2E9XC

The crystal structure of human gins core complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
186
Chain Sequence
GPHMSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords DNA replication complex GINS protein PSF1
publication title Structure of the human GINS complex and its assembly and functional interface in replication initiation
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 186
sequence length 195
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05916 Sld5 GINS complex protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2e9xC00
2EHOD 2Q9QD 3ANWB 3JC6C 2E9XC
chains in the Genus database with same CATH superfamily
2WZHA 4FJOA 5TAOA 5ABGA 3OPCA 3RX6A 4JI8T 2W00A 3T1HT 2W63A 3G06A 1IBLT 2XQYA 2XSAA 3I1AA 4XBFB 4DBQA 3V5SA 5L47A 1HFAA 4HWCA 4JUYA 4B3MT 2C0SA 4TN7B 2IW5B 2RA1A 5IYZE 4X1YE 2IUBA 2BKNA 4GYRA 3KVAA 3E08A 1G73A 1HX8A 4YSYA 4UF0B 3Q2MA 3R6NA 5HCMA 5AQLB 4YHHT 2LSIA 3IF8B 3KV4A 4KHZF 1NEKA 3QB5K 3QOFA 1KNRA 5JREA 3MKDA 4EIWA 2VQFT 3OVUA 4JV5T 1FIOA 3IHRA 5ABEA 2VVNA 3WI3A 1NAFA 2W67A 4YXDA 3A7MA 4HGAA 3CQCB 3JCFA 2W4XA 5LA6E 4NXMT 2BVMA 5AQSB 3HI2A 3KFWX 1BR0A 4GIWA 4U31A 2MYSA 2IHR1 1WR0A 4ZXLA 4I55E 3RH3A 4ZZCA 1LRZA 4A56A 4DIDB 4DV0T 5F8PA 3AE1A 4BA9A 2DHRA 4EOZB 3FB2A 1KEYA 5FL1A 2AXDS 1FMWA 4CZZB 5J1GA 5LMUT 3KBTA 3N9QA 2WU2A 5HEJA 1ZEEA 4EB6E 4EAHA 4X20E 4QWNB 2LRLA 2ZM6T 4PJLA 3ESLA 2V7IA 4JI7T 2C5KT 3TLTA 3C50A 3Q5XA 2W62A 3ZEFB 2LOPA 3NBXX 2V1DB 4ASKA 3OYZA 5L4HA 2SPCA 4EEBA 2D0UA 4YSXA 5DQVA 3MZKB 1UX4A 3VKHA 5LG4A 3IA3A 4UVBB 2K9AA 5LBQB 1JNRA 5BR8T 5FMNA 2CMRA 3V5UA 3KVBA 4EYUA 4ILAA 3ZMSB 3ABVA 4G63A 3UQ7A 3AXJA 3PJAJ 3ANWA 3NVOA 1U4QA 3CK6A 4TWFA 2LT3A 4DUYT 3RC3A 3J9X1 5HXCA 2X0LB 5F5WA 1ZV4X 4LF4T 4HFCA 5HXEA 1LVKA 1D0XA 5FXVA 5IHYA 4JI4T 1YKHB 3K8PC 4QXBB 2V7MA 1LVFA 2CHNA 2UU9T 3ZJ2A 4YY3T 4LF5T 3LFMA 4LF8T 5AQRB 2UUCT 4L0RA 3LBXB 1OEDC 1EZ3A 5LXTE 2WS3A 3EDUA 2DWKA 3TKLB 4WYVA 3CPZA 3E0ZA 3P4RA 4LF6T 4UR9A 5HEOA 2JMKA 3BQKA 4HWHA 2NW9A 5JQGE 2WWVA 2CXDA 3JAFA 2XASB 2QGSA 4AKRB 3B13A 2LOSA 3UUBA 3RKGA 4K0UA 2JMHA 1IBKT 3K1SA 3M3ZB 4IDZA 3CX8B 2LE8A 1UUSA 2VKJA 3HKBE 3L39A 4H9NC 4E7ZA 1T7SA 1MMNA 2JQQA 5GONE 2UUBT 3RIFA 4ILBA 3VR8A 1T98A 4YHJA 2Q9QA 2VKHA 2XY8B 2FJEA 1WCRA 3AECA 5LBMA 3PV0F 5CA1E 2LSJA 5JRCA 3PTRB 4AQYT 3FXEB 1D1CA 1UURA 3KBUA 4IREA 3KV9A 2LKGA 2L9QA 1MIVA 4JYAT 2WU5A 3FZMB 4QX7B 3UQ4A 3MACA 2CXFA 5AQNB 2PG8A 2WBLA 2XQAA 2D2SA 1XMOT 1ZP0A 2VWAA 4JI5T 4I0UA 4PAGA 2OV9A 4TNVA 2UXDT 3LK3B 2KSRA 2YEVC 3AEGA 1SHZC 3PE0A 3NZPA 4O4JE 2K3WA 5JDQA 4EXTA 1QLBA 3C51A 5JR9B 4JI1T 4NUUA 1VCSA 1UX5A 4U7IA 1AJ3A 4DV7T 1T8BA 3FZKB 2XJ7A 4EYYR 3ZN0B 1M62A 4TWHA 2XPKA 1HG5A 2NTXA 4PJNA 4X1KE 1BR4A 1W0BA 2A72A 4UXNB 2H89A 5JDMA 2PFVA 3C98B 3SFEA 3P50A 4ZI3D 1IJ5A 4CQIA 5E0OA 2IC9A 2L8KA 3VU7H 5KDMC 2JQKA 2HPJA 2ODVA 5M4YA 3NRYA 4V1Av 3JADA 3CX7B 5AFUL 5LJNA 5LGTB 2WDVA 1VCTA 2XQ3A 4TZ4C 3ZPOA 2LSYA 3CVRA 2KMFA 3K3OA 5DQWA 5DJQC 2ZMAA 2LSGA 5LGUB 3AAAB 4YJ2E 2IAKA 4HE8A 3B57A 2BDEA 4XZCA 2E5VA 1XNQT 2IDOB 2FJAA 5AQQB 5EK4A 2I59A 5LCYA 2NTYA 2YINA 1U5PA 1VOMA 4CN4A 2NOXA 5AQGB 2DNXA 3PJAA 1MNDA 4OYJA 3JAEA 4KX6A 4B6XA 4MFRA 2CA5A 2CBIA 1H7CA 3ZYLA 4WW0A 4NIQA 4BJNA 1XWMA 5FXZA 2WQYA 5H6RB 2WDRA 3EI0A 4JI6T 4KBMB 3AE2A 3ZT5A 2H88A 5KXJA 2MPKA 2D9DA 4QXHB 3ZSSA 4HFVA 3RQWA 3ZCIA 1HR0T 3AEAA 4DBRA 5HEHA 3KINB 5L3FB 4DV4T 1Y01A 4YLHA 3PUAA 4X1IE 5A1LA 3BK9A 5FY7A 2X66A 1XNRT 1KF6A 1N36T 5AQUB 4K0KT 4QH1A 2PTFA 4AQFC 2K5BB 3FXDB 4DR3T 3I0OA 4WNKA 2V7LA 2V7JA 4DV6T 5LHHB 4HKAA 3RIUC 3RKOA 3C4XA 5ADXL 2WCAA 3RPUA 1L0VA 1YD8G 3HKCE 2YKSA 1DU2A 5ABFA 2HPLA 3N9OA 4ZEYA 4C90A 3ZT7A 1E7PA 4GKJT 2X0YA 4HFEA 4H9SE 3GMIA 4X5TA 3K3QC 4LMKA 1OEDE 1X79A 3NKZA 3EABA 1LKXA 4B3RT 1GQEA 4DNDA 5FVLA 2M6IA 3I0QA 4IGUA 5FNVE 2BBJA 4JEHB 1UCUA 2E9XA 2MAWA 5JVDE 2KLQA 4F6RC 1IAPA 4X65T 4IE7A 3Q5DA 3AXJB 5LOVE 2LRKA 3ANWB 4MLKA 3P4SA 4WZXA 4X66T 3AB3B 4DV2T 3SRZA 1MMAA 2BVLA 2G0UA 3AA0B 5CB4E 3SWHA 4DR6T 2A9UA 1WYBA 4EZHA 4ERRA 3N9LA 5EK2A 2HH7A 2LM9A 4I50E 5LJMA 3RQUA 3N2KE 4O2BE 4CXWA 3DJBA 2LHNA 3KV5A 3T1YT 2KNDA 4ANJA 4N78D 4G2AA 5AQIB 4WBNE 4OYKA 4PW8A 4DR2T 3TLUA 4I4TE 3UU4A 3EHZA 3PU3A 2YN6A 2N2NA 4YTMA 2NP9A 4LMJA 5JR9C 4QH4A 4HTEA 2BG9B 3IEEA 