2E9XC

The crystal structure of human gins core complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
186
Chain Sequence
GPHMSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the human GINS complex and its assembly and functional interface in replication initiation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords DNA replication complex GINS protein PSF1
total genus 59
structure length 186
sequence length 195
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05916 Sld5 GINS complex protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2050 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2e9xC00
3ANWB 3JC6C 2E9XC 2Q9QD 2EHOD
chains in the Genus database with same CATH superfamily
3AE2A 3ZYLA 4PK4A 3RYHE 4QH4A 2BDEA 4ZEYA 1IZNB 4IDNA 3I9WA 4H63V 3PUXF 2GK9A 3LK2B 3C51A 1OXZA 2MOZA 4YT0A 3ZLIA 2WB5A 1VCSA 4YSZA 3HKBE 2NR4A 1OEDB 1LRZA 2PG8A 2X9XA 5JDLA 1ZV4X 2WDVA 4G63A 4U7YA 2CXLA 4C90A 4HWFA 3J7Yq 4LF6T 4TUYE 5FL0A 1XMQT 2XUEA 4DVDA 1WYBA 2KNDA 2CHNA 3AVSA 3KDSE 5HEOA 1BR1A 3GN5A 4TNVA 5AQVB 3WAKA 4BJMA 4DUYT 3MKDA 3VRAA 4H9PC 3CKDA 2LSKA 4DBRA 4HFDA 3AA7B 2BBJA 5FXVA 2UUCT 1N36T 3UUNA 5HXHA 4ILAA 5LP6E 4ADZA 3N2OA 1W0BA 3AE6A 3GA8A 1D0ZA 2FUPA 4L9IA 1HFAA 4HKAA 3Q9DA 2YK0A 3SWHA 2L9QA 5ABGA 2CHOA 2EHOD 4GOUA 2V7IA 2J1DG 2JMKA 2QA7A 3NVOA 4JI2T 2JQKA 1HG2A 2YDRA 3LJCA 5L3DB 2E9XD 4I43B 3U78A 2W00A 5FXWA 2VQFT 1HG5A 1KNPA 2LSIA 3ONXA 1IJ6A 4PK6A 4Z91A 2E9XB 3PU8A 4GYRA 4I50E 2WZIA 1I6ZA 1IJ5A 1WR6A 2QGSA 1ZOYA 3CQCB 2C5IT 2LSGA 2V5CA 5JR9A 4E7SA 4GKJT 1DU2A 4AXPA 2BKPA 2ACXA 4EZHA 5FY7A 2MPKA 5ABEA 3RYCE 1LVFA 3UU3A 2V6XA 5L4HA 4JYAT 2W4XA 2XQ3A 4P0BA 3C4ZA 2PBIA 3EAMA 2NOXA 1MIWA 2I6HA 2WMNA 2PJQA 5AQQB 1L0VA 3CQGB 2ZM2A 2ZM6T 4AKIA 1T72A 5LMNT 1HNWT 1D1AA 2L3LA 3G06A 5EK4A 4F8HA 5CB4E 3ZCJA 4DR3T 2EHOA 2YINA 2VK9A 5IHYA 4IDPA 2B76A 2D5UA 4CI3B 4E7ZA 5C3JA 4LFCT 1ZKEA 4DNDA 4NUVA 4O2AE 5JDFA 5KDMC 2VB6A 1NENA 2LSYA 4PW8A 5L3FB 4B3MT 4YJ2E 3RKOA 4COFA 5FVKA 4ILUA 5L3CB 4DR6T 4XBFB 4EEBA 2E5VA 3CX8B 2LSJA 4AKHA 3QUJA 2XQ8A 3NRYA 3OBVE 4O4LE 5LA6E 4X1IE 2XQ9A 5GONE 2K3WA 5HWYA 5F5WA 2AE9A 2H7OA 2VQET 2DWKA 5LG4A 3DP7A 3FZKB 4OHFA 4IDZA 4DIDB 3KVBA 3UU4A 1E7PA 3ZYKA 3AEFA 4EB6E 3MA9A 3OYXA 3AEDA 4TN7B 4QHOA 5JDGA 2KLQA 3RRCA 4DMVA 5JDHA 2CLYB 3HI2A 3N9NA 4AQYT 4LF7T 5H6RB 1FMVA 2NTXA 2XHEB 1VRBA 3O1JA 1US7B 1M7KA 3NRXA 5CGMA 1N34T 4CXXA 3TLWA 2CA5A 3L3PA 1IBMT 2ES0A 3RH3A 3ZCIA 4QX8B 4B6XA 1N32T 1GQEA 2LJLA 3P4QA 4CXWA 1LKXA 2DCFA 2CWOA 2KXPB 2QYWA 3AA1B 5JTGA 4DV4T 1X79A 4B3ST 4L5GA 1D0XA 2G0UA 2X9WA 3JADA 3O4XE 2JQHA 3B13A 3F2EA 4YJ3E 2MYSA 5AQOB 2E8IA 2SPCA 4EXTA 4DV0T 3HA4A 4ILCA 2D2SA 2XY8B 2BZBA 2Y8DA 4NPPA 4DR4T 2CM0A 4UF0A 1XDPA 5LGUB 2ACZA 4YSYA 2N9DA 3L8RA 5ABFB 3ABVA 3QB5A 2CLYC 3J9X1 2Q9QA 3EABA 1H7CA 4AQFA 4BAYB 3ZC0A 4KHPT 2CMRA 2VASA 2XAFB 3TKLB 1SA0E 1OEDA 2XZEA 4AKRB 2E9XC 2NW8A 2JQQA 2W61A 2OA5A 1QLBA 3ZSSA 4ERRA 3AE7A 2XAJB 2XQ4A 3LSVA 3RC3A 4DMWA 4QWNB 3FZMB 5J2TE 3LG7A 2RA1A 3LK42 4HFHA 3T8OA 3LDQB 2ZLYA 4EEDA 4J2CA 5EK2A 1HR0T 3N9PA 5LBQB 3DTOA 4BJNA 2PFVA 3ANWA 5AQFB 1MNEA 3C4WA 2AXDS 5IYZE 2V6YB 4CQIA 3B57A 1Z8UA 2W2UA 3NKZA 4YHJA 3TLUA 4OFZA 3R84B 2MTQA 2LOPA 1QSDA 4HE8A 3ZN1B 3L39A 4B3TT 2A2FX 2LHRA 3ZT6A 4DR1T 2HN2A 5DJQC 5LJMA 4UV8B 2QRXA 4UV9B 3ZMVB 3ZT5A 2FJDA 4NXNT 3FXDB 3AE3A 5AQPB 2HPLA 2XPKA 3NWIA 4K0UA 2BS3A 4KUMB 2WU5A 3LBXA 3UT5E 2N1GA 4A56A 3BQIA 5JDQA 5LHGB 5JRCA 1XZYA 5EZYE 2NP9A 1HX1B 4YTNA 4JI8T 3SOLA 2JMHA 4ZHQE 1UUSA 3CPZA 3ZT7A 2CPTA 2V7JA 2BS4A 3Q5WA 3UUXB 1WCRA 2NW7A 5JREA 3Q5EA 4FJOA 5AQSB 2V7KA 3QB5K 1JNRA 2IC6A 4QH1A 1W09A 4HGAA 3OKQA 4U3CA 3RIUA 3UULA 5JQGE 4JI3T 4CN4A 3RC8A 4ISTA 5LCYA 4I55E 5LGTB 3AA0B 4K0KT 2XQ6A 2NW9A 4ZZCA 2VL8A 5FP3A 4WW0A 5FY1A 1W9RA 2BG9A 1KF6A 1Y01A 4FI5A 3TLSA 3BK9A 4P0AA 3I9YA 2FJEA 4QXHB 4UVAB 3RIUC 2C5KT 5FVLA 1YW0A 3CWZB 4JI6T 2XQYA 1G73A 5J0ZA 4JI4T 4ZS3A 2XSBA 4C91A 3SS1A 4JI5T 3VR9A 4IGUA 3VU7H 5LG3A 4DR7T 2DNXA 2L8KA 3EUHA 2UXBT 4IT4A 2K9AA 5ABHA 2DLRA 2YN6A 1FIOA 5FXXA 1B7TA 3P4RA 3W15B 3HL6A 3FBLA 5LHIB 5AFUL 2IMLA 4X1YE 3VKHA 1NEKA 1IAPA 1UCUA 2YEVC 3C4XA 3OVUA 4HWIB 4UVBB 4CZZB 2X51A 3KBTA 4IE7A 2YKSA 4YY3T 4X1KE 2XJ7A 1KFYA 3N2GE 3RYFE 4H9NC 3RRWA 3RQUA 2J4GA 2D0TA 3EHZA 3SFEA 