5M4YA

Crystal structure of the sec3/sso2 complex at 2.20 angstrom resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
177
Chain Sequence
SHMDFVAFMNKINSINANLSRYENIINQIDAQHKDLLTQVSEEQEMELRRSLDDYISQATDLQYQLKADIKDAQRDGLHDSNKQAQAENCRQKFLKLIQDYRIIDSNYKEESKEQAKRQYTIIQPEATDEEVEAAINDVNGQKTALAEVQARHQELLKLEKTMAELTQLFNDMEELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sec3 promotes the initial binary t-SNARE complex assembly and membrane fusion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Structural protein
molecule keywords Protein SSO2
total genus 80
structure length 177
sequence length 193
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2016-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5m4yA00
1FIOA 5LG4A 3C98B 3LG7A 4TX5A 4JEHB 1S94A 1BR0A 4JEUB 2XHEB 5M4YA 2DNXA 1HS7A 1FEWA 1G73A 1EZ3A
chains in the Genus database with same CATH superfamily
3OYZA 1U5PA 2L9QA 4ISSA 5LNKA 4LF6T 1US7B 1HFAA 1HNZT 2ES0A 4H9RC 3E08A 2H3RA 4KBMB 2W00A 4YLHA 1W0AA 4P0BA 5FNVE 2CWYA 1LKXA 5LHIB 4AKIA 3HKCE 3N9QA 4CN1A 4IL9A 5L3GB 5JH7E 1W09A 3RIAA 1UX5A 2EHOC 2KZ7B 1MNDA 4H9OC 4ZI7E 1OEDB 3AA0B 4UF0A 2YEVC 3E0ZA 1ZHCA 1ZV4X 3CQCB 3MZKB 4IE7A 1UGOA 3CVRA 4QXBB 2CCQA 2L3LA 1UURA 2OA5A 4H9SE 3NVOA 3AAIA 2F4VT 3ZSSA 5AQPB 3SFDA 1T72A 4I0UA 2VKJA 4AQGA 5L3FB 5LOVE 1MMAA 3MACA 1B7TA 5EK2A 4HFIA 4IHJE 4EYUA 3AEFA 5J0ZA 4XBFB 2X67A 3FZMB 2D0UA 1W9RA 2EHOD 5JR9A 2WSSV 5LCYA 3ZEFB 2UXCT 4PW8A 4LFCT 3CX6B 2V1DB 1V9DA 2WY2A 3VHLA 5A1LA 2FJAA 2Z6EA 1IBLT 3HI2A 3O1JA 4F8HA 1SUMB 5AQMB 4HKAA 3VKHA 4CXXA 5DQVA 4PK4A 4DV4T 3AEEA 4P09A 4DR4T 2YN6A 2NW9A 2NP9A 4ANJA 1VCTA 4U2ZA 3PUYF 1YXRA 4U3CA 5GONE 3RYCE 4YXDA 3NKZA 1VOMA 5JQGE 5AQFB 4GIWA 3GN5B 3RLFF 5ABFA 2W2UA 3FB2A 4HTEA 2DLRA 2WM9A 5DQWA 2LM9A 1UK5A 3AA7B 3N9MA 5HWYA 3UQ4A 5JTGA 3AE2A 4DV1T 5FY0A 2JQ9A 4YTNA 1I6ZA 3U78A 2WZHA 1XDPA 1D0XA 4HN9A 1QSDA 4NXMT 2M6BA 5EK4A 1WYBA 4DBRA 5IYZE 3WAKA 2RA1A 2OLTA 1WYCA 3CQGB 2VWAA 3FBZA 4O2AE 4PJMA 1L0VA 5HWXA 2V7IA 2VVSA 3LBXB 4HWHA 4ASKA 1MMGA 3CKDA 3LJCA 3KBUA 2MAWA 3QB5A 4HE8A 4WBOA 4B6XA 4KHZF 2IHR1 2WMNA 3PUWF 1Z0PA 2XJ7A 3AEBA 4V1Av 3VU7H 1IBKT 4K0KT 3A5XA 2UXNB 1WR6A 1HX1B 3C4WA 1HCIA 3N5LA 3A7MA 2E9XD 2X9HA 3F31A 4QXHB 2WAUA 2KINB 3AAAB 2W67A 4YTPA 4AQFC 3JAEA 3OVUA 3C98B 4QKNA 2JIWA 4X1KE 5AQHB 5CGMA 2SPCA 2CXFA 4PAGA 5AQLB 3L09A 5L3BB 3TLTA 2YKSA 3P8CD 3L39A 3VR9A 2DL1A 5KMGP 3V5UA 2LKGA 4NPPA 4A98A 4DR3T 4YSXA 4EGWA 4ZI2C 1VCSA 3N9LA 4M1PA 5IHYA 4WW0A 3ZYLA 1XNQT 3ZMSB 3ABVA 4AISA 4ILCA 4IE0A 5FY7A 3MK7C 2E8IA 3ZSTA 1IJ5A 1WLXA 3E22E 4P1NA 5FVLA 4X1IE 5ETWA 2Q9QA 1S94A 4B3RT 5FP3A 5LBMA 5FKYA 4OFZA 2IW5B 4DV5T 2G0UA 2PFVA 2WWVA 5JRCB 3CWZB 4EXTA 4DR5T 2ZMAA 3GA8A 1DU2A 2M6IA 4UVCB 4ZEYA 3AVRA 5KX5E 1ZKEA 2A72A 4TNVA 3BQIA 2NOXA 4ADZA 2LSJA 3FXEB 3K3OA 2DWKA 4MBQA 4UVAB 2YU2A 3RIUC 3C4ZA 1YQ3A 3OPCA 3P4QA 5M4YA 4NXNT 2LE8A 5IUXA 3ONXA 2VB6A 4Q25A 4IDQA 1OXZA 4K0UA 3AAEB 3UUXB 4AKHA 5HEOA 4DUZT 4H9PC 2V8SV 4A5XA 2WP9A 3RC8A 3Q5WA 1ZOYA 1X79A 3CPZA 3DJBA 2K24A 2VURA 5AFUL 4YHHT 2W4XA 4PFPA 3ZT6A 