8G 4IDQA 4PNIA 4AKRB 3F31A 2X51A 5FY0A 4CN4A 3P50A 4J2CA 4ZZCA 4O2BE 2BKNA 2WZHA 4K0KT 2CE7A 4IL9A 4HWCA 1HF8A 4HEAA 1IBLT 4GK5E 5EK2A 4DV5T 2CLYB 4XAXB 3PUQA 4C91A 2LSIA 1MIWA 2I0MA 4HFCA 4UV9B 4YSXA 2WCAA 2H88A 4KUMB 3KV9A 5ABFA 4NXNT 2UXDT 1N33T 2FJBA 2RP4A 2JRKA 2CCQA 3ZKRA 3LK3B 1T7SA 5KXJA 2DWKA 1AJ3A 2A2FX 4P1NA 1O3XA 3PJAA 4TX5A 3SOLA 4JEHB 4QWNB 5F5WA 3CMLA 4ILUA 5FXWA 2XASB 3UU5A 2NR4A 4YTNA 2C5KT 4ZI3C 4EEDA 2FJAA 4DR6T 2PBIA 1WR6A 2QVAA 2CWYA 3BQIA 4ZI3D 3PURA 3OVUA 4G2AA 5CA1E 5L3CB 1R8IA 3VU7H 5FXXA 4IGUA 2YDSA 2CBIA 1H7CA 4ZZBA 3UU6A 4LF6T 4COFA 3RKOA 4PK6A 5L4HA 1SA0E 5JR9B 2RA1A 4U33A 2KWIB 4DBRA 4P0BA 3UUBA 2NW8A 3ANWB 3KV5A 4MLKA 3UU8A 2XSBA 3HA4A 3AB3B 2FJEA 4YTPA 5FKYA 4QX7B 2IC9A 2E5VA 4IE5A 4YT0A 4X66T 2LJLA 4UF0A 2Q9QB 3JCFA 3EVYA 5JDQA 1XZYA 3ZMTB 2YINA 3ETVA 5IWAT 2ZMAA 3KVBA 5AQFB 2VL8A 3TLUA 2VKJA 3AEAA 3MA9A 2KT9A 3O1HA 5LA6E 5HXHA 2OV9A 1WFDA 4P09A 1HFAA 1X79A 4CZZB 3HKCE 4ANJA 3H3AA 3CWZB 4DVDA 4UR9A 1WYBA 2XQYA 3AEDA 2UUAT 5JQGE 2YU1A 3RHWA 1M62A 4WW0A 3K3NA 4EZHA 4DR7T 4ZXLA 4QXHB 1WLXA 4IT4A 4HE8A 3SWHA 5L3EB 3AAIA 4ASKA 5DQVA 3PJAJ 4AKLA 2CWOA 4U3CA 3ZYKA 1UURA 1XNRT 3WI3A 4NIQA 2C5JA 5E0OA 4EAHA 4HFDA 3N9LA 4YY3T 2WBLA 3RGLA 5ABHA 2CLYC 4ADZA 4AI6A 2XTLA 4HFVA 2XM2A 2G0UA 2WP9A 1US7B 4LF5T 1L0VA 2HH7A 3AEBA 2ZM8A 1NWMX 4PJMA 2KWHA 3HKEE 2JPFA 4Z91A 5ABFB 3ZJ2A 3WAJA 1IAPA 1E1HB 1YKEB 5L47A 3K1SA 5GONE 1W0AA 2F4VT 2MAWA 3ABVA 1UK5A 3IHRA 4X62T 4WYVA 2V6YA 2LSGA 2SPCA 3P4QA 3GA8A 2LHRA 3ZC1A 3UU3A 1CUNA 2BS2A 2GK9A 2ACZA 3N5LA 3ZT7A 4L0RA 5M4YA 3M3ZB 3NRXA 4EOZB 2P9BA 2XQ8A 2CHNA 4AKIA 2L3LA 4AIUA 5JR9C 1WR0A 2X0HA 3IA3A 2MTQA 3QB5K 5J0ZA 5H6QB 2JQHA 3DJBA 5C8YE 3PE0A 1YKHB 3EDVA 1BR4A 5JDGA 3TLSA 3FZKB 4HWIB 3IBPA 2W66A 4MBQA 1W9RA 5FXVA 2NOXA 4WNKA 4HFBA 4ZI2D 2Q9QC 2DL1A 1IBMT 3N2GE 1UCUA 3FZMB 5JTGA 5LGTB 2BZBA 2HHHT 1EZ3A 3LK42 3EAMA 2YK0A 4IREA 2ES0A 2D9DA 4ILCA 5AQGB 2E2AA 4B3ST 5KX5E 4I4TE 4UF0B 3F2EA 5L2LA 2WU5A 5CJ5A 4YSZA 1MMNA 3OTOT 3VHLA 2LOSA 3RIUC 2IDOB 3KBUA 2LT3A 4KP3C 2XM1A 2QYWA 5FP3A 3IF8B 4GKKT 2RPAA 2EHOA 3GWHA 3FB2A 4B3RT 4P0AA 4H9OC 3ZLIA 3ZMZB 4O4HE 1OEDA 2XY8B 5EK3A 1KF6A 2X9HA 4YSYA 4DIDB 1SUMB 5FY1A 5ABEA 2J62A 4O2AE 1LKXA 2A9UA 2QRXA 4F8HA 3UFEA 1X9BA 3CX7B 3FXEB 5HYAA 2W4XA 2KXPB 3GMIA 1BR1A 3EI0A 4QH4A 1HR0T 4TN7B 2BBJA 1G8XA 5L3FB 2N2NA 3K8PC 5HXRA 1S35A 4YXDA 2WZIA 3AE4A 2YEVC 3RYIE 2FJDA 4FJOA 3CQGB 4IL4A 4XBFB 4LFCT 1VRBA 4M1PA 1YQ3A 3O1JA 3J9X1 2YKSA 4X1KE 1D0ZA 4H63H 3JADA 1HNZT 5FNVE 3P4SA 4GOUA 4KHZF 4JI2T 2V6YB 3RRWA 4E7SA 4MFRA 1Z0PA 4MALA 2VB6A 4Z90A 3PU3A 3TLWA 2DHRA 2JQKA 3VR9A 2MOZA 4L9IA 3EABA 4JI8T 1FMVA 4H9NC 2X67A 2E5LT 1ZKEA 5LBMA 4DV4T 4EIWA 4ZS2A 1Y01A 4UVCB 3OPCA 3AEFA 4ISTA 2BS3A 2D5UA 4X1IE 1FEWA 3SFEA 2XAJB 3CIRA 3PUSA 2W67A 4EXTA 3GN5A 5AFUL 4U7YA 3RIAA 5HEJA 2WMOA 3BQLA 2LEHA 4PK4A 3C50A 4JI4T 2W61A 3M65A 5JREA 4JI7T 3IEEA 4KMCA 2NTYA 1W09A 2VKHA 2WSSV 2KZ7B 4YFSA 4JV5T 4BAYB 3ZMVB 4KBMB 2CBJA 1E2AA 2E9XA 4ZHQE 3PUVF 2CXDA 2EHOB 4AQFA 1N34T 4EGWA 5LMUT 3L09A 2XQ7A 3AE8A 2XPKA 5AQUB 2YU2A 4DV0T 3A7MA 4AKGA 3K3QC 4X5TA 5AQPB 5LNKA 1OEDB 3CQXC 3PDYA 2XQAA 4CN1A 5C2TA 1W0BA 3RRCA 4QXCB 2B76A 3DP7A 2W62A 2LLYA 3K3OA 1CHUA 3ZC0A 3MJXA 2ODUA 2A3DA 4ZEYA 3ZJ1A 1HG5A 1MNEA 2IUBA 3FXDB 2ODVA 3MACA 5BMVE 4DO0A 1ZEEA 2LKHA 4AKHA 4CI1B 2IMLA 1T8BA 2V7KA 1KK7A 4QHOA 2X68A 2B1EA 3Q5XA 4KX6A 2V5CA 4V1Av 3J7Yq 4YHJA 4JI1T 1XMQT 4GYSA 5L3GB 4HWDA 1U4QA 1YQ4A 1HNXT 2PG8A 1YXRA 3N9QA 2YDQA 1MMDA 4LMKA 5JDMA 4CQIA 3C4ZA 1DU2A 1I94T 3R6NA 3LFMA 4JUYA 5FVKA 3LK2B 3C64A 2W0GA 3AE1A 2K24A 3R84B 5LHHB 4UELA 2WQYA 4YTMA 2X9XA 1OXZA 5AQVB 3MK7C 3LG7A 3AA1B 3QNUA 4AXPA 4IHJE 4ILBA 4DUZT 1XDOA 4CXXA 4PAGA 