1WFDA 3A8YC 3FZFB 3ZMTB 4ANJA 5IWAT 4LFBT 5BR8T 3KV9A 5LHHB 1MMNA 4A5XA 4AQFC 1YKEB 3N9LA 1I94T 2WWUA 1XNRT 4JBWF 2UUAT 3EVYA 1YQ4A 3M65A 1KNRA 4ZI2C 2E5LT 2XAHB 2KSRA 4TWHA 3K1SA 3OPCA 3UFEA 2W67A 4EV6A 1MIYA 5F8PA 3O9XA 3B5MA 5AQLB 2FBWA 3KV4A 3PDYA 5KMGP 2YU2A 3CX6B 2YDQA 3WI3A 2BG9B 4KX6A 3UUMA 2KMFA 4O4JE 5AQIB 4IL4A 3P4SA 2X66A 5E0OA 5HWXA 5HXEA 3JAEA 4YLHA 2F4VT 2FJBA 4YXDA 5LXTE 4WBOA 2N2NA 1HS7A 1E1HB 4JLEA 5HAXA 1FJGT 1OEDE 4G2AA 4KHZF 3QK6A 2LE8A 3KFWX 4TV8E 2I59A 3RLFF 2X9YA 2XQ5A 1CHUA 2WMOA 3AEEA 3AEBA 4U33A 2LT3A 4PJNA 2WM9A 2EHOC 2KINB 2HN1A 3PUZF 4EZ4A 4IE4A 2X68A 2ZM8A 2WDRA 3N9MA 5JVDE 5HCJA 1KK7A 5JDNA 4IE6A 3N9OA 3K8PC 1O3XA 2KWIB 1Z0PA 3F57A 3PU3A 5TAOA 4ZI3D 5FL1A 3VR8A 4PFPA 1W0AA 1KNZA 5M4YA 5L2LA 2QVAA 1FEWA 2Q9QC 2DHRA 2XAGB 3ZMSB 4U2ZA 3EDVA 3RI5A 4JI0T 4O2BE 3N5LA 1D1BA 2V6YA 2CXFA 2JPFA 2LRLA 2LRKA 2VKDA 3IA3A 1VOMA 2X0HA 3QC9A 4H9QC 5AQHB 2WZHA 5LBMA 3R6NA 3IEEA 3D0TA 3N2KE 1U4QA 5DABA 1MIVA 2JRKA 5F3JA 2XTLA 3AXJB 3QNUA 1R8IA 3PJAJ 4ILBA 2E2AA 3MACA 5HEHA 2UU9T 5CA0E 2YU1A 4OK0A 1HCIA 3PV0F 4KI0F 3PUVF 1MMAA 4F6RC 1HNZT 2Q9QD 1HF8A 4DUZT 4O8SA 2WCAA 4HEAA 4LFAT 1WYCA 3U3IA 3AAAB 2BVMA 4HTEA 5ADXL 4TZ4C 2WP9A 3IHRA 3RIFA 3UQ4A 1T8BA 1ZHCA 3VKGA 2B1EA 2Q9QB 4IDOA 2XM2A 3RHWA 4I0UA 4O4HE 3ONLC 1D1CA 5ABFA 4EAHA 2UUBT 3E08A 2A3DA 2HHHT 3N9QA 2CRBA 4LF8T 4B3RT 1UX5A 4X20E 4YFSA 4JEUB 2IW5B 5L3GB 3AE4A 4JEHB 5AQTB 5HEUA 2FJAA 4EYUA 3IBPA 2WS3A 4LF4T 1KEYA 2BKOA 2Y6XA 1NWMX 3TLVA 3ZPOA 3ZJ1A 4DV7T 5LGNB 2W62A 1IBLT 3SRZA 2WDQA 4X64T 3HKCE 3PUGA 4H9SE 4OX9T 4UELA 3P50A 4UEMA 4Q25A 4DV1T 4UXNB 5FY0A 4DR5T 1M62A 3QOFA 2VKJA 3CMLA 4WNKA 2IUBA 4AISA 4M1PA 4DV5T 4LMJA 2HPJA 2HH7A 4IIJE 3UU8A 2UXNB 5AQUB 3AAEB 2C5JA 5A1LA 1S35A 4IREA 2A9UA 1HX8A 4OYJA 2DI4A 2IHR1 5LYJE 5J2UE 3WAJA 5EK3A 4GK0E 2VL0A 4CN1A 2H7VC 2RP4A 3E22E 4JV5T 2H3RA 5HXSA 5JRCB 4PAGA 5J1GA 5L3BB 2V7LA 1UURA 3PUQA 4HFBA 4PJMA 2UXDT 4MHCA 5HEGA 3DJBA 1E2AA 4KP3C 2ODUA 4HFEA 2LKGA 1MMGA 3AEAA 5AQRB 3HKEE 4QKNA 2DWGA 3H3AA 1WR0A 3PUWF 2XSAA 4TWDA 5DQWA 2IAKA 3CVRA 4MFRA 1YKHB 4QH5A 2M6IA 5C2TA 3JC6C 1QUUA 4LF9T 1YQ3A 2H88A 2IIUA 2K48A 2V7MA 3AE5A 3PTRB 2J47A 3Q2MA 4IE0A 4X66T 4KMCA 3UUBA 2P9BA 3KBUA 3FB2A 1SUMB 2CWYA 2V8SV 3ZEFB 5CA1E 4H63H 5L47A 4NXMT 3X1DA 3K3QC 2EHOB 5JH7E 4H9OC 2LKHA 5FMNA 5HXCA 2CEAA 3I0OA 1SHZC 2JIWA 2X67A 1CUNA 2M67A 3ESLA 4XZCA 3CK6A 5HXRA 3TLTA 4KBMB 2JJ9A 3F31A 4PFOA 2Z6EA 3ZSTA 2IC9A 3FXEB 4EYYR 4P1NA 1BR2A 3PUAA 3P7IA 3OTOT 2JQ9A 3ANWB 3UTKA 3ETUA 2VWAA 2LEHA 2WBLA 3KV5A 1G8XA 4GK5E 4HWHA 3CX7B 3RQWA 2BG9C 3UU6A 4CXYA 1BR4A 2A72A 1ZEEA 3JCFA 4U72A 5JR9B 2XAQB 1WRDA 3BQKA 3C50A 5AQJB 4MLKA 2XQAA 5FKYA 3RIAA 5ETWA 4MBQA 4DV6T 3HR0A 3RF1A 1HTJF 3ZC1A 2LOSA 2CBIA 2LM2A 4GIWA 3LK3B 2V1DB 4TV9E 3AE9A 2V26A 3HKDE 4X65T 4AKGA 3FHNA 2UXXB 2Y48B 4ZI7E 4EIWA 1XNQT 4TWFA 2VKOA 4U7IA 5CFBA 5AQKB 2KWHA 2ODVA 2X0YA 2YOEA 2VVNA 3FZHB 1D0YA 3CIRA 2D9DA 4UF0B 2M6BA 4PJLA 3MJXA 3V5SA 3C98B 2IDOB 2BKNA 3KINB 1XMOT 3P4PA 2OV9A 3VRBA 5KX5E 1AJ3A 4PK5A 3C64A 1VCTA 3GN5B 4ZOLE 4EOZB 3ZN0B 4AI6A 1V9DA 3ETVA 4PJJA 4DBQA 5KXJA 4JI7T 3AE1A 3ONJA 2LM9A 4HWDA 3H3MA 3PJAA 4EGWA 1FMWA 3AE8A 4ZS2A 4JI1T 5FXZA 2NTYA 3RKGA 3FBZA 2WWVA 3JAFA 1MNDA 3UFGA 3GMIA 4X5TA 5LNKA 2XASB 1J5WA 2C0SA 3NZQA 4O4IE 3CQXC 4QX7B 4Z90A 5AQNB 2VVSA 1UX4A 2WSSV 3RYIE 3K3NA 3V5UA 2K24A 3PUYF 4YTMA 1EZ3A 2OLTA 2XM1A 4Z8XA 5IUXA 1J5ET 1OEDC 4LF5T 2VURA 3UQ7A 5FYMA 5LMUT 2RPAA 4V1Av 3ZJ2A 1ZP0A 1T7SA 4BA9A 2X9HA 4ZXLA 4MALA 3PUSA 4CN6A 4YTPA 3MK7C 4U2YA 2J62A 3EDUA 4WYVA 3ZMUB 2ZM0A 4AIUA 4QXBB 1LVKA 2LLYA 1YXRA 1YD8G 3AECA 3NZPA 2D0UA 4L0RA 4ASKA 4I4TE 2YDSA 4XAXB 2CE7A 4LMKA 5LOVE 4YSXA 5CJ5A 4HFCA 1Y64B 3RGLA 4A97A 2BBHA 3NBXX 5H6QB 4N78D 1WLXA 1X9BA 1N33T 4HN9A 1HNXT 4DV2T 3I1AA 3OYZA 4UR9A 1S94A 2UXCT 3AB3B 3PE0A 3M3ZB 2MBGA 4H9RC 1U5PA 2I0MA 2V5DA 4IE5A 3K3OA 4LMLA 4ZI3C 3AA6B 5FNVE 3H37A 5LB7B 4U31A 2VKHA 4ZI2D 4CI1B 5LJNA 3EI0A 4UVCB 5AQMB 4DO0A 1NAFA 4HFIA 4JUYA 1UGOA 2NWBA 3ZKRA 1SE7A 5AQGB 5JDMA 2CXDA 3P8CD 3RPUA 4NUUA 3L09A 2LHNA 4QXCB 2PTFA 3AXJA 3KV6A 2DL1A 2MAWA 5L4EA 5BMVE 5JR9C 1J1JA 1XWMA 2BVLA 3MZKB 3Q5XA 4HFVA 4YHHT 4IHJE 1BR0A 4AQGA 2R6GF 2BG9E 2H89A 3GWHA 3I0QA 3KVAA 3AAIA 4CI2B 4DV3T 3RX6A 2WU2A 2E9XA 1IBKT 1MMDA 2XQ7A 4U74A 4TNWA 4IL9A 3AVRA 4NIQA 4X62T 2CBJA 3O1HA 4GYSA 3OJAA 3LFMA 4GKKT 2X0LB 3JC6D 3A5XA 3O1IA 3VHLA 4ZZBA 4IDQA 3SFDA 1OWAA 4DR2T 2W66A 3LBXB 3T1YT 5C8YE 1T98A 2KZ7B 2W0GA 3E0ZA 3S4UA 5DQVA 5HEJA 5HYAA 3FZLB 3ZMZB 5L3EB 4HWCA 3BQLA 2CCQA 1XDOA 3ZYMA 4P09A 4A98A 4UIGA 1JNZA 3T1HT 1UK5A 3A7MA 4TX5A 4OYKA 3AEGA 2WY2A 2WQYA 3IF8B 3Q5DA 3PURA 2WAUA 3MXZA 2K5BB 3P4WA 2KT9A 4ISSA 3UU5A 4AKLA 2W63A 2ZMAA 4WBNE 4WZXA 2BS2A 5HCMA 4PNIA