2QRXA 3UFEA 3J7Yq 5LMUT 4IDPA 3PDYA 2CLYB 2YINA 1T98A 2WWUA 2KT9A 3KBTA 4KUMB 3KDSE 3KFWX 4OYKA 4DR2T 2V6XA 2JMKA 1IAPA 2E5VA 3LFMA 3LK2B 4IE5A 4ZI2D 3O9XA 5HEJA 2CBJA 2MPKA 2WDRA 2WQYA 4JI4T 5JDHA 2BKNA 2CHOA 4LF7T 1IZNB 1D0YA 2C5IT 2XZEA 3AE9A 1N32T 4AKGA 4JYAT 2A2FX 3SOLA 5F5WA 3B5MA 5FYMA 4ZI3D 5L4HA 4CN4A 4ZZBA 1MMNA 3UT5E 2QVAA 2LRKA 3I9YA 3OJAA 2LSIA 2YDQA 4IDZA 2HPJA 2JQHA 4N78D 1HNXT 4OX9T 1N33T 2FJBA 2KWHA 1YD8G 5KDMC 1WCRA 2K48A 2WU2A 4Z90A 2EHOA 5HXSA 5L47A 2B76A 3EABA 3AVSA 4PJJA 4EEBA 2XQ8A 2YDSA 4IDOA 4LFBT 5HYAA 1LRZA 2NW7A 4CZZB 2MOZA 2DNXA 3KV5A 4JI3T 4UEMA 5H6QB 5LP6E 2K9AA 2UXDT 1BR2A 1HX8A 2I0MA 3AA6B 3ZC1A 2CWOA 4EZHA 2BBJA 5HCMA 2LSYA 1HR0T 1Z8UA 4H9QC 3ZLIA 3ZYMA 2X9XA 3IF8B 4EYYR 4ILBA 3P4WA 5AQNB 5FXWA 3W15B 5KXJA 5BMVE 3C4XA 4LF8T 3I1AA 3WAJA 5L2LA 4HEAA 1SE7A 4ZZCA 3FZKB 3UFGA 2YU1A 5LGNB 1UUSA 4GKKT 3AXJA 2ZM2A 3J9X1 5FY1A 3PUVF 1MIYA 4IL4A 5ADXL 3PV0F 5C2TA 4KHPT 5AQUB 3PUSA 3H37A 3LK3B 3AE6A 5HXRA 2CXDA 3P4RA 1OWAA 5AQIB 2CE7A 2XQ4A 2DWGA 2HN1A 3LBXA 1MIVA 2K5BB 3KVBA 3EDVA 3ZN0B 1G73A 2UUBT 3MXZA 2HHHT 4B3MT 4ZS2A 3ZJ1A 4X66T 4EEDA 3VRBA 1XZYA 3PUZF 2X68A 2Y48B 4B3ST 1OEDC 1HNWT 3FXDB 5HEUA 2NTXA 4CXWA 2IC6A 4DMVA 5FL1A 1E2AA 5JDNA 3JCFA 3ZJ2A 4YSYA 3L3PA 2ACXA 1G8XA 5IWAT 4MLKA 4B3TT 2WS3A 3AEDA 2XAFB 4NUUA 1U4QA 4IDNA 4CN6A 2AE9A 3ANWB 2XTLA 4KP3C 2E9XA 1WRDA 2HPLA 2XHEB 3QC9A 3C51A 2CBIA 4LMJA 3P4PA 5JDFA 4I50E 2LM2A 2BKPA 3CIRA 5AQQB 5JDGA 2UUCT 2N1GA 4O4IE 2X66A 4IE6A 3Q5EA 4EZ4A 4QH1A 2BDEA 2KSRA 4Z8XA 2LT3A 3AXJB 5FXVA 3FHNA 1ZP0A 4I43B 5LA6E 2XAQB 5AQGB 2UXXB 4JV5T 1HS7A 3GWHA 4JBWF 5JDQA 1NAFA 4DR7T 5LGTB 4LF5T 3UU8A 2CRBA 5FVKA 3HR0A 5HXHA 5L3CB 1S35A 4HGAA 2IMLA 5L3EB 3EHZA 4UV9B 5C3JA 3ZMVB 2IAKA 4X5TA 2Q9QD 1CHUA 4QX7B 1FMWA 5ABHA 2BBHA 3PU8A 2YOEA 4MALA 2WBLA 3SFEA 4YFSA 4PNIA 4U7YA 3SWHA 3ZKRA 4OYJA 2H7VC 2CHNA 4QXCB 4TUYE 3SS1A 4E7ZA 5JDMA 4DV2T 3T1YT 2XSAA 4AIUA 3PUQA 1KK7A 3T1HT 2WU5A 2VASA 3H3MA 4UIGA 2VKHA 4O4HE 4JUYA 1I94T 3PUXF 1OEDA 4O2BE 1BR0A 1AJ3A 2E9XB 3EDUA 5LXTE 3IA3A 3A8YC 2N9DA 3GN5A 2LJLA 5LG4A 4JI8T 4AKRB 2IIUA 3KV4A 5ABEA 4L9IA 4NIQA 2V7KA 3RYHE 4O4LE 4TWFA 3UULA 4EAHA 3RQWA 5JVDE 3ZT7A 4QX8B 3VKGA 5JR9C 1T7SA 1M62A 4DO0A 5CFBA 3RI5A 5HXEA 3B13A 3GMIA 4UR9A 3V5SA 4DV6T 2MBGA 3RPUA 3UU3A 3RYFE 3LK42 4TWDA 3RIFA 4C91A 1OEDE 5LGUB 2V6YA 3UUBA 2QYWA 4X65T 2YDRA 3RX6A 2H7OA 5CA1E 5HXCA 2JQQA 1J5ET 4H9NC 3AEGA 1SHZC 5HCJA 4ZS3A 2J62A 2JPFA 3O4XE 1XNRT 3T8OA 3K3NA 3QUJA 4HWDA 4JEHB 4QH5A 1CUNA 1X9BA 3NBXX 5F8PA 3EVYA 4GYSA 5LYJE 2ODUA 2VKDA 3PUGA 3RC3A 3OYXA 2CLYC 4X20E 3TLSA 4ILUA 2RP4A 3N9OA 3RH3A 3ZN1B 2L8KA 1Y64B 2XAGB 4GK0E 2JQKA 1NWMX 2XM1A 5AQSB 1E7PA 2LEHA 3Q5DA 4CQIA 5LB7B 3Q9DA 2BS2A 4UF0B 3N9NA 1QUUA 3F2EA 2C5KT 4JI5T 1GQEA 5AQTB 2LRLA 4HFHA 4CI3B 3AE5A 3IEEA 1HG2A 1XDOA 3P50A 2D9DA 4ISTA 3RHWA 4LF9T 5JR9B 5JRCA 2OV9A 2BS4A 1XMOT 4IGUA 2Q9QB 2CM0A 2LOSA 3TLWA 1UCUA 4ZI3C 4UXNB 4U31A 2CA5A 2JJ9A 4PJLA 4OHFA 5LHHB 5JREA 1KNZA 2BVLA 4U2YA 1MIWA 2AXDS 5J2TE 2NTYA 5AQVB 4GKJT 5L3DB 2W63A 2XASB 3CX7B 3UQ7A 3PUAA 2UXBT 2J47A 