5M4YA

Crystal structure of the sec3/sso2 complex at 2.20 angstrom resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
177
Chain Sequence
b'SHMDFVAFMNKINSINANLSRYENIINQIDAQHKDLLTQVSEEQEMELRRSLDDYISQATDLQYQLKADIKDAQRDGLHDSNKQAQAENCRQKFLKLIQDYRIIDSNYKEESKEQAKRQYTIIQPEATDEEVEAAINDVNGQKTALAEVQARHQELLKLEKTMAELTQLFNDMEELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SSO2
publication title Sec3 promotes the initial binary t-SNARE complex assembly and membrane fusion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Structural protein
total genus 80
structure length 177
sequence length 193
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2016-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5m4yA00
1FIOA 3C98B 5LG4A 5M4YA 4JEUB 4TX5A 3LG7A 1BR0A 1S94A 4JEHB 2DNXA 1G73A 1HS7A 2XHEB 1EZ3A 1FEWA
chains in the Genus database with same CATH superfamily
1J5WA 3OVUA 4DV3T 4GK5E 2W00A 5HEGA 5GONE 1OWAA 5LYJE 3PJAJ 4U2YA 2UXBT 2LSIA 3TKLB 2X66A 5AQTB 2V8SV 2VB6A 2XZEA 2LM9A 2UUAT 4OK0A 3ZYKA 4EXTA 5FXVA 3R84B 2XASB 5ADXL 2E2AA 3ZCIA 1BR1A 4YSXA 1WYCA 2VASA 2RP4A 3LFMA 4ZZBA 5EK4A 2ODVA 3NKZA 3ZYLA 3S4UA 3C51A 5KX5E 4O4IE 4NXNT 3ZEFB 5AQPB 3T8OA 4AKLA 2UXCT 4YHJA 3NZQA 2QRXA 3KINB 2C0SA 3L3PA 1D1AA 2WCAA 2UU9T 4WZXA 5LBMA 4DV6T 4UIGA 3ZCJA 2WP9A 3B5MA 2W61A 3DTOA 5JDMA 2KWIB 3PUGA 4ISTA 3VR9A 4HN9A 4CI3B 4EAHA 4P1NA 4DR7T 3SFEA 5CA1E 4YLHA 4QX7B 1UGOA 4UVBB 3B57A 3OYXA 4LFBT 4YSZA 2I59A 2FJBA 1ZP0A 4COFA 2PTFA 4U31A 3EDVA 2XAQB 3CX7B 3RLFF 3MZKB 4HFCA 1KNRA 2KLQA 2J1DG 5HXHA 3BK9A 4DR1T 4YJ3E 4GIWA 3RKGA 1YKEB 2VURA 4X66T 2V6XA 2X68A 1WCRA 4LF8T 3FBZA 3IA3A 5EK2A 2NTXA 5KXJA 5LOVE 5AQNB 4PW8A 3Q5XA 2X0YA 4HFDA 3C50A 1D0XA 2NW9A 2N9DA 3JC6D 3HA4A 2OV9A 2CXDA 1UK5A 4EEBA 3QC9A 5HEJA 2YU2A 1XZYA 3EDUA 4YTNA 4X5TA 5HXSA 1W09A 4ANJA 3V5UA 3DP7A 4H9NC 4LF5T 2Z6EA 4U72A 2V7LA 3SRZA 4NUVA 3P7IA 4PFOA 4JUYA 3QNUA 2J4GA 3I0QA 2X9HA 1WYBA 2XY8B 4GK0E 1MIVA 2XUEA 3CX8B 3RIFA 2UXNB 2XQ4A 4IE7A 3JCFA 4L5GA 5L3EB 2XSBA 4YHHT 1US7B 3RC8A 1XMQT 4Z91A 4DR5T 1T7SA 2DI4A 4H9OC 2X51A 1XWMA 2NP9A 3C4ZA 3UU4A 4QH4A 3U78A 2MOZA 3EAMA 2HN1A 4EEDA 4DBQA 4EYYR 3SOLA 2XAFB 3RF1A 2DHRA 2Q9QA 3RRWA 3AAEB 5CB4E 3QK6A 1T72A 4IIJE 4HFBA 3N2GE 2NR4A 3L09A 1T98A 4I43B 4I50E 1FMVA 2CPTA 2LSGA 5DQVA 1ZHCA 3CWZB 2WZHA 3TLTA 1DU2A 3OKQA 3QB5K 3W15B 4E7SA 2BKOA 4H9PC 2QA7A 3K3QC 2W63A 1MNEA 1OEDE 3E0ZA 4FJOA 2QVAA 2FUPA 2LEHA 4YTPA 5L3CB 4Z8XA 4DNDA 4PNIA 2E5LT 5JREA 2LLYA 5AQRB 2CEAA 3MXZA 2V7KA 1IJ5A 4HFIA 4AKIA 3BQLA 4H9SE 3ZSTA 4OX9T 3I1AA 5HWYA 5L4HA 2W0GA 2BG9B 3OTOT 3VR8A 4UVAB 2ODUA 3UFGA 4TX5A 4U7YA 4NUUA 1HS7A 5KDMC 3FZLB 4IDNA 4LF6T 3HI2A 3ANWB 4J2CA 2KMFA 2YINA 2XQAA 4G63A 4X1YE 3PUZF 3TLVA 3D0TA 2CBIA 3A7MA 5BR8T 5HEHA 4ZI2C 4QXBB 5LJNA 4HKAA 3ZMZB 3GWHA 4HWIB 2X9YA 2IMLA 3IBPA 4YJ2E 5JRCB 2ZM0A 1VRBA 2BG9A 4L0RA 4H63V 3NWIA 3Q5WA 3ZT6A 5AQKB 2E9XB 1SUMB 4CXYA 5J0ZA 1J1JA 3ZMVB 4L9IA 2H89A 3UU6A 5HCMA 3ANWA 4EYUA 2VQFT 5F5WA 5F3JA 1OEDB 5H6QB 4DV7T 4EIWA 5ABFB 5HYAA 5CFBA 3NZPA 2WDQA 3HL6A 2EHOC 4HTEA 2FJEA 2CLYC 4M1PA 3RKOA 2XM2A 4YFSA 1SA0E 4O8SA 4IDQA 4JI8T 4IHJE 1L0VA 5JRCA 2XPKA 2M67A 5JDQA 2E9XA 5J1GA 3KBUA 3RGLA 5LGNB 2EHOD 3UQ4A 3EUHA 2C5IT 4O2AE 4IREA 1AJ3A 4XZCA 2X0LB 2XQ6A 2VVSA 4MLKA 4FI5A 1FEWA 3F31A 3ZN0B 3FZMB 5FXXA 2CXLA 1IZNB 4PJMA 2LHNA 3PUSA 5L3BB 2UXDT 1HFAA 4QHOA 2DL1A 5EK3A 4C90A 2BBHA 2WZIA 2V7JA 1Y64B 2LKGA 3HKBE 5L3FB 3SWHA 3PU3A 3AXJB 4O4HE 3H3MA 4I0UA 3HKEE 4KUMB 5TAOA 1UCUA 4EB6E 3AEBA 1M7KA 2H7OA 3C64A 1YQ4A 4OHFA 3FZKB 2E8IA 3AEEA 3O1IA 2W62A 3ZMSB 1Y01A 4GKJT 3RYCE 1OEDC 5LXTE 2WB5A 4QXHB 2KSRA 2LSKA 4P0AA 5LGTB 3PURA 3TLWA 2X67A 5LNKA 2D5UA 2OA5A 4KP3C 2JPFA 5LG4A 4U3CA 2V5CA 4U2ZA 2UUBT 3JAFA 1YQ3A 4Q25A 3LK42 2VKOA 3K3OA 2YDQA 2XQ5A 3FXDB 1VCSA 3AEGA 4WBOA 3KDSE 3PU8A 3ZSSA 3AE7A 2LOPA 1CHUA 2WMOA 5F8PA 2BKPA 2VKJA 3UU5A 1E7PA 3EHZA 1G73A 3KVAA 4TNWA 3MKDA 4LFAT 5FXZA 2BS2A 4HWFA 4CXWA 2KXPB 2NW8A 4H63H 1OXZA 4X1IE 3AE6A 4P0BA 4AQFC 4DIDB 3P4WA 3FZFB 2WMNA 2LM2A 2XHEB 3AA1B 5DJQC 1MMDA 2WWUA 3ZJ1A 1LKXA 4UEMA 4ILCA 2RA1A 1JNRA 5AFUL 5FXWA 5AQOB 1WRDA 3WAJA 3J9X1 4CXXA 3LJCA 1XDPA 2DWGA 2WU2A 3UFEA 3R6NA 2CMRA 2D0TA 2ZM8A 2VVNA 1IJ6A 3EVYA 4TWHA 5HXRA 3ZPOA 4ZS3A 3UUMA 2IIUA 2V6YB 5FVLA 1BR0A 2YKSA 4CN1A 3F57A 