chains in the Genus database with same CATH topology
4PK4A 3RYHE 2BDEA 1IZNB 3I9WA 4H63V 2GK9A 3LK2B 3C51A 1OXZA 2MOZA 3ZLIA 3HKBE 1LRZA 2PG8A 2X9XA 5JDLA 1ZV4X 4G63A 3J7Yq 2CXLA 4C90A 4TUYE 2XUEA 4DVDA 1WYBA 2KNDA 3AVSA 3KDSE 3WAKA 4BJMA 1BR1A 3GN5A 3MKDA 4H9PC 3CKDA 2LSKA 4DBRA 3AA7B 5FXVA 3UUNA 5LP6E 4ADZA 3N2OA 3GA8A 1D0ZA 4L9IA 1HFAA 4HKAA 3Q9DA 2YK0A 3SWHA 2L9QA 2EHOD 4GOUA 2V7IA 2J1DG 2JMKA 2QA7A 5L3DB 3LJCA 1HG2A 2E9XD 4I43B 3U78A 2W00A 5FXWA 1HG5A 2LSIA 4PK6A 3ONXA 1IJ6A 2E9XB 3PU8A 4GYRA 4I50E 1IJ5A 1WR6A 2QGSA 3CQCB 2C5IT 2LSGA 5JR9A 4E7SA 4AXPA 2ACXA 4EZHA 5FY7A 3RYCE 1LVFA 4P0BA 3C4ZA 2PBIA 2NOXA 1MIWA 2WMNA 2PJQA 3CQGB 2ZM2A 4AKIA 1D1AA 2L3LA 5EK4A 5CB4E 3ZCJA 2EHOA 2YINA 2VK9A 5IHYA 4CI3B 2D5UA 4E7ZA 1ZKEA 4DNDA 4NUVA 4O2AE 5JDFA 5KDMC 2VB6A 4PW8A 2LSYA 5L3FB 4YJ2E 3RKOA 4ILUA 5L3CB 4XBFB 3CX8B 2LSJA 4AKHA 3QUJA 3NRYA 3OBVE 4O4LE 5LA6E 4X1IE 5GONE 5HWYA 2H7OA 2DWKA 5LG4A 3DP7A 4OHFA 4IDZA 3KVBA 3ZYKA 4EB6E 3MA9A 3OYXA 5JDGA 4TN7B 4QHOA 5JDHA 2KLQA 3RRCA 4DMVA 2CLYB 3HI2A 5H6RB 1FMVA 2NTXA 2XHEB 1VRBA 3O1JA 1US7B 3NRXA 4CXXA 2CA5A 3L3PA 2ES0A 3RH3A 3ZCIA 4QX8B 4B6XA 2LJLA 4CXWA 1LKXA 2DCFA 2CWOA 2KXPB 3AA1B 1X79A 4L5GA 1D0XA 2G0UA 2X9WA 3O4XE 4YJ3E 3B13A 3F2EA 4EXTA 2MYSA 2E8IA 2SPCA 3HA4A 2D2SA 2BZBA 2Y8DA 2CM0A 4UF0A 5LGUB 2N9DA 3J9X1 2CLYC 2Q9QA 4AQFA 1H7CA 4BAYB 3ZC0A 2CMRA 2VASA 2XAFB 3TKLB 1SA0E 4AKRB 2E9XC 2NW8A 2JQQA 2W61A 2OA5A 4ERRA 2XAJB 3RC3A 4DMWA 5J2TE 4QWNB 3LG7A 2RA1A 3LK42 3T8OA 2ZLYA 5EK2A 4J2CA 3N9PA 5LBQB 3DTOA 4BJNA 2PFVA 3ANWA 1MNEA 3C4WA 5IYZE 4CQIA 3B57A 4YHJA 4OFZA 3R84B 2MTQA 2LOPA 1QSDA 4HE8A 3ZN1B 2A2FX 2LHRA 5DJQC 5LJMA 4UV8B 4UV9B 3ZMVB 3FXDB 3UT5E 2HPLA 4K0UA 4KUMB 3LBXA 4A56A 2N1GA 5JDQA 3BQIA 5LHGB 5JRCA 5EZYE 2NP9A 3SOLA 2JMHA 4ZHQE 3CPZA 2V7JA 3Q5WA 3UUXB 2NW7A 5JREA 4FJOA 2V7KA 2IC6A 4HGAA 5JQGE 3OKQA 3UULA 3RC8A 4ISTA 5LCYA 4I55E 5LGTB 3AA0B 2NW9A 2VL8A 5FP3A 4WW0A 5FY1A 4FI5A 3BK9A 4P0AA 3I9YA 4QXHB 4UVAB 2C5KT 1YW0A 3CWZB 2XQYA 1G73A 4ZS3A 4C91A 3SS1A 4IGUA 3VU7H 2DNXA 2L8KA 3EUHA 2K9AA 2DLRA 1FIOA 5FXXA 1B7TA 3W15B 5LHIB 3HL6A 3FBLA 5AFUL 4X1YE 3VKHA 3C4XA 1IAPA 1UCUA 2YEVC 4UVBB 4CZZB 2X51A 3KBTA 4IE7A 4X1KE 3RYFE 3N2GE 4H9NC 3RRWA 2D0TA 3ZMTB 4ANJA 3KV9A 5LHHB 1MMNA 4AQFC 1YKEB 3N9LA 2WWUA 3EVYA 3M65A 4ZI2C 2XAHB 3UFEA 3O9XA 1MIYA 5F8PA 3KV4A 3PDYA 2YU2A 3CX6B 3WI3A 3UUMA 5HWXA 2KMFA 4O4JE 5HXEA 2X66A 5E0OA 4YLHA 5LXTE 4WBOA 2N2NA 1HS7A 1E1HB 4JLEA 5HAXA 4G2AA 3QK6A 2LE8A 3KFWX 4TV8E 2I59A 2X9YA 2WMOA 2LT3A 4PJNA 2WM9A 2EHOC 2KINB 4EZ4A 4IE4A 2X68A 2ZM8A 3N9MA 5JVDE 1KK7A 5JDNA 4IE6A 3N9OA 3K8PC 1O3XA 2KWIB 1Z0PA 3F57A 3PU3A 5TAOA 4ZI3D 4PFPA 5M4YA 5L2LA 1FEWA 2Q9QC 2DHRA 2XAGB 3ZMSB 3EDVA 4O2BE 3N5LA 1D1BA 2CXFA 2JPFA 3N9NA 5HXHA 2VKDA 3QC9A 4H9QC 1VOMA 3R6NA 5LBMA 3IEEA 3D0TA 3N2KE 1U4QA 5DABA 1MIVA 2JRKA 5F3JA 2XTLA 3MACA 5CA0E 2YU1A 4OK0A 1HCIA 1MMAA 4F6RC 2Q9QD 1HF8A 4O8SA 4HEAA 1WYCA 3U3IA 3AAAB 2BVMA 4HTEA 5ADXL 4TZ4C 3IHRA 3VKGA 1ZHCA 2B1EA 2Q9QB 4O4HE 1D1CA 4EAHA 3E08A 2A3DA 3N9QA 1UX5A 4X20E 4YFSA 4JEUB 2IW5B 5L3GB 4JEHB 4EYUA 3IBPA 2Y6XA 1NWMX 3ZPOA 3ZJ1A 5LGNB 2W62A 3SRZA 3HKCE 3PUGA 4H9SE 4UELA 4UEMA 4UXNB 5FY0A 2VKJA 3CMLA 4WNKA 4M1PA 2HPJA 2HH7A 4IIJE 2UXNB 3AAEB 2C5JA 5A1LA 1S35A 5LYJE 1HX8A 4OYJA 2DI4A 5J2UE 3WAJA 5EK3A 4GK0E 2H7VC 2RP4A 3E22E 2H3RA 5HXSA 4PAGA 5J1GA 5L3BB 2V7LA 4PJMA 3PUQA 4MHCA 3DJBA 4KP3C 2ODUA 1MMGA 3HKEE 4QKNA 2DWGA 3H3AA 5DQWA 3ZYLA 4AI6A 2IAKA 3CVRA 4MFRA 1YKHB 3JC6C 1QUUA 2V7MA 2K48A 3PTRB 3Q2MA 4IE0A 4KMCA 2P9BA 3KBUA 3FB2A 3ZEFB 2CWYA 5CA1E 4H63H 3K3QC 2EHOB 5JH7E 4H9OC 5FMNA 5HXCA 2CEAA 3I0OA 1SHZC 2X67A 3ESLA 1CUNA 2M67A 4XZCA 5HXRA 4KBMB 2JJ9A 3F31A 4PFOA 2W63A 2IC9A 3FXEB 4EYYR 1BR2A 3PUAA 3P7IA 3ANWB 3UTKA 3ETUA 2VWAA 2LEHA 2WBLA 3KV5A 1G8XA 4GK5E 4CXYA 3CX7B 