2X9YA 3ZCIA 2R6GF 3EUHA 4L0RA 2KMFA 2QA7A 1D0ZA 4GYRA 3RRCA 2VL8A 4HFCA 1N36T 4HFDA 3P7IA 3UU6A 4HFEA 1HF8A 4JEUB 3C50A 2XQ5A 3WI3A 2BG9A 2D5UA 2XQ9A 3ZMZB 2VK9A 4JI7T 3AE1A 2X9WA 2MYSA 4TX5A 4L5GA 4LMLA 3CK6A 3M65A 5J1GA 4DV0T 3EI0A 2X0LB 4GOUA 3HL6A 2BVMA 3B57A 2KLQA 5L4EA 1IJ6A 4CXYA 2Q9QC 3KV6A 2PBIA 4CI1B 2C0SA 2FJEA 3FZFB 3ONJA 2ZM0A 3NRXA 1XMQT 3RKGA 2V6YB 4P0AA 3BQLA 3MA9A 2B1EA 2BG9C 3NRYA 4TN7B 3CQXC 3C64A 1KF6A 1W0BA 2M67A 4PFOA 2V7MA 2XAJB 4YSZA 2I6HA 2V7JA 4IE4A 4PK5A 4G2AA 3UU4A 4XAXB 3N2GE 3K8PC 4DUYT 2W62A 5HEHA 3DP7A 4X62T 4J2CA 4U72A 3RRWA 3JADA 2BKOA 4PK6A 4G63A 3AA1B 2XAHB 3BK9A 4WBNE 1FIOA 1KNPA 2I59A 5FXXA 4DNDA 5CA0E 3O1IA 2FBWA 2BS3A 4KI0F 4NUVA 4DV3T 1VRBA 2XY8B 2J4GA 4HFBA 4ILAA 5AQOB 3X1DA 4COFA 1FEWA 3HKDE 2N2NA 4BJMA 3QK6A 3I0OA 5LHGB 2IDOB 2HN2A 2BG9E 3VRAA 1ZEEA 1LVKA 3G06A 4PJNA 3ETVA 4DIDB 2VVNA 4EOZB 3I0QA 4YTMA 1IBMT 3HKEE 3KV9A 1H7CA 5DJQC 2H89A 3JC6D 2H88A 2D2SA 2PJQA 3RIUA 4YT0A 5EK3A 4TWHA 1HG5A 2X0YA 4XZCA 1D1BA 4U7IA 5CB4E 3U3IA 2KNDA 2XQAA 3LDQB 4DR6T 1NENA 3H3AA 2WZIA 2CXLA 2ZM6T 4BAYB 4IT4A 2E5LT 2VL0A 3ETUA 4UV8B 2V5CA 5LBQB 2A3DA 4H63V 1LVFA 3SRZA 4H63H 5DABA 5LG3A 2UUAT 4X1YE 3NZPA 2X0HA 3AE8A 4HWIB 1WFDA 2ODVA 3OBVE 3PU3A 4QWNB 1QLBA 2KWIB 3LSVA 3ZC0A 3PTRB 1J1JA 2C5JA 4DMWA 3HKBE 2FJDA 4CI2B 4DBQA 3TLUA 3N2OA 3QB5K 3OKQA 3JAFA 3KVAA 3JC6C 5TAOA 3TLVA 3ONLC 4FI5A 3ANWA 3KINB 4MHCA 4OK0A 4U33A 5HAXA 3ZT5A 2GK9A 2RPAA 1BR1A 2BZBA 3D0TA 3PJAJ 4TV9E 4HWCA 2FUPA 1JNZA 4U74A 4WNKA 1UX4A 2PTFA 2KXPB 2WMOA 3K3QC 1YKHB 2BG9B 2LKHA 3I9WA 3NZQA 4TZ4C 2WB5A 4UELA 2NR4A 4YHJA 5FMNA 5ABGA 2QGSA 2W61A 3PURA 3RF1A 4DV7T 2XUEA 3BQKA 4JI6T 3AB3B 3PE0A 4MFRA 3UU5A 3ZMTB 3NWIA 4JI1T 3N2KE 3UTKA 5LMNT 2HH7A 3AEAA 1YW0A 2XSBA 3ESLA 1O3XA 2NWBA 3TKLB 3ZYKA 5CJ5A 3O1HA 3PJAA 1YKEB 3RQUA 5C8YE 4DR1T 2CEAA 4ZHQE 3MKDA 2EHOB 4AKLA 2JRKA 3AE4A 4GK5E 4QHOA 1BR4A 3RKOA 4DVDA 2Y8DA 2K3WA 2ACZA 3R84B 4TNWA 2LSGA 4YJ3E 5AQJB 3RYIE 5AQKB 4QH4A 5E0OA 3VR8A 5ABFB 1FMVA 3IHRA 4TV8E 2P9BA 1KEYA 3MJXA 4AQFA 2LHNA 3K1SA 1EZ3A 3Q5XA 2E2AA 4O4JE 4Z91A 3CX8B 1MNEA 3ZPOA 2WDVA 1D1AA 2J1DG 1M7KA 3DTOA 2MTQA 4O8SA 4WZXA 3N9PA 4YY3T 5BR8T 5H6RB 2ZM8A 4ZXLA 3CMLA 3FZLB 2NW8A 1T8BA 5LJMA 2VKOA 5LJNA 1D1CA 2XPKA 4LF4T 5J2UE 3S4UA 3HA4A 4JI0T 1KNRA 1SA0E 2XM2A 4LMKA 4IIJE 5FXZA 4ZOLE 4KX6A 5JDLA 4F6RC 2XQ7A 2VQFT 3RGLA 1XWMA 1R8IA 3FZHB 5EZYE 4E7SA 3LG7A 3AE7A 4YJ2E 3QOFA 2WCAA 2IUBA 3F57A 1E1HB 3R6NA 4WYVA 4X64T 3OTOT 2LSKA 3AECA 2V5DA 5AQRB 2JMHA 2PG8A 3UUNA 4KMCA 4JLEA 4EIWA 4A56A 4I4TE 2W66A 2WDQA 4IREA 3M3ZB 1WR0A 2VQET 2E9XC 1MMDA 2XQ3A 2Y6XA 4FJOA 3ZCJA 3Q2MA 2W0GA 4HWFA 3ZMUB 4C90A 4EB6E 2DI4A 2V26A 2DHRA 1JNRA 1YQ4A 2IC9A 3IBPA 2UU9T 1FJGT 2CPTA 2LHRA 1Y01A 2LLYA 3P4SA 5F3JA 2CMRA 4UVBB 1N34T 2XQYA 2DCFA 3UUMA 1HTJF 3AE3A 3QNUA 4HFVA 4JI2T 4EV6A 4LFAT 2A9UA 2XQ6A 4AXPA 1J5WA 2D0TA 3FBLA 3L8RA 5HEGA 1NEKA 4A97A 2V7LA 5FL0A 4I55E 4BA9A 4AI6A 2X51A 4BJNA 2YK0A 3EAMA 4AQYT 2ZLYA 4ERRA 1KFYA 2LOPA
chains in the Genus database with same CATH topology