1KNZA 3FZHB 3LSVA 2VKHA 1N33T 3ZC1A 3CVRA 4BJNA 2BS3A 3B13A 4KBMB 1VCTA 3RX6A 4IDOA 3N9PA 3ZKRA 3ESLA 4UV9B 2XTLA 4OFZA 3UT5E 1MNDA 2XAJB 4JYAT 2K48A 4DUYT 4ZOLE 4ILAA 2BS4A 3ONJA 4X20E 3K8PC 3QB5A 4B6XA 2C5JA 1B7TA 4B3RT 3CK6A 5FP3A 1KEYA 4PJJA 4PK4A 3MACA 4LFCT 3V5SA 3OBVE 2K3WA 2AXDS 3N5LA 2V6YA 5AQMB 4CZZB 4IE5A 1Z8UA 4F8HA 3CQXC 1ZEEA 2J62A 4JI2T 4JI1T 3G06A 3CX6B 5HCJA 5JTGA 5LJMA 2XAHB 2VQET 4JI6T 4K0KT 3RIUA 5IUXA 4JV5T 1HF8A 1I94T 2IW5B 2WDVA 1ZOYA 5JR9C 4LF4T 2PFVA 2XQ3A 1GQEA 1KNPA 2CCQA 2KNDA 3FB2A 2WU5A 2W4XA 5LBQB 5AQIB 2PG8A 4PK5A 3F2EA 1NENA 5JDHA 2JQ9A 3N9QA 1HX8A 4B3TT 4IDZA 4IGUA 2W2UA 5CA0E 4ZXLA 5FMNA 4DVDA 2K5BB 3K3NA 3N9MA 4XAXB 4IT4A 3C4WA 1YXRA 5C8YE 1BR4A 4GYRA 2A9UA 1NAFA 4A56A 3DJBA 4B3MT 4PFPA 4KMCA 3CQCB 4H9RC 5FY0A 3NRYA 3A5XA 4KX6A 2IC9A 4NXMT 4QH1A 5HXCA 1MMAA 4O4JE 2EHOB 2NW7A 4AKGA 1Z0PA 5FVKA 3O9XA 2LE8A 1JNZA 1IBLT 3VKHA 3O4XE 3HR0A 3IHRA 4IE6A 1BR2A 3U3IA 2DNXA 3AA7B 3M3ZB 2CLYB 4DMVA 2H88A 5DQWA 2KZ7B 4A98A 5FY7A 4UELA 1UX5A 2JMHA 4DV2T 3LBXB 4EGWA 2MYSA 5FL1A 3I0OA 5AQJB 3ONXA 2K24A 3FBLA 1S35A 2H3RA 4Z90A 2CXFA 3UULA 2JQHA 5JDFA 2L9QA 2VWAA 3RQUA 2XQ8A 3N9LA 3I9YA 2DCFA 2BKNA 1MMNA 5BMVE 1MIYA 3VKGA 2MAWA 5AQFB 2I0MA 5AQQB 1HNZT 1NWMX 5L3DB 2X0HA 2LJLA 5AQUB 2MTQA 2HPJA 2JQQA 5LHIB 3L8RA 3AA0B 4HEAA 4ERRA 2C5KT 4BA9A 4DMWA 5JDLA 5L3GB 1IAPA 5LHHB 2D9DA 4OYJA 2CM0A 2B1EA 2Y6XA 4JI3T 4ZI2D 5ABHA 4WW0A 3TLSA 1QUUA 5KMGP 3LK2B 4TWDA 5FYMA 4AISA 3ZT7A 4YSYA 2V26A 4UR9A 4F6RC 1FIOA 3C98B 3RPUA 1XDOA 3KFWX 1X79A 4HFVA 4LMKA 3PUWF 4DR6T 1LVFA 1ZV4X 3VU7H 3RQWA 2CA5A 1LRZA 2XJ7A 3AE2A 2E5VA 2L8KA 3AE1A 3RHWA 3MK7C 2XAGB 3IF8B 4JEUB 5IWAT 4DV5T 2AE9A 1OEDA 5ABFA 2A3DA 2L3LA 4CQIA 3AAIA 4ILUA 4HE8A 4LF7T 5JVDE 3ZJ2A 4CI2B 4HGAA 1G8XA 2UUCT 3O1JA 3IEEA 1FJGT 3PUAA 2LRLA 5FNVE 3AVSA 4DR2T 5JH7E 3E08A 3UUXB 4MALA 1E2AA 3RYIE 3PE0A 2CBJA 1QLBA 1HNWT 2V5DA 3LDQB 2KINB 2CHOA 3N2KE 1HCIA 1SHZC 2ACZA 2G0UA 1W0BA 2KWHA 1D1BA 3WAKA 1S94A 4QWNB 3UU3A 2A2FX 5FY1A 3PTRB 5DABA 5IHYA 4NIQA 4PJLA 3T1YT 2NTYA 2FBWA 4IE4A 3OYZA 4TV9E 3VRBA 1IBKT 4AQFA 5A1LA 3AEDA 1M62A 3AXJA 4TV8E 2W66A 2I6HA 4CI1B 3HKDE 2XSAA 1O3XA 1U5PA 3H37A 3K1SA 3ZMTB 2IAKA 2UXXB 3ETUA 3QUJA 4YY3T 3AEFA 2J47A 3KVBA 5HAXA 1UURA 3WI3A 4KI0F 3PV0F 1YW0A 4I55E 2NOXA 5HXEA 4E7ZA 2QYWA 4AXPA 3UUNA 2XM1A 2ZM6T 5ABEA 4ZEYA 2N1GA 1HNXT 1D1CA 3HKCE 4TZ4C 3AE9A 3NBXX 5LHGB 3O1HA 2KT9A 2XQ7A 1N36T 2CE7A 4A5XA 3N2OA 2D0UA 3P4QA 3FHNA 4IE0A 4ZS2A 5LA6E 3PUXF 4X62T 4ADZA 3VHLA 3Q2MA 4JLEA 3P4PA 5LG3A 4IL9A 4WYVA 1J5ET 5JR9B 3RH3A 3CPZA 3CQGB 2GK9A 1KFYA 3Q5DA 1U4QA 2WWVA 3A8YC 3CKDA 5LB7B 3JC6C 3VRAA 3GA8A 1KF6A 4O4LE 1H7CA 3KV5A 2X9WA 4OYKA 1D0YA 4EZHA 2YEVC 4JBWF 5EZYE 2JQKA 4LMLA 4KHPT 3UU8A 4A97A 2BVMA 2VL0A 2LSJA 2QGSA 4UXNB 3Q9DA 4B3ST 1X9BA 4AKHA 3ZT5A 4DBRA 4GKKT 4AQYT 4JI7T 2W67A 2VK9A 3ZC0A 2R6GF 2V1DB 5JR9A 2CWOA 4ASKA 2ZMAA 2PJQA 4GYSA 3NRXA 3KV4A 3AE5A 3OPCA 4ZHQE 2ACXA 2Q9QB 5C2TA 4G2AA 4EOZB 5LGUB 2JMKA 3EI0A 4LMJA 2IUBA 4C91A 2WQYA 2BG9E 2WS3A 1SE7A 3P8CD 1W9RA 4DO0A 3PUYF 2B76A 3UTKA 5ETWA 4TUYE 4ISSA 4X64T 1HR0T 4DUZT 2IDOB 2XQYA 2IC6A 2IHR1 2LOSA 4AKRB 2M6BA 3AE8A 4TNVA 5JDNA 3TLUA 1HTJF 3ZYMA 2ZLYA 3RYFE 1HG2A 2M6IA 2BVLA 2LSYA 4ILBA 4PJNA 3SS1A 3RRCA 4DV0T 4ZI7E 3RI5A 4NPPA 1XNQT 4V1Av 3P50A 3RIAA 1LVKA 5LMNT 2HH7A 4DV4T 3ZLIA 4IL4A 2SPCA 4AI6A 4JI4T 4LF9T 2ES0A 3RIUC 3E22E 5LP6E 2XQ9A 3L39A 3BQIA 2FJDA 2PBIA 3GMIA 4X65T 3M65A 3AAAB 1D0ZA 2JIWA 2Q9QC 2V7IA 2YN6A 5CGMA 2V7MA 2K9AA 3CIRA 2Y48B 3FXEB 2NWBA 5FL0A 1QSDA 4YTMA 4EZ4A 1MMGA 2YK0A 3KBTA 3PUQA 4UV8B 4YXDA 1N32T 2FJAA 3AE4A 1R8IA 5JQGE 4N78D 4JI5T 3Q5EA 1YD8G 2CWYA 2VL8A 2WAUA 2YOEA 4P09A 5AQLB 4PK6A 2Q9QD 3OJAA 4QXCB 5HEUA 3LG7A 4ZZCA 4ZI3C 3RYHE 4UF0B 4HWHA 2EHOA 1I6ZA 2LRKA 2BDEA 4HFEA 1V9DA 3QOFA 3AEAA 4UVCB 2DWKA 2WY2A 3GN5B 2BBJA 3C4XA 5L2LA 3RC3A 4DR3T 1XMOT 4DR4T 3N9NA 2OLTA 3LK3B 5HEOA 3P4SA 1ZKEA 1E1HB 1FMWA 3LBXA 4U74A 4HWCA 1MIWA 2YDSA 4ZI3D 4AQGA 5IYZE 2YU1A 2F4VT 3J7Yq 4TWFA 3PDYA 4GOUA 2D2SA 4TN7B 4X1KE 5J2UE 5AQGB 5L47A 2MBGA 1UX4A 2X9XA 5LCYA 1VOMA 4MBQA 1IBMT 3ZN1B 4UF0A 2WSSV 4MFRA 4MHCA 3KV6A 3I9WA 4I4TE 4BAYB 5H6RB 4CN4A 5E0OA 4HWDA 2YDRA 2JJ9A 2LT3A 5ABGA 3AA6B 2ZM2A 4WNKA 3PJAA 2CHNA 2LHRA 3KV9A 3GN5A 2BG9C 4JI0T 2MPKA 2Y8DA 3ETVA 1KK7A 3UQ7A 5L4EA 3CMLA 5AQHB 1EZ3A 3MA9A 4O2BE 1W0AA 4U7IA 2HN2A 2WDRA 3SFDA 2JRKA 2BZBA 4HFHA 4QH5A 4XBFB 5JDGA 3PUVF 3N9OA 5CJ5A 1WLXA 4PAGA 2HPLA 3JADA 3AECA 4K0UA 2A72A 3NVOA 5AQSB 1UUSA 1HX1B 5AQVB 5FKYA 3H3AA 1N34T 4WBNE 5LMUT 4KHZF 4AIUA 3AB3B 4EV6A 2CRBA 4IDPA 2N2NA 2VKDA 3AVRA 3UUBA 4CN6A 4DV1T 2HHHT 1CUNA 4BJMA 3ZMUB 3EABA 3ONLC 5C3JA 1WR6A 4U33A 2E9XC 2RPAA 3X1DA 3T1HT 5J2TE 1HG5A 3BQKA 2LKHA 4YT0A 1XNRT 4H9QC 5M4YA 1WFDA 3MJXA 2DLRA 2WBLA 2P9BA 4QX8B 5HWXA 4JEHB 3AE3A 1YKHB 4QKNA 1T8BA 1NEKA 3ABVA 3P4RA 2H7VC 1WR0A 3JAEA 2WM9A 2E9XD