1BR4A 2A72A 1ZEEA 4U72A 5JR9B 2XAQB 1WRDA 3BQKA 3C50A 4MLKA 5ETWA 4MBQA 3HR0A 3ZC1A 1HTJF 2LOSA 4GIWA 3LK3B 2V1DB 4TV9E 4AKGA 2V26A 3HKDE 3FHNA 2UXXB 2Y48B 4ZI7E 4EIWA 2VKOA 2KWHA 2ODVA 1D0YA 4UF0B 4PJLA 3MJXA 3V5SA 3C98B 3KINB 5KX5E 1AJ3A 4PK5A 3C64A 3GN5B 4ZOLE 4EOZB 3ZN0B 1V9DA 3ETVA 4PJJA 4DBQA 2LM9A 1FMWA 4ZS2A 5FXZA 2NTYA 3FBZA 5LNKA 1MNDA 3GMIA 2XASB 2C0SA 3NZQA 4O4IE 4QX7B 3CQXC 3RYIE 2WSSV 1UX4A 3V5UA 3K3NA 2K24A 1EZ3A 4Z8XA 5FYMA 4V1Av 3ZJ2A 4BA9A 2X9HA 4MALA 3PUSA 3MK7C 3EDUA 3ZMUB 2ZM0A 4QXBB 1LVKA 1YD8G 4L0RA 3NZPA 2D0UA 4ASKA 4I4TE 4XAXB 2CE7A 5LOVE 1Y64B 3NBXX 5H6QB 4N78D 1WLXA 4HN9A 3I1AA 3OYZA 1S94A 3AB3B 3PE0A 2MBGA 4H9RC 1U5PA 4IE5A 4ZI3C 1KNZA 3K3OA 5KMGP 4CI1B 3AA6B 5FNVE 3H37A 4ZI2D 2VKHA 5LJNA 4UVCB 4DO0A 1NAFA 4JUYA 5JDMA 2NWBA 2CXDA 3P8CD 3RPUA 4NUUA 3L09A 2LHNA 4QXCB 3KV6A 5BMVE 5JR9C 3Q5XA 2BVLA 3MZKB 1BR0A 4HFVA 4IHJE 4AQGA 4CI2B 3I0QA 3GWHA 3KVAA 3AAIA 3RX6A 2E9XA 1MMDA 4U74A 3AVRA 3O1HA 4GYSA 3OJAA 3LFMA 2X0LB 3JC6D 3A5XA 3O1IA 3VHLA 1OWAA 3LBXB 5JRCB 5C8YE 1T98A 2KZ7B 2W0GA 3E0ZA 3S4UA 5DQVA 5HYAA 5L3EB 3ZMZB 3BQLA 2CCQA 3ZYMA 4P09A 4UIGA 4TX5A 4OYKA 3IF8B 3PURA 2WAUA 3MXZA 2K5BB 4ISSA 2KT9A 4AKLA 4WBNE 2Z6EA 2ZMAA 4PNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ANW B;  3JC6 C;  2E9X C;  2Q9Q D;  2EHO D; 
#chains in the Genus database with same CATH topology
 3AE2 A;  3ZYL A;  4PK4 A;  3RYH E;  4QH4 A;  2BDE A;  4ZEY A;  1IZN B;  4IDN A;  3I9W A;  4H63 V;  3PUX F;  2GK9 A;  3LK2 B;  3C51 A;  1OXZ A;  2MOZ A;  4YT0 A;  3ZLI A;  2WB5 A;  1VCS A;  4YSZ A;  3HKB E;  2NR4 A;  1OED B;  1LRZ A;  2PG8 A;  2X9X A;  5JDL A;  1ZV4 X;  2WDV A;  4G63 A;  4U7Y A;  2CXL A;  4C90 A;  4HWF A;  3J7Y q;  4LF6 T;  4TUY E;  5FL0 A;  1XMQ T;  2XUE A;  4DVD A;  1WYB A;  2KND A;  2CHN A;  3AVS A;  3KDS E;  5HEO A;  1BR1 A;  3GN5 A;  4TNV A;  5AQV B;  3WAK A;  4BJM A;  4DUY T;  3MKD A;  3VRA A;  4H9P C;  3CKD A;  2LSK A;  4DBR A;  4HFD A;  3AA7 B;  2BBJ A;  5FXV A;  2UUC T;  1N36 T;  3UUN A;  5HXH A;  4ILA A;  5LP6 E;  4ADZ A;  3N2O A;  1W0B A;  3AE6 A;  3GA8 A;  1D0Z A;  2FUP A;  4L9I A;  1HFA A;  4HKA A;  3Q9D A;  2YK0 A;  3SWH A;  2L9Q A;  5ABG A;  2CHO A;  2EHO D;  4GOU A;  2V7I A;  2J1D G;  2JMK A;  2QA7 A;  3NVO A;  4JI2 T;  2JQK A;  1HG2 A;  2YDR A;  3LJC A;  5L3D B;  2E9X D;  4I43 B;  3U78 A;  2W00 A;  5FXW A;  2VQF T;  1HG5 A;  1KNP A;  2LSI A;  3ONX A;  1IJ6 A;  4PK6 A;  4Z91 A;  2E9X B;  3PU8 A;  4GYR A;  4I50 E;  2WZI A;  1I6Z A;  1IJ5 A;  1WR6 A;  2QGS A;  1ZOY A;  3CQC B;  2C5I T;  2LSG A;  2V5C A;  5JR9 A;  4E7S A;  4GKJ T;  1DU2 A;  4AXP A;  2BKP A;  2ACX A;  4EZH A;  5FY7 A;  2MPK A;  5ABE A;  3RYC E;  1LVF A;  3UU3 A;  2V6X A;  5L4H A;  4JYA T;  2W4X A;  2XQ3 A;  4P0B A;  3C4Z A;  2PBI A;  3EAM A;  2NOX A;  1MIW A;  2I6H A;  2WMN A;  2PJQ A;  5AQQ B;  1L0V A;  3CQG B;  2ZM2 A;  2ZM6 T;  4AKI A;  1T72 A;  5LMN T;  1HNW T;  1D1A A;  2L3L A;  3G06 A;  5EK4 A;  4F8H A;  5CB4 E;  3ZCJ A;  4DR3 T;  2EHO A;  2YIN A;  2VK9 A;  5IHY A;  4IDP A;  2B76 A;  2D5U A;  4CI3 B;  4E7Z A;  5C3J A;  4LFC T;  1ZKE A;  4DND A;  4NUV A;  4O2A E;  5JDF A;  5KDM C;  2VB6 A;  1NEN A;  2LSY A;  4PW8 A;  5L3F B;  4B3M T;  4YJ2 E;  3RKO A;  4COF A;  5FVK A;  4ILU A;  5L3C B;  4DR6 T;  4XBF B;  4EEB A;  2E5V A;  3CX8 B;  2LSJ A;  4AKH A;  3QUJ A;  2XQ8 A;  3NRY A;  3OBV E;  4O4L E;  5LA6 E;  4X1I E;  2XQ9 A;  5GON E;  2K3W A;  5HWY A;  5F5W A;  2AE9 A;  2H7O A;  2VQE T;  2DWK A;  5LG4 A;  3DP7 A;  3FZK B;  4OHF A;  4IDZ A;  4DID B;  3KVB A;  3UU4 A;  1E7P A;  3ZYK A;  3AEF A;  4EB6 E;  3MA9 A;  3OYX A;  3AED A;  4TN7 B;  4QHO A;  5JDG A;  2KLQ A;  3RRC A;  4DMV A;  5JDH A;  2CLY B;  3HI2 A;  3N9N A;  4AQY T;  4LF7 T;  5H6R B;  1FMV A;  2NTX A;  2XHE B;  1VRB A;  3O1J A;  1US7 B;  1M7K A;  3NRX A;  5CGM A;  1N34 T;  4CXX A;  3TLW A;  2CA5 A;  3L3P A;  1IBM T;  2ES0 A;  3RH3 A;  3ZCI A;  4QX8 B;  4B6X A;  1N32 T;  1GQE A;  2LJL A;  3P4Q A;  4CXW A;  1LKX A;  2DCF A;  2CWO A;  2KXP B;  2QYW A;  3AA1 B;  5JTG A;  4DV4 T;  1X79 A;  4B3S T;  4L5G A;  1D0X A;  2G0U A;  2X9W A;  3JAD A;  3O4X E;  2JQH A;  3B13 A;  3F2E A;  4YJ3 E;  2MYS A;  5AQO B;  2E8I A;  2SPC A;  4EXT A;  4DV0 T;  3HA4 