3OYZA 1U5PA 2L9QA 4ISSA 5LNKA 1US7B 1HFAA 2ES0A 4H9RC 3E08A 2H3RA 4KBMB 2W00A 4YLHA 4P0BA 5FNVE 2CWYA 1LKXA 5LHIB 4AKIA 3HKCE 3N9QA 5L3GB 5JH7E 1UX5A 2EHOC 2KZ7B 1MNDA 4H9OC 4ZI7E 3AA0B 4UF0A 2YEVC 3E0ZA 1ZHCA 1ZV4X 3CQCB 3MZKB 4IE7A 4QXBB 3CVRA 2CCQA 2L3LA 2OA5A 4H9SE 3AAIA 5L3FB 2VKJA 4AQGA 5LOVE 1MMAA 3MACA 1B7TA 5EK2A 4IHJE 4EYUA 4XBFB 2X67A 2D0UA 2EHOD 5JR9A 2WSSV 5LCYA 3ZEFB 4PW8A 3CX6B 2V1DB 1V9DA 3VHLA 5A1LA 2Z6EA 3HI2A 3O1JA 4HKAA 3VKHA 4CXXA 5DQVA 4PK4A 4P09A 2NW9A 2NP9A 4ANJA 5GONE 3RYCE 1VOMA 5JQGE 4GIWA 3GN5B 3FB2A 4HTEA 2DLRA 2WM9A 5DQWA 2LM9A 3AA7B 3N9MA 5HWYA 5FY0A 3U78A 1D0XA 4HN9A 1QSDA 5EK4A 1WYBA 4DBRA 5IYZE 3WAKA 2RA1A 3CQGB 1WYCA 3FBZA 2VWAA 4PJMA 4O2AE 5HWXA 2V7IA 3LBXB 4ASKA 1MMGA 3CKDA 3LJCA 3KBUA 4HE8A 4WBOA 4B6XA 2WMNA 3VU7H 1Z0PA 4V1Av 3A5XA 2UXNB 1WR6A 3N5LA 3C4WA 1HCIA 4QXHB 2E9XD 2X9HA 3F31A 2WAUA 2KINB 3AAAB 4AQFC 4QKNA 3C98B 4X1KE 5L3BB 2SPCA 2CXFA 4PAGA 3L09A 3P8CD 5KMGP 3V5UA 4ZI2C 3N9LA 4M1PA 5IHYA 4WW0A 3ZYLA 3ZMSB 4IE0A 5FY7A 3MK7C 2E8IA 1IJ5A 1WLXA 3E22E 4X1IE 5ETWA 2Q9QA 1S94A 5FP3A 5LBMA 4OFZA 5JRCB 2G0UA 2PFVA 3CWZB 2ZMAA 3GA8A 4UVCB 3AVRA 5KX5E 1ZKEA 2A72A 3BQIA 2NOXA 4ADZA 2LSJA 3FXEB 3K3OA 2DWKA 4MBQA 4UVAB 2YU2A 4EXTA 3C4ZA 5M4YA 2LE8A 3ONXA 2VB6A 3UUXB 4K0UA 1OXZA 4AKHA 3AAEB 3RC8A 4H9PC 3Q5WA 3DJBA 3CPZA 1X79A 2K24A 5AFUL 4PFPA 3UFEA 3J7Yq 3PDYA 2CLYB 2YINA 1T98A 2WWUA 2KT9A 3KBTA 4KUMB 3KDSE 3KFWX 4OYKA 2JMKA 1IAPA 3LFMA 3LK2B 4IE5A 4ZI2D 3O9XA 5JDHA 1IZNB 1D0YA 2C5IT 4AKGA 2A2FX 3SOLA 5FYMA 1MMNA 3UT5E 3I9YA 3OJAA 2LSIA 4IDZA 2HPJA 4N78D 5KDMC 2KWHA 1YD8G 2K48A 5HXSA 2EHOA 4PJJA 3AVSA 5HYAA 1LRZA 2NW7A 4CZZB 2MOZA 2DNXA 3KV5A 4UEMA 5H6QB 5LP6E 2K9AA 1BR2A 1HX8A 4EZHA 3AA6B 3ZC1A 2CWOA 2LSYA 4H9QC 3ZYMA 3ZLIA 4EYYR 2X9XA 3IF8B 5FXWA 3W15B 5BMVE 3C4XA 3WAJA 3I1AA 5L2LA 4HEAA 2YU1A 5LGNB 2ZM2A 3J9X1 5FY1A 1MIYA 5ADXL 3PUSA 3H37A 3LK3B 5HXRA 2CXDA 1OWAA 2CE7A 2DWGA 3LBXA 1MIVA 2K5BB 3KVBA 3EDVA 3ZN0B 1G73A 3MXZA 4ZS2A 3ZJ1A 2X68A 2Y48B 3FXDB 4DMVA 2NTXA 4CXWA 2IC6A 5JDNA 3ZJ2A 3L3PA 2ACXA 1G8XA 4MLKA 2XAFB 4NUUA 1U4QA 3ANWB 4KP3C 2XTLA 2E9XA 1WRDA 2HPLA 2XHEB 3QC9A 3C51A 5JDFA 5JDGA 4I50E 2N1GA 4O4IE 2X66A 4IE6A 4EZ4A 2BDEA 4Z8XA 2LT3A 5LA6E 5FXVA 3FHNA 4I43B 2XAQB 2UXXB 1HS7A 3GWHA 5JDQA 1NAFA 3HR0A 5HXHA 5L3CB 1S35A 4HGAA 5L3EB 4UV9B 3ZMVB 2IAKA 2Q9QD 4QX7B 1FMWA 3PU8A 4MALA 2WBLA 3SWHA 4YFSA 4PNIA 4OYJA 2H7VC 4TUYE 4QXCB 3SS1A 4E7ZA 3PUQA 1KK7A 2VASA 4UIGA 2VKHA 4O4HE 4JUYA 1BR0A 4O2BE 1AJ3A 2E9XB 3EDUA 5LXTE 2N9DA 3GN5A 2LJLA 5LG4A 4AKRB 3KV4A 4L9IA 2V7KA 3RYHE 4O4LE 4EAHA 3UULA 5JVDE 4QX8B 3VKGA 5JR9C 4DO0A 5HXEA 3B13A 3GMIA 3V5SA 2MBGA 3RPUA 3RYFE 3LK42 4C91A 5LGUB 3RX6A 5CA1E 2H7OA 5HXCA 2JQQA 4H9NC 1SHZC 4ZS3A 2JPFA 3O4XE 3T8OA 3K3NA 3QUJA 4JEHB 5F8PA 1CUNA 3NBXX 5LYJE 3EVYA 4GYSA 2ODUA 2VKDA 3PUGA 3RC3A 3OYXA 2CLYC 4X20E 4ILUA 2RP4A 3N9OA 3RH3A 3ZN1B 2L8KA 1Y64B 2XAGB 4GK0E 4CQIA 1NWMX 2LEHA 3Q9DA 4UF0B 3N9NA 1QUUA 3F2EA 2C5KT 4CI3B 3IEEA 1HG2A 4ISTA 5JRCA 5JR9B 4IGUA 2Q9QB 2CM0A 2LOSA 1UCUA 4ZI3C 4UXNB 5LHHB 2CA5A 2JJ9A 4PJLA 4OHFA 1KNZA 5JREA 2BVLA 1MIWA 5J2TE 2NTYA 