chains in the Genus database with same CATH topology
1NAFA 4A56A 3DJBA 4GK5E 4PFPA 4KMCA 3NZPA 2W00A 5GONE 3CQCB 1OWAA 2BVMA 3HL6A 4H9RC 2EHOC 2LSJA 2QGSA 4HTEA 4UXNB 3Q9DA 4AKHA 5FY0A 5LYJE 4DBRA 3NRYA 3A5XA 2IC9A 5HXCA 2LSIA 2CLYC 3TKLB 2VK9A 1MMAA 2X66A 4O4JE 4M1PA 2EHOB 2NW7A 3RKOA 2VB6A 3ZC0A 2LM9A 4AKGA 1Z0PA 4OK0A 3O9XA 4YFSA 2LE8A 1SA0E 4O8SA 3ZYKA 3VKHA 2V1DB 4EXTA 3O4XE 5JR9A 5FXVA 2CWOA 4IHJE 3R84B 3HR0A 3IHRA 4IE6A 1BR2A 2XASB 4ASKA 5JRCA 3U3IA 5ADXL 3ZCIA 2DNXA 2ZMAA 1BR1A 3AA7B 2PJQA 4GYSA 2CLYB 3NRXA 3KV4A 1WYCA 2VASA 4DMVA 2M67A 2RP4A 5JDQA 4ZHQE 3LFMA 2E9XA 5J1GA 5DQWA 2KZ7B 5EK4A 2ACXA 2ODVA 2Q9QB 5FY7A 3S4UA 3ZYLA 4UELA 5LGUB 3C51A 4G2AA 4EOZB 5KX5E 1UX5A 2JMKA 4O4IE 3KBUA 3ZEFB 3T8OA 2JMHA 4AKLA 5LGNB 4C91A 2EHOD 4YHJA 3NZQA 3EUHA 3LBXB 2C5IT 3KINB 4O2AE 2C0SA 3L3PA 1D1AA 2MYSA 1AJ3A 3I0OA 3ONXA 3P8CD 4XZCA 2K24A 2X0LB 3FBLA 4DO0A 1S35A 2H3RA 5LBMA 2CXFA 3UULA 4MLKA 4FI5A 4UIGA 3ZCJA 1FEWA 5JDFA 3F31A 2W61A 3UTKA 5ETWA 3ZN0B 2L9QA 3DTOA 4TUYE 5JDMA 2VWAA 4ISSA 5FXXA 2CXLA 1IZNB 2KWIB 4PJMA 2LHNA 3PUSA 3N9LA 3PUGA 4ISTA 5L3BB 3I9YA 2DCFA 4HN9A 1HFAA 4QHOA 1MMNA 4CI3B 5EK3A 5BMVE 1MIYA 4C90A 4EAHA 3VKGA 2V7JA 5CA1E 1Y64B 3HKBE 5L3FB 3SWHA 3PU3A 4YLHA 4QX7B 2XQYA 4O4HE 4UVBB 3B57A 1NWMX 2IC6A 5L3DB 3HKEE 4KUMB 2LOSA 5TAOA 3OYXA 4AKRB 1UCUA 2I59A 2LJLA 4EB6E 2MTQA 2HPJA 2JQQA 5LHIB 3AA0B 4HEAA 2H7OA 5JDNA 4ERRA 1HTJF 3C64A 3ZYMA 4OHFA 3EDVA 2E8IA 2XAQB 3O1IA 2C5KT 2W62A 4BA9A 3CX7B 2ZLYA 3ZMSB 4DMWA 3RYFE 1HG2A 5JDLA 5L3GB 1IAPA 3MZKB 2BVLA 2LSYA 3RYCE 2KLQA 4PJNA 3SS1A 5LXTE 3RRCA 5LHHB 4OYJA 4QXHB 4ZI7E 2J1DG 5HXHA 3BK9A 2CM0A 2B1EA 2Y6XA 4YJ3E 2LSKA 4GIWA 4P0AA 4ZI2D 5LGTB 3PURA 1YKEB 4WW0A 2X67A 4V1Av 1QUUA 5KMGP 5LNKA 1LVKA 3LK2B 2D5UA 2OA5A 2HH7A 5FYMA 3ZLIA 2X68A 2SPCA 4KP3C 4AI6A 2JPFA 2ES0A 3FBZA 5LG4A 3E22E 5EK2A 2V26A 2NTXA 4F6RC 5LP6E 1FIOA 3C98B 5LOVE 3RPUA 4PW8A 3KFWX 3Q5XA 1X79A 4HFVA 3LK42 3BQIA 2VKOA 2PBIA 3GMIA 3M65A 3K3OA 3C50A 1LVFA 1D0XA 2NW9A 3AAAB 1D0ZA 1ZV4X 2N9DA 3JC6D 3HA4A 2CXDA 2Q9QC 3FXDB 3VU7H 2V7IA 2V7MA 2CA5A 3QC9A 4WBOA 2YU2A 3KDSE 2K9AA 1LRZA 3PU8A 2Y48B 3FXEB 2NWBA 3EDUA 2L8KA 1QSDA 2LOPA 4EZ4A 2WMOA 5HXSA 1MMGA 5F8PA 4ANJA 3V5UA 3DP7A 2VKJA 4H9NC 2YK0A 2Z6EA 4U72A 3KBTA 2V7LA 3PUQA 3SRZA 4UV8B 4NUVA 1G73A 3KVAA 3P7IA 4PFOA 3MK7C 4JUYA 2XAGB 3MKDA 3IF8B 4JEUB 3I0QA 5FXZA 2X9HA 4CXWA 2KXPB 5JQGE 1WYBA 2NW8A 4N78D 4H63H 1OXZA 1YD8G 2CWYA 2A3DA 2VL8A 2WAUA 4X1IE 4P09A 4P0BA 4AQFC 4GK0E 4PK6A 1MIVA 2XUEA 3CX8B 2L3LA 2Q9QD 4CQIA 3AAIA 3OJAA 4QXCB 2UXNB 4ILUA 4IE7A 2WMNA 4HE8A 5JVDE 3LG7A 4L5GA 5L3EB 3ZJ2A 4CI2B 1US7B 2XHEB 4HGAA 4ZI3C 3RYHE 3RC8A 3AA1B 5DJQC 1G8XA 4UF0B 1MMDA 2WWUA 3O1JA 3IEEA 3ZJ1A 1LKXA 2EHOA 4UEMA 2DI4A 3PUAA 4H9OC 2X51A 2RA1A 5FNVE 3AVSA 5AFUL 2NP9A 3C4ZA 5JH7E 3U78A 2BDEA 3E08A 3UUXB 5FXWA 1V9DA 4MALA 2MOZA 3RYIE 4UVCB 2DWKA 4DBQA 3PE0A 3GN5B 4EYYR 1WRDA 3SOLA 3WAJA 2XAFB 3J9X1 4CXXA 2DHRA 3LJCA 3C4XA 2Q9QA 5L2LA 3RC3A 5CB4E 3AAEB 3RRWA 3QK6A 2DWGA 2KINB 3N2KE 3UFEA 3N9NA 1HCIA 3LK3B 3R6NA 1SHZC 2CMRA 2D0TA 2ZM8A 2G0UA 1ZKEA 4IIJE 1E1HB 1FMWA 1IJ6A 3LBXA 4U74A 3EVYA 3N2GE 5HXRA 2KWHA 1MIWA 3L09A 1D1BA 1T98A 4I50E 4I43B 3WAKA 4ZI3D 1FMVA 3ZPOA 4AQGA 5IYZE 4ZS3A 1S94A 3UUMA 4QWNB 2LSGA 2A2FX 2YU1A 5FY1A 5DQVA 1ZHCA 3J7Yq 3CWZB 1BR0A 3PTRB 5DABA 3PDYA 1KNZA 3F57A 4GOUA 2D2SA 4TN7B 5IHYA 2VKHA 4X1KE 4PJLA 3ZC1A 5J2UE 3CVRA 2NTYA 3OKQA 3W15B 4IE4A 3OYZA 4BJNA 4E7SA 4TV9E 2MBGA 4H9PC 3B13A 1UX4A 2QA7A 2X9XA 4KBMB 5LCYA 3K3QC 3RX6A 1VOMA 4MBQA 2W63A 4AQFA 5A1LA 3ZN1B 1MNEA 3E0ZA 4FJOA 2WSSV 4MFRA 4MHCA 4UF0A 4TV8E 3KV6A 3N9PA 3I9WA 4I4TE 4BAYB 2LEHA 4CI1B 5L3CB 3ESLA 4UV9B 5H6RB 2XTLA 5E0OA 4Z8XA 4DNDA 4PNIA 4OFZA 3UT5E 5JREA 2JJ9A 2LT3A 