A;  4ILC A;  2D2S A;  2XY8 B;  2BZB A;  2Y8D A;  4NPP A;  4DR4 T;  2CM0 A;  4UF0 A;  1XDP A;  5LGU B;  2ACZ A;  4YSY A;  2N9D A;  3L8R A;  5ABF B;  3ABV A;  3QB5 A;  2CLY C;  3J9X 1;  2Q9Q A;  3EAB A;  1H7C A;  4AQF A;  4BAY B;  3ZC0 A;  4KHP T;  2CMR A;  2VAS A;  2XAF B;  3TKL B;  1SA0 E;  1OED A;  2XZE A;  4AKR B;  2E9X C;  2NW8 A;  2JQQ A;  2W61 A;  2OA5 A;  1QLB A;  3ZSS A;  4ERR A;  3AE7 A;  2XAJ B;  2XQ4 A;  3LSV A;  3RC3 A;  4DMW A;  4QWN B;  3FZM B;  5J2T E;  3LG7 A;  2RA1 A;  3LK4 2;  4HFH A;  3T8O A;  3LDQ B;  2ZLY A;  4EED A;  4J2C A;  5EK2 A;  1HR0 T;  3N9P A;  5LBQ B;  3DTO A;  4BJN A;  2PFV A;  3ANW A;  5AQF B;  1MNE A;  3C4W A;  2AXD S;  5IYZ E;  2V6Y B;  4CQI A;  3B57 A;  1Z8U A;  2W2U A;  3NKZ A;  4YHJ A;  3TLU A;  4OFZ A;  3R84 B;  2MTQ A;  2LOP A;  1QSD A;  4HE8 A;  3ZN1 B;  3L39 A;  4B3T T;  2A2F X;  2LHR A;  3ZT6 A;  4DR1 T;  2HN2 A;  5DJQ C;  5LJM A;  4UV8 B;  2QRX A;  4UV9 B;  3ZMV B;  3ZT5 A;  2FJD A;  4NXN T;  3FXD B;  3AE3 A;  5AQP B;  2HPL A;  2XPK A;  3NWI A;  4K0U A;  2BS3 A;  4KUM B;  2WU5 A;  3LBX A;  3UT5 E;  2N1G A;  4A56 A;  3BQI A;  5JDQ A;  5LHG B;  5JRC A;  1XZY A;  5EZY E;  2NP9 A;  1HX1 B;  4YTN A;  4JI8 T;  3SOL A;  2JMH A;  4ZHQ E;  1UUS A;  3CPZ A;  3ZT7 A;  2CPT A;  2V7J A;  2BS4 A;  3Q5W A;  3UUX B;  1WCR A;  2NW7 A;  5JRE A;  3Q5E A;  4FJO A;  5AQS B;  2V7K A;  3QB5 K;  1JNR A;  2IC6 A;  4QH1 A;  1W09 A;  4HGA A;  3OKQ A;  4U3C A;  3RIU A;  3UUL A;  5JQG E;  4JI3 T;  4CN4 A;  3RC8 A;  4IST A;  5LCY A;  4I55 E;  5LGT B;  3AA0 B;  4K0K T;  2XQ6 A;  2NW9 A;  4ZZC A;  2VL8 A;  5FP3 A;  4WW0 A;  5FY1 A;  1W9R A;  2BG9 A;  1KF6 A;  1Y01 A;  4FI5 A;  3TLS A;  3BK9 A;  4P0A A;  3I9Y A;  2FJE A;  4QXH B;  4UVA B;  3RIU C;  2C5K T;  5FVL A;  1YW0 A;  3CWZ B;  4JI6 T;  2XQY A;  1G73 A;  5J0Z A;  4JI4 T;  4ZS3 A;  2XSB A;  4C91 A;  3SS1 A;  4JI5 T;  3VR9 A;  4IGU A;  3VU7 H;  5LG3 A;  4DR7 T;  2DNX A;  2L8K A;  3EUH A;  2UXB T;  4IT4 A;  2K9A A;  5ABH A;  2DLR A;  2YN6 A;  1FIO A;  5FXX A;  1B7T A;  3P4R A;  3W15 B;  3HL6 A;  3FBL A;  5LHI B;  5AFU L;  2IML A;  4X1Y E;  3VKH A;  1NEK A;  1IAP A;  1UCU A;  2YEV C;  3C4X A;  3OVU A;  4HWI B;  4UVB B;  4CZZ B;  2X51 A;  3KBT A;  4IE7 A;  2YKS A;  4YY3 T;  4X1K E;  2XJ7 A;  1KFY A;  3N2G E;  3RYF E;  4H9N C;  3RRW A;  3RQU A;  2J4G A;  2D0T A;  3EHZ A;  3SFE A;  1WFD A;  3A8Y C;  3FZF B;  3ZMT B;  4ANJ A;  5IWA T;  4LFB T;  5BR8 T;  3KV9 A;  5LHH B;  1MMN A;  4A5X A;  4AQF C;  1YKE B;  3N9L A;  1I94 T;  2WWU A;  1XNR T;  4JBW F;  2UUA T;  3EVY A;  1YQ4 A;  3M65 A;  1KNR A;  4ZI2 C;  2E5L T;  2XAH B;  2KSR A;  4TWH A;  3K1S A;  3OPC A;  3UFE A;  2W67 A;  4EV6 A;  1MIY A;  5F8P A;  3O9X A;  3B5M A;  5AQL B;  2FBW A;  3KV4 A;  3PDY A;  5KMG P;  2YU2 A;  3CX6 B;  2YDQ A;  3WI3 A;  2BG9 B;  4KX6 A;  3UUM A;  2KMF A;  4O4J E;  5AQI B;  4IL4 A;  3P4S A;  2X66 A;  5E0O A;  5HWX A;  5HXE A;  3JAE A;  4YLH A;  2F4V T;  2FJB A;  4YXD A;  5LXT E;  4WBO A;  2N2N A;  1HS7 A;  1E1H B;  4JLE A;  5HAX A;  1FJG T;  1OED E;  4G2A A;  4KHZ F;  3QK6 A;  2LE8 A;  3KFW X;  4TV8 E;  2I59 A;  3RLF F;  2X9Y A;  2XQ5 A;  1CHU A;  2WMO A;  3AEE A;  3AEB A;  4U33 A;  2LT3 A;  4PJN A;  2WM9 A;  2EHO C;  2KIN B;  2HN1 A;  3PUZ F;  4EZ4 A;  4IE4 A;  2X68 A;  2ZM8 A;  2WDR A;  3N9M A;  5JVD E;  5HCJ A;  1KK7 A;  5JDN A;  4IE6 A;  3N9O A;  3K8P C;  1O3X A;  2KWI B;  1Z0P A;  3F57 A;  3PU3 A;  5TAO A;  4ZI3 D;  5FL1 A;  3VR8 A;  4PFP A;  1W0A A;  1KNZ A;  5M4Y A;  5L2L A;  2QVA A;  1FEW A;  2Q9Q C;  2DHR A;  2XAG B;  3ZMS B;  4U2Z A;  3EDV A;  3RI5 A;  4JI0 T;  4O2B E;  3N5L A;  1D1B A;  2V6Y A;  2CXF A;  2JPF A;  2LRL A;  2LRK A;  2VKD A;  3IA3 A;  1VOM A;  2X0H A;  3QC9 A;  4H9Q C;  5AQH B;  2WZH A;  5LBM A;  3R6N A;  3IEE A;  3D0T A;  3N2K E;  1U4Q A;  5DAB A;  1MIV A;  2JRK A;  5F3J A;  2XTL A;  3AXJ B;  3QNU A;  1R8I A;  3PJA J;  4ILB A;  2E2A A;  3MAC A;  5HEH A;  2UU9 T;  5CA0 E;  2YU1 A;  4OK0 A;  1HCI A;  3PV0 F;  4KI0 F;  3PUV F;  1MMA A;  4F6R C;  1HNZ T;  2Q9Q D;  1HF8 A;  4DUZ T;  4O8S A;  2WCA A;  4HEA A;  4LFA T;  1WYC A;  3U3I A;  3AAA B;  2BVM A;  4HTE A;  5ADX L;  4TZ4 C;  2WP9 A;  3IHR A;  3RIF A;  3UQ4 A;  1T8B A;  1ZHC A;  