5L3DB 2W63A 2XASB 3CX7B 3PUAA 2X9YA 3ZCIA 3EUHA 4L0RA 2KMFA 2QA7A 1D0ZA 4GYRA 3RRCA 2VL8A 3P7IA 1HF8A 4JEUB 3C50A 3WI3A 3ZMZB 2D5UA 2VK9A 2X9WA 2MYSA 4L5GA 3M65A 5J1GA 4GOUA 2X0LB 3HL6A 2BVMA 3B57A 2KLQA 1IJ6A 4CXYA 2Q9QC 3KV6A 2PBIA 4CI1B 2C0SA 4P0AA 2ZM0A 3NRXA 3BQLA 3MA9A 2B1EA 3NRYA 4TN7B 3CQXC 3C64A 4TX5A 4PFOA 2M67A 2V7MA 2XAJB 2V7JA 4IE4A 4PK5A 4G2AA 4XAXB 3N2GE 3K8PC 2W62A 3DP7A 4J2CA 4U72A 3RRWA 4PK6A 4G63A 3AA1B 2XAHB 3BK9A 4WBNE 1FIOA 2I59A 5FXXA 4DNDA 5CA0E 3O1IA 4NUVA 1VRBA 1FEWA 3HKDE 2N2NA 4BJMA 3QK6A 3I0OA 5LHGB 1ZEEA 1LVKA 4PJNA 3ETVA 4EOZB 3I0QA 3HKEE 3KV9A 1H7CA 5DJQC 3JC6D 2D2SA 2PJQA 5EK3A 1HG5A 4XZCA 5CB4E 1D1BA 3U3IA 2KNDA 3H3AA 2CXLA 4BAYB 3ETUA 4UV8B 5LBQB 2A3DA 4H63V 1LVFA 3SRZA 4H63H 5DABA 4X1YE 3NZPA 3OBVE 2ODVA 3PU3A 4QWNB 2KWIB 3ZC0A 3PTRB 2C5JA 4DMWA 3HKBE 4CI2B 4DBQA 3N2OA 5TAOA 3OKQA 3KVAA 3JC6C 4FI5A 3ANWA 3KINB 4MHCA 4OK0A 5HAXA 4ZI3D 2GK9A 3D0TA 1BR1A 2BZBA 4TV9E 4U74A 4WNKA 3S4UA 5JDMA 5LGTB 1UX4A 2KXPB 2IW5B 2WMOA 3K3QC 1YKHB 3I9WA 3NZQA 5FMNA 4TZ4C 4UELA 4YHJA 2QGSA 2W61A 3PURA 2XUEA 3BQKA 3AB3B 3PE0A 4MFRA 3ZMTB 3N2KE 3UTKA 2HH7A 3ESLA 1YW0A 1O3XA 2NWBA 3TKLB 3ZYKA 3O1HA 5C8YE 1YKEB 2CEAA 4ZHQE 3MKDA 2EHOB 4AKLA 2JRKA 4GK5E 4QHOA 1BR4A 3RKOA 4DVDA 2Y8DA 3R84B 2LSGA 4YJ3E 3RYIE 5E0OA 1FMVA 3IHRA 4TV8E 2P9BA 3MJXA 4AQFA 2LHNA 1EZ3A 3Q5XA 4O4JE 3ZPOA 3CX8B 1MNEA 1D1AA 2J1DG 3DTOA 4O8SA 2MTQA 3N9PA 5H6RB 2ZM8A 5LJNA 3CMLA 2NW8A 5LJMA 2VKOA 1D1CA 5J2UE 3HA4A 1SA0E 5FXZA 4IIJE 4ZOLE 5JDLA 4F6RC 5EZYE 4E7SA 4YJ2E 3LG7A 3F57A 3R6NA 1E1HB 2LSKA 2JMHA 2PG8A 3UUNA 4KMCA 4JLEA 4EIWA 4A56A 4I4TE 2E9XC 1MMDA 3ZCJA 2Y6XA 4FJOA 3Q2MA 2W0GA 3ZMUB 4C90A 4EB6E 2DI4A 2V26A 2DHRA 2IC9A 3IBPA 2LHRA 5F3JA 2CMRA 4UVBB 2XQYA 2DCFA 3UUMA 1HTJF 4HFVA 4AXPA 2D0TA 3FBLA 2V7LA 4BA9A 4I55E 4AI6A 2X51A 4BJNA 2YK0A 2ZLYA 4ERRA 2LOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIO A;  5LG4 A;  3C98 B;  3LG7 A;  4TX5 A;  4JEH B;  1S94 A;  1BR0 A;  4JEU B;  2XHE B;  5M4Y A;  2DNX A;  1HS7 A;  1FEW A;  1G73 A;  1EZ3 A; 
#chains in the Genus database with same CATH topology
 3OYZ A;  1U5P A;  2L9Q A;  4ISS A;  5LNK A;  4LF6 T;  1US7 B;  1HFA A;  1HNZ T;  2ES0 A;  4H9R C;  3E08 A;  2H3R A;  4KBM B;  2W00 A;  4YLH A;  1W0A A;  4P0B A;  5FNV E;  2CWY A;  1LKX A;  5LHI B;  4AKI A;  3HKC E;  3N9Q A;  4CN1 A;  4IL9 A;  5L3G B;  5JH7 E;  1W09 A;  3RIA A;  1UX5 A;  2EHO C;  2KZ7 B;  1MND A;  4H9O C;  4ZI7 E;  1OED B;  3AA0 B;  4UF0 A;  2YEV C;  3E0Z A;  1ZHC A;  1ZV4 X;  3CQC B;  3MZK B;  4IE7 A;  1UGO A;  3CVR A;  4QXB B;  2CCQ A;  2L3L A;  1UUR A;  2OA5 A;  4H9S E;  3NVO A;  3AAI A;  2F4V T;  3ZSS A;  5AQP B;  3SFD A;  1T72 A;  4I0U A;  2VKJ A;  4AQG A;  5L3F B;  5LOV E;  1MMA A;  3MAC A;  1B7T A;  5EK2 A;  4HFI A;  4IHJ E;  4EYU A;  3AEF A;  5J0Z A;  4XBF B;  2X67 A;  3FZM B;  2D0U A;  1W9R A;  2EHO D;  5JR9 A;  2WSS V;  5LCY A;  3ZEF B;  2UXC T;  4PW8 A;  4LFC T;  3CX6 B;  2V1D B;  1V9D A;  2WY2 A;  3VHL A;  5A1L A;  2FJA A;  2Z6E A;  1IBL T;  3HI2 A;  3O1J A;  4F8H A;  1SUM B;  5AQM