3AA6B 2CEAA 2ZM2A 3HKDE 3MXZA 4WNKA 1MNDA 2V7KA 1IJ5A 2XAJB 2LHRA 1O3XA 1U5PA 3H37A 3KV9A 4AKIA 3BQLA 3GN5A 2K48A 4H9SE 4ZOLE 3ZMTB 2IAKA 3I1AA 2UXXB 2Y8DA 5HWYA 4X20E 3ETVA 3ETUA 3K8PC 1KK7A 3QUJA 4B6XA 2C5JA 2W0GA 3CMLA 1B7TA 3KVBA 5HAXA 5FP3A 4PJJA 3WI3A 4UVAB 4PK4A 3MACA 1EZ3A 2ODUA 3MA9A 1YW0A 4I55E 4O2BE 3V5SA 3OBVE 2NOXA 4TX5A 5HXEA 2JRKA 4NUUA 2BZBA 4E7ZA 3N5LA 1HS7A 5KDMC 4CZZB 4XBFB 4AXPA 5JDGA 3UUNA 4IE5A 3N9OA 3HI2A 1WLXA 3CQXC 4PAGA 1ZEEA 2HPLA 3ANWB 4J2CA 2N1GA 4K0UA 3CX6B 1D1CA 3HKCE 4TZ4C 2A72A 5LJMA 2KMFA 2XAHB 2YINA 3NBXX 5LHGB 3O1HA 2KT9A 3H3AA 4G63A 4WBNE 2CE7A 4X1YE 3N2OA 3D0TA 2D0UA 3AB3B 3FHNA 1HF8A 2IW5B 2N2NA 2VKDA 3AVRA 4IE0A 4ZS2A 5LA6E 1CUNA 4BJMA 5JR9C 3ZMUB 4ZI2C 2PFVA 4ADZA 4QXBB 5LJNA 4HKAA 3ZMZB 3VHLA 3GWHA 3Q2MA 1WR6A 2CCQA 2KNDA 4JLEA 5HYAA 3FB2A 2X9YA 5LBQB 2PG8A 3IBPA 2E9XC 4YJ2E 5JR9B 4PK5A 5JRCB 5J2TE 1HG5A 3BQKA 2ZM0A 1VRBA 3CPZA 4L0RA 3RH3A 3CQGB 3F2EA 4H63V 2GK9A 4H9QC 5M4YA 3Q5WA 5JDHA 3MJXA 2E9XB 3N9QA 2DLRA 2WBLA 1HX8A 4CXYA 4IDZA 2P9BA 4QX8B 4IGUA 5HWXA 1U4QA 4JEHB 3ZMVB 1YKHB 4QKNA 4L9IA 5CA0E 3CKDA 3JC6C 3ANWA 5FMNA 4DVDA 4EYUA 3GA8A 2K5BB 3K3NA 3N9MA 5F3JA 4XAXB 4O4LE 3C4WA 1H7CA 3KV5A 5H6QB 2X9WA 4OYKA 2H7VC 1D0YA 4EIWA 4EZHA 2YEVC 5C8YE 5EZYE 1BR4A 2WM9A 2E9XD 4GYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIO A;  3C98 B;  5LG4 A;  5M4Y A;  4JEU B;  4TX5 A;  3LG7 A;  1BR0 A;  1S94 A;  4JEH B;  2DNX A;  1G73 A;  1HS7 A;  2XHE B;  1EZ3 A;  1FEW A; 
#chains in the Genus database with same CATH topology
 1J5W A;  3OVU A;  4DV3 T;  4GK5 E;  2W00 A;  5HEG A;  5GON E;  1OWA A;  5LYJ E;  3PJA J;  4U2Y A;  2UXB T;  2LSI A;  3TKL B;  2X66 A;  5AQT B;  2V8S V;  2VB6 A;  2XZE A;  2LM9 A;  2UUA T;  4OK0 A;  3ZYK A;  4EXT A;  5FXV A;  3R84 B;  2XAS B;  5ADX L;  2E2A A;  3ZCI A;  1BR1 A;  4YSX A;  1WYC A;  2VAS A;  2RP4 A;  3LFM A;  4ZZB A;  5EK4 A;  2ODV A;  3NKZ A;  3ZYL A;  3S4U A;  3C51 A;  5KX5 E;  4O4I E;  4NXN T;  3ZEF B;  5AQP B;  3T8O A;  4AKL A;  2UXC T;  4YHJ A;  3NZQ A;  2QRX A;  3KIN B;  2C0S A;  3L3P A;  1D1A A;  2WCA A;  2UU9 T;  4WZX A;  5LBM A;  4DV6 T;  4UIG A;  3ZCJ A;  2WP9 A;  3B5M A;  2W61 A;  3DTO A;  5JDM A;  2KWI B;  3PUG A;  4IST A;  3VR9 A;  4HN9 A;  4CI3 B;  4EAH A;  4P1N A;  4DR7 T;  3SFE A;  5CA1 E;  4YLH A;  4QX7 B;  1UGO A;  4UVB B;  3B57 A;  3OYX A;  4LFB T;  4YSZ A;  2I59 A;  2FJB A;  1ZP0 A;  4COF A;  2PTF A;  4U31 A;  3EDV A;  2XAQ B;  3CX7 B;  3RLF F;  3MZK B;  4HFC A;  1KNR A;  2KLQ A;  2J1D G;  5HXH A;  3BK9 A;  4DR1 T;  4YJ3 E;  4GIW A;  3RKG A;  1YKE B;  2VUR A;  4X66 T;  2V6X A;  2X68 A;  1WCR A;  4LF8 T;  3FBZ A;  3IA3 A;  5EK2 A;  2NTX A;  5KXJ A;  5LOV E;  5AQN B;  4PW8 A;  3Q5X A;  2X0Y A;  4HFD A;  3C50 A;  1D0X A;  2NW9 A;  2N9D A;  3JC6 D;  3HA4 A;  2OV9 A;  2CXD A;  1UK5 A;  4EEB A;  3QC9 A;  5HEJ A;  2YU2 A;  1XZY A;  3EDU A;  4YTN A;  4X5T A;  5HXS A;  1W09 A;  4ANJ A;  3V5U A;  3DP7 A;  4H9N C;  4LF5 T;  2Z6E A;  4U72 A;  2V7L A;  3SRZ A;  4NUV A;  3P7I A;  4PFO A;  4JUY A;  3QNU A;  2J4G A;  3I0Q A;  2X9H A;  1WYB A;  2XY8 B;  4GK0 E;  1MIV A;  2XUE A;  3CX8 B;  3RIF A;  2UXN B;  2XQ4 A;  4IE7 A;  3JCF A;  4L5G A;  5L3E B;  2XSB A;  4YHH T;  1US7 B;  3RC8 A;  1XMQ T;  4Z91 A;  4DR5 T;  1T7S A;  2DI4 A;  4H9O C;  2X51 A;  1XWM A;  2NP9 A;  3C4Z A;  3UU4 A;  4QH4 A;  3U78 A;  2MOZ A;  3EAM A;  2HN1 A;  4EED A;  4DBQ A;  4EYY R;  3SOL A;  2XAF B;  3RF1 A;  2DHR A;  2Q9Q A;  3RRW A;  3AAE B;  5CB4 E;  3QK6 A;  1T72 A;  4IIJ E;  4HFB A;  3N2G E;  2NR4 A;  3L09 A;  1T98 A;  4I43 B;  4I50 E;  1FMV A;  2CPT A;  2LSG A;  5DQV A;  1ZHC A;  3CWZ B;  2WZH A;  3TLT A;  1DU2 A;  3OKQ A;  3QB5 K;  3W15 B;  4E7S A;  2BKO A;  4H9P C;  2QA7 A;  3K3Q C;  2W63 A;  1MNE A;  1OED E;  3E0Z A;  4FJO A;  2QVA A;  2FUP A;  2LEH A;  4YTP A;  5L3C B;  4Z8X A;  4DND A;  4PNI A;  2E5L T;  5JRE A;  2LLY A;  5AQR B;  2CEA A;  3MXZ A;  2V7K A;  1IJ5 A;  4HFI A;  4AKI A;  3BQL A;  4H9S E;  3ZST A;  4OX9 T;  3I1A A;  5HWY A;  5L4H A;  2W0G A;  2BG9 B;  3OTO T;  3VR8 A;  4UVA B;  2ODU A;  3UFG A;  4TX5 A;  4U7Y A;  4NUU A;  1HS7 A;  5KDM C;  3FZL B;  4IDN A;  4LF6 T;  3HI2 A;  3ANW B;  4J2C A;  2KMF A;  2YIN A;  2XQA A;  4G63 A;  4X1Y E;  3PUZ F;  3TLV A;  3D0T