3L3PA 3AAEB 5CJ5A 4PK4A 3UU8A 2XAQB 3PURA 3GA8A 4H63H 1D1AA 2PBIA 2JRKA 5JDLA 2LHRA 3RRCA 3U3IA 3D0TA 4GOUA 3WAJA 5HWYA 2WM9A 3AAIA 4DO0A 3CQGB 2CWYA 5AQOB 2VK9A 3P4QA 2VQET 3MK7C 1Z8UA 5AQJB 5LNKA 2Q9QB 2WP9A 3AE5A 1Z0PA 2I6HA 2EHOA 1FJGT 4H9RC 2N1GA 1E2AA 1D0ZA 2UUAT 5ETWA 3ZC1A 3JC6D 2ACXA 5JRCB 2XTLA 4O4LE 3TLVA 5LMNT 4ISSA 3UT5E 1IBMT 2JIWA 5FY1A 2YU1A 2WMOA 5AQPB 4LF9T 1ZOYA 2X9WA 3FBLA 1XDOA 4AKIA 4ZI7E 4GK0E 1I6ZA 3RYFE 3FBZA 2YDSA 3T8OA 2XSBA 5HYAA 4Z8XA 5AQKB 4HEAA 4DR5T 3L09A 3QC9A 1XMQT 4ZOLE 5FL0A 2XQ5A 3QB5A 2AE9A 4F8HA 4DVDA 3DP7A 3ZJ1A 3M65A 2K48A 3VKGA 2BS2A 3MA9A 3P7IA 3NWIA 1OWAA 4XAXB 1OXZA 4YJ3E 4UVCB 1S35A 4ZI2D 4IHJE 2OA5A 4IE4A 2V6YA 2DWGA 1V9DA 1D0YA 3GN5A 2LLYA 4ADZA 2NW7A 2VVSA 4JI0T 2QRXA 4CN1A 1HNZT 1IZNB 4HWDA 3ZMUB 2N9DA 2Y48B 5HXSA 3QK6A 1ZKEA 2P9BA 4ILCA 5FY0A 2MBGA 4BAYB 4U3CA 4HFBA 3I9WA 2M6BA 3S4UA 4TV9E 3Q9DA 4COFA 1HNWT 2XQ6A 5AQMB 1X9BA 2LJLA 3H3AA 1N32T 3ZN1B 3ZYMA 3X1DA 3AA1B 4IE6A 1Y64B 1J5ET 4U33A 1MMGA 3U78A 4IE5A 2I0MA 2D0TA 2VURA 3OJAA 2ZM0A 4WBOA 2CLYB 3C4ZA 4DV1T 2J62A 5AQVB 2CXLA 2CEAA 1HNXT 4MHCA 2XAJB 3P4PA 4CI2B 2Q9QD 3RYIE 5HXRA 2VL0A 2W61A 3LK2B 5FYMA 3AA7B 2CCQA 4LFBT 1UGOA 2IMLA 2V6XA 1SUMB 2X68A 4H9PC 1YW0A 2YK0A 1T72A 2DI4A 1HX1B 1YQ3A 2UXCT 4HWFA 2CHOA 4QKNA 3JC6C 2XZEA 3RLFF 5HEGA 4ILUA 3UU6A 4C91A 4AQGA 1HS7A 2C5JA 3N9PA 2E8IA 3ZCJA 4IDPA 1ZHCA 1CUNA 3AVRA 4A97A 4AKLA 4NUVA 2PJQA 3HKEE 3AEBA 4TWDA 2DLRA 1S94A 5FVKA 4YSZA 3MJXA 1US7B 3VRBA 2X67A 4PK5A 5FXWA 3A5XA 5LHIB 2B76A 3KDSE 5LYJE 4NXNT 3VHLA 4JEUB 4EEDA 4OFZA 5H6QB 3PUWF 4AXPA 5L2LA 3OBVE 3ETUA 5C8YE 4B3TT 3AE7A 1D1BA 3ZSTA 2KWHA 4QX8B 2WZIA 3C4WA 3O4XE 1QSDA 2ZM2A 5BMVE 4QHOA 2LKHA 4EZ4A 4JBWF 3SFDA 1YKEB 5IUXA 2WY2A 3RF1A 1CHUA 1N34T 4LMLA 3KV6A 5F3JA 1OEDA 4GKKT 4X64T 4UELA 4YTNA 5ABFB 2BG9C 2LM2A 2BS4A 4UIGA 2WSSV 2UXBT 3B5MA 4JI2T 1BR2A 2NW8A 1KNPA 3EAMA 1MIYA 4LFAT 3OTOT 3FZLB 2WAUA 4MALA 3ONJA 3NZQA 3UUXB 3PUSA 4O2AE 3RI5A 4IE0A 4L9IA 5AQTB 4B3ST 4HFIA 3UU5A 2Q9QC 4KI0F 2E9XB 2FUPA 1MIWA 4DV3T 4IL9A 2VASA 2DCFA 1WR6A 2D5UA 5L3BB 5L3GB 2V26A 5KX5E 3OYXA 3Q5EA 4M1PA 3HA4A 4IIJE 3AE4A 4AKHA 3GWHA 5LG3A 2RPAA 4ZI3C 4P1NA 3RIAA 4ISTA 5LHGB 4IDQA 4H9QC 3FZHB 4UEMA 2XAHB 3EDVA 4QH5A 3AA6B 4H63V 5HWXA 2CM0A 2C5IT 3UU3A 2ES0A 4MBQA 1UK5A 3N2GE 3PU8A 3ZMVB 4AKGA 2CE7A 2E2AA 3RGLA 2XQ9A 4U2ZA 4E7SA 4CXYA 4U7YA 2CRBA 3TLSA 2V5CA 2CPTA 2ZM8A 3P4WA 2XUEA 5C3JA 1R8IA 4NPPA 5IWAT 1O3XA 3A8YC 4A5XA 4YTPA 1G8XA 4UF0A 3EUHA 4KUMB 2Z6EA 1HF8A 1XZYA 4HWIB 4Z91A 1YXRA 1WFDA 3HL6A 3NRXA 4Q25A 3N2OA 4AI6A 4JLEA 4DMVA 2X9YA 2EHOB 4UV8B 4PK6A 1KK7A 3UUNA 1JNZA 3RYHE 5L4EA 3CKDA 1W9RA 3PDYA 2OLTA 4GK5E 3O1JA 5JDHA 4U72A 2JQHA 2CLYC 1KFYA 2B1EA 4X62T 4CI3B 2K24A 3CWZB 3ZYKA 3AVSA 4DUZT 2R6GF 5EZYE 2KXPB 2BBHA 4LF7T 1MMDA 3CIRA 2E9XD 4LFCT 2XQ8A 5FP3A 3UFGA 1W09A 3F2EA 3AEFA 4OK0A 2CBJA 2QYWA 1HCIA 1YQ4A 3MXZA 4EGWA 2L3LA 4JI3T 3N9NA 3CQXC 3C64A 3ZMTB 4O4IE 3EVYA 2NR4A 2V6YB 4I43B 3ZMZB 2XM2A 3SS1A 3GN5B 4AISA 5LGNB 1HG2A 2KWIB 4GYSA 2XQ4A 4DMWA 4ZZBA 2LSKA 4UVAB 2FJBA 3CMLA 4P09A 3J7Yq 2W2UA 3AE3A 2WWUA 3BQIA 3BQLA 2MOZA 2IIUA 5JH7E 1KNZA 4CXXA 1SA0E 3PUGA 3QUJA 5HEUA 3N9MA 2BG9A 3ZC0A 3RRWA 4O4HE 4BJMA 1IJ6A 2YDRA 2VKOA 2ZLYA 3AEDA 3RYCE 1XDPA 1J5WA 2V8SV 3PUVF 2VL8A 2VB6A 2Y6XA 2XQ7A 2V7KA 3HR0A 2XHEB 5L3EB 2X0HA 3PUQA 2M67A 3RHWA 2KZ7B 5KMGP 2KT9A 4CI1B 3OKQA 4DR1T 1FMVA 3WAKA 3H37A 2CWOA 5CFBA 2EHOD 4AQFA 2YOEA 3ETVA 4PNIA 3UFEA 2GK9A 1NWMX 2QA7A 5J2UE 5HCJA 3LBXA 3LSVA 5J2TE 1BR1A 3RIUA 5LB7B 2WB5A 2XM1A 1E1HB 3UTKA 4HFDA 1J1JA 2WDQA 3SOLA 1HTJF 2IC6A 3AE8A 2XAFB 1B7TA 3ONLC 4O8SA 5JDGA 1FEWA 2KINB 3VR9A 2HHHT 3P8CD 4L5GA 3ONXA 1WYCA 3F31A 2ODUA 4CN6A 5J0ZA 5AQFB 3DTOA 1WLXA 2MTQA 3LG7A 3CX6B 2JJ9A 4U2YA 5HAXA 2J4GA 1N33T 2BG9E 2E9XC 4TV8E 4DR7T 4PFPA 3AE6A 2E5LT 2V5DA 2HN2A 2BS3A 2ACZA 2X9XA 3O9XA 4DV5T 4QXCB 2BKPA 2FJDA 2DL1A 3RC8A 2A2FX 3E22E 1I94T 5AQHB 4AIUA 1QUUA 3W15B 3PUYF 4DR4T 3FZFB 1MNEA 4ZS2A 2QVAA 3H3MA 4IDNA 5DABA 3K3NA 1VRBA 4ZS3A 3ZLIA 3PUZF 4TUYE 2J1DG 1SE7A 3LK42 1OEDB 4HN9A 4IDOA 2H3RA 5CA0E 4U74A 2W0GA 1W0AA 2H7OA 2JQ9A 2BZBA 2XAGB 4KHPT 1WRDA 5JR9A 5CGMA 3L8RA 4P0BA 3Q5WA 4OHFA 3ZKRA 4UV9B 3HKDE 4TNWA 3F57A 4OX9T 3I9YA 3QNUA 2A3DA 5JTGA 5L3DB 2VKDA 2NWBA 3ZT6A 2X9HA 2F4VT 2X51A 4PJJA 3O1IA 3LJCA 4ZI2C 3AEEA 4EV6A 4PFOA 3LDQB 2Y8DA 4FI5A 5EK3A 5ABHA 3AE9A 5HXHA 4KP3C 2EHOC 4ZHQE 2H7VC 4H9OC 5FXXA 2YU2A 2YDQA 3TLWA 4J2CA 3IBPA 1NENA 3UULA 3FHNA 4P0AA 3O1HA 3VRAA 4IL4A 2WMNA 3UUMA 5JDFA 2JPFA 3PUXF 4IT4A 2HN1A 2RP4A 5L3CB 2LEHA 4YFSA 5FKYA 4KMCA 4A98A 2FBWA 2UXXB 2UXNB 4Z90A 3R84B 5JDNA 2BKOA 5C2TA 5LP6E 3N5LA 4HFHA 4TX5A 1M7KA 2J47A 4YT0A 4PJMA 2W66A