B;  4HKA A;  3VKH A;  4CXX A;  5DQV A;  4PK4 A;  4DV4 T;  3AEE A;  4P09 A;  4DR4 T;  2YN6 A;  2NW9 A;  2NP9 A;  4ANJ A;  1VCT A;  4U2Z A;  3PUY F;  1YXR A;  4U3C A;  5GON E;  3RYC E;  4YXD A;  3NKZ A;  1VOM A;  5JQG E;  5AQF B;  4GIW A;  3GN5 B;  3RLF F;  5ABF A;  2W2U A;  3FB2 A;  4HTE A;  2DLR A;  2WM9 A;  5DQW A;  2LM9 A;  1UK5 A;  3AA7 B;  3N9M A;  5HWY A;  3UQ4 A;  5JTG A;  3AE2 A;  4DV1 T;  5FY0 A;  2JQ9 A;  4YTN A;  1I6Z A;  3U78 A;  2WZH A;  1XDP A;  1D0X A;  4HN9 A;  1QSD A;  4NXM T;  2M6B A;  5EK4 A;  1WYB A;  4DBR A;  5IYZ E;  3WAK A;  2RA1 A;  2OLT A;  1WYC A;  3CQG B;  2VWA A;  3FBZ A;  4O2A E;  4PJM A;  1L0V A;  5HWX A;  2V7I A;  2VVS A;  3LBX B;  4HWH A;  4ASK A;  1MMG A;  3CKD A;  3LJC A;  3KBU A;  2MAW A;  3QB5 A;  4HE8 A;  4WBO A;  4B6X A;  4KHZ F;  2IHR 1;  2WMN A;  3PUW F;  1Z0P A;  2XJ7 A;  3AEB A;  4V1A v;  3VU7 H;  1IBK T;  4K0K T;  3A5X A;  2UXN B;  1WR6 A;  1HX1 B;  3C4W A;  1HCI A;  3N5L A;  3A7M A;  2E9X D;  2X9H A;  3F31 A;  4QXH B;  2WAU A;  2KIN B;  3AAA B;  2W67 A;  4YTP A;  4AQF C;  3JAE A;  3OVU A;  3C98 B;  4QKN A;  2JIW A;  4X1K E;  5AQH B;  5CGM A;  2SPC A;  2CXF A;  4PAG A;  5AQL B;  3L09 A;  5L3B B;  3TLT A;  2YKS A;  3P8C D;  3L39 A;  3VR9 A;  2DL1 A;  5KMG P;  3V5U A;  2LKG A;  4NPP A;  4A98 A;  4DR3 T;  4YSX A;  4EGW A;  4ZI2 C;  1VCS A;  3N9L A;  4M1P A;  5IHY A;  4WW0 A;  3ZYL A;  1XNQ T;  3ZMS B;  3ABV A;  4AIS A;  4ILC A;  4IE0 A;  5FY7 A;  3MK7 C;  2E8I A;  3ZST A;  1IJ5 A;  1WLX A;  3E22 E;  4P1N A;  5FVL A;  4X1I E;  5ETW A;  2Q9Q A;  1S94 A;  4B3R T;  5FP3 A;  5LBM A;  5FKY A;  4OFZ A;  2IW5 B;  4DV5 T;  2G0U A;  2PFV A;  2WWV A;  5JRC B;  3CWZ B;  4EXT A;  4DR5 T;  2ZMA A;  3GA8 A;  1DU2 A;  2M6I A;  4UVC B;  4ZEY A;  3AVR A;  5KX5 E;  1ZKE A;  2A72 A;  4TNV A;  3BQI A;  2NOX A;  4ADZ A;  2LSJ A;  3FXE B;  3K3O A;  2DWK A;  4MBQ A;  4UVA B;  2YU2 A;  3RIU C;  3C4Z A;  1YQ3 A;  3OPC A;  3P4Q A;  5M4Y A;  4NXN T;  2LE8 A;  5IUX A;  3ONX A;  2VB6 A;  4Q25 A;  4IDQ A;  1OXZ A;  4K0U A;  3AAE B;  3UUX B;  4AKH A;  5HEO A;  4DUZ T;  4H9P C;  2V8S V;  4A5X A;  2WP9 A;  3RC8 A;  3Q5W A;  1ZOY A;  1X79 A;  3CPZ A;  3DJB A;  2K24 A;  2VUR A;  5AFU L;  4YHH T;  2W4X A;  4PFP A;  3ZT6 A;  2QRX A;  3UFE A;  3J7Y q;  5LMU T;  4IDP A;  3PDY A;  2CLY B;  2YIN A;  1T98 A;  2WWU A;  2KT9 A;  3KBT A;  4KUM B;  3KDS E;  3KFW X;  4OYK A;  4DR2 T;  2V6X A;  2JMK A;  1IAP A;  2E5V A;  3LFM A;  3LK2 B;  4IE5 A;  4ZI2 D;  3O9X A;  5HEJ A;  2CBJ A;  2MPK A;  2WDR A;  2WQY A;  4JI4 T;  5JDH A;  2BKN A;  2CHO A;  4LF7 T;  1IZN B;  1D0Y A;  2C5I T;  2XZE A;  3AE9 A;  1N32 T;  4AKG A;  4JYA T;  2A2F X;  3SOL A;  5F5W A;  3B5M A;  5FYM A;  4ZI3 D;  5L4H A;  4CN4 A;  4ZZB A;  1MMN A;  3UT5 E;  2QVA A;  2LRK A;  3I9Y A;  3OJA A;  2LSI A;  2YDQ A;  4IDZ A;  2HPJ A;  2JQH A;  4N78 D;  1HNX T;  4OX9 T;  1N33 T;  2FJB A;  2KWH A;  1YD8 G;  5KDM C;  1WCR A;  2K48 A;  2WU2 A;  4Z90 A;  2EHO A;  5HXS A;  5L47 A;  2B76 A;  3EAB A;  3AVS A;  4PJJ A;  4EEB A;  2XQ8 A;  2YDS A;  