3VKG A;  2B1E A;  2Q9Q B;  4IDO A;  2XM2 A;  3RHW A;  4I0U A;  4O4H E;  3ONL C;  1D1C A;  5ABF A;  4EAH A;  2UUB T;  3E08 A;  2A3D A;  2HHH T;  3N9Q A;  2CRB A;  4LF8 T;  4B3R T;  1UX5 A;  4X20 E;  4YFS A;  4JEU B;  2IW5 B;  5L3G B;  3AE4 A;  4JEH B;  5AQT B;  5HEU A;  2FJA A;  4EYU A;  3IBP A;  2WS3 A;  4LF4 T;  1KEY A;  2BKO A;  2Y6X A;  1NWM X;  3TLV A;  3ZPO A;  3ZJ1 A;  4DV7 T;  5LGN B;  2W62 A;  1IBL T;  3SRZ A;  2WDQ A;  4X64 T;  3HKC E;  3PUG A;  4H9S E;  4OX9 T;  4UEL A;  3P50 A;  4UEM A;  4Q25 A;  4DV1 T;  4UXN B;  5FY0 A;  4DR5 T;  1M62 A;  3QOF A;  2VKJ A;  3CML A;  4WNK A;  2IUB A;  4AIS A;  4M1P A;  4DV5 T;  4LMJ A;  2HPJ A;  2HH7 A;  4IIJ E;  3UU8 A;  2UXN B;  5AQU B;  3AAE B;  2C5J A;  5A1L A;  1S35 A;  4IRE A;  2A9U A;  1HX8 A;  4OYJ A;  2DI4 A;  2IHR 1;  5LYJ E;  5J2U E;  3WAJ A;  5EK3 A;  4GK0 E;  2VL0 A;  4CN1 A;  2H7V C;  2RP4 A;  3E22 E;  4JV5 T;  2H3R A;  5HXS A;  5JRC B;  4PAG A;  5J1G A;  5L3B B;  2V7L A;  1UUR A;  3PUQ A;  4HFB A;  4PJM A;  2UXD T;  4MHC A;  5HEG A;  3DJB A;  1E2A A;  4KP3 C;  2ODU A;  4HFE A;  2LKG A;  1MMG A;  3AEA A;  5AQR B;  3HKE E;  4QKN A;  2DWG A;  3H3A A;  1WR0 A;  3PUW F;  2XSA A;  4TWD A;  5DQW A;  2IAK A;  3CVR A;  4MFR A;  1YKH B;  4QH5 A;  2M6I A;  5C2T A;  3JC6 C;  1QUU A;  4LF9 T;  1YQ3 A;  2H88 A;  2IIU A;  2K48 A;  2V7M A;  3AE5 A;  3PTR B;  2J47 A;  3Q2M A;  4IE0 A;  4X66 T;  4KMC A;  3UUB A;  2P9B A;  3KBU A;  3FB2 A;  1SUM B;  2CWY A;  2V8S V;  3ZEF B;  5CA1 E;  4H63 H;  5L47 A;  4NXM T;  3X1D A;  3K3Q C;  2EHO B;  5JH7 E;  4H9O C;  2LKH A;  5FMN A;  5HXC A;  2CEA A;  3I0O A;  1SHZ C;  2JIW A;  2X67 A;  1CUN A;  2M67 A;  3ESL A;  4XZC A;  3CK6 A;  5HXR A;  3TLT A;  4KBM B;  2JJ9 A;  3F31 A;  4PFO A;  2Z6E A;  3ZST A;  2IC9 A;  3FXE B;  4EYY R;  4P1N A;  1BR2 A;  3PUA A;  3P7I A;  3OTO T;  2JQ9 A;  3ANW B;  3UTK A;  3ETU A;  2VWA A;  2LEH A;  2WBL A;  3KV5 A;  1G8X A;  4GK5 E;  4HWH A;  3CX7 B;  3RQW A;  2BG9 C;  3UU6 A;  4CXY A;  1BR4 A;  2A72 A;  1ZEE A;  3JCF A;  4U72 A;  5JR9 B;  2XAQ B;  1WRD A;  3BQK A;  3C50 A;  5AQJ B;  4MLK A;  2XQA A;  5FKY A;  3RIA A;  5ETW A;  4MBQ A;  4DV6 T;  3HR0 A;  3RF1 A;  1HTJ F;  3ZC1 A;  2LOS A;  2CBI A;  2LM2 A;  4GIW A;  3LK3 B;  2V1D B;  4TV9 E;  3AE9 A;  2V26 A;  3HKD E;  4X65 T;  4AKG A;  3FHN A;  2UXX B;  2Y48 B;  4ZI7 E;  4EIW A;  1XNQ T;  4TWF A;  2VKO A;  4U7I A;  5CFB A;  5AQK B;  2KWH A;  2ODV A;  2X0Y A;  2YOE A;  2VVN A;  3FZH B;  1D0Y A;  3CIR A;  2D9D A;  4UF0 B;  2M6B A;  4PJL A;  3MJX A;  3V5S A;  3C98 B;  2IDO B;  2BKN A;  3KIN B;  1XMO T;  3P4P A;  2OV9 A;  3VRB A;  5KX5 E;  1AJ3 A;  4PK5 A;  3C64 A;  1VCT A;  3GN5 B;  4ZOL E;  4EOZ B;  3ZN0 B;  4AI6 A;  1V9D A;  3ETV A;  4PJJ A;  4DBQ A;  5KXJ A;  4JI7 T;  3AE1 A;  3ONJ A;  2LM9 A;  4HWD A;  3H3M A;  3PJA A;  4EGW A;  1FMW A;  3AE8 A;  4ZS2 A;  4JI1 T;  5FXZ A;  2NTY A;  3RKG A;  3FBZ A;  2WWV A;  3JAF A;  1MND A;  3UFG A;  3GMI A;  4X5T A;  5LNK A;  2XAS B;  1J5W A;  2C0S A;  3NZQ A;  4O4I E;  3CQX C;  4QX7 B;  4Z90 A;  5AQN B;  2VVS A;  1UX4 A;  2WSS V;  3RYI E;  3K3N A;  3V5U A;  2K24 A;  3PUY F;  4YTM A;  1EZ3 A;  2OLT A;  2XM1 A;  4Z8X A;  5IUX A;  1J5E T;  1OED C;  4LF5 T;  2VUR A;  3UQ7 A;  5FYM A;  5LMU T;  2RPA A;  4V1A v;  3ZJ2 A;  1ZP0 A;  1T7S A;  4BA9 A;  2X9H A;  4ZXL A;  4MAL A;  3PUS A;  4CN6 A;  4YTP A;  3MK7 C;  4U2Y A;  2J62 A;  3EDU A;  4WYV A;  3ZMU B;  2ZM0 A;  4AIU A;  4QXB B;  1LVK A;  2LLY A;  1YXR A;  1YD8 G;  3AEC A;  3NZP A;  2D0U A;  4L0R A;  4ASK A;  4I4T E;  2YDS A;  4XAX B;  2CE7 A;  4LMK A;  5LOV E;  4YSX A;  5CJ5 A;  4HFC A;  1Y64 B;  3RGL A;  4A97 A;  2BBH A;  3NBX X;  5H6Q B;  4N78 D;  1WLX A;  1X9B A;  1N33 T;  4HN9 A;  1HNX T;  4DV2 T;  3I1A A;  3OYZ A;  4UR9 A;  1S94 A;  2UXC T;  3AB3 B;  3PE0 A;  3M3Z B;  2MBG A;  4H9R C;  1U5P A;  2I0M A;  2V5D A;  4IE5 A;  3K3O A;  4LML A;  4ZI3 C;  3AA6 B;  5FNV E;  3H37 A;  5LB7 B;  4U31 A;  2VKH A;  4ZI2 D;  4CI1 B;  5LJN A;  3EI0 A;  4UVC B;  5AQM B;  4DO0 A;  1NAF A;  4HFI A;  4JUY A;  1UGO A;  2NWB A;  3ZKR A;  1SE7 A;  5AQG B;  5JDM A;  2CXD A;  3P8C D;  3RPU A;  4NUU A;  3L09 A;  2LHN A;  4QXC B;  2PTF A;  3AXJ A;  3KV6 A;  2DL1 A;  2MAW