chains in the Genus database with same CATH topology
4FJOA 5TAOA 5HYAA 4Z8XA 1HG5A 2NTXA 3HL6A 3RX6A 3NRXA 4PJNA 2W00A 4X1KE 4HEAA 2W63A 3L09A 3QC9A 3N2OA 4AI6A 4JLEA 4ZOLE 4DMVA 2XQYA 2X9YA 3I1AA 2EHOB 1BR4A 4UV8B 4XBFB 2A72A 4DBQA 4UXNB 3V5SA 4DVDA 1HFAA 3DP7A 4PK6A 3ZJ1A 3M65A 5JDMA 2K48A 2PFVA 1KK7A 3UUNA 4JUYA 3MA9A 3VKGA 3P7IA 3C98B 3RYHE 1OWAA 3CKDA 4ZI3D 3PDYA 1IJ5A 4XAXB 2C0SA 1OXZA 4TN7B 2IW5B 2RA1A 4YJ3E 4CQIA 4UVCB 1S35A 4ZI2D 5E0OA 4IHJE 2IC9A 2OA5A 4GK5E 4IE4A 2DWGA 2L8KA 5IYZE 4X1YE 3VU7H 3O1JA 4GYRA 5KDMC 1V9DA 3KVAA 3E08A 1D0YA 5JDHA 4U72A 1G73A 1HX8A 3GN5A 2HPJA 2ODVA 5M4YA 2CLYC 4ADZA 3NRYA 2NW7A 4V1Av 3CX7B 4UF0B 3Q2MA 1IZNB 5AFUL 2B1EA 3ZMUB 2N9DA 3R6NA 5LJNA 5LGTB 2Y48B 4CI3B 5HXSA 2K24A 3CWZB 3ZYKA 3QK6A 3AVSA 2LSIA 3IF8B 1ZKEA 2P9BA 3KV4A 5FY0A 2MBGA 5EZYE 2KXPB 4BAYB 4TZ4C 1MMDA 2E9XD 3MKDA 4EIWA 5JREA 3I9WA 3ZPOA 3S4UA 4TV9E 5FP3A 1FIOA 3Q9DA 2LSYA 3IHRA 3F2EA 3CVRA 2KMFA 3WI3A 4OK0A 3K3OA 1NAFA 5DQWA 1HCIA 2ZMAA 5DJQC 2LJLA 3H3AA 3ZN1B 2LSGA 5LGUB 3ZYMA 3AAAB 4YJ2E 2IAKA 4HE8A 3B57A 3AA1B 3MXZA 2BDEA 4XZCA 2L3LA 3N9NA 3CQXC 3C64A 4HGAA 4IE6A 1Y64B 3CQCB 3ZMTB 4O4IE 3EVYA 1MMGA 3U78A 4IE5A 4I43B 5LA6E 5EK4A 3ZMZB 2I59A 5LCYA 3SS1A 2BVMA 2D0TA 3GN5B 3OJAA 2NTYA 2ZM0A 4WBOA 5LGNB 2CLYB 1HG2A 2YINA 1U5PA 3C4ZA 3HI2A 1VOMA 3KFWX 1BR0A 4GIWA 2CXLA 2MYSA 2CEAA 2NOXA 2DNXA 4OYJA 1MNDA 2KWIB 4GYSA 4MHCA 4I55E 2XAJB 3RH3A 4CI2B 4B6XA 4MFRA 1LRZA 4A56A 2CA5A 2Q9QD 3RYIE 1H7CA 4DMWA 2LSKA 3ZYLA 4UVAB 3CMLA 4P09A 5F8PA 5HXRA 4WW0A 3J7Yq 2W61A 4BJNA 3LK2B 4BA9A 5FYMA 2DHRA 4EOZB 2WWUA 5FXZA 3AA7B 3FB2A 3BQIA 3BQLA 2CCQA 2MOZA 5H6RB 5JH7E 1KNZA 1FMWA 4CXXA 4CZZB 1SA0E 3PUGA 4KBMB 3QUJA 3N9MA 3ZC0A 5J1GA 3RRWA 4O4HE 4BJMA 1IJ6A 2X68A 4H9PC 1YW0A 3KBTA 2YK0A 3N9QA 2DI4A 2VKOA 2ZLYA 1ZEEA 4EB6E 4EAHA 3RYCE 4X20E 4QXHB 4QWNB 4HFVA 3ZCIA 2VL8A 4QKNA 3JC6C 2VB6A 4DBRA 4PJLA 3ESLA 2Y6XA 2V7IA 3KINB 4ILUA 2C5KT 4C91A 3C50A 2V7KA 3HR0A 2XHEB 4AQGA 3Q5XA 2W62A 3ZEFB 5L3EB 2LOPA 2C5JA 1HS7A 5L3FB 3NBXX 3PUQA 2M67A 2KZ7B 3N9PA 5KMGP 2E8IA 2V1DB 4YLHA 3PUAA 4X1IE 3OYZA 4ASKA 5A1LA 3ZCJA 2KT9A 3BK9A 5FY7A 2SPCA 4CI1B 3OKQA 2X66A 1FMVA 2D0UA 3WAKA 1ZHCA 3H37A 5DQVA 1CUNA 2CWOA 3AVRA 4AKLA 4AQFC 4NUVA 2EHOD 2K5BB 2PJQA 4AQFA 3HKEE 3ETVA 1UX4A 3MZKB 4PNIA 3VKHA 3UFEA 3FXDB 5LG4A 2DLRA 1S94A 3I0OA 4UVBB 3MJXA 1US7B 2K9AA 2GK9A 4WNKA 2X67A 1NWMX 5LBQB 2QA7A 5J2UE 4PK5A 5FXWA 2V7LA 2V7JA 3LBXA 3A5XA 5LHHB 4HKAA 5J2TE 5FMNA 3KDSE 3C4XA 2CMRA 1BR1A 3RKOA 5ADXL 5LHIB 5LYJE 3RPUA 3V5UA 3KVBA 4EYUA 3VHLA 1YD8G 3HKCE 4JEUB 4OFZA 3ZMSB 5H6QB 4G63A 2HPLA 3N9OA 1E1HB 3ANWA 4AXPA 5L2LA 3UTKA 1U4QA 3OBVE 3ETUA 5C8YE 4C90A 2LT3A 1D1BA 3SOLA 3RC3A 1HTJF 2IC6A 2KWHA 3J9X1 2XAFB 5HXCA 1B7TA 2X0LB 4O8SA 1ZV4X 4QX8B 3C4WA 5JDGA 1FEWA 2KINB 3O4XE 1QSDA 3P8CD 4L5GA 3ONXA 2ZM2A 1WYCA 3F31A 2ODUA 5HXEA 4H9SE 1LVKA 1D0XA 3GMIA 5FXVA 5IHYA 1YKHB 5BMVE 3K8PC 4QXBB 2V7MA 1LVFA 3DTOA 4QHOA 3K3QC 1X79A 1WLXA 4EZ4A 3ZJ2A 1LKXA 2MTQA 3LG7A 3LFMA 3CX6B 4DNDA 2JJ9A 1YKEB 3I0QA 4IGUA 5HAXA 5FNVE 2E9XC 4TV8E 4JEHB 4L0RA 1UCUA 2E9XA 3LBXB 4PFPA 1EZ3A 5JVDE 3KV6A 3EDUA 5F3JA 5LXTE 2DWKA 2KLQA 3TKLB 4F6RC 3CPZA 1IAPA 3E0ZA 4UELA 4IE7A 2JMKA 5LOVE 3ANWB 2X9XA 3BQKA 4MLKA 3O9XA 2NW9A 4QXCB 5JQGE 3AB3B 2CXDA 4UIGA 2WSSV 2XASB 2QGSA 3SRZA 1BR2A 1MMAA 2NW8A 3B13A 4AKRB 2LOSA 3RC8A 2BVLA 2G0UA 1MIYA 2A2FX 3E22E 3AA0B 5CB4E 3SWHA 4K0UA 2JMHA 1WYBA 4EZHA 4ERRA 1QUUA 2WAUA 3CX8B 3N9LA 4IDZA 4MALA 3W15B 5EK2A 2LE8A 3NZQA 2HH7A 2LM9A 3UUXB 1MNEA 4ZS2A 2VKJA 3HKBE 3PUSA 4O2AE 5DABA 4I50E 4H9NC 4IE0A 4E7ZA 5LJMA 3N2KE 4O2BE 4CXWA 1MMNA 3K3NA 3DJBA 2JQQA 2LHNA 1VRBA 3KV5A 4ZS3A 5GONE 3ZLIA 2KNDA 4ANJA 4L9IA 4TUYE 4N78D 2J1DG 4G2AA 4WBNE 2Q9QC 4OYKA 1T98A 4YHJA 4PW8A 2Q9QA 2E9XB 2VKHA 4I4TE 3LK42 1MIWA 4HN9A 3PU3A 2VASA 2DCFA 5CA0E 2H3RA 4U74A 1WR6A 