4IDO A;  4LFB T;  5HYA A;  1LRZ A;  2NW7 A;  4CZZ B;  2MOZ A;  2DNX A;  3KV5 A;  4JI3 T;  4UEM A;  5H6Q B;  5LP6 E;  2K9A A;  2UXD T;  1BR2 A;  1HX8 A;  2I0M A;  3AA6 B;  3ZC1 A;  2CWO A;  4EZH A;  2BBJ A;  5HCM A;  2LSY A;  1HR0 T;  1Z8U A;  4H9Q C;  3ZLI A;  3ZYM A;  2X9X A;  3IF8 B;  4EYY R;  4ILB A;  3P4W A;  5AQN B;  5FXW A;  3W15 B;  5KXJ A;  5BMV E;  3C4X A;  4LF8 T;  3I1A A;  3WAJ A;  5L2L A;  4HEA A;  1SE7 A;  4ZZC A;  3FZK B;  3UFG A;  2YU1 A;  5LGN B;  1UUS A;  4GKK T;  3AXJ A;  2ZM2 A;  3J9X 1;  5FY1 A;  3PUV F;  1MIY A;  4IL4 A;  5ADX L;  3PV0 F;  5C2T A;  4KHP T;  5AQU B;  3PUS A;  3H37 A;  3LK3 B;  3AE6 A;  5HXR A;  2CXD A;  3P4R A;  1OWA A;  5AQI B;  2CE7 A;  2XQ4 A;  2DWG A;  2HN1 A;  3LBX A;  1MIV A;  2K5B B;  3KVB A;  3EDV A;  3ZN0 B;  1G73 A;  2UUB T;  3MXZ A;  2HHH T;  4B3M T;  4ZS2 A;  3ZJ1 A;  4X66 T;  4EED A;  3VRB A;  1XZY A;  3PUZ F;  2X68 A;  2Y48 B;  4B3S T;  1OED C;  1HNW T;  3FXD B;  5HEU A;  2NTX A;  4CXW A;  2IC6 A;  4DMV A;  5FL1 A;  1E2A A;  5JDN A;  3JCF A;  3ZJ2 A;  4YSY A;  3L3P A;  2ACX A;  1G8X A;  5IWA T;  4MLK A;  4B3T T;  2WS3 A;  3AED A;  2XAF B;  4NUU A;  1U4Q A;  4IDN A;  4CN6 A;  2AE9 A;  3ANW B;  2XTL A;  4KP3 C;  2E9X A;  1WRD A;  2HPL A;  2XHE B;  3QC9 A;  3C51 A;  2CBI A;  4LMJ A;  3P4P A;  5JDF A;  4I50 E;  2LM2 A;  2BKP A;  3CIR A;  5AQQ B;  5JDG A;  2UUC T;  2N1G A;  4O4I E;  2X66 A;  4IE6 A;  3Q5E A;  4EZ4 A;  4QH1 A;  2BDE A;  2KSR A;  4Z8X A;  2LT3 A;  3AXJ B;  5FXV A;  3FHN A;  1ZP0 A;  4I43 B;  5LA6 E;  2XAQ B;  5AQG B;  2UXX B;  4JV5 T;  1HS7 A;  3GWH A;  4JBW F;  5JDQ A;  1NAF A;  4DR7 T;  5LGT B;  4LF5 T;  3UU8 A;  2CRB A;  5FVK A;  3HR0 A;  5HXH A;  5L3C B;  1S35 A;  4HGA A;  2IML A;  5L3E B;  3EHZ A;  4UV9 B;  5C3J A;  3ZMV B;  2IAK A;  4X5T A;  2Q9Q D;  1CHU A;  4QX7 B;  1FMW A;  5ABH A;  2BBH A;  3PU8 A;  2YOE A;  4MAL A;  2WBL A;  3SFE A;  4YFS A;  4PNI A;  4U7Y A;  3SWH A;  3ZKR A;  4OYJ A;  2H7V C;  2CHN A;  4QXC B;  4TUY E;  3SS1 A;  4E7Z A;  5JDM A;  4DV2 T;  3T1Y T;  2XSA A;  4AIU A;  3PUQ A;  1KK7 A;  3T1H T;  2WU5 A;  2VAS A;  3H3M A;  4UIG A;  2VKH A;  4O4H E;  4JUY A;  1I94 T;  3PUX F;  1OED A;  4O2B E;  1BR0 A;  1AJ3 A;  2E9X B;  3EDU A;  5LXT E;  3IA3 A;  3A8Y C;  2N9D A;  3GN5 A;  2LJL A;  5LG4 A;  4JI8 T;  4AKR B;  2IIU A;  3KV4 A;  5ABE A;  4L9I A;  4NIQ A;  2V7K A;  3RYH E;  4O4L E;  4TWF A;  3UUL A;  4EAH A;  3RQW A;  5JVD E;  3ZT7 A;  4QX8 B;  3VKG A;  5JR9 C;  1T7S A;  1M62 A;  4DO0 A;  5CFB A;  3RI5 A;  5HXE A;  3B13 A;  3GMI A;  4UR9 A;  3V5S A;  4DV6 T;  2MBG A;  3RPU A;  3UU3 A;  3RYF E;  3LK4 2;  4TWD A;  3RIF A;  4C91 A;  1OED E;  5LGU B;  2V6Y A;  3UUB A;  2QYW A;  4X65 T;  2YDR A;  3RX6 A;  2H7O A;  5CA1 E;  5HXC A;  2JQQ A;  1J5E T;  4H9N C;  3AEG A;  1SHZ C;  5HCJ A;  4ZS3 A;  2J62 A;  2JPF A;  3O4X E;  1XNR T;  3T8O A;  3K3N A;  3QUJ A;  4HWD A;  4JEH B;  4QH5 A;  1CUN A;  1X9B A;  3NBX X;  5F8P A;  3EVY A;  4GYS A;  5LYJ E;  2ODU A;  2VKD A;  3PUG A;  3RC3 A;  3OYX A;  2CLY C;  4X20 E;  3TLS