A;  2CBI A;  3A7M A;  5BR8 T;  5HEH A;  4ZI2 C;  4QXB B;  5LJN A;  4HKA A;  3ZMZ B;  3GWH A;  4HWI B;  2X9Y A;  2IML A;  3IBP A;  4YJ2 E;  5JRC B;  2ZM0 A;  1VRB A;  2BG9 A;  4L0R A;  4H63 V;  3NWI A;  3Q5W A;  3ZT6 A;  5AQK B;  2E9X B;  1SUM B;  4CXY A;  5J0Z A;  1J1J A;  3ZMV B;  4L9I A;  2H89 A;  3UU6 A;  5HCM A;  3ANW A;  4EYU A;  2VQF T;  5F5W A;  5F3J A;  1OED B;  5H6Q B;  4DV7 T;  4EIW A;  5ABF B;  5HYA A;  5CFB A;  3NZP A;  2WDQ A;  3HL6 A;  2EHO C;  4HTE A;  2FJE A;  2CLY C;  4M1P A;  3RKO A;  2XM2 A;  4YFS A;  1SA0 E;  4O8S A;  4IDQ A;  4JI8 T;  4IHJ E;  1L0V A;  5JRC A;  2XPK A;  2M67 A;  5JDQ A;  2E9X A;  5J1G A;  3KBU A;  3RGL A;  5LGN B;  2EHO D;  3UQ4 A;  3EUH A;  2C5I T;  4O2A E;  4IRE A;  1AJ3 A;  4XZC A;  2X0L B;  2XQ6 A;  2VVS A;  4MLK A;  4FI5 A;  1FEW A;  3F31 A;  3ZN0 B;  3FZM B;  5FXX A;  2CXL A;  1IZN B;  4PJM A;  2LHN A;  3PUS A;  5L3B B;  2UXD T;  1HFA A;  4QHO A;  2DL1 A;  5EK3 A;  4C90 A;  2BBH A;  2WZI A;  2V7J A;  1Y64 B;  2LKG A;  3HKB E;  5L3F B;  3SWH A;  3PU3 A;  3AXJ B;  4O4H E;  3H3M A;  4I0U A;  3HKE E;  4KUM B;  5TAO A;  1UCU A;  4EB6 E;  3AEB A;  1M7K A;  2H7O A;  3C64 A;  1YQ4 A;  4OHF A;  3FZK B;  2E8I A;  3AEE A;  3O1I A;  2W62 A;  3ZMS B;  1Y01 A;  4GKJ T;  3RYC E;  1OED C;  5LXT E;  2WB5 A;  4QXH B;  2KSR A;  2LSK A;  4P0A A;  5LGT B;  3PUR A;  3TLW A;  2X67 A;  5LNK A;  2D5U A;  2OA5 A;  4KP3 C;  2JPF A;  5LG4 A;  4U3C A;  2V5C A;  4U2Z A;  2UUB T;  3JAF A;  1YQ3 A;  4Q25 A;  3LK4 2;  2VKO A;  3K3O A;  2YDQ A;  2XQ5 A;  3FXD B;  1VCS A;  3AEG A;  4WBO A;  3KDS E;  3PU8 A;  3ZSS A;  3AE7 A;  2LOP A;  1CHU A;  2WMO A;  5F8P A;  2BKP A;  2VKJ A;  3UU5 A;  1E7P A;  3EHZ A;  1G73 A;  3KVA A;  4TNW A;  3MKD A;  4LFA T;  5FXZ A;  2BS2 A;  4HWF A;  4CXW A;  2KXP B;  2NW8 A;  4H63 H;  1OXZ A;  4X1I E;  3AE6 A;  4P0B A;  4AQF C;  4DID B;  3P4W A;  3FZF B;  2WMN A;  2LM2 A;  2XHE B;  3AA1 B;  5DJQ C;  1MMD A;  2WWU A;  3ZJ1 A;  1LKX A;  4UEM A;  4ILC A;  2RA1 A;  1JNR A;  5AFU L;  5FXW A;  5AQO B;  1WRD A;  3WAJ A;  3J9X 1;  4CXX A;  3LJC A;  1XDP A;  2DWG A;  2WU2 A;  3UFE A;  3R6N A;  2CMR A;  2D0T A;  2ZM8 A;  2VVN A;  1IJ6 A;  3EVY A;  4TWH A;  5HXR A;  3ZPO A;  4ZS3 A;  3UUM A;  2IIU A;  2V6Y B;  5FVL A;  1BR0 A;  2YKS A;  4CN1 A;  3F57 A;  1KNZ A;  3FZH B;  3LSV A;  2VKH A;  1N33 T;  3ZC1 A;  3CVR A;  4BJN A;  2BS3 A;  3B13 A;  4KBM B;  1VCT A;  3RX6 A;  4IDO A;  3N9P A;  3ZKR A;  3ESL A;  4UV9 B;  2XTL A;  4OFZ A;  3UT5 E;  1MND A;  2XAJ B;  4JYA T;  2K48 A;  4DUY T;  4ZOL E;  4ILA A;  2BS4 A;  3ONJ A;  4X20 E;  3K8P C;  3QB5 A;  4B6X A;  2C5J A;  1B7T A;  4B3R T;  3CK6 A;  5FP3 A;  1KEY A;  4PJJ A;  4PK4 A;  3MAC A;  4LFC T;  3V5S A;  3OBV E;  2K3W A;  2AXD S;  3N5L A;  2V6Y A;  5AQM B;  4CZZ B;  4IE5 A;  1Z8U A;  4F8H A;  3CQX C;  1ZEE A;  2J62 A;  4JI2 T;  4JI1 T;  3G06 A;  3CX6 B;  5HCJ A;  5JTG A;  5LJM A;  2XAH B;  2VQE T;  4JI6 T;  4K0K T;  3RIU A;  5IUX A;  4JV5 T;  1HF8 A;  1I94 T;  2IW5 B;  2WDV A;  1ZOY A;  5JR9 C;  4LF4 T;  2PFV A;  2XQ3 A;  1GQE A;  1KNP A;  2CCQ A;  2KND A;  3FB2 A;  2WU5 A;  2W4X A;  5LBQ B;  5AQI B;  2PG8 A;  4PK5 A;  3F2E A;  1NEN A;  5JDH A;  2JQ9 A;  3N9Q A;  1HX8 A;  4B3T T;  4IDZ A;  4IGU A;  2W2U A;  5CA0 E;  4ZXL A;  5FMN A;  4DVD A;  2K5B B;  3K3N A;  3N9M A;  4XAX B;  4IT4 A;  3C4W A;  1YXR A;  5C8Y E;  1BR4 A;  4GYR A;  2A9U A;  1NAF A;  4A56 A;  3DJB A;  4B3M T;  4PFP A;  4KMC A;  3CQC B;  4H9R C;  5FY0 A;  3NRY A;  3A5X A;  4KX6 A;  2IC9 A;  4NXM T;  4QH1 A;  5HXC A;  1MMA A;  4O4J E;  2EHO B;  2NW7 A;  4AKG A;  1Z0P A;  5FVK A;  3O9X A;  2LE8 A;  1JNZ A;  1IBL T;  3VKH A;  3O4X E;  3HR0 A;  3IHR A;  4IE6 A;  1BR2 A;  3U3I A;  2DNX A;  3AA7 B;  3M3Z B;  2CLY B;  4DMV A;  2H88 A;  5DQW A;  2KZ7 B;  4A98 A;  5FY7 A;  4UEL A;  1UX5 A;  2JMH A;  4DV2 T;  3LBX B;  4EGW A;  2MYS A;  5FL1 A;  3I0O A;  5AQJ B;  3ONX A;  2K24 A;  3FBL A;  1S35 A;  2H3R A;  4Z90 A;  2CXF A;  3UUL A;  2JQH A;  5JDF A;  2L9Q A;  2VWA A;  3RQU A;  2XQ8 A;  3N9L A;  3I9Y A;  2DCF A;  2BKN A;  1MMN A;  5BMV E;  1MIY A;  3VKG A;  2MAW A;  5AQF B;  2I0M A;  5AQQ B;  1HNZ T;  1NWM X;  5L3D B;  2X0H A;  2LJL A;  5AQU B;  2MTQ A;  2HPJ A;  2JQQ A;  5LHI B;  3L8R A;  3AA0 