2D5UA 2N2NA 5LBMA 5L3GB 5L3BB 2W0GA 2V26A 5KX5E 2H7OA 2NP9A 5JR9C 5CA1E 3OYXA 2BZBA 2XAGB 1WRDA 5JR9A 4HTEA 4M1PA 3HA4A 4P0BA 3Q5WA 4OHFA 3IEEA 4UV9B 3L3PA 3HKDE 3F57A 2LSJA 5JRCA 3AAEB 3PTRB 3I9YA 4IIJE 4PK4A 2A3DA 3FXEB 5L3DB 1D1CA 2XAQB 3PURA 3KBUA 3KV9A 3GA8A 4AKHA 2VKDA 4H63H 1D1AA 3GWHA 2NWBA 2L9QA 1MIVA 2JRKA 2PBIA 2X9HA 5JDLA 2LHRA 3RRCA 3U3IA 4QX7B 2X51A 3D0TA 4GOUA 3MACA 2CXFA 4PJJA 3WAJA 3O1IA 4ZI3C 2PG8A 2WBLA 3LJCA 2WM9A 4ISTA 5HWYA 5LHGB 3AAIA 4H9QC 4ZI2C 2D2SA 4DO0A 4UEMA 3CQGB 2VWAA 2XAHB 3EDVA 2CWYA 3AA6B 2VK9A 4H63V 3MK7C 5HWXA 4PFOA 2CM0A 4PAGA 2C5IT 2Y8DA 4FI5A 3LK3B 5LNKA 5EK3A 2YEVC 2ES0A 2Q9QB 4MBQA 5HXHA 1SHZC 3PE0A 3NZPA 4KP3C 3N2GE 4O4JE 1Z0PA 2EHOC 5JDQA 4ZHQE 3PU8A 2EHOA 2H7VC 4EXTA 4H9OC 5FXXA 3ZMVB 2YU2A 4AKGA 2CE7A 4H9RC 3C51A 4J2CA 4CXYA 4E7SA 3IBPA 3UULA 3FHNA 5JR9B 4P0AA 2N1GA 1D0ZA 3O1HA 5ETWA 4NUUA 3ZC1A 2WMNA 3UUMA 5JDFA 2JPFA 3JC6D 2ACXA 5JRCB 2XTLA 1UX5A 4O4LE 2RP4A 4ISSA 5L3CB 3UT5E 1AJ3A 2LEHA 4YFSA 5FY1A 2ZM8A 4KMCA 2XUEA 2YU1A 2WMOA 1O3XA 2UXXB 2UXNB 3R84B 2X9WA 3FBLA 4AKIA 5JDNA 4ZI7E 1G8XA 4UF0A 3EUHA 5LP6E 4GK0E 4EYYR 3N5LA 4TX5A 4KUMB 3RYFE 3ZN0B 2Z6EA 3FBZA 1HF8A 4PJMA 3T8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHO D;  2Q9Q D;  3ANW B;  3JC6 C;  2E9X C; 
#chains in the Genus database with same CATH topology
 2WZH A;  4FJO A;  5TAO A;  5ABG A;  3OPC A;  3RX6 A;  4JI8 T;  2W00 A;  3T1H T;  2W63 A;  3G06 A;  1IBL T;  2XQY A;  2XSA A;  3I1A A;  4XBF B;  4DBQ A;  3V5S A;  5L47 A;  1HFA A;  4HWC A;  4JUY A;  4B3M T;  2C0S A;  4TN7 B;  2IW5 B;  2RA1 A;  5IYZ E;  4X1Y E;  2IUB A;  2BKN A;  4GYR A;  3KVA A;  3E08 A;  1G73 A;  1HX8 A;  4YSY A;  4UF0 B;  3Q2M A;  3R6N A;  5HCM A;  5AQL B;  4YHH T;  2LSI A;  3IF8 B;  3KV4 A;  4KHZ F;  1NEK A;  3QB5 K;  3QOF A;  1KNR A;  5JRE A;  3MKD A;  4EIW A;  2VQF T;  3OVU A;  4JV5 T;  1FIO A;  3IHR A;  5ABE A;  2VVN A;  3WI3 A;  1NAF A;  2W67 A;  4YXD A;  3A7M A;  4HGA A;  3CQC B;  3JCF A;  2W4X A;  5LA6 E;  4NXM T;  2BVM A;  5AQS B;  3HI2 A;  3KFW X;  1BR0 A;  4GIW A;  4U31 A;  2MYS A;  2IHR 1;  1WR0 A;  4ZXL A;  4I55 E;  3RH3 A;  4ZZC A;  1LRZ A;  4A56 A;  4DID B;  4DV0 T;  5F8P A;  3AE1 A;  4BA9 A;  2DHR A;  4EOZ B;  3FB2 A;  1KEY A;  5FL1 A;  2AXD S;  1FMW A;  4CZZ B;  5J1G A;  5LMU T;  3KBT A;  3N9Q A;  2WU2 A;  5HEJ A;  1ZEE A;  4EB6 E;  4EAH A;  4X20 E;  4QWN B;  2LRL A;  2ZM6 T;  4PJL A;  3ESL A;  2V7I A;  4JI7 T;  2C5K T;  3TLT A;  3C50 A;  3Q5X A;  2W62 A;  3ZEF B;  2LOP A;  3NBX X;  2V1D B;  4ASK A;  3OYZ A;  5L4H A;  2SPC A;  4EEB A;  2D0U A;  4YSX A;  5DQV A;  3MZK B;  1UX4 A;  3VKH A;  5LG4 A;  3IA3 A;  4UVB B;  2K9A A;  5LBQ B;  1JNR A;  5BR8 T;  5FMN A;  2CMR A;  3V5U A;  3KVB A;  4EYU A;  4ILA A;  3ZMS B;  3ABV A;  4G63 A;  3UQ7 A;  3AXJ A;  3PJA J;  3ANW A;  3NVO A;  1U4Q A;  3CK6 A;  4TWF A;  2LT3 A;  4DUY T;  3RC3 A;  3J9X 1;  5HXC A;  2X0L B;  5F5W A;  1ZV4 X;  4LF4 T;  4HFC A;  5HXE A;  1LVK A;  1D0X A;  5FXV A;  5IHY A;  4JI4 T;  1YKH B;  3K8P C;  4QXB B;  2V7M A;  1LVF A;  2CHN A;  2UU9 T;  3ZJ2 A;  4YY3 T;  4LF5 T;  3LFM A;  4LF8 T;  5AQR B;  2UUC T;  4L0R A;  3LBX B;  1OED C;  1EZ3 A;  5LXT E;  2WS3 A;  3EDU A;  2DWK A;  3TKL B;  4WYV A;  3CPZ A;  3E0Z A;  3P4R A;  4LF6 T;  4UR9 A;  5HEO A;  2JMK A;  3BQK A;  4HWH A;  2NW9 A;  5JQG E;  2WWV A;  2CXD A;  3JAF A;  2XAS B;  2QGS A;  4AKR B;  3B13 A;  2LOS A;  3UUB A;  3RKG A;  4K0U A;  2JMH A;  1IBK T;  3K1S A;  3M3Z B;  4IDZ A;  3CX8 B;  2LE8 A;  1UUS A;  2VKJ A;  3HKB E;  3L39 A;  4H9N C;  4E7Z A;  1T7S A;  1MMN A;  2JQQ A;  5GON E;  2UUB T;  3RIF A;  4ILB A;  3VR8 A;  1T98 A;  4YHJ A;  2Q9Q A;  2VKH A;  2XY8 B;  2FJE A;  1WCR A;  3AEC A;  5LBM A;  3PV0 F;  5CA1 E;  2LSJ A;  5JRC A;  3PTR B;  4AQY T;  3FXE B;  1D1C A;  1UUR A;  3KBU A;  4IRE A;  3KV9 A;  2LKG A;  2L9Q A;  1MIV A;  4JYA T;  2WU5 A;  3FZM B;  4QX7 B;  3UQ4 A;  3MAC A;  2CXF A;  5AQN B;  2PG8 A;  2WBL A;  2XQA A;  2D2S A;  1XMO T;  1ZP0 A;  2VWA A;  4JI5 T;  4I0U A;  4PAG A;  2OV9 A;  4TNV A;  2UXD T;  3LK3 B;  2KSR A;  2YEV C;  3AEG A;  1SHZ C;  3PE0 A;  3NZP A;  4O4J E;  2K3W A;  5JDQ A;  4EXT A;  1QLB A;  3C51 A;  5JR9 B;  4JI1 T;  4NUU A;  1VCS A;  1UX5 A;  