5LYJE 5FVLA 3GN5B 1HX8A 5J2UE 5HWYA 4K0UA 3T8OA 5AQKB 2UU9T 3NZPA 3F57A 4DBQA 3NZQA 3A5XA 2UUCT 5AQRB 3OYXA 2IAKA 4DR2T 3ZN0B 4ISSA 3FBZA 1G73A 4B3MT 1MMGA 1HG2A 4C90A 1T72A 4F6RC 1XWMA 4PJNA 4H9QC 1MIYA 2JQQA 3PTRB 4EYUA 3Q5EA 2EHOC 4PFPA 3CQCB 2MYSA 2CRBA 4HTEA 5LXTE 4HWHA 4DR3T 4JEUB 5AQQB 4LF9T 2E9XB 2XAFB 1OEDC 4GIWA 3RLFF 3ZMSB 3UULA 1IBKT 3O9XA 2WDVA 2NTXA 4H9SE 2ZM0A 3RIFA 1HNWT 5A1LA 4A5XA 4H63V 2XQ6A 1QSDA 5J1GA 4JI6T 1WRDA 4DUYT 2LRLA 1VCSA 2BBHA 3RF1A 5FYMA 1FMWA 3T1YT 3VRBA 3AA6B 4EYYR 3PV0F 5EZYE 3N9NA 2I6HA 3OYZA 5HXCA 1QLBA 3UUMA 3OJAA 3SRZA 5LJMA 4JBWF 4PFOA 2HPJA 2XAGB 1GQEA 3O4XE 4DV2T 3CPZA 4NUUA 3P7IA 1KEYA 2UXBT 3BQKA 4IDOA 3ZCJA 2R6GF 4PJLA 4EEBA 5CA0E 2BKOA 3PUGA 4BJNA 2Q9QD 5HCJA 4LF7T 3X1DA 2A72A 2NW9A 3Q5WA 3P4RA 2VASA 2XQ9A 1D0YA 5LCYA
chains in the Genus database with same CATH topology
3PU3A 2DHRA 3EDUA 3PU8A 3RKOA 5LJNA 3AVRA 5LBQB 1OWAA 5H6RB 3OBVE 2MOZA 4L9IA 4PK6A 4QX8B 1SA0E 5JR9B 2NWBA 2RA1A 2KWIB 5JRCB 2XAHB 2JJ9A 5KDMC 1FMVA 4DBRA 4H9NC 3LBXA 2X67A 3ETUA 3ZCIA 4P0BA 2Z6EA 3UUXB 2NW8A 1ZKEA 5LBMA 1MMAA 1D1AA 3VKGA 3ANWB 3KV5A 4NUVA 4EIWA 2I59A 4MLKA 4ZS2A 3RPUA 2LSYA 3TKLB 3NBXX 2PFVA 3ZMUB 3HA4A 4TV9E 3AB3B 4UVCB 3I1AA 3D0TA 2X9WA 2KINB 2IC9A 2CXFA 4ISTA 4QX7B 2C5IT 3KVAA 3N9MA 4IE5A 3RYHE 2LJLA 4UF0A 2D5UA 2Q9QB 1FEWA 4X1IE 5ADXL 2EHOD 3EVYA 5JDQA 2XAJB 5LHGB 4JLEA 1NAFA 5LGUB 3I0QA 1IJ6A 1HTJF 3RC8A 3ZMTB 2YINA 3JC6C 3MZKB 4UVBB 2N9DA 3ETVA 3PUSA 4EXTA 2ZMAA 3GN5A 3KVBA 3SS1A 5AFUL 2VWAA 3KV6A 3AAAB 4O8SA 1D0XA 3EUHA 4PK5A 3KDSE 2VL8A 5DJQC 3JC6D 4CXYA 4YJ2E 2VKJA 4IE4A 4UXNB 4I50E 3MA9A 4UEMA 5KMGP 2KT9A 3O1HA 5LA6E 5HXHA 5ETWA 1LVFA 2WMOA 3BQLA 4P09A 2LEHA 1HFAA 3NRYA 1X79A 1HS7A 4PK4A 4CZZB 1YW0A 3HKCE 3C50A 3H3AA 4ANJA 4DNDA 4EZ4A 3CWZB 4DVDA 3W15B 2W61A 2CM0A 3M65A 2NP9A 3UTKA 1WYBA 2XQYA 5JREA 5JQGE 2LHNA 2YU1A 3IEEA 2BDEA 2ZLYA 1Y64B 2NTYA 2WAUA 2LSKA 2PJQA 3I9WA 1LRZA 4KMCA 2VKHA 2BVMA 2WSSV 2KZ7B 4YFSA 4WW0A 4FI5A 3K3NA 4EZHA 4U72A 4OYJA 4U74A 4BAYB 2J1DG 3ZMVB 1FIOA 4KBMB 3N2OA 1SHZC 3RYFE 2E9XA 4QXHB 4ZHQE 2E8IA 2ACXA 1WLXA 4TUYE 4HE8A 3SWHA 5L3EB 4ZI2C 3AA0B 5JDFA 2V26A 1KNZA 1T98A 4CI3B 3E0ZA 2CXDA 5F3JA 2EHOB 3AAIA 4AQFA 4ASKA 5DQVA 3KV4A 4AKLA 4B6XA 1U5PA 2CWOA 2C0SA 2M67A 3L09A 3ZYKA 2H7OA 2QGSA 1BR2A 4IE7A 3WI3A 2VK9A 2C5JA 5E0OA 4EAHA 3FHNA 2Y8DA 5JDHA 2E9XC 3I0OA 2YU2A 4YLHA 5DABA 5HXEA 3N9LA 1V9DA 4AKGA 3K3QC 5LNKA 3QC9A 3CQXC 1HCIA 3PDYA 2XAQB 3P8CD 4HGAA 2WBLA 5F8PA 4AQGA 3RRCA 2CLYC 4QXCB 4ADZA 4AQFC 2WWUA 4G63A 3KBTA 3DP7A 5L3BB 2E9XD 4AI6A 2XTLA 1UX5A 4HFVA 2G0UA 2W62A 3ZC0A 3K3OA 2OA5A 3ONXA 1US7B 3MJXA 2ODUA 2QA7A 4X20E 2A3DA 2XUEA 1HG5A 1MNEA 3ZJ1A 3FBLA 2KMFA 5J2TE 3FXDB 2HH7A 5CB4E 2UXXB 2XHEB 1NWMX 2ZM8A 2ODVA 3QK6A 3MACA 4UIGA 5BMVE 4PJMA 2KWHA 3DTOA 3HKEE 4DO0A 2V7IA 5LHIB 1ZEEA 2JPFA 4UV8B 4ERRA 1ZHCA 3PUAA 5DQWA 2K5BB 4N78D 4AKHA 4CI1B 2V7LA 1QUUA 1WYCA 2L8KA 2V7KA 1KK7A 4O4JE 1D1CA 3OKQA 4ZS3A 3U78A 3WAJA 4L5GA 1IAPA 4QHOA 1E1HB 1YKEB 2X68A 2B1EA 3Q5XA 4HN9A 3AVSA 5GONE 4OK0A 3L3PA 1MIVA 4A56A 2IC6A 3AA7B 2D0TA 2Y6XA 4ZOLE 3HR0A 4V1Av 4E7ZA 3ZEFB 3J7Yq 2W00A 5JH7E 2ZM2A 1IZNB 4YHJA 4I43B 2CXLA 3IHRA 3Q2MA 3QUJA 4PW8A 5TAOA 4GYSA 3Q9DA 3ZYLA 2LSGA 2X0LB 5LG4A 2SPCA 5FY7A 3GA8A 5L3GB 2H3RA 4GK0E 3U3IA 2LHRA 3ZC1A 1IJ5A 4YJ3E 1CUNA 5JR9A 1U4QA 3C51A 2GK9A 3S4UA 5JRCA 3N5LA 4IE6A 4BJMA 1MNDA 4L0RA 4OYKA 5M4YA 1LVKA 2PG8A 3NRXA 4EOZB 2VKOA 4DMVA 2P9BA 1BR0A 3ANWA 5HXSA 2HPLA 4AKIA 2L3LA 3HKDE 4X1YE 3RH3A 3N9QA 5JDLA 2WM9A 5JR9C 4BA9A 1MMDA 3UT5E 3E08A 5JDMA 3VKHA 2V1DB 5FMNA 4WBNE 4CQIA 2LE8A 2MTQA 3V5UA 3CKDA 2IW5B 2N1GA 3C4ZA 2LSJA 5H6QB 3R6NA 4TZ4C 3DJBA 5LP6E 3C98B 5C8YE 3MKDA 3O1IA 4WBOA 3LFMA 