B;  4HEA A;  4ERR A;  2C5K T;  4BA9 A;  4DMW A;  5JDL A;  5L3G B;  1IAP A;  5LHH B;  2D9D A;  4OYJ A;  2CM0 A;  2B1E A;  2Y6X A;  4JI3 T;  4ZI2 D;  5ABH A;  4WW0 A;  3TLS A;  1QUU A;  5KMG P;  3LK2 B;  4TWD A;  5FYM A;  4AIS A;  3ZT7 A;  4YSY A;  2V26 A;  4UR9 A;  4F6R C;  1FIO A;  3C98 B;  3RPU A;  1XDO A;  3KFW X;  1X79 A;  4HFV A;  4LMK A;  3PUW F;  4DR6 T;  1LVF A;  1ZV4 X;  3VU7 H;  3RQW A;  2CA5 A;  1LRZ A;  2XJ7 A;  3AE2 A;  2E5V A;  2L8K A;  3AE1 A;  3RHW A;  3MK7 C;  2XAG B;  3IF8 B;  4JEU B;  5IWA T;  4DV5 T;  2AE9 A;  1OED A;  5ABF A;  2A3D A;  2L3L A;  4CQI A;  3AAI A;  4ILU A;  4HE8 A;  4LF7 T;  5JVD E;  3ZJ2 A;  4CI2 B;  4HGA A;  1G8X A;  2UUC T;  3O1J A;  3IEE A;  1FJG T;  3PUA A;  2LRL A;  5FNV E;  3AVS A;  4DR2 T;  5JH7 E;  3E08 A;  3UUX B;  4MAL A;  1E2A A;  3RYI E;  3PE0 A;  2CBJ A;  1QLB A;  1HNW T;  2V5D A;  3LDQ B;  2KIN B;  2CHO A;  3N2K E;  1HCI A;  1SHZ C;  2ACZ A;  2G0U A;  1W0B A;  2KWH A;  1D1B A;  3WAK A;  1S94 A;  4QWN B;  3UU3 A;  2A2F X;  5FY1 A;  3PTR B;  5DAB A;  5IHY A;  4NIQ A;  4PJL A;  3T1Y T;  2NTY A;  2FBW A;  4IE4 A;  3OYZ A;  4TV9 E;  3VRB A;  1IBK T;  4AQF A;  5A1L A;  3AED A;  1M62 A;  3AXJ A;  4TV8 E;  2W66 A;  2I6H A;  4CI1 B;  3HKD E;  2XSA A;  1O3X A;  1U5P A;  3H37 A;  3K1S A;  3ZMT B;  2IAK A;  2UXX B;  3ETU A;  3QUJ A;  4YY3 T;  3AEF A;  2J47 A;  3KVB A;  5HAX A;  1UUR A;  3WI3 A;  4KI0 F;  3PV0 F;  1YW0 A;  4I55 E;  2NOX A;  5HXE A;  4E7Z A;  2QYW A;  4AXP A;  3UUN A;  2XM1 A;  2ZM6 T;  5ABE A;  4ZEY A;  2N1G A;  1HNX T;  1D1C A;  3HKC E;  4TZ4 C;  3AE9 A;  3NBX X;  5LHG B;  3O1H A;  2KT9 A;  2XQ7 A;  1N36 T;  2CE7 A;  4A5X A;  3N2O A;  2D0U A;  3P4Q A;  3FHN A;  4IE0 A;  4ZS2 A;  5LA6 E;  3PUX F;  4X62 T;  4ADZ A;  3VHL A;  3Q2M A;  4JLE A;  3P4P A;  5LG3 A;  4IL9 A;  4WYV A;  1J5E T;  5JR9 B;  3RH3 A;  3CPZ A;  3CQG B;  2GK9 A;  1KFY A;  3Q5D A;  1U4Q A;  2WWV A;  3A8Y C;  3CKD A;  5LB7 B;  3JC6 C;  3VRA A;  3GA8 A;  1KF6 A;  4O4L E;  1H7C A;  3KV5 A;  2X9W A;  4OYK A;  1D0Y A;  4EZH A;  2YEV C;  4JBW F;  5EZY E;  2JQK A;  4LML A;  4KHP T;  3UU8 A;  4A97 A;  2BVM A;  2VL0 A;  2LSJ A;  2QGS A;  4UXN B;  3Q9D A;  4B3S T;  1X9B A;  4AKH A;  3ZT5 A;  4DBR A;  4GKK T;  4AQY T;  4JI7 T;  2W67 A;  2VK9 A;  3ZC0 A;  2R6G F;  2V1D B;  5JR9 A;  2CWO A;  4ASK A;  2ZMA A;  2PJQ A;  4GYS A;  3NRX A;  3KV4 A;  3AE5 A;  3OPC A;  4ZHQ E;  2ACX A;  2Q9Q B;  5C2T A;  4G2A A;  4EOZ B;  5LGU B;  2JMK A;  3EI0 A;  4LMJ A;  2IUB A;  4C91 A;  2WQY A;  2BG9 E;  2WS3 A;  1SE7 A;  3P8C D;  1W9R A;  4DO0 A;  3PUY F;  2B76 A;  3UTK A;  5ETW A;  4TUY E;  4ISS A;  4X64 T;  1HR0 T;  4DUZ T;  2IDO B;  2XQY A;  2IC6 A;  2IHR 1;  2LOS A;  4AKR B;  2M6B A;  3AE8 A;  4TNV A;  5JDN A;  3TLU A;  1HTJ F;  3ZYM A;  2ZLY A;  3RYF E;  1HG2 A;  2M6I A;  2BVL A;  2LSY A;  4ILB A;  4PJN A;  3SS1 A;  3RRC A;  4DV0 T;  4ZI7 E;  3RI5 A;  4NPP A;  1XNQ T;  4V1A v;  3P50 A;  3RIA A;  1LVK A;  5LMN T;  2HH7 A;  4DV4 T;  3ZLI A;  4IL4 A;  2SPC A;  4AI6 A;  4JI4 T;  4LF9 T;  2ES0 A;  3RIU C;  3E22 E;  5LP6 E;  2XQ9 A;  3L39 A;  3BQI A;  2FJD A;  2PBI A;  3GMI A;  4X65 T;  3M65 A;  3AAA B;  1D0Z A;  2JIW A;  2Q9Q C;  2V7I A;  2YN6 A;  5CGM A;  2V7M A;  2K9A A;  3CIR A;  2Y48 B;  3FXE B;  2NWB A;  5FL0 A;  1QSD A;  4YTM A;  4EZ4 A;  1MMG A;  2YK0 A;  3KBT A;  3PUQ A;  4UV8 B;  4YXD A;  1N32 T;  2FJA A;  3AE4 A;  1R8I A;  5JQG E;  4N78 D;  4JI5 T;  3Q5E A;  1YD8 G;  2CWY A;  2VL8 A;  2WAU A;  2YOE A;  4P09 A;  5AQL B;  4PK6 A;  2Q9Q D;  3OJA A;  4QXC B;  5HEU A;  3LG7 A;  4ZZC A;  4ZI3 C;  3RYH E;  4UF0 B;  4HWH A;  2EHO A;  1I6Z A;  2LRK A;  2BDE A;  4HFE A;  1V9D A;  3QOF A;  3AEA A;  4UVC B;  2DWK A;  2WY2 A;  3GN5 B;  2BBJ A;  3C4X A;  5L2L A;  3RC3 A;  4DR3 T;  1XMO T;  4DR4 T;  3N9N A;  2OLT A;  3LK3 B;  5HEO A;  3P4S A;  1ZKE A;  1E1H B;  1FMW A;  3LBX A;  4U74 A;  4HWC A;  1MIW A;  2YDS A;  4ZI3 D;  4AQG A;  5IYZ E;  2YU1 A;  2F4V T;  3J7Y q;  4TWF A;  3PDY A;  4GOU A;  2D2S A;  4TN7 B;  4X1K E;  5J2U E;  5AQG B;  5L47 A;  2MBG A;  1UX4 A;  2X9X A;  5LCY A;  1VOM A;  4MBQ A;  1IBM T;  3ZN1 B;  4UF0 A;  2WSS V;  4MFR A;  4MHC A;  3KV6 A;  3I9W A;  4I4T E;  4BAY B;  5H6R B;  4CN4 A;  5E0O A;  4HWD A;  2YDR A;  2JJ9 