4U7I A;  1AJ3 A;  4DV7 T;  1T8B A;  3FZK B;  2XJ7 A;  4EYY R;  3ZN0 B;  1M62 A;  4TWH A;  2XPK A;  1HG5 A;  2NTX A;  4PJN A;  4X1K E;  1BR4 A;  1W0B A;  2A72 A;  4UXN B;  2H89 A;  5JDM A;  2PFV A;  3C98 B;  3SFE A;  3P50 A;  4ZI3 D;  1IJ5 A;  4CQI A;  5E0O A;  2IC9 A;  2L8K A;  3VU7 H;  5KDM C;  2JQK A;  2HPJ A;  2ODV A;  5M4Y A;  3NRY A;  4V1A v;  3JAD A;  3CX7 B;  5AFU L;  5LJN A;  5LGT B;  2WDV A;  1VCT A;  2XQ3 A;  4TZ4 C;  3ZPO A;  2LSY A;  3CVR A;  2KMF A;  3K3O A;  5DQW A;  5DJQ C;  2ZMA A;  2LSG A;  5LGU B;  3AAA B;  4YJ2 E;  2IAK A;  4HE8 A;  3B57 A;  2BDE A;  4XZC A;  2E5V A;  1XNQ T;  2IDO B;  2FJA A;  5AQQ B;  5EK4 A;  2I59 A;  5LCY A;  2NTY A;  2YIN A;  1U5P A;  1VOM A;  4CN4 A;  2NOX A;  5AQG B;  2DNX A;  3PJA A;  1MND A;  4OYJ A;  3JAE A;  4KX6 A;  4B6X A;  4MFR A;  2CA5 A;  2CBI A;  1H7C A;  3ZYL A;  4WW0 A;  4NIQ A;  4BJN A;  1XWM A;  5FXZ A;  2WQY A;  5H6R B;  2WDR A;  3EI0 A;  4JI6 T;  4KBM B;  3AE2 A;  3ZT5 A;  2H88 A;  5KXJ A;  2MPK A;  2D9D A;  4QXH B;  3ZSS A;  4HFV A;  3RQW A;  3ZCI A;  1HR0 T;  3AEA A;  4DBR A;  5HEH A;  3KIN B;  5L3F B;  4DV4 T;  1Y01 A;  4YLH A;  3PUA A;  4X1I E;  5A1L A;  3BK9 A;  5FY7 A;  2X66 A;  1XNR T;  1KF6 A;  1N36 T;  5AQU B;  4K0K T;  4QH1 A;  2PTF A;  4AQF C;  2K5B B;  3FXD B;  4DR3 T;  3I0O A;  4WNK A;  2V7L A;  2V7J A;  4DV6 T;  5LHH B;  4HKA A;  3RIU C;  3RKO A;  3C4X A;  5ADX L;  2WCA A;  3RPU A;  1L0V A;  1YD8 G;  3HKC E;  2YKS A;  1DU2 A;  5ABF A;  2HPL A;  3N9O A;  4ZEY A;  4C90 A;  3ZT7 A;  1E7P A;  4GKJ T;  2X0Y A;  4HFE A;  4H9S E;  3GMI A;  4X5T A;  3K3Q C;  4LMK A;  1OED E;  1X79 A;  3NKZ A;  3EAB A;  1LKX A;  4B3R T;  1GQE A;  4DND A;  5FVL A;  2M6I A;  3I0Q A;  4IGU A;  5FNV E;  2BBJ A;  4JEH B;  1UCU A;  2E9X A;  2MAW A;  5JVD E;  2KLQ A;  4F6R C;  1IAP A;  4X65 T;  4IE7 A;  3Q5D A;  3AXJ B;  5LOV E;  2LRK A;  3ANW B;  4MLK A;  3P4S A;  4WZX A;  4X66 T;  3AB3 B;  4DV2 T;  3SRZ A;  1MMA A;  2BVL A;  2G0U A;  3AA0 B;  5CB4 E;  3SWH A;  4DR6 T;  2A9U A;  1WYB A;  4EZH A;  4ERR A;  3N9L A;  5EK2 A;  2HH7 A;  2LM9 A;  4I50 E;  5LJM A;  3RQU A;  3N2K E;  4O2B E;  4CXW A;  3DJB A;  2LHN A;  3KV5 A;  3T1Y T;  2KND A;  4ANJ A;  4N78 D;  4G2A A;  5AQI B;  4WBN E;  4OYK A;  4PW8 A;  4DR2 T;  3TLU A;  4I4T E;  3UU4 A;  3EHZ A;  3PU3 A;  2YN6 A;  2N2N A;  4YTM A;  2NP9 A;  4LMJ A;  5JR9 C;  4QH4 A;  4HTE A;  2BG9 B;  3IEE A;  3L3P A;  3AAE B;  5CJ5 A;  4PK4 A;  3UU8 A;  2XAQ B;  3PUR A;  3GA8 A;  4H63 H;  1D1A A;  2PBI A;  2JRK A;  5JDL A;  2LHR A;  3RRC A;  3U3I A;  3D0T A;  4GOU A;  3WAJ A;  5HWY A;  2WM9 A;  3AAI A;  4DO0 A;  3CQG B;  2CWY A;  5AQO B;  2VK9 A;  3P4Q A;  2VQE T;  3MK7 C;  1Z8U A;  5AQJ B;  5LNK A;  2Q9Q B;  2WP9 A;  3AE5 A;  1Z0P A;  2I6H A;  2EHO A;  1FJG T;  4H9R C;  2N1G A;  1E2A A;  1D0Z A;  2UUA T;  5ETW A;  3ZC1 A;  3JC6 D;  2ACX A;  5JRC B;  2XTL A;  4O4L E;  3TLV A;  5LMN T;  4ISS A;  3UT5 E;  1IBM T;  2JIW A;  5FY1 A;  2YU1 A;  2WMO A;  5AQP B;  4LF9 T;  1ZOY A;  2X9W A;  3FBL A;  1XDO A;  4AKI A;  4ZI7 E;  4GK0 E;  1I6Z A;  3RYF E;  3FBZ A;  2YDS A;  3T8O A;  2XSB A;  5HYA A;  4Z8X A;  5AQK B;  4HEA A;  4DR5 T;  3L09 A;  3QC9 A;  1XMQ T;  4ZOL E;  5FL0 A;  2XQ5 A;  3QB5 A;  2AE9 A;  4F8H A;  4DVD A;  3DP7 A;  3ZJ1 A;  3M65 A;  2K48 A;  3VKG A;  2BS2 A;  3MA9 A;  3P7I A;  3NWI A;  1OWA A;  4XAX B;  1OXZ A;  4YJ3 E;  4UVC B;  1S35 A;  4ZI2 D;  4IHJ E;  2OA5 A;  4IE4 A;  2V6Y A;  2DWG A;  1V9D A;  1D0Y A;  3GN5 A;  2LLY A;  4ADZ A;  2NW7 A;  2VVS A;  4JI0 T;  2QRX A;  4CN1 A;  1HNZ T;  1IZN B;  4HWD A;  3ZMU B;  2N9D A;  2Y48 B;  5HXS A;  3QK6 A;  1ZKE A;  2P9B A;  4ILC A;  5FY0 A;  2MBG A;  4BAY B;  4U3C A;  4HFB A;  3I9W A;  2M6B A;  3S4U A;  4TV9 E;  3Q9D A;  4COF A;  1HNW T;  2XQ6 A;  5AQM B;  1X9B A;  2LJL A;  3H3A A;  1N32 T;  3ZN1 B;  3ZYM A;  3X1D A;  3AA1 B;  4IE6 A;  1Y64 B;  1J5E T;  4U33 A;  1MMG A;  3U78 A;  4IE5 A;  2I0M A;  2D0T A;  2VUR A;  3OJA A;  2ZM0 A;  4WBO A;  2CLY B;  3C4Z A;  4DV1 T;  2J62 A;  5AQV B;  2CXL A;  2CEA A;  1HNX T;  4MHC A;  2XAJ B;  3P4P A;  4CI2 B;  2Q9Q D;  3RYI E;  5HXR A;  2VL0 A;  2W61 A;  3LK2 B;  5FYM A;  3AA7 B;  2CCQ A;  4LFB T;  1UGO A;  2IML A;  2V6X