A;  5L4E A;  5BMV E;  5JR9 C;  1J1J A;  1XWM A;  2BVL A;  3MZK B;  3Q5X A;  4HFV A;  4YHH T;  4IHJ E;  1BR0 A;  4AQG A;  2R6G F;  2BG9 E;  2H89 A;  3GWH A;  3I0Q A;  3KVA A;  3AAI A;  4CI2 B;  4DV3 T;  3RX6 A;  2WU2 A;  2E9X A;  1IBK T;  1MMD A;  2XQ7 A;  4U74 A;  4TNW A;  4IL9 A;  3AVR A;  4NIQ A;  4X62 T;  2CBJ A;  3O1H A;  4GYS A;  3OJA A;  3LFM A;  4GKK T;  2X0L B;  3JC6 D;  3A5X A;  3O1I A;  3VHL A;  4ZZB A;  4IDQ A;  3SFD A;  1OWA A;  4DR2 T;  2W66 A;  3LBX B;  3T1Y T;  5C8Y E;  1T98 A;  2KZ7 B;  2W0G A;  3E0Z A;  3S4U A;  5DQV A;  5HEJ A;  5HYA A;  3FZL B;  3ZMZ B;  5L3E B;  4HWC A;  3BQL A;  2CCQ A;  1XDO A;  3ZYM A;  4P09 A;  4A98 A;  4UIG A;  1JNZ A;  3T1H T;  1UK5 A;  3A7M A;  4TX5 A;  4OYK A;  3AEG A;  2WY2 A;  2WQY A;  3IF8 B;  3Q5D A;  3PUR A;  2WAU A;  3MXZ A;  2K5B B;  3P4W A;  2KT9 A;  4ISS A;  3UU5 A;  4AKL A;  2W63 A;  2ZMA A;  4WBN E;  4WZX A;  2BS2 A;  5HCM A;  4PNI A; 
#chains in the Genus database with same CATH homology
 4PK4 A;  3RYH E;  2BDE A;  1IZN B;  3I9W A;  4H63 V;  2GK9 A;  3LK2 B;  3C51 A;  1OXZ A;  2MOZ A;  3ZLI A;  3HKB E;  1LRZ A;  2PG8 A;  2X9X A;  5JDL A;  1ZV4 X;  4G63 A;  3J7Y q;  2CXL A;  4C90 A;  4TUY E;  2XUE A;  4DVD A;  1WYB A;  2KND A;  3AVS A;  3KDS E;  3WAK A;  4BJM A;  1BR1 A;  3GN5 A;  3MKD A;  4H9P C;  3CKD A;  2LSK A;  4DBR A;  3AA7 B;  5FXV A;  3UUN A;  5LP6 E;  4ADZ A;  3N2O A;  3GA8 A;  1D0Z A;  4L9I A;  1HFA A;  4HKA A;  3Q9D A;  2YK0 A;  3SWH A;  2L9Q A;  2EHO D;  4GOU A;  2V7I A;  2J1D G;  2JMK A;  2QA7 A;  5L3D B;  3LJC A;  1HG2 A;  2E9X D;  4I43 B;  3U78 A;  2W00 A;  5FXW A;  1HG5 A;  2LSI A;  4PK6 A;  3ONX A;  1IJ6 A;  2E9X B;  3PU8 A;  4GYR A;  4I50 E;  1IJ5 A;  1WR6 A;  2QGS A;  3CQC B;  2C5I T;  2LSG A;  5JR9 A;  4E7S A;  4AXP A;  2ACX A;  4EZH A;  5FY7 A;  3RYC E;  1LVF A;  4P0B A;  3C4Z A;  2PBI A;  2NOX A;  1MIW A;  2WMN A;  2PJQ A;  3CQG B;  2ZM2 A;  4AKI A;  1D1A A;  2L3L A;  5EK4 A;  5CB4 E;  3ZCJ A;  2EHO A;  2YIN A;  2VK9 A;  5IHY A;  4CI3 B;  2D5U A;  4E7Z A;  1ZKE A;  4DND A;  4NUV A;  4O2A E;  5JDF A;  5KDM C;  2VB6 A;  4PW8 A;  2LSY A;  5L3F B;  4YJ2 E;  3RKO A;  4ILU A;  5L3C B;  4XBF B;  3CX8 B;  2LSJ A;  4AKH A;  3QUJ A;  3NRY A;  3OBV E;  4O4L E;  5LA6 E;  4X1I E;  5GON E;  5HWY A;  2H7O A;  2DWK A;  5LG4 A;  3DP7 A;  4OHF A;  4IDZ A;  3KVB A;  3ZYK A;  4EB6 E;  3MA9 A;  3OYX A;  5JDG A;  4TN7 B;  4QHO A;  5JDH A;  2KLQ A;  3RRC A;  4DMV A;  2CLY B;  3HI2 A;  5H6R B;  1FMV A;  2NTX A;  2XHE B;  1VRB A;  3O1J A;  1US7 B;  3NRX A;  4CXX A;  2CA5 A;  3L3P A;  2ES0 A;  3RH3 A;  3ZCI A;  4QX8 B;  4B6X A;  2LJL A;  4CXW A;  1LKX A;  2DCF A;  2CWO A;  2KXP B;  3AA1 B;  1X79 A;  4L5G A;  1D0X A;  2G0U A;  2X9W A;  3O4X E;  4YJ3 E;  3B13 A;  3F2E A;  4EXT A;  2MYS A;  2E8I A;  2SPC A;  3HA4 A;  2D2S A;  2BZB A;  2Y8D A;  2CM0 A;  4UF0 A;  5LGU B;  2N9D A;  3J9X 1;  2CLY C;  2Q9Q A;  4AQF A;  1H7C A;  4BAY B;  3ZC0 A;  2CMR A;  2VAS A;  2XAF B;  3TKL B;  1SA0 E;  4AKR B;  2E9X C;  2NW8 A;  2JQQ A;  2W61 A;  2OA5 A;  4ERR A;  2XAJ B;  3RC3 A;  4DMW A;  5J2T E;  4QWN B;  3LG7 A;  2RA1 A;  3LK4 2;  3T8O A;  2ZLY A;  5EK2 A;  4J2C A;  3N9P A;  5LBQ B;  3DTO A;  4BJN A;  2PFV A;  3ANW A;  1MNE A;  3C4W A;  5IYZ E;  4CQI A;  3B57 A;  4YHJ A;  4OFZ A;  3R84 B;  2MTQ A;  2LOP A;  1QSD A;  4HE8 A;  3ZN1 B;  2A2F X;  2LHR A;  5DJQ C;  5LJM A;  4UV8 B;  4UV9 B;  3ZMV B;  3FXD B;  3UT5 E;  2HPL A;  4K0U A;  4KUM B;  3LBX A;  4A56 A;  2N1G A;  5JDQ A;  3BQI A;  5LHG B;  5JRC A;  5EZY E;  2NP9 A;  3SOL A;  2JMH A;  4ZHQ E;  3CPZ A;  2V7J A;  3Q5W A;  3UUX B;  2NW7 A;  5JRE A;  4FJO A;  2V7K A;  2IC6 A;  4HGA A;  5JQG E;  3OKQ A;  3UUL A;  3RC8 A;  4IST A;  5LCY A;  4I55 E;  5LGT B;  3AA0 B;  2NW9 A;  2VL8 A;  5FP3 A;  4WW0 A;  5FY1 A;  4FI5 A;  3BK9 A;  4P0A A;  3I9Y A;  4QXH B;  4UVA B;  2C5K T;  1YW0 A;  3CWZ B;  2XQY A;  1G73 A;  4ZS3 A;  4C91 A;  3SS1 A;  4IGU A;  3VU7 H;  2DNX A;  2L8K A;  3EUH A;  2K9A A;  2DLR A;  1FIO A;  5FXX A;  1B7T A;  3W15 B;  5LHI B;  3HL6 A;  3FBL A;  5AFU L;  4X1Y E;  3VKH A;  3C4X A;  1IAP A;  1UCU A;  2YEV C;  4UVB B;  4CZZ B;  2X51 A;  3KBT A;  4IE7 A;  4X1K E;  3RYF E;  3N2G E;  4H9N C;  3RRW A;  