A;  2LT3 A;  5ABG A;  3AA6 B;  2ZM2 A;  4WNK A;  3PJA A;  2CHN A;  2LHR A;  3KV9 A;  3GN5 A;  2BG9 C;  4JI0 T;  2MPK A;  2Y8D A;  3ETV A;  1KK7 A;  3UQ7 A;  5L4E A;  3CML A;  5AQH B;  1EZ3 A;  3MA9 A;  4O2B E;  1W0A A;  4U7I A;  2HN2 A;  2WDR A;  3SFD A;  2JRK A;  2BZB A;  4HFH A;  4QH5 A;  4XBF B;  5JDG A;  3PUV F;  3N9O A;  5CJ5 A;  1WLX A;  4PAG A;  2HPL A;  3JAD A;  3AEC A;  4K0U A;  2A72 A;  3NVO A;  5AQS B;  1UUS A;  1HX1 B;  5AQV B;  5FKY A;  3H3A A;  1N34 T;  4WBN E;  5LMU T;  4KHZ F;  4AIU A;  3AB3 B;  4EV6 A;  2CRB A;  4IDP A;  2N2N A;  2VKD A;  3AVR A;  3UUB A;  4CN6 A;  4DV1 T;  2HHH T;  1CUN A;  4BJM A;  3ZMU B;  3EAB A;  3ONL C;  5C3J A;  1WR6 A;  4U33 A;  2E9X C;  2RPA A;  3X1D A;  3T1H T;  5J2T E;  1HG5 A;  3BQK A;  2LKH A;  4YT0 A;  1XNR T;  4H9Q C;  5M4Y A;  1WFD A;  3MJX A;  2DLR A;  2WBL A;  2P9B A;  4QX8 B;  5HWX A;  4JEH B;  3AE3 A;  1YKH B;  4QKN A;  1T8B A;  1NEK A;  3ABV A;  3P4R A;  2H7V C;  1WR0 A;  3JAE A;  2WM9 A;  2E9X D; 
#chains in the Genus database with same CATH homology
 1NAF A;  4A56 A;  3DJB A;  4GK5 E;  4PFP A;  4KMC A;  3NZP A;  2W00 A;  5GON E;  3CQC B;  1OWA A;  2BVM A;  3HL6 A;  4H9R C;  2EHO C;  2LSJ A;  2QGS A;  4HTE A;  4UXN B;  3Q9D A;  4AKH A;  5FY0 A;  5LYJ E;  4DBR A;  3NRY A;  3A5X A;  2IC9 A;  5HXC A;  2LSI A;  2CLY C;  3TKL B;  2VK9 A;  1MMA A;  2X66 A;  4O4J E;  4M1P A;  2EHO B;  2NW7 A;  3RKO A;  2VB6 A;  3ZC0 A;  2LM9 A;  4AKG A;  1Z0P A;  4OK0 A;  3O9X A;  4YFS A;  2LE8 A;  1SA0 E;  4O8S A;  3ZYK A;  3VKH A;  2V1D B;  4EXT A;  3O4X E;  5JR9 A;  5FXV A;  2CWO A;  4IHJ E;  3R84 B;  3HR0 A;  3IHR A;  4IE6 A;  1BR2 A;  2XAS B;  4ASK A;  5JRC A;  3U3I A;  5ADX L;  3ZCI A;  2DNX A;  2ZMA A;  1BR1 A;  3AA7 B;  2PJQ A;  4GYS A;  2CLY B;  3NRX A;  3KV4 A;  1WYC A;  2VAS A;  4DMV A;  2M67 A;  2RP4 A;  5JDQ A;  4ZHQ E;  3LFM A;  2E9X A;  5J1G A;  5DQW A;  2KZ7 B;  5EK4 A;  2ACX A;  2ODV A;  2Q9Q B;  5FY7 A;  3S4U A;  3ZYL A;  4UEL A;  5LGU B;  3C51 A;  4G2A A;  4EOZ B;  5KX5 E;  1UX5 A;  2JMK A;  4O4I E;  3KBU A;  3ZEF B;  3T8O A;  2JMH A;  4AKL A;  5LGN B;  4C91 A;  2EHO D;  4YHJ A;  3NZQ A;  3EUH A;  3LBX B;  2C5I T;  3KIN B;  4O2A E;  2C0S A;  3L3P A;  1D1A A;  2MYS A;  1AJ3 A;  3I0O A;  3ONX A;  3P8C D;  4XZC A;  2K24 A;  2X0L B;  3FBL A;  4DO0 A;  1S35 A;  2H3R A;  5LBM A;  2CXF A;  3UUL A;  4MLK A;  4FI5 A;  4UIG A;  3ZCJ A;  1FEW A;  5JDF A;  3F31 A;  2W61 A;  3UTK A;  5ETW A;  3ZN0 B;  2L9Q A;  3DTO A;  4TUY E;  5JDM A;  2VWA A;  4ISS A;  5FXX A;  2CXL A;  1IZN B;  2KWI B;  4PJM A;  2LHN A;  3PUS A;  3N9L A;  3PUG A;  4IST A;  5L3B B;  3I9Y A;  2DCF A;  4HN9 A;  1HFA A;  4QHO A;  1MMN A;  4CI3 B;  5EK3 A;  5BMV E;  1MIY A;  4C90 A;  4EAH A;  3VKG A;  2V7J A;  5CA1 E;  1Y64 B;  3HKB E;  5L3F B;  3SWH A;  3PU3 A;  4YLH A;  4QX7 B;  2XQY A;  4O4H E;  4UVB B;  3B57 A;  1NWM X;  2IC6 A;  5L3D B;  3HKE E;  4KUM B;  2LOS A;  5TAO A;  3OYX A;  4AKR B;  1UCU A;  2I59 A;  2LJL A;  4EB6 E;  2MTQ A;  2HPJ A;  2JQQ A;  5LHI B;  3AA0 B;  4HEA A;  2H7O A;  5JDN A;  4ERR A;  1HTJ F;  3C64 A;  3ZYM A;  4OHF A;  3EDV A;  2E8I A;  2XAQ B;  3O1I A;  2C5K T;  2W62 A;  4BA9 A;  3CX7 B;  2ZLY A;  3ZMS B;  4DMW A;  3RYF E;  1HG2 A;  5JDL A;  5L3G B;  1IAP A;  3MZK B;  2BVL A;  2LSY A;  3RYC E;  2KLQ A;  4PJN A;  3SS1 A;  5LXT E;  3RRC A;  5LHH B;  4OYJ A;  4QXH B;  4ZI7 E;  2J1D G;  5HXH A;  3BK9 A;  2CM0 A;  2B1E A;  2Y6X A;  4YJ3 E;  2LSK A;  4GIW A;  4P0A A;  4ZI2 D;  5LGT B;  3PUR A;  1YKE B;  4WW0 A;  2X67 A;  4V1A v;  1QUU A;  5KMG P;  5LNK A;  1LVK A;  3LK2 B;  2D5U A;  2OA5 A;  2HH7 A;  5FYM A;  3ZLI A;  2X68 A;  2SPC A;  4KP3 C;  4AI6 A;  2JPF A;  2ES0 A;  3FBZ A;  5LG4 A;  3E22 E;  5EK2 A;  2V26 A;  2NTX A;  4F6R C;  5LP6 E;  1FIO A;  3C98 B;  5LOV E;  3RPU A;  4PW8 A;  3KFW X;  3Q5X A;  1X79 A;  4HFV A;  3LK4 2;  3BQI A;  2VKO A;  2PBI A;  3GMI A;  3M65 A;  3K3O A;  3C50 A;  1LVF A;  1D0X A;  2NW9 A;  3AAA B;  1D0Z A;  1ZV4 X;  2N9D A;  3JC6 D;  3HA4 A;  2CXD A;  2Q9Q C;  3FXD B;  3VU7 H;  2V7I A;  2V7M A;  2CA5 A;  3QC9 A;  4WBO A;  2YU2 A;  3KDS E;  2K9A A;  1LRZ A;  3PU8 A;  2Y48 B;  3FXE B;  2NWB A;  3EDU A;  2L8K A;  1QSD A;  2LOP A;  4EZ4 A;  2WMO A;  5HXS A;  1MMG A;  5F8P