A;  1SUM B;  2X68 A;  4H9P C;  1YW0 A;  2YK0 A;  1T72 A;  2DI4 A;  1HX1 B;  1YQ3 A;  2UXC T;  4HWF A;  2CHO A;  4QKN A;  3JC6 C;  2XZE A;  3RLF F;  5HEG A;  4ILU A;  3UU6 A;  4C91 A;  4AQG A;  1HS7 A;  2C5J A;  3N9P A;  2E8I A;  3ZCJ A;  4IDP A;  1ZHC A;  1CUN A;  3AVR A;  4A97 A;  4AKL A;  4NUV A;  2PJQ A;  3HKE E;  3AEB A;  4TWD A;  2DLR A;  1S94 A;  5FVK A;  4YSZ A;  3MJX A;  1US7 B;  3VRB A;  2X67 A;  4PK5 A;  5FXW A;  3A5X A;  5LHI B;  2B76 A;  3KDS E;  5LYJ E;  4NXN T;  3VHL A;  4JEU B;  4EED A;  4OFZ A;  5H6Q B;  3PUW F;  4AXP A;  5L2L A;  3OBV E;  3ETU A;  5C8Y E;  4B3T T;  3AE7 A;  1D1B A;  3ZST A;  2KWH A;  4QX8 B;  2WZI A;  3C4W A;  3O4X E;  1QSD A;  2ZM2 A;  5BMV E;  4QHO A;  2LKH A;  4EZ4 A;  4JBW F;  3SFD A;  1YKE B;  5IUX A;  2WY2 A;  3RF1 A;  1CHU A;  1N34 T;  4LML A;  3KV6 A;  5F3J A;  1OED A;  4GKK T;  4X64 T;  4UEL A;  4YTN A;  5ABF B;  2BG9 C;  2LM2 A;  2BS4 A;  4UIG A;  2WSS V;  2UXB T;  3B5M A;  4JI2 T;  1BR2 A;  2NW8 A;  1KNP A;  3EAM A;  1MIY A;  4LFA T;  3OTO T;  3FZL B;  2WAU A;  4MAL A;  3ONJ A;  3NZQ A;  3UUX B;  3PUS A;  4O2A E;  3RI5 A;  4IE0 A;  4L9I A;  5AQT B;  4B3S T;  4HFI A;  3UU5 A;  2Q9Q C;  4KI0 F;  2E9X B;  2FUP A;  1MIW A;  4DV3 T;  4IL9 A;  2VAS A;  2DCF A;  1WR6 A;  2D5U A;  5L3B B;  5L3G B;  2V26 A;  5KX5 E;  3OYX A;  3Q5E A;  4M1P A;  3HA4 A;  4IIJ E;  3AE4 A;  4AKH A;  3GWH A;  5LG3 A;  2RPA A;  4ZI3 C;  4P1N A;  3RIA A;  4IST A;  5LHG B;  4IDQ A;  4H9Q C;  3FZH B;  4UEM A;  2XAH B;  3EDV A;  4QH5 A;  3AA6 B;  4H63 V;  5HWX A;  2CM0 A;  2C5I T;  3UU3 A;  2ES0 A;  4MBQ A;  1UK5 A;  3N2G E;  3PU8 A;  3ZMV B;  4AKG A;  2CE7 A;  2E2A A;  3RGL A;  2XQ9 A;  4U2Z A;  4E7S A;  4CXY A;  4U7Y A;  2CRB A;  3TLS A;  2V5C A;  2CPT A;  2ZM8 A;  3P4W A;  2XUE A;  5C3J A;  1R8I A;  4NPP A;  5IWA T;  1O3X A;  3A8Y C;  4A5X A;  4YTP A;  1G8X A;  4UF0 A;  3EUH A;  4KUM B;  2Z6E A;  1HF8 A;  1XZY A;  4HWI B;  4Z91 A;  1YXR A;  1WFD A;  3HL6 A;  3NRX A;  4Q25 A;  3N2O A;  4AI6 A;  4JLE A;  4DMV A;  2X9Y A;  2EHO B;  4UV8 B;  4PK6 A;  1KK7 A;  3UUN A;  1JNZ A;  3RYH E;  5L4E A;  3CKD A;  1W9R A;  3PDY A;  2OLT A;  4GK5 E;  3O1J A;  5JDH A;  4U72 A;  2JQH A;  2CLY C;  1KFY A;  2B1E A;  4X62 T;  4CI3 B;  2K24 A;  3CWZ B;  3ZYK A;  3AVS A;  4DUZ T;  2R6G F;  5EZY E;  2KXP B;  2BBH A;  4LF7 T;  1MMD A;  3CIR A;  2E9X D;  4LFC T;  2XQ8 A;  5FP3 A;  3UFG A;  1W09 A;  3F2E A;  3AEF A;  4OK0 A;  2CBJ A;  2QYW A;  1HCI A;  1YQ4 A;  3MXZ A;  4EGW A;  2L3L A;  4JI3 T;  3N9N A;  3CQX C;  3C64 A;  3ZMT B;  4O4I E;  3EVY A;  2NR4 A;  2V6Y B;  4I43 B;  3ZMZ B;  2XM2 A;  3SS1 A;  3GN5 B;  4AIS A;  5LGN B;  1HG2 A;  2KWI B;  4GYS A;  2XQ4 A;  4DMW A;  4ZZB A;  2LSK A;  4UVA B;  2FJB A;  3CML A;  4P09 A;  3J7Y q;  2W2U A;  3AE3 A;  2WWU A;  3BQI A;  3BQL A;  2MOZ A;  2IIU A;  5JH7 E;  1KNZ A;  4CXX A;  1SA0 E;  3PUG A;  3QUJ A;  5HEU A;  3N9M A;  2BG9 A;  3ZC0 A;  3RRW A;  4O4H E;  4BJM A;  1IJ6 A;  2YDR A;  2VKO A;  2ZLY A;  3AED A;  3RYC E;  1XDP A;  1J5W A;  2V8S V;  3PUV F;  2VL8 A;  2VB6 A;  2Y6X A;  2XQ7 A;  2V7K A;  3HR0 A;  2XHE B;  5L3E B;  2X0H A;  3PUQ A;  2M67 A;  3RHW A;  2KZ7 B;  5KMG P;  2KT9 A;  4CI1 B;  3OKQ A;  4DR1 T;  1FMV A;  3WAK A;  3H37 A;  2CWO A;  5CFB A;  2EHO D;  4AQF A;  2YOE A;  3ETV A;  4PNI A;  3UFE A;  2GK9 A;  1NWM X;  2QA7 A;  5J2U E;  5HCJ A;  3LBX A;  3LSV A;  5J2T E;  1BR1 A;  3RIU A;  5LB7 B;  2WB5 A;  2XM1 A;  1E1H B;  3UTK A;  4HFD A;  1J1J A;  2WDQ A;  3SOL A;  1HTJ F;  2IC6 A;  3AE8 A;  2XAF B;  1B7T A;  3ONL C;  4O8S A;  5JDG A;  1FEW A;  2KIN B;  3VR9 A;  2HHH T;  3P8C D;  4L5G A;  3ONX A;  1WYC A;  3F31 A;  2ODU A;  4CN6 A;  5J0Z A;  5AQF B;  3DTO A;  1WLX A;  2MTQ A;  3LG7 A;  3CX6 B;  2JJ9 A;  4U2Y A;  5HAX A;  2J4G A;  1N33 T;  2BG9 E;  2E9X C;  4TV8 E;  4DR7 T;  4PFP A;  3AE6 A;  2E5L T;  2V5D A;  2HN2 A;  2BS3 A;  2ACZ A;  2X9X A;  3O9X A;  4DV5 T;  4QXC B;  2BKP A;  2FJD A;  2DL1 A;  3RC8 A;  2A2F X;  3E22 E;  1I94 T;  5AQH B;  4AIU A;  1QUU A;  3W15 B;  3PUY F;  4DR4 T;  3FZF B;  1MNE A;  4ZS2 A;  2QVA A;  3H3M A;  4IDN A;  5DAB A;  3K3N A;  1VRB A;  4ZS3 A;  3ZLI A;  3PUZ F;  4TUY E;  2J1D G;  1SE7 A;  3LK4 2;  1OED B;  