2Q9QA 2KLQA 4TV8E 3PE0A 2DNXA 1YKHB 4JUYA 4UVAB 3EDVA 3LK2B 4CI2B 3C64A 1BR4A 2W0GA 3BK9A 3N2KE 5JDGA 2DCFA 3AAEB 5JDNA 3CVRA 3IBPA 5LOVE 2BVLA 4Z8XA 3RYCE 3V5SA 2K24A 3LBXB 2Y48B 4DMWA 3R84B 4MBQA 5FXVA 5FXZA 2NOXA 3B13A 4OHFA 2W63A 4WNKA 5LHHB 2LM9A 4QXBB 3I9YA 4ZI2D 5HWXA 4UELA 2Q9QC 3N2GE 4GYRA 4ZI7E 2X9XA 4CXWA 1UCUA 1OXZA 5LGTB 2DWGA 2BZBA 4IDZA 3MK7C 2MBGA 1EZ3A 3LK42 3LG7A 2YK0A 3CX8B 4H9RC 3AA1B 2ES0A 3HKBE 4PJJA 2D0UA 2DLRA 5KX5E 4I4TE 5EK4A 4UF0B 5IHYA 3F2EA 4OFZA 4AXPA 3C4WA 3RX6A 5L2LA 2V7JA 3UUNA 3KINB 2CA5A 3N9PA 4IHJE 4CXXA 4PAGA 1MMNA 4XZCA 1D1BA 5LYJE 3VHLA 3C4XA 2JMHA 2LOSA 3GN5B 2UXNB 1HX8A 5J2UE 5HWYA 3KBUA 4K0UA 3T8OA 2LT3A 4H9PC 3NZPA 4KP3C 3F57A 4DBQA 2JMKA 2KNDA 3NZQA 3A5XA 3CX6B 3OYXA 2IAKA 4QKNA 5FP3A 1ZV4X 3IF8B 5IYZE 5L3DB 3ZN0B 1YD8G 4IE0A 4ISSA 3FBZA 1G73A 2EHOA 3GWHA 4PNIA 4AKRB 1MMGA 1HG2A 3F31A 2X51A 5FY0A 4C90A 4F6RC 2CMRA 1VOMA 2X9YA 3FB2A 4J2CA 4PJNA 4P0AA 3HI2A 4H9QC 4H9OC 4O2BE 1MIYA 3RC3A 3ZLIA 3ZMZB 2JQQA 3PTRB 4O4HE 2CE7A 2K9AA 4EYUA 2EHOC 3N9OA 4PFPA 3ZN1B 3CQCB 2MYSA 5EK3A 2H7VC 4O4IE 2X9HA 4HTEA 5LXTE 1HF8A 4HKAA 4JEUB 4HEAA 2CEAA 4GK5E 2E9XB 2X66A 1S94A 2XAFB 5EK2A 5FY1A 2LOPA 4GIWA 3ZMSB 4O2AE 2CLYB 4XAXB 2VKDA 3UULA 1LKXA 3MXZA 3ZYMA 3PUQA 1UX4A 2K48A 4H9SE 2NTXA 4C91A 2LSIA 1MIWA 3O9XA 3UFEA 3CX7B 2ZM0A 3FXEB 4UV9B 5A1LA 4H63V 4KUMB 3KV9A 1QSDA 3KFWX 4O4LE 3H37A 5HYAA 2KXPB 5J1GA 4IIJE 3GMIA 1BR1A 1WRDA 4TN7B 2RP4A 1FMWA 2JRKA 5FYMA 5JVDE 4EB6E 2CCQA 2NW7A 3AA6B 4EYYR 2L9QA 3B57A 1G8XA 5LGNB 3LK3B 5L3FB 5EZYE 3ZPOA 2N2NA 4I55E 2V7MA 3N9NA 2DWKA 1AJ3A 3OYZA 2A2FX 5HXCA 3UUMA 1O3XA 3K8PC 3OJAA 4TX5A 3SRZA 3WAKA 3SOLA 4JEHB 5LJMA 3HL6A 1S35A 2DI4A 5HXRA 4QWNB 4PFOA 2HPJA 3CMLA 2XAGB 4ILUA 5FXWA 2XASB 2YEVC 3O4XE 3E22E 3RYIE 3ESLA 3CPZA 4NUUA 3P7IA 2C5KT 4ZI3C 3BQKA 4FJOA 3CQGB 2PBIA 3ZCJA 1WR6A 2D2SA 4PJLA 5CA0E 3LJCA 4XBFB 4BJNA 3PUGA 2CWYA 2Q9QD 1VRBA 3BQIA 4M1PA 4ZI3D 3PURA 2A72A 3O1JA 4G2AA 2NW9A 5CA1E 3J9X1 3Q5WA 5L3CB 2VASA 4X1KE 3VU7H 1D0YA 1D0ZA 4H63H 5FXXA 4IGUA 4MHCA 5HAXA 2WMNA 5FNVE 1B7TA 5LCYA 4GOUA 3ZJ2A 3RRWA 1H7CA 4E7SA 4MFRA 1Z0PA 4MALA 2VB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ANW B;  2Q9Q D;  2E9X C;  3JC6 C;  2EHO D; 
#chains in the Genus database with same CATH topology
 1KNP A;  3A8Y C;  3PU8 A;  3EDU A;  3FZL B;  5LBQ B;  2NWB A;  2JIW A;  1ZOY A;  2XAH B;  2JJ9 A;  4DR1 T;  2BG9 A;  3LBX A;  2WY2 A;  3ETU A;  3ZCI A;  3PUW F;  4NUV A;  2I59 A;  3PUY F;  5AQO B;  3RPU A;  1N32 T;  3TLT A;  2UXC T;  3NBX X;  4IDN A;  4TV9 E;  3I1A A;  3D0T A;  4NXM T;  2CXF A;  4LFB T;  2C5I T;  3KVA A;  3N9M A;  3RYH E;  5ADX L;  3AE2 A;  5LHG B;  1HTJ F;  1XDP A;  2N9D A;  3QB5 A;  2AE9 A;  3SS1 A;  3KV6 A;  3AAA B;  4O8S A;  3EUH A;  3KDS E;  4CN6 A;  5DJQ C;  3PUX F;  4Q25 A;  4YJ2 E;  4JI3 T;  4UEM A;  5KMG P;  4A97 A;  2FBW A;  2LKG A;  1LVF A;  2XQ3 A;  4TNV A;  4HWF A;  4DND A;  2CM0 A;  3UTK A;  5ABG A;  2LHN A;  2BDE A;  2ZLY A;  1Y64 B;  3I9W A;  2LSK A;  2PJQ A;  1KNR A;  1LRZ A;  5C3J A;  4U2Z A;  4FI5 A;  3UFG A;  3VR8 A;  1Z8U A;  2J1D G;  1FIO A;  3N2O A;  4LF4 T;  4TUY E;  4QH1 A;  3AA0 B;  1UUS A;  3E0Z A;  3EHZ A;  3KV4 A;  4B6X A;  3NWI A;  2H7O A;  4IE7 A;  5JDH A;  2WDR A;  3AEE A;  2YDR A;  2E9X C;  5HXE A;  1J5E T;  1V9D A;  2XAQ B;  3P8C D;  4HGA A;  5F8P A;  4AQF C;  5LB7 B;  2VQF T;  1VCT A;  2XQ4 A;  3KBT A;  2E9X D;  3AEC A;  1UX5 A;  3JAF A;  1J5W A;  4X20 E;  2PTF A;  3ZST A;  3FBL A;  3B5M A;  5CB4 E;  2UXX B;  2XHE B;  4UIG A;  3DTO A;  2V7I A;  2CHO A;  2ZM6 T;  2V8S V;  1NEK A;  4UV8 B;  4ERR A;  2V6X A;  4N78 D;  2V7L A;  4X64 T;  1QUU A;  1WYC A;  1D1C A;  2VVN A;  