A;  4ANJ A;  3V5U A;  3DP7 A;  2VKJ A;  4H9N C;  2YK0 A;  2Z6E A;  4U72 A;  3KBT A;  2V7L A;  3PUQ A;  3SRZ A;  4UV8 B;  4NUV A;  1G73 A;  3KVA A;  3P7I A;  4PFO A;  3MK7 C;  4JUY A;  2XAG B;  3MKD A;  3IF8 B;  4JEU B;  3I0Q A;  5FXZ A;  2X9H A;  4CXW A;  2KXP B;  5JQG E;  1WYB A;  2NW8 A;  4N78 D;  4H63 H;  1OXZ A;  1YD8 G;  2CWY A;  2A3D A;  2VL8 A;  2WAU A;  4X1I E;  4P09 A;  4P0B A;  4AQF C;  4GK0 E;  4PK6 A;  1MIV A;  2XUE A;  3CX8 B;  2L3L A;  2Q9Q D;  4CQI A;  3AAI A;  3OJA A;  4QXC B;  2UXN B;  4ILU A;  4IE7 A;  2WMN A;  4HE8 A;  5JVD E;  3LG7 A;  4L5G A;  5L3E B;  3ZJ2 A;  4CI2 B;  1US7 B;  2XHE B;  4HGA A;  4ZI3 C;  3RYH E;  3RC8 A;  3AA1 B;  5DJQ C;  1G8X A;  4UF0 B;  1MMD A;  2WWU A;  3O1J A;  3IEE A;  3ZJ1 A;  1LKX A;  2EHO A;  4UEM A;  2DI4 A;  3PUA A;  4H9O C;  2X51 A;  2RA1 A;  5FNV E;  3AVS A;  5AFU L;  2NP9 A;  3C4Z A;  5JH7 E;  3U78 A;  2BDE A;  3E08 A;  3UUX B;  5FXW A;  1V9D A;  4MAL A;  2MOZ A;  3RYI E;  4UVC B;  2DWK A;  4DBQ A;  3PE0 A;  3GN5 B;  4EYY R;  1WRD A;  3SOL A;  3WAJ A;  2XAF B;  3J9X 1;  4CXX A;  2DHR A;  3LJC A;  3C4X A;  2Q9Q A;  5L2L A;  3RC3 A;  5CB4 E;  3AAE B;  3RRW A;  3QK6 A;  2DWG A;  2KIN B;  3N2K E;  3UFE A;  3N9N A;  1HCI A;  3LK3 B;  3R6N A;  1SHZ C;  2CMR A;  2D0T A;  2ZM8 A;  2G0U A;  1ZKE A;  4IIJ E;  1E1H B;  1FMW A;  1IJ6 A;  3LBX A;  4U74 A;  3EVY A;  3N2G E;  5HXR A;  2KWH A;  1MIW A;  3L09 A;  1D1B A;  1T98 A;  4I50 E;  4I43 B;  3WAK A;  4ZI3 D;  1FMV A;  3ZPO A;  4AQG A;  5IYZ E;  4ZS3 A;  1S94 A;  3UUM A;  4QWN B;  2LSG A;  2A2F X;  2YU1 A;  5FY1 A;  5DQV A;  1ZHC A;  3J7Y q;  3CWZ B;  1BR0 A;  3PTR B;  5DAB A;  3PDY A;  1KNZ A;  3F57 A;  4GOU A;  2D2S A;  4TN7 B;  5IHY A;  2VKH A;  4X1K E;  4PJL A;  3ZC1 A;  5J2U E;  3CVR A;  2NTY A;  3OKQ A;  3W15 B;  4IE4 A;  3OYZ A;  4BJN A;  4E7S A;  4TV9 E;  2MBG A;  4H9P C;  3B13 A;  1UX4 A;  2QA7 A;  2X9X A;  4KBM B;  5LCY A;  3K3Q C;  3RX6 A;  1VOM A;  4MBQ A;  2W63 A;  4AQF A;  5A1L A;  3ZN1 B;  1MNE A;  3E0Z A;  4FJO A;  2WSS V;  4MFR A;  4MHC A;  4UF0 A;  4TV8 E;  3KV6 A;  3N9P A;  3I9W A;  4I4T E;  4BAY B;  2LEH A;  4CI1 B;  5L3C B;  3ESL A;  4UV9 B;  5H6R B;  2XTL A;  5E0O A;  4Z8X A;  4DND A;  4PNI A;  4OFZ A;  3UT5 E;  5JRE A;  2JJ9 A;  2LT3 A;  3AA6 B;  2CEA A;  2ZM2 A;  3HKD E;  3MXZ A;  4WNK A;  1MND A;  2V7K A;  1IJ5 A;  2XAJ B;  2LHR A;  1O3X A;  1U5P A;  3H37 A;  3KV9 A;  4AKI A;  3BQL A;  3GN5 A;  2K48 A;  4H9S E;  4ZOL E;  3ZMT B;  2IAK A;  3I1A A;  2UXX B;  2Y8D A;  5HWY A;  4X20 E;  3ETV A;  3ETU A;  3K8P C;  1KK7 A;  3QUJ A;  4B6X A;  2C5J A;  2W0G A;  3CML A;  1B7T A;  3KVB A;  5HAX A;  5FP3 A;  4PJJ A;  3WI3 A;  4UVA B;  4PK4 A;  3MAC A;  1EZ3 A;  2ODU A;  3MA9 A;  1YW0 A;  4I55 E;  4O2B E;  3V5S A;  3OBV E;  2NOX A;  4TX5 A;  5HXE A;  2JRK A;  4NUU A;  2BZB A;  4E7Z A;  3N5L A;  1HS7 A;  5KDM C;  4CZZ B;  4XBF B;  4AXP A;  5JDG A;  3UUN A;  4IE5 A;  3N9O A;  3HI2 A;  1WLX A;  3CQX C;  4PAG A;  1ZEE A;  2HPL A;  3ANW B;  4J2C A;  2N1G A;  4K0U A;  3CX6 B;  1D1C A;  3HKC E;  4TZ4 C;  2A72 A;  5LJM A;  2KMF A;  2XAH B;  2YIN A;  3NBX X;  5LHG B;  3O1H A;  2KT9 A;  3H3A A;  4G63 A;  4WBN E;  2CE7 A;  4X1Y E;  3N2O A;  3D0T A;  2D0U A;  3AB3 B;  3FHN A;  1HF8 A;  2IW5 B;  2N2N A;  2VKD A;  3AVR A;  4IE0 A;  4ZS2 A;  5LA6 E;  1CUN A;  4BJM A;  5JR9 C;  3ZMU B;  4ZI2 C;  2PFV A;  4ADZ A;  4QXB B;  5LJN A;  4HKA A;  3ZMZ B;  3VHL A;  3GWH A;  3Q2M A;  1WR6 A;  2CCQ A;  2KND A;  4JLE A;  5HYA A;  3FB2 A;  2X9Y A;  5LBQ B;  2PG8 A;  3IBP A;  2E9X C;  4YJ2 E;  5JR9 B;  4PK5 A;  5JRC B;  5J2T E;  1HG5 A;  3BQK A;  2ZM0 A;  1VRB A;  3CPZ A;  4L0R A;  3RH3 A;  3CQG B;  3F2E A;  4H63 V;  2GK9 A;  4H9Q C;  5M4Y A;  3Q5W A;  5JDH A;  3MJX A;  2E9X B;  3N9Q A;  2DLR A;  2WBL A;  1HX8 A;  4CXY A;  4IDZ A;  2P9B A;  4QX8 B;  4IGU A;  5HWX A;  1U4Q A;  4JEH B;  3ZMV B;  1YKH B;  4QKN A;  4L9I A;  5CA0 E;  3CKD A;  3JC6 C;  3ANW A;  5FMN A;  4DVD A;  4EYU A;  3GA8 A;  2K5B B;  3K3N A;  3N9M A;  5F3J A;  4XAX B;  4O4L E;  3C4W A;  1H7C A;  3KV5 A;  5H6Q B;  2X9W A;  4OYK A;  2H7V C;  1D0Y A;  4EIW A;  4EZH A;  2YEV C;  5C8Y E;  5EZY E;  1BR4 A;  2WM9 A;  2E9X D;  4GYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...