4HN9 A;  4IDO A;  2H3R A;  5CA0 E;  4U74 A;  2W0G A;  1W0A A;  2H7O A;  2JQ9 A;  2BZB A;  2XAG B;  4KHP T;  1WRD A;  5JR9 A;  5CGM A;  3L8R A;  4P0B A;  3Q5W A;  4OHF A;  3ZKR A;  4UV9 B;  3HKD E;  4TNW A;  3F57 A;  4OX9 T;  3I9Y A;  3QNU A;  2A3D A;  5JTG A;  5L3D B;  2VKD A;  2NWB A;  3ZT6 A;  2X9H A;  2F4V T;  2X51 A;  4PJJ A;  3O1I A;  3LJC A;  4ZI2 C;  3AEE A;  4EV6 A;  4PFO A;  3LDQ B;  2Y8D A;  4FI5 A;  5EK3 A;  5ABH A;  3AE9 A;  5HXH A;  4KP3 C;  2EHO C;  4ZHQ E;  2H7V C;  4H9O C;  5FXX A;  2YU2 A;  2YDQ A;  3TLW A;  4J2C A;  3IBP A;  1NEN A;  3UUL A;  3FHN A;  4P0A A;  3O1H A;  3VRA A;  4IL4 A;  2WMN A;  3UUM A;  5JDF A;  2JPF A;  3PUX F;  4IT4 A;  2HN1 A;  2RP4 A;  5L3C B;  2LEH A;  4YFS A;  5FKY A;  4KMC A;  4A98 A;  2FBW A;  2UXX B;  2UXN B;  4Z90 A;  3R84 B;  5JDN A;  2BKO A;  5C2T A;  5LP6 E;  3N5L A;  4HFH A;  4TX5 A;  1M7K A;  2J47 A;  4YT0 A;  4PJM A;  2W66 A; 
#chains in the Genus database with same CATH homology
 4FJO A;  5TAO A;  5HYA A;  4Z8X A;  1HG5 A;  2NTX A;  3HL6 A;  3RX6 A;  3NRX A;  4PJN A;  2W00 A;  4X1K E;  4HEA A;  2W63 A;  3L09 A;  3QC9 A;  3N2O A;  4AI6 A;  4JLE A;  4ZOL E;  4DMV A;  2XQY A;  2X9Y A;  3I1A A;  2EHO B;  1BR4 A;  4UV8 B;  4XBF B;  2A72 A;  4DBQ A;  4UXN B;  3V5S A;  4DVD A;  1HFA A;  3DP7 A;  4PK6 A;  3ZJ1 A;  3M65 A;  5JDM A;  2K48 A;  2PFV A;  1KK7 A;  3UUN A;  4JUY A;  3MA9 A;  3VKG A;  3P7I A;  3C98 B;  3RYH E;  1OWA A;  3CKD A;  4ZI3 D;  3PDY A;  1IJ5 A;  4XAX B;  2C0S A;  1OXZ A;  4TN7 B;  2IW5 B;  2RA1 A;  4YJ3 E;  4CQI A;  4UVC B;  1S35 A;  4ZI2 D;  5E0O A;  4IHJ E;  2IC9 A;  2OA5 A;  4GK5 E;  4IE4 A;  2DWG A;  2L8K A;  5IYZ E;  4X1Y E;  3VU7 H;  3O1J A;  4GYR A;  5KDM C;  1V9D A;  3KVA A;  3E08 A;  1D0Y A;  5JDH A;  4U72 A;  1G73 A;  1HX8 A;  3GN5 A;  2HPJ A;  2ODV A;  5M4Y A;  2CLY C;  4ADZ A;  3NRY A;  2NW7 A;  4V1A v;  3CX7 B;  4UF0 B;  3Q2M A;  1IZN B;  5AFU L;  2B1E A;  3ZMU B;  2N9D A;  3R6N A;  5LJN A;  5LGT B;  2Y48 B;  4CI3 B;  5HXS A;  2K24 A;  3CWZ B;  3ZYK A;  3QK6 A;  3AVS A;  2LSI A;  3IF8 B;  1ZKE A;  2P9B A;  3KV4 A;  5FY0 A;  2MBG A;  5EZY E;  2KXP B;  4BAY B;  4TZ4 C;  1MMD A;  2E9X D;  3MKD A;  4EIW A;  5JRE A;  3I9W A;  3ZPO A;  3S4U A;  4TV9 E;  5FP3 A;  1FIO A;  3Q9D A;  2LSY A;  3IHR A;  3F2E A;  3CVR A;  2KMF A;  3WI3 A;  4OK0 A;  3K3O A;  1NAF A;  5DQW A;  1HCI A;  2ZMA A;  5DJQ C;  2LJL A;  3H3A A;  3ZN1 B;  2LSG A;  5LGU B;  3ZYM A;  3AAA B;  4YJ2 E;  2IAK A;  4HE8 A;  3B57 A;  3AA1 B;  3MXZ A;  2BDE A;  4XZC A;  2L3L A;  3N9N A;  3CQX C;  3C64 A;  4HGA A;  4IE6 A;  1Y64 B;  3CQC B;  3ZMT B;  4O4I E;  3EVY A;  1MMG A;  3U78 A;  4IE5 A;  4I43 B;  5LA6 E;  5EK4 A;  3ZMZ B;  2I59 A;  5LCY A;  3SS1 A;  2BVM A;  2D0T A;  3GN5 B;  3OJA A;  2NTY A;  2ZM0 A;  4WBO A;  5LGN B;  2CLY B;  1HG2 A;  2YIN A;  1U5P A;  3C4Z A;  3HI2 A;  1VOM A;  3KFW X;  1BR0 A;  4GIW A;  2CXL A;  2MYS A;  2CEA A;  2NOX A;  2DNX A;  4OYJ A;  1MND A;  2KWI B;  4GYS A;  4MHC A;  4I55 E;  2XAJ B;  3RH3 A;  4CI2 B;  4B6X A;  4MFR A;  1LRZ A;  4A56 A;  2CA5 A;  2Q9Q D;  3RYI E;  1H7C A;  4DMW A;  2LSK A;  3ZYL A;  4UVA B;  3CML A;  4P09 A;  5F8P A;  5HXR A;  4WW0 A;  3J7Y q;  2W61 A;  4BJN A;  3LK2 B;  4BA9 A;  5FYM A;  2DHR A;  4EOZ B;  2WWU A;  5FXZ A;  3AA7 B;  3FB2 A;  3BQI A;  3BQL A;  2CCQ A;  2MOZ A;  5H6R B;  5JH7 E;  1KNZ A;  1FMW A;  4CXX A;  4CZZ B;  1SA0 E;  3PUG A;  4KBM B;  3QUJ A;  3N9M A;  3ZC0 A;  5J1G A;  3RRW A;  4O4H E;  4BJM A;  1IJ6 A;  2X68 A;  4H9P C;  1YW0 A;  3KBT A;  2YK0 A;  3N9Q A;  2DI4 A;  2VKO A;  2ZLY A;  1ZEE A;  4EB6 E;  4EAH A;  3RYC E;  4X20 E;  4QXH B;  4QWN B;  4HFV A;  3ZCI A;  2VL8 A;  4QKN A;  3JC6 C;  2VB6 A;  4DBR A;  4PJL A;  3ESL A;  2Y6X A;  2V7I A;  3KIN B;  4ILU A;  2C5K T;  4C91 A;  3C50 A;  2V7K A;  3HR0 A;  2XHE B;  4AQG A;  3Q5X A;  2W62 A;  3ZEF B;  5L3E B;  2LOP A;  2C5J A;  1HS7 A;  5L3F B;  3NBX X;  3PUQ A;  2M67 A;  2KZ7 B;  3N9P A;  5KMG P;  2E8I A;  2V1D B;  4YLH A;  3PUA A;  4X1I E;  3OYZ A;  4ASK A;  5A1L A;  3ZCJ A;  2KT9 A;  3BK9 A;  5FY7 A;  2SPC A;  4CI1 B;  3OKQ A;  2X66 A;  1FMV A;  2D0U A;  3WAK A;  1ZHC A;  3H37 A;  5DQV A;  1CUN A;  2CWO A;  3AVR A;  4AKL A;  4AQF C;  