3OKQ A;  4ZS3 A;  4L5G A;  3RI5 A;  3AVS A;  4A56 A;  2IC6 A;  3AA7 B;  2D0T A;  2Y6X A;  4ZOL E;  4E7Z A;  3Q5D A;  2W00 A;  5JH7 E;  1HX1 B;  1IZN B;  3Q2M A;  3UU4 A;  3ONL C;  2VVS A;  3Q9D A;  5LG4 A;  5FY7 A;  3RQU A;  2H3R A;  4GK0 E;  3U3I A;  1IJ5 A;  4YJ3 E;  3C51 A;  3S4U A;  4GKJ T;  5JRC A;  3PUZ F;  4IE6 A;  4BJM A;  1MND A;  3ZT5 A;  1I6Z A;  4DMV A;  2HPL A;  4X1Y E;  1N36 T;  5JDL A;  2WM9 A;  4BA9 A;  3UT5 E;  3E08 A;  3T1H T;  2LE8 A;  3CKD A;  2IW5 B;  2N1G A;  2LSJ A;  2WS3 A;  1SE7 A;  2VQE T;  3MKD A;  3O1I A;  4TV8 E;  4CI2 B;  2BKP A;  2WDQ A;  3RYC E;  2BG9 B;  5HCM A;  3V5S A;  3LBX B;  4DMW A;  4HFE A;  4ILA A;  3B13 A;  4OHF A;  4QXB B;  3I9Y A;  4GYR A;  4ZI7 E;  4TWH A;  4IDZ A;  1KFY A;  4DV3 T;  4H9R C;  2W2U A;  5HEO A;  3HKB E;  4PJJ A;  2DLR A;  5EK4 A;  5IHY A;  4OFZ A;  3RX6 A;  2V7J A;  2FUP A;  3AXJ A;  2CA5 A;  3N9P A;  4XZC A;  1D1B A;  4LML A;  3C4X A;  5L4E A;  4DV1 T;  4U31 A;  2UXN B;  3AE9 A;  5FL1 A;  4H9P C;  2KND A;  2VL0 A;  3CX6 B;  4QKN A;  5IYZ E;  4IE0 A;  2CMR A;  1VOM A;  2X9Y A;  3HI2 A;  3RC3 A;  2K9A A;  2J47 A;  3N9O A;  4AQY T;  3ZN1 B;  2H7V C;  4DR5 T;  4O4I E;  4YHH T;  4TWF A;  1JNR A;  4HKA A;  2CEA A;  2X66 A;  1S94 A;  2LOP A;  3AE7 A;  1J1J A;  2VKD A;  3ZYM A;  3MXZ A;  1UX4 A;  2K48 A;  5AQH B;  2AXD S;  1UGO A;  3KFW X;  4O4L E;  2M6I A;  3H37 A;  4IIJ E;  2IIU A;  2XSA A;  1E7P A;  2HN2 A;  2IHR 1;  3P4W A;  5JVD E;  4EB6 E;  2NW7 A;  4DV6 T;  4NPP A;  2L9Q A;  3B57 A;  5LGN B;  3ZPO A;  4I55 E;  2V7M A;  3H3M A;  5CFB A;  2OLT A;  3WAK A;  3RKG A;  5AQI B;  3L39 A;  3HL6 A;  2DI4 A;  3ONJ A;  5HEH A;  3LSV A;  3E22 E;  3ESL A;  2BS4 A;  2XZE A;  2D2S A;  3LJC A;  4HFH A;  2K3W A;  5LMN T;  2JQ9 A;  3L8R A;  5HEG A;  2H89 A;  4IDP A;  4MHC A;  5HAX A;  2HN1 A;  2WMN A;  4HFI A;  1B7T A;  3RQW A;  2J4G A;  3VRA A;  4JI5 T;  5LJN A;  3AVR A;  1OWA A;  5H6R B;  3OBV E;  4QX8 B;  3FZF B;  5JRC B;  5KDM C;  2M6B A;  2Z6E A;  3UUX B;  4JYA T;  1MMA A;  1D1A A;  3VKG A;  5AQJ B;  3NVO A;  2LSY A;  3TKL B;  2PFV A;  3ZMU B;  3NKZ A;  4DV7 T;  5CGM A;  2BG9 C;  2X9W A;  4LF8 T;  2KSR A;  2KIN B;  2CPT A;  2EHO D;  3QOF A;  4JLE A;  1NAF A;  5LGU B;  3I0Q A;  1IJ6 A;  3SFD A;  3RC8 A;  3JC6 C;  3LDQ B;  3MZK B;  4UVB B;  3G06 A;  5AQN B;  2VWA A;  1D0X A;  4PK5 A;  3JC6 D;  4CXY A;  4IE4 A;  4UXN B;  4I50 E;  3AE6 A;  3JAE A;  5ETW A;  2VUR A;  1ZP0 A;  3NRY A;  1HS7 A;  3TLV A;  1YW0 A;  4EZ4 A;  3W15 B;  1XNQ T;  2NP9 A;  3UQ7 A;  4QH5 A;  3AXJ B;  2WAU A;  4U7I A;  2BVM A;  2V5D A;  4U72 A;  4OYJ A;  4U74 A;  2BG9 E;  2MPK A;  1SHZ C;  3RYF E;  2E8I A;  2ACX A;  2XQ5 A;  4ZI2 C;  5JDF A;  2V26 A;  3ZSS A;  1KNZ A;  1T98 A;  4CI3 B;  5F3J A;  2WU2 A;  1U5P A;  1OED E;  2C0S A;  2M67 A;  2QGS A;  1BR2 A;  5LG3 A;  2VK9 A;  3FHN A;  2Y8D A;  3I0O A;  4YLH A;  5DAB A;  3QC9 A;  1HCI A;  4AQG A;  4OX9 T;  2WWU A;  4G63 A;  5L3B B;  3UQ4 A;  2OA5 A;  3ONX A;  2YOE A;  5BR8 T;  2QA7 A;  2XUE A;  2KMF A;  5J2T E;  2X0Y A;  4A98 A;  3QK6 A;  3CK6 A;  4KI0 F;  5FL0 A;  5LHI B;  1XMO T;  4TWD A;  1ZHC A;  3PUA A;  5DQW A;  2K5B B;  2L8K A;  4O4J E;  3U78 A;  1WCR A;  4X65 T;  5IUX A;  4HN9 A;  4OK0 A;  3L3P A;  1MIV A;  4EV6 A;  4B3T T;  5AQS B;  3HR0 A;  3ZEF B;  4DR4 T;  2ZM2 A;  4I43 B;  1NEN A;  2CXL A;  3QUJ A;  5AQM B;  4PW8 A;  5TAO A;  3ZYL A;  2X0L B;  4TNW A;  2LM2 A;  5JR9 A;  2XJ7 A;  3ZT6 A;  3AE5 A;  1FJG T;  4OYK A;  1LVK A;  2VKO A;  1BR0 A;  3ANW A;  5HXS A;  3HKD E;  3RH3 A;  2UUB T;  3FZH B;  4KHP T;  3VKH A;  2V1D B;  5FMN A;  4WBN E;  4JI0 T;  3V5U A;  4TZ4 C;  5LP6 E;  3C98 B;  4WBO A;  