2D0T A;  3ZMT B;  4ANJ A;  3KV9 A;  5LHH B;  1MMN A;  4AQF C;  1YKE B;  3N9L A;  2WWU A;  3EVY A;  3M65 A;  4ZI2 C;  2XAH B;  3UFE A;  3O9X A;  1MIY A;  5F8P A;  3KV4 A;  3PDY A;  2YU2 A;  3CX6 B;  3WI3 A;  3UUM A;  5HWX A;  2KMF A;  4O4J E;  5HXE A;  2X66 A;  5E0O A;  4YLH A;  5LXT E;  4WBO A;  2N2N A;  1HS7 A;  1E1H B;  4JLE A;  5HAX A;  4G2A A;  3QK6 A;  2LE8 A;  3KFW X;  4TV8 E;  2I59 A;  2X9Y A;  2WMO A;  2LT3 A;  4PJN A;  2WM9 A;  2EHO C;  2KIN B;  4EZ4 A;  4IE4 A;  2X68 A;  2ZM8 A;  3N9M A;  5JVD E;  1KK7 A;  5JDN A;  4IE6 A;  3N9O A;  3K8P C;  1O3X A;  2KWI B;  1Z0P A;  3F57 A;  3PU3 A;  5TAO A;  4ZI3 D;  4PFP A;  5M4Y A;  5L2L A;  1FEW A;  2Q9Q C;  2DHR A;  2XAG B;  3ZMS B;  3EDV A;  4O2B E;  3N5L A;  1D1B A;  2CXF A;  2JPF A;  3N9N A;  5HXH A;  2VKD A;  3QC9 A;  4H9Q C;  1VOM A;  3R6N A;  5LBM A;  3IEE A;  3D0T A;  3N2K E;  1U4Q A;  5DAB A;  1MIV A;  2JRK A;  5F3J A;  2XTL A;  3MAC A;  5CA0 E;  2YU1 A;  4OK0 A;  1HCI A;  1MMA A;  4F6R C;  2Q9Q D;  1HF8 A;  4O8S A;  4HEA A;  1WYC A;  3U3I A;  3AAA B;  2BVM A;  4HTE A;  5ADX L;  4TZ4 C;  3IHR A;  3VKG A;  1ZHC A;  2B1E A;  2Q9Q B;  4O4H E;  1D1C A;  4EAH A;  3E08 A;  2A3D A;  3N9Q A;  1UX5 A;  4X20 E;  4YFS A;  4JEU B;  2IW5 B;  5L3G B;  4JEH B;  4EYU A;  3IBP A;  2Y6X A;  1NWM X;  3ZPO A;  3ZJ1 A;  5LGN B;  2W62 A;  3SRZ A;  3HKC E;  3PUG A;  4H9S E;  4UEL A;  4UEM A;  4UXN B;  5FY0 A;  2VKJ A;  3CML A;  4WNK A;  4M1P A;  2HPJ A;  2HH7 A;  4IIJ E;  2UXN B;  3AAE B;  2C5J A;  5A1L A;  1S35 A;  5LYJ E;  1HX8 A;  4OYJ A;  2DI4 A;  5J2U E;  3WAJ A;  5EK3 A;  4GK0 E;  2H7V C;  2RP4 A;  3E22 E;  2H3R A;  5HXS A;  4PAG A;  5J1G A;  5L3B B;  2V7L A;  4PJM A;  3PUQ A;  4MHC A;  3DJB A;  4KP3 C;  2ODU A;  1MMG A;  3HKE E;  4QKN A;  2DWG A;  3H3A A;  5DQW A;  3ZYL A;  4AI6 A;  2IAK A;  3CVR A;  4MFR A;  1YKH B;  3JC6 C;  1QUU A;  2V7M A;  2K48 A;  3PTR B;  3Q2M A;  4IE0 A;  4KMC A;  2P9B A;  3KBU A;  3FB2 A;  3ZEF B;  2CWY A;  5CA1 E;  4H63 H;  3K3Q C;  2EHO B;  5JH7 E;  4H9O C;  5FMN A;  5HXC A;  2CEA A;  3I0O A;  1SHZ C;  2X67 A;  3ESL A;  1CUN A;  2M67 A;  4XZC A;  5HXR A;  4KBM B;  2JJ9 A;  3F31 A;  4PFO A;  2W63 A;  2IC9 A;  3FXE B;  4EYY R;  1BR2 A;  3PUA A;  3P7I A;  3ANW B;  3UTK A;  3ETU A;  2VWA A;  2LEH A;  2WBL A;  3KV5 A;  1G8X A;  4GK5 E;  4CXY A;  3CX7 B;  1BR4 A;  2A72 A;  1ZEE A;  4U72 A;  5JR9 B;  2XAQ B;  1WRD A;  3BQK A;  3C50 A;  4MLK A;  5ETW A;  4MBQ A;  3HR0 A;  3ZC1 A;  1HTJ F;  2LOS A;  4GIW A;  3LK3 B;  2V1D B;  4TV9 E;  4AKG A;  2V26 A;  3HKD E;  3FHN A;  2UXX B;  2Y48 B;  4ZI7 E;  4EIW A;  2VKO A;  2KWH A;  2ODV A;  1D0Y A;  4UF0 B;  4PJL A;  3MJX A;  3V5S A;  3C98 B;  3KIN B;  5KX5 E;  1AJ3 A;  4PK5 A;  3C64 A;  3GN5 B;  4ZOL E;  4EOZ B;  3ZN0 B;  1V9D A;  3ETV A;  4PJJ A;  4DBQ A;  2LM9 A;  1FMW A;  4ZS2 A;  5FXZ A;  2NTY A;  3FBZ A;  5LNK A;  1MND A;  3GMI A;  2XAS B;  2C0S A;  3NZQ A;  4O4I E;  4QX7 B;  3CQX C;  3RYI E;  2WSS V;  1UX4 A;  3V5U A;  3K3N A;  2K24 A;  1EZ3 A;  4Z8X A;  5FYM A;  4V1A v;  3ZJ2 A;  4BA9 A;  2X9H A;  4MAL A;  3PUS A;  3MK7 C;  3EDU A;  3ZMU B;  2ZM0 A;  4QXB B;  1LVK A;  1YD8 G;  4L0R A;  3NZP A;  2D0U A;  4ASK A;  4I4T E;  4XAX B;  2CE7 A;  5LOV E;  1Y64 B;  3NBX X;  5H6Q B;  4N78 D;  1WLX A;  4HN9 A;  3I1A A;  3OYZ A;  1S94 A;  3AB3 B;  3PE0 A;  2MBG A;  4H9R C;  1U5P A;  4IE5 A;  4ZI3 C;  1KNZ A;  3K3O A;  5KMG P;  4CI1 B;  3AA6 B;  5FNV E;  3H37 A;  4ZI2 D;  2VKH A;  5LJN A;  4UVC B;  4DO0 A;  1NAF A;  4JUY A;  5JDM A;  2NWB A;  2CXD A;  3P8C D;  3RPU A;  4NUU A;  3L09 A;  2LHN A;  4QXC B;  3KV6 A;  5BMV E;  5JR9 C;  3Q5X A;  2BVL A;  3MZK B;  1BR0 A;  4HFV A;  4IHJ E;  4AQG A;  4CI2 B;  3I0Q A;  3GWH A;  3KVA A;  3AAI A;  3RX6 A;  2E9X A;  1MMD A;  4U74 A;  3AVR A;  3O1H A;  4GYS A;  3OJA A;  3LFM A;  2X0L B;  3JC6 D;  3A5X A;  3O1I A;  3VHL A;  1OWA A;  3LBX B;  5JRC B;  5C8Y E;  1T98 A;  2KZ7 B;  2W0G A;  3E0Z A;  3S4U A;  5DQV A;  5HYA A;  5L3E B;  3ZMZ B;  3BQL A;  2CCQ A;  3ZYM A;  4P09 A;  4UIG A;  4TX5 A;  4OYK A;  3IF8 B;  3PUR A;  2WAU A;  3MXZ A;  2K5B B;  4ISS A;  2KT9 A;  4AKL A;  4WBN E;  2Z6E A;  2ZMA A;  4PNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...