4NUV A;  2EHO D;  2K5B B;  2PJQ A;  4AQF A;  3HKE E;  3ETV A;  1UX4 A;  3MZK B;  4PNI A;  3VKH A;  3UFE A;  3FXD B;  5LG4 A;  2DLR A;  1S94 A;  3I0O A;  4UVB B;  3MJX A;  1US7 B;  2K9A A;  2GK9 A;  4WNK A;  2X67 A;  1NWM X;  5LBQ B;  2QA7 A;  5J2U E;  4PK5 A;  5FXW A;  2V7L A;  2V7J A;  3LBX A;  3A5X A;  5LHH B;  4HKA A;  5J2T E;  5FMN A;  3KDS E;  3C4X A;  2CMR A;  1BR1 A;  3RKO A;  5ADX L;  5LHI B;  5LYJ E;  3RPU A;  3V5U A;  3KVB A;  4EYU A;  3VHL A;  1YD8 G;  3HKC E;  4JEU B;  4OFZ A;  3ZMS B;  5H6Q B;  4G63 A;  2HPL A;  3N9O A;  1E1H B;  3ANW A;  4AXP A;  5L2L A;  3UTK A;  1U4Q A;  3OBV E;  3ETU A;  5C8Y E;  4C90 A;  2LT3 A;  1D1B A;  3SOL A;  3RC3 A;  1HTJ F;  2IC6 A;  2KWH A;  3J9X 1;  2XAF B;  5HXC A;  1B7T A;  2X0L B;  4O8S A;  1ZV4 X;  4QX8 B;  3C4W A;  5JDG A;  1FEW A;  2KIN B;  3O4X E;  1QSD A;  3P8C D;  4L5G A;  3ONX A;  2ZM2 A;  1WYC A;  3F31 A;  2ODU A;  5HXE A;  4H9S E;  1LVK A;  1D0X A;  3GMI A;  5FXV A;  5IHY A;  1YKH B;  5BMV E;  3K8P C;  4QXB B;  2V7M A;  1LVF A;  3DTO A;  4QHO A;  3K3Q C;  1X79 A;  1WLX A;  4EZ4 A;  3ZJ2 A;  1LKX A;  2MTQ A;  3LG7 A;  3LFM A;  3CX6 B;  4DND A;  2JJ9 A;  1YKE B;  3I0Q A;  4IGU A;  5HAX A;  5FNV E;  2E9X C;  4TV8 E;  4JEH B;  4L0R A;  1UCU A;  2E9X A;  3LBX B;  4PFP A;  1EZ3 A;  5JVD E;  3KV6 A;  3EDU A;  5F3J A;  5LXT E;  2DWK A;  2KLQ A;  3TKL B;  4F6R C;  3CPZ A;  1IAP A;  3E0Z A;  4UEL A;  4IE7 A;  2JMK A;  5LOV E;  3ANW B;  2X9X A;  3BQK A;  4MLK A;  3O9X A;  2NW9 A;  4QXC B;  5JQG E;  3AB3 B;  2CXD A;  4UIG A;  2WSS V;  2XAS B;  2QGS A;  3SRZ A;  1BR2 A;  1MMA A;  2NW8 A;  3B13 A;  4AKR B;  2LOS A;  3RC8 A;  2BVL A;  2G0U A;  1MIY A;  2A2F X;  3E22 E;  3AA0 B;  5CB4 E;  3SWH A;  4K0U A;  2JMH A;  1WYB A;  4EZH A;  4ERR A;  1QUU A;  2WAU A;  3CX8 B;  3N9L A;  4IDZ A;  4MAL A;  3W15 B;  5EK2 A;  2LE8 A;  3NZQ A;  2HH7 A;  2LM9 A;  3UUX B;  1MNE A;  4ZS2 A;  2VKJ A;  3HKB E;  3PUS A;  4O2A E;  5DAB A;  4I50 E;  4H9N C;  4IE0 A;  4E7Z A;  5LJM A;  3N2K E;  4O2B E;  4CXW A;  1MMN A;  3K3N A;  3DJB A;  2JQQ A;  2LHN A;  1VRB A;  3KV5 A;  4ZS3 A;  5GON E;  3ZLI A;  2KND A;  4ANJ A;  4L9I A;  4TUY E;  4N78 D;  2J1D G;  4G2A A;  4WBN E;  2Q9Q C;  4OYK A;  1T98 A;  4YHJ A;  4PW8 A;  2Q9Q A;  2E9X B;  2VKH A;  4I4T E;  3LK4 2;  1MIW A;  4HN9 A;  3PU3 A;  2VAS A;  2DCF A;  5CA0 E;  2H3R A;  4U74 A;  1WR6 A;  2D5U A;  2N2N A;  5LBM A;  5L3G B;  5L3B B;  2W0G A;  2V26 A;  5KX5 E;  2H7O A;  2NP9 A;  5JR9 C;  5CA1 E;  3OYX A;  2BZB A;  2XAG B;  1WRD A;  5JR9 A;  4HTE A;  4M1P A;  3HA4 A;  4P0B A;  3Q5W A;  4OHF A;  3IEE A;  4UV9 B;  3L3P A;  3HKD E;  3F57 A;  2LSJ A;  5JRC A;  3AAE B;  3PTR B;  3I9Y A;  4IIJ E;  4PK4 A;  2A3D A;  3FXE B;  5L3D B;  1D1C A;  2XAQ B;  3PUR A;  3KBU A;  3KV9 A;  3GA8 A;  4AKH A;  2VKD A;  4H63 H;  1D1A A;  3GWH A;  2NWB A;  2L9Q A;  1MIV A;  2JRK A;  2PBI A;  2X9H A;  5JDL A;  2LHR A;  3RRC A;  3U3I A;  4QX7 B;  2X51 A;  3D0T A;  4GOU A;  3MAC A;  2CXF A;  4PJJ A;  3WAJ A;  3O1I A;  4ZI3 C;  2PG8 A;  2WBL A;  3LJC A;  2WM9 A;  4IST A;  5HWY A;  5LHG B;  3AAI A;  4H9Q C;  4ZI2 C;  2D2S A;  4DO0 A;  4UEM A;  3CQG B;  2VWA A;  2XAH B;  3EDV A;  2CWY A;  3AA6 B;  2VK9 A;  4H63 V;  3MK7 C;  5HWX A;  4PFO A;  2CM0 A;  4PAG A;  2C5I T;  2Y8D A;  4FI5 A;  3LK3 B;  5LNK A;  5EK3 A;  2YEV C;  2ES0 A;  2Q9Q B;  4MBQ A;  5HXH A;  1SHZ C;  3PE0 A;  3NZP A;  4KP3 C;  3N2G E;  4O4J E;  1Z0P A;  2EHO C;  5JDQ A;  4ZHQ E;  3PU8 A;  2EHO A;  2H7V C;  4EXT A;  4H9O C;  5FXX A;  3ZMV B;  2YU2 A;  4AKG A;  2CE7 A;  4H9R C;  3C51 A;  4J2C A;  4CXY A;  4E7S A;  3IBP A;  3UUL A;  3FHN A;  5JR9 B;  4P0A A;  2N1G A;  1D0Z A;  3O1H A;  5ETW A;  4NUU A;  3ZC1 A;  2WMN A;  3UUM A;  5JDF A;  2JPF A;  3JC6 D;  2ACX A;  5JRC B;  2XTL A;  1UX5 A;  4O4L E;  2RP4 A;  4ISS A;  5L3C B;  3UT5 E;  1AJ3 A;  2LEH A;  4YFS A;  5FY1 A;  2ZM8 A;  4KMC A;  2XUE A;  2YU1 A;  2WMO A;  1O3X A;  2UXX B;  2UXN B;  3R84 B;  2X9W A;  3FBL A;  4AKI A;  5JDN A;  4ZI7 E;  1G8X A;  4UF0 A;  3EUH A;  5LP6 E;  4GK0 E;  4EYY R;  3N5L A;  4TX5 A;  4KUM B;  3RYF E;  3ZN0 B;  2Z6E A;  3FBZ A;  1HF8 A;  4PJM A;  3T8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...