4AIS A;  2Q9Q A;  2KLQ A;  4U2Y A;  2DNX A;  4UVA B;  3BK9 A;  3N2K E;  2YN6 A;  2DCF A;  3AAE B;  5JDN A;  3CVR A;  5LOV E;  2BVL A;  4Z8X A;  2Y48 B;  5FXZ A;  2LRK A;  3AEG A;  2W63 A;  2LM9 A;  5AQL B;  5HWX A;  4CXW A;  2DWG A;  1M7K A;  2MBG A;  3CX8 B;  3RIU A;  4WZX A;  2D0U A;  3C4W A;  3UUN A;  3KIN B;  5HEU A;  3P4P A;  2JMH A;  2WWV A;  4LMJ A;  5AQT B;  1JNZ A;  2WB5 A;  3AE3 A;  2JMK A;  4LFA T;  1ZV4 X;  5L3D B;  4I0U A;  1YD8 G;  4IDQ A;  4PNI A;  4AKR B;  3F31 A;  2X51 A;  5FY0 A;  4CN4 A;  3P50 A;  4J2C A;  4ZZC A;  4O2B E;  2BKN A;  2WZH A;  4K0K T;  2CE7 A;  4IL9 A;  4HWC A;  1HF8 A;  4HEA A;  1IBL T;  4GK5 E;  5EK2 A;  4DV5 T;  2CLY B;  4XAX B;  3PUQ A;  4C91 A;  2LSI A;  1MIW A;  2I0M A;  4HFC A;  4UV9 B;  4YSX A;  2WCA A;  2H88 A;  4KUM B;  3KV9 A;  5ABF A;  4NXN T;  2UXD T;  1N33 T;  2FJB A;  2RP4 A;  2JRK A;  2CCQ A;  3ZKR A;  3LK3 B;  1T7S A;  5KXJ A;  2DWK A;  1AJ3 A;  2A2F X;  4P1N A;  1O3X A;  3PJA A;  4TX5 A;  3SOL A;  4JEH B;  4QWN B;  5F5W A;  3CML A;  4ILU A;  5FXW A;  2XAS B;  3UU5 A;  2NR4 A;  4YTN A;  2C5K T;  4ZI3 C;  4EED A;  2FJA A;  4DR6 T;  2PBI A;  1WR6 A;  2QVA A;  2CWY A;  3BQI A;  4ZI3 D;  3PUR A;  3OVU A;  4G2A A;  5CA1 E;  5L3C B;  1R8I A;  3VU7 H;  5FXX A;  4IGU A;  2YDS A;  2CBI A;  1H7C A;  4ZZB A;  3UU6 A;  4LF6 T;  4COF A;  3RKO A;  4PK6 A;  5L4H A;  1SA0 E;  5JR9 B;  2RA1 A;  4U33 A;  2KWI B;  4DBR A;  4P0B A;  3UUB A;  2NW8 A;  3ANW B;  3KV5 A;  4MLK A;  3UU8 A;  2XSB A;  3HA4 A;  3AB3 B;  2FJE A;  4YTP A;  5FKY A;  4QX7 B;  2IC9 A;  2E5V A;  4IE5 A;  4YT0 A;  4X66 T;  2LJL A;  4UF0 A;  2Q9Q B;  3JCF A;  3EVY A;  5JDQ A;  1XZY A;  3ZMT B;  2YIN A;  3ETV A;  5IWA T;  2ZMA A;  3KVB A;  5AQF B;  2VL8 A;  3TLU A;  2VKJ A;  3AEA A;  3MA9 A;  2KT9 A;  3O1H A;  5LA6 E;  5HXH A;  2OV9 A;  1WFD A;  4P09 A;  1HFA A;  1X79 A;  4CZZ B;  3HKC E;  4ANJ A;  3H3A A;  3CWZ B;  4DVD A;  4UR9 A;  1WYB A;  2XQY A;  3AED A;  2UUA T;  5JQG E;  2YU1 A;  3RHW A;  1M62 A;  4WW0 A;  3K3N A;  4EZH A;  4DR7 T;  4ZXL A;  4QXH B;  1WLX A;  4IT4 A;  4HE8 A;  3SWH A;  5L3E B;  3AAI A;  4ASK A;  5DQV A;  3PJA J;  4AKL A;  2CWO A;  4U3C A;  3ZYK A;  1UUR A;  1XNR T;  3WI3 A;  4NIQ A;  2C5J A;  5E0O A;  4EAH A;  4HFD A;  3N9L A;  4YY3 T;  2WBL A;  3RGL A;  5ABH A;  2CLY C;  4ADZ A;  4AI6 A;  2XTL A;  4HFV A;  2XM2 A;  2G0U A;  2WP9 A;  1US7 B;  4LF5 T;  1L0V A;  2HH7 A;  3AEB A;  2ZM8 A;  1NWM X;  4PJM A;  2KWH A;  3HKE E;  2JPF A;  4Z91 A;  5ABF B;  3ZJ2 A;  3WAJ A;  1IAP A;  1E1H B;  1YKE B;  5L47 A;  3K1S A;  5GON E;  1W0A A;  2F4V T;  2MAW A;  3ABV A;  1UK5 A;  3IHR A;  4X62 T;  4WYV A;  2V6Y A;  2LSG A;  2SPC A;  3P4Q A;  3GA8 A;  2LHR A;  3ZC1 A;  3UU3 A;  1CUN A;  2BS2 A;  2GK9 A;  2ACZ A;  3N5L A;  3ZT7 A;  4L0R A;  5M4Y A;  3M3Z B;  3NRX A;  4EOZ B;  2P9B A;  2XQ8 A;  2CHN A;  4AKI A;  2L3L A;  4AIU A;  5JR9 C;  1WR0 A;  2X0H A;  3IA3 A;  2MTQ A;  3QB5 K;  5J0Z A;  5H6Q B;  2JQH A;  3DJB A;  5C8Y E;  3PE0 A;  1YKH B;  3EDV A;  1BR4 A;  5JDG A;  3TLS A;  3FZK B;  4HWI B;  3IBP A;  2W66 A;  4MBQ A;  1W9R A;  5FXV A;  2NOX A;  4WNK A;  4HFB A;  4ZI2 D;  2Q9Q C;  2DL1 A;  1IBM T;  3N2G E;  1UCU A;  3FZM B;  5JTG A;  5LGT B;  2BZB A;  2HHH T;  1EZ3 A;  3LK4 2;  3EAM A;  2YK0 A;  4IRE A;  2ES0 A;  2D9D A;  4ILC A;  5AQG B;  2E2A A;  4B3S T;  5KX5 E;  4I4T E;  4UF0 B;  3F2E A;  5L2L A;  2WU5 A;  5CJ5 A;  4YSZ A;  1MMN A;  3OTO T;  3VHL A;  2LOS A;  3RIU C;  2IDO B;  3KBU A;  2LT3 A;  4KP3 C;  2XM1 A;  2QYW A;  5FP3 A;  3IF8 B;  4GKK T;  2RPA A;  2EHO A;  3GWH A;  3FB2 A;  4B3R T;  4P0A A;  4H9O C;  3ZLI A;  3ZMZ B;  4O4H E;  1OED A;  2XY8 B;  5EK3 A;  1KF6 A;  2X9H A;  4YSY A;  4DID B;  1SUM B;  5FY1 A;  5ABE A;  2J62 A;  4O2A E;  1LKX A;  2A9U A;  2QRX A;  4F8H A;  3UFE A;  1X9B A;  3CX7 B;  3FXE B;  5HYA A;  2W4X A;  2KXP B;  3GMI A;  1BR1 A;  3EI0 A;  4QH4 A;  1HR0 T;  4TN7 B;  2BBJ A;  1G8X A;  5L3F B;  2N2N A;  3K8P C;  5HXR A;  1S35 A;  4YXD A;  2WZI A;  3AE4 A;  2YEV C;  3RYI E;  2FJD A;  4FJO A;  3CQG B;  4IL4 A;  4XBF B;  4LFC T;  1VRB A;  4M1P A;  1YQ3 A;  3O1J A;  3J9X 1;  2YKS A;  4X1K E;  1D0Z A;  4H63 H;  3JAD A;  1HNZ T;  5FNV E;  3P4S A;  4GOU A;  4KHZ F;  4JI2 T;  2V6Y B;  3RRW A;  4E7S A;  4MFR A;  1Z0P A;  4MAL A;  2VB6 A;  4Z90 A;  3PU3 A;  3TLW A;  2DHR A;  2JQK A;  3VR9 A;  2MOZ A;  4L9I A;  3EAB A;  4JI8 T;  1FMV A;  4H9N C;  2X67 A;  2E5L T;  1ZKE A;  5LBM A;  4DV4 T;  4EIW A;  4ZS2 A;  1Y01 A;  4UVC B;  3OPC A;  3AEF A;  4IST A;  2BS3 A;  2D5U A;  4X1I E;  1FEW A;  3SFE A;  2XAJ B;  3CIR A;  3PUS A;  2W67 A;  4EXT A;  3GN5 A;  5AFU L;  4U7Y A;  3RIA A;  5HEJ A;  2WMO A;  3BQL A;  2LEH A;  4PK4 A;  3C50 A;  4JI4 T;  2W61 A;  3M65 A;  5JRE A;  4JI7 T;  3IEE A;  4KMC A;  2NTY A;  1W09 A;  2VKH A;  2WSS V;  2KZ7 B;  4YFS A;  4JV5 T;  4BAY B;  3ZMV B;  4KBM B;  2CBJ A;  1E2A A;  2E9X A;  4ZHQ E;  3PUV F;  2CXD A;  2EHO B;  4AQF A;  1N34 T;  4EGW A;  5LMU T;  3L09 A;  2XQ7 A;  3AE8 A;  2XPK A;  5AQU B;  2YU2 A;  4DV0 T;  3A7M A;  4AKG A;  3K3Q C;  4X5T A;  5AQP B;  5LNK A;  1OED B;  3CQX C;  3PDY A;  2XQA A;  4CN1 A;  5C2T A;  1W0B A;  3RRC A;  4QXC B;  2B76 A;  3DP7 A;  2W62 A;  2LLY A;  3K3O A;  1CHU A;  3ZC0 A;  3MJX A;  2ODU A;  2A3D A;  4ZEY A;  3ZJ1 A;  1HG5 A;  1MNE A;  2IUB A;  3FXD B;  2ODV A;  3MAC A;  5BMV E;  4DO0 A;  1ZEE A;  2LKH A;  4AKH A;  4CI1 B;  2IML A;  1T8B A;  2V7K A;  1KK7 A;  4QHO A;  2X68 A;  2B1E A;  3Q5X A;  4KX6 A;  2V5C A;  4V1A v;  3J7Y q;  4YHJ A;  4JI1 T;  1XMQ T;  4GYS A;  5L3G B;  4HWD A;  1U4Q A;  1YQ4 A;  1HNX T;  2PG8 A;  1YXR A;  3N9Q A;  2YDQ A;  1MMD A;  4LMK A;  5JDM A;  4CQI A;  3C4Z A;  1DU2 A;  1I94 T;  3R6N A;  3LFM A;  4JUY A;  5FVK A;  3LK2 B;  3C64 A;  2W0G A;  3AE1 A;  2K24 A;  3R84 B;  5LHH B;  4UEL A;  2WQY A;  4YTM A;  2X9X A;  1OXZ A;  5AQV B;  3MK7 C;  3LG7 A;  3AA1 B;  3QNU A;  4AXP A;  4IHJ E;  4ILB A;  4DUZ T;  1XDO A;  4CXX A;  4PAG A;  5LYJ E;  5FVL A;  3GN5 B;  1HX8 A;  5J2U E;  5HWY A;  4K0U A;  3T8O A;  5AQK B;  2UU9 T;  3NZP A;  3F57 A;  4DBQ A;  3NZQ A;  3A5X A;  2UUC T;  5AQR B;  3OYX A;  2IAK A;  4DR2 T;  3ZN0 B;  4ISS A;  3FBZ A;  1G73 A;  4B3M T;  1MMG A;  1HG2 A;  4C90 A;  1T72 A;  4F6R C;  1XWM A;  4PJN A;  4H9Q C;  1MIY A;  2JQQ A;  3PTR B;  4EYU A;  3Q5E A;  2EHO C;  4PFP A;  3CQC B;  2MYS A;  2CRB A;  4HTE A;  5LXT E;  4HWH A;  4DR3 T;  4JEU B;  5AQQ B;  4LF9 T;  2E9X B;  2XAF B;  1OED C;  4GIW A;  3RLF F;  3ZMS B;  3UUL A;  1IBK T;  3O9X A;  2WDV A;  2NTX A;  4H9S E;  2ZM0 A;  3RIF A;  1HNW T;  5A1L A;  4A5X A;  4H63 V;  2XQ6 A;  1QSD A;  5J1G A;  4JI6 T;  1WRD A;  4DUY T;  2LRL A;  1VCS A;  2BBH A;  3RF1 A;  5FYM A;  1FMW A;  3T1Y T;  3VRB A;  3AA6 B;  4EYY R;  3PV0 F;  5EZY E;  3N9N A;  2I6H A;  3OYZ A;  5HXC A;  1QLB A;  3UUM A;  3OJA A;  3SRZ A;  5LJM A;  4JBW F;  4PFO A;  2HPJ A;  2XAG B;  1GQE A;  3O4X E;  4DV2 T;  3CPZ A;  4NUU A;  3P7I A;  1KEY A;  2UXB T;  3BQK A;  4IDO A;  3ZCJ A;  2R6G F;  4PJL A;  4EEB A;  5CA0 E;  2BKO A;  3PUG A;  4BJN A;  2Q9Q D;  5HCJ A;  4LF7 T;  3X1D A;  2A72 A;  2NW9 A;  3Q5W A;  3P4R A;  2VAS A;  2XQ9 A;  1D0Y A;  5LCY A; 
#chains in the Genus database with same CATH homology
 3PU3 A;  2DHR A;  3EDU A;  3PU8 A;  3RKO A;  5LJN A;  3AVR A;  5LBQ B;  1OWA A;  5H6R B;  3OBV E;  2MOZ A;  4L9I A;  4PK6 A;  4QX8 B;  1SA0 E;  5JR9 B;  2NWB A;  2RA1 A;  2KWI B;  5JRC B;  2XAH B;  2JJ9 A;  5KDM C;  1FMV A;  4DBR A;  4H9N C;  3LBX A;  2X67 A;  3ETU A;  3ZCI A;  4P0B A;  2Z6E A;  3UUX B;  2NW8 A;  1ZKE A;  5LBM A;  1MMA A;  1D1A A;  3VKG A;  3ANW B;  3KV5 A;  4NUV A;  4EIW A;  2I59 A;  4MLK A;  4ZS2 A;  3RPU A;  2LSY A;  3TKL B;  3NBX X;  2PFV A;  3ZMU B;  3HA4 A;  4TV9 E;  3AB3 B;  4UVC B;  3I1A A;  3D0T A;  2X9W A;  2KIN B;  2IC9 A;  2CXF A;  4IST A;  4QX7 B;  2C5I T;  3KVA A;  3N9M A;  4IE5 A;  3RYH E;  2LJL A;  4UF0 A;  2D5U A;  2Q9Q B;  1FEW A;  4X1I E;  5ADX L;  2EHO D;  3EVY A;  5JDQ A;  2XAJ B;  5LHG B;  4JLE A;  1NAF A;  5LGU B;  3I0Q A;  1IJ6 A;  1HTJ F;  3RC8 A;  3ZMT B;  2YIN A;  3JC6 C;  3MZK B;  4UVB B;  2N9D A;  3ETV A;  3PUS A;  4EXT A;  2ZMA A;  3GN5 A;  3KVB A;  3SS1 A;  5AFU L;  2VWA A;  3KV6 A;  3AAA B;  4O8S A;  1D0X A;  3EUH A;  4PK5 A;  3KDS E;  2VL8 A;  5DJQ C;  3JC6 D;  4CXY A;  4YJ2 E;  2VKJ A;  4IE4 A;  4UXN B;  4I50 E;  3MA9 A;  4UEM A;  5KMG P;  2KT9 A;  3O1H A;  5LA6 E;  5HXH A;  5ETW A;  1LVF A;  2WMO A;  3BQL A;  4P09 A;  2LEH A;  1HFA A;  3NRY A;  1X79 A;  1HS7 A;  4PK4 A;  4CZZ B;  1YW0 A;  3HKC E;  3C50 A;  3H3A A;  4ANJ A;  4DND A;  4EZ4 A;  3CWZ B;  4DVD A;  3W15 B;  2W61 A;  2CM0 A;  3M65 A;  2NP9 A;  3UTK A;  1WYB A;  2XQY A;  5JRE A;  5JQG E;  2LHN A;  2YU1 A;  3IEE A;  2BDE A;  2ZLY A;  1Y64 B;  2NTY A;  2WAU A;  2LSK A;  2PJQ A;  3I9W A;  1LRZ A;  4KMC A;  2VKH A;  2BVM A;  2WSS V;  2KZ7 B;  4YFS A;  4WW0 A;  4FI5 A;  3K3N A;  4EZH A;  4U72 A;  4OYJ A;  4U74 A;  4BAY B;  2J1D G;  3ZMV B;  1FIO A;  4KBM B;  3N2O A;  1SHZ C;  3RYF E;  2E9X A;  4QXH B;  4ZHQ E;  2E8I A;  2ACX A;  1WLX A;  4TUY E;  4HE8 A;  3SWH A;  5L3E B;  4ZI2 C;  3AA0 B;  5JDF A;  2V26 A;  1KNZ A;  1T98 A;  4CI3 B;  3E0Z A;  2CXD A;  5F3J A;  2EHO B;  3AAI A;  4AQF A;  4ASK A;  5DQV A;  3KV4 A;  4AKL A;  4B6X A;  1U5P A;  2CWO A;  2C0S A;  2M67 A;  3L09 A;  3ZYK A;  2H7O A;  2QGS A;  1BR2 A;  4IE7 A;  3WI3 A;  2VK9 A;  2C5J A;  5E0O A;  4EAH A;  3FHN A;  2Y8D A;  5JDH A;  2E9X C;  3I0O A;  2YU2 A;  4YLH A;  5DAB A;  5HXE A;  3N9L A;  1V9D A;  4AKG A;  3K3Q C;  5LNK A;  3QC9 A;  3CQX C;  1HCI A;  3PDY A;  2XAQ B;  3P8C D;  4HGA A;  2WBL A;  5F8P A;  4AQG A;  3RRC A;  2CLY C;  4QXC B;  4ADZ A;  4AQF C;  2WWU A;  4G63 A;  3KBT A;  3DP7 A;  5L3B B;  2E9X D;  4AI6 A;  2XTL A;  1UX5 A;  4HFV A;  2G0U A;  2W62 A;  3ZC0 A;  3K3O A;  2OA5 A;  3ONX A;  1US7 B;  3MJX A;  2ODU A;  2QA7 A;  4X20 E;  2A3D A;  2XUE A;  1HG5 A;  1MNE A;  3ZJ1 A;  3FBL A;  2KMF A;  5J2T E;  3FXD B;  2HH7 A;  5CB4 E;  2UXX B;  2XHE B;  1NWM X;  2ZM8 A;  2ODV A;  3QK6 A;  3MAC A;  4UIG A;  5BMV E;  4PJM A;  2KWH A;  3DTO A;  3HKE E;  4DO0 A;  2V7I A;  5LHI B;  1ZEE A;  2JPF A;  4UV8 B;  4ERR A;  1ZHC A;  3PUA A;  5DQW A;  2K5B B;  4N78 D;  4AKH A;  4CI1 B;  2V7L A;  1QUU A;  1WYC A;  2L8K A;  2V7K A;  1KK7 A;  4O4J E;  1D1C A;  3OKQ A;  4ZS3 A;  3U78 A;  3WAJ A;  4L5G A;  1IAP A;  4QHO A;  1E1H B;  1YKE B;  2X68 A;  2B1E A;  3Q5X A;  4HN9 A;  3AVS A;  5GON E;  4OK0 A;  3L3P A;  1MIV A;  4A56 A;  2IC6 A;  3AA7 B;  2D0T A;  2Y6X A;  4ZOL E;  3HR0 A;  4V1A v;  4E7Z A;  3ZEF B;  3J7Y q;  2W00 A;  5JH7 E;  2ZM2 A;  1IZN B;  4YHJ A;  4I43 B;  2CXL A;  3IHR A;  3Q2M A;  3QUJ A;  4PW8 A;  5TAO A;  4GYS A;  3Q9D A;  3ZYL A;  2LSG A;  2X0L B;  5LG4 A;  2SPC A;  5FY7 A;  3GA8 A;  5L3G B;  2H3R A;  4GK0 E;  3U3I A;  2LHR A;  3ZC1 A;  1IJ5 A;  4YJ3 E;  1CUN A;  5JR9 A;  1U4Q A;  3C51 A;  2GK9 A;  3S4U A;  5JRC A;  3N5L A;  4IE6 A;  4BJM A;  1MND A;  4L0R A;  4OYK A;  5M4Y A;  1LVK A;  2PG8 A;  3NRX A;  4EOZ B;  2VKO A;  4DMV A;  2P9B A;  1BR0 A;  3ANW A;  5HXS A;  2HPL A;  4AKI A;  2L3L A;  3HKD E;  4X1Y E;  3RH3 A;  3N9Q A;  5JDL A;  2WM9 A;  5JR9 C;  4BA9 A;  1MMD A;  3UT5 E;  3E08 A;  5JDM A;  3VKH A;  2V1D B;  5FMN A;  4WBN E;  4CQI A;  2LE8 A;  2MTQ A;  3V5U A;  3CKD A;  2IW5 B;  2N1G A;  3C4Z A;  2LSJ A;  5H6Q B;  3R6N A;  4TZ4 C;  3DJB A;  5LP6 E;  3C98 B;  5C8Y E;  3MKD A;  3O1I A;  4WBO A;  3LFM A;  2Q9Q A;  2KLQ A;  4TV8 E;  3PE0 A;  2DNX A;  1YKH B;  4JUY A;  4UVA B;  3EDV A;  3LK2 B;  4CI2 B;  3C64 A;  1BR4 A;  2W0G A;  3BK9 A;  3N2K E;  5JDG A;  2DCF A;  3AAE B;  5JDN A;  3CVR A;  3IBP A;  5LOV E;  2BVL A;  4Z8X A;  3RYC E;  3V5S A;  2K24 A;  3LBX B;  2Y48 B;  4DMW A;  3R84 B;  4MBQ A;  5FXV A;  5FXZ A;  2NOX A;  3B13 A;  4OHF A;  2W63 A;  4WNK A;  5LHH B;  2LM9 A;  4QXB B;  3I9Y A;  4ZI2 D;  5HWX A;  4UEL A;  2Q9Q C;  3N2G E;  4GYR A;  4ZI7 E;  2X9X A;  4CXW A;  1UCU A;  1OXZ A;  5LGT B;  2DWG A;  2BZB A;  4IDZ A;  3MK7 C;  2MBG A;  1EZ3 A;  3LK4 2;  3LG7 A;  2YK0 A;  3CX8 B;  4H9R C;  3AA1 B;  2ES0 A;  3HKB E;  4PJJ A;  2D0U A;  2DLR A;  5KX5 E;  4I4T E;  5EK4 A;  4UF0 B;  5IHY A;  3F2E A;  4OFZ A;  4AXP A;  3C4W A;  3RX6 A;  5L2L A;  2V7J A;  3UUN A;  3KIN B;  2CA5 A;  3N9P A;  4IHJ E;  4CXX A;  4PAG A;  1MMN A;  4XZC A;  1D1B A;  5LYJ E;  3VHL A;  3C4X A;  2JMH A;  2LOS A;  3GN5 B;  2UXN B;  1HX8 A;  5J2U E;  5HWY A;  3KBU A;  4K0U A;  3T8O A;  2LT3 A;  4H9P C;  3NZP A;  4KP3 C;  3F57 A;  4DBQ A;  2JMK A;  2KND A;  3NZQ A;  3A5X A;  3CX6 B;  3OYX A;  2IAK A;  4QKN A;  5FP3 A;  1ZV4 X;  3IF8 B;  5IYZ E;  5L3D B;  3ZN0 B;  1YD8 G;  4IE0 A;  4ISS A;  3FBZ A;  1G73 A;  2EHO A;  3GWH A;  4PNI A;  4AKR B;  1MMG A;  1HG2 A;  3F31 A;  2X51 A;  5FY0 A;  4C90 A;  4F6R C;  2CMR A;  1VOM A;  2X9Y A;  3FB2 A;  4J2C A;  4PJN A;  4P0A A;  3HI2 A;  4H9Q C;  4H9O C;  4O2B E;  1MIY A;  3RC3 A;  3ZLI A;  3ZMZ B;  2JQQ A;  3PTR B;  4O4H E;  2CE7 A;  2K9A A;  4EYU A;  2EHO C;  3N9O A;  4PFP A;  3ZN1 B;  3CQC B;  2MYS A;  5EK3 A;  2H7V C;  4O4I E;  2X9H A;  4HTE A;  5LXT E;  1HF8 A;  4HKA A;  4JEU B;  4HEA A;  2CEA A;  4GK5 E;  2E9X B;  2X66 A;  1S94 A;  2XAF B;  5EK2 A;  5FY1 A;  2LOP A;  4GIW A;  3ZMS B;  4O2A E;  2CLY B;  4XAX B;  2VKD A;  3UUL A;  1LKX A;  3MXZ A;  3ZYM A;  3PUQ A;  1UX4 A;  2K48 A;  4H9S E;  2NTX A;  4C91 A;  2LSI A;  1MIW A;  3O9X A;  3UFE A;  3CX7 B;  2ZM0 A;  3FXE B;  4UV9 B;  5A1L A;  4H63 V;  4KUM B;  3KV9 A;  1QSD A;  3KFW X;  4O4L E;  3H37 A;  5HYA A;  2KXP B;  5J1G A;  4IIJ E;  3GMI A;  1BR1 A;  1WRD A;  4TN7 B;  2RP4 A;  1FMW A;  2JRK A;  5FYM A;  5JVD E;  4EB6 E;  2CCQ A;  2NW7 A;  3AA6 B;  4EYY R;  2L9Q A;  3B57 A;  1G8X A;  5LGN B;  3LK3 B;  5L3F B;  5EZY E;  3ZPO A;  2N2N A;  4I55 E;  2V7M A;  3N9N A;  2DWK A;  1AJ3 A;  3OYZ A;  2A2F X;  5HXC A;  3UUM A;  1O3X A;  3K8P C;  3OJA A;  4TX5 A;  3SRZ A;  3WAK A;  3SOL A;  4JEH B;  5LJM A;  3HL6 A;  1S35 A;  2DI4 A;  5HXR A;  4QWN B;  4PFO A;  2HPJ A;  3CML A;  2XAG B;  4ILU A;  5FXW A;  2XAS B;  2YEV C;  3O4X E;  3E22 E;  3RYI E;  3ESL A;  3CPZ A;  4NUU A;  3P7I A;  2C5K T;  4ZI3 C;  3BQK A;  4FJO A;  3CQG B;  2PBI A;  3ZCJ A;  1WR6 A;  2D2S A;  4PJL A;  5CA0 E;  3LJC A;  4XBF B;  4BJN A;  3PUG A;  2CWY A;  2Q9Q D;  1VRB A;  3BQI A;  4M1P A;  4ZI3 D;  3PUR A;  2A72 A;  3O1J A;  4G2A A;  2NW9 A;  5CA1 E;  3J9X 1;  3Q5W A;  5L3C B;  2VAS A;  4X1K E;  3VU7 H;  1D0Y A;  1D0Z A;  4H63 H;  5FXX A;  4IGU A;  4MHC A;  5HAX A;  2WMN A;  5FNV E;  1B7T A;  5LCY A;  4GOU A;  3ZJ2 A;  3RRW A;  1H7C A;  4E7S A;  4MFR A;  1Z0P A;  4MAL A;  2VB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...