A;  4ILU A;  2RP4 A;  3N9O A;  3RH3 A;  3ZN1 B;  2L8K A;  1Y64 B;  2XAG B;  4GK0 E;  2JQK A;  1NWM X;  2XM1 A;  5AQS B;  1E7P A;  2LEH A;  3Q5D A;  4CQI A;  5LB7 B;  3Q9D A;  2BS2 A;  4UF0 B;  3N9N A;  1QUU A;  3F2E A;  2C5K T;  4JI5 T;  1GQE A;  5AQT B;  2LRL A;  4HFH A;  4CI3 B;  3AE5 A;  3IEE A;  1HG2 A;  1XDO A;  3P50 A;  2D9D A;  4IST A;  3RHW A;  4LF9 T;  5JR9 B;  5JRC A;  2OV9 A;  2BS4 A;  1XMO T;  4IGU A;  2Q9Q B;  2CM0 A;  2LOS A;  3TLW A;  1UCU A;  4ZI3 C;  4UXN B;  4U31 A;  2CA5 A;  2JJ9 A;  4PJL A;  4OHF A;  5LHH B;  5JRE A;  1KNZ A;  2BVL A;  4U2Y A;  1MIW A;  2AXD S;  5J2T E;  2NTY A;  5AQV B;  4GKJ T;  5L3D B;  2W63 A;  2XAS B;  3CX7 B;  3UQ7 A;  3PUA A;  2UXB T;  2J47 A;  2X9Y A;  3ZCI A;  2R6G F;  3EUH A;  4L0R A;  2KMF A;  2QA7 A;  1D0Z A;  4GYR A;  3RRC A;  2VL8 A;  4HFC A;  1N36 T;  4HFD A;  3P7I A;  3UU6 A;  4HFE A;  1HF8 A;  4JEU B;  3C50 A;  2XQ5 A;  3WI3 A;  2BG9 A;  2D5U A;  2XQ9 A;  3ZMZ B;  2VK9 A;  4JI7 T;  3AE1 A;  2X9W A;  2MYS A;  4TX5 A;  4L5G A;  4LML A;  3CK6 A;  3M65 A;  5J1G A;  4DV0 T;  3EI0 A;  2X0L B;  4GOU A;  3HL6 A;  2BVM A;  3B57 A;  2KLQ A;  5L4E A;  1IJ6 A;  4CXY A;  2Q9Q C;  3KV6 A;  2PBI A;  4CI1 B;  2C0S A;  2FJE A;  3FZF B;  3ONJ A;  2ZM0 A;  3NRX A;  1XMQ T;  3RKG A;  2V6Y B;  4P0A A;  3BQL A;  3MA9 A;  2B1E A;  2BG9 C;  3NRY A;  4TN7 B;  3CQX C;  3C64 A;  1KF6 A;  1W0B A;  2M67 A;  4PFO A;  2V7M A;  2XAJ B;  4YSZ A;  2I6H A;  2V7J A;  4IE4 A;  4PK5 A;  4G2A A;  3UU4 A;  4XAX B;  3N2G E;  3K8P C;  4DUY T;  2W62 A;  5HEH A;  3DP7 A;  4X62 T;  4J2C A;  4U72 A;  3RRW A;  3JAD A;  2BKO A;  4PK6 A;  4G63 A;  3AA1 B;  2XAH B;  3BK9 A;  4WBN E;  1FIO A;  1KNP A;  2I59 A;  5FXX A;  4DND A;  5CA0 E;  3O1I A;  2FBW A;  2BS3 A;  4KI0 F;  4NUV A;  4DV3 T;  1VRB A;  2XY8 B;  2J4G A;  4HFB A;  4ILA A;  5AQO B;  3X1D A;  4COF A;  1FEW A;  3HKD E;  2N2N A;  4BJM A;  3QK6 A;  3I0O A;  5LHG B;  2IDO B;  2HN2 A;  2BG9 E;  3VRA A;  1ZEE A;  1LVK A;  3G06 A;  4PJN A;  3ETV A;  4DID B;  2VVN A;  4EOZ B;  3I0Q A;  4YTM A;  1IBM T;  3HKE E;  3KV9 A;  1H7C A;  5DJQ C;  2H89 A;  3JC6 D;  2H88 A;  2D2S A;  2PJQ A;  3RIU A;  4YT0 A;  5EK3 A;  4TWH A;  1HG5 A;  2X0Y A;  4XZC A;  1D1B A;  4U7I A;  5CB4 E;  3U3I A;  2KND A;  2XQA A;  3LDQ B;  4DR6 T;  1NEN A;  3H3A A;  2WZI A;  2CXL A;  2ZM6 T;  4BAY B;  4IT4 A;  2E5L T;  2VL0 A;  3ETU A;  4UV8 B;  2V5C A;  5LBQ B;  2A3D A;  4H63 V;  1LVF A;  3SRZ A;  4H63 H;  5DAB A;  5LG3 A;  2UUA T;  4X1Y E;  3NZP A;  2X0H A;  3AE8 A;  4HWI B;  1WFD A;  2ODV A;  3OBV E;  3PU3 A;  4QWN B;  1QLB A;  2KWI B;  3LSV A;  3ZC0 A;  3PTR B;  1J1J A;  2C5J A;  4DMW A;  3HKB E;  2FJD A;  4CI2 B;  4DBQ A;  3TLU A;  3N2O A;  3QB5 K;  3OKQ A;  3JAF A;  3KVA A;  3JC6 C;  5TAO A;  3TLV A;  3ONL C;  4FI5 A;  3ANW A;  3KIN B;  4MHC A;  4OK0 A;  4U33 A;  5HAX A;  3ZT5 A;  2GK9 A;  2RPA A;  1BR1 A;  2BZB A;  3D0T A;  3PJA J;  4TV9 E;  4HWC A;  2FUP A;  1JNZ A;  4U74 A;  4WNK A;  1UX4 A;  2PTF A;  2KXP B;  2WMO A;  3K3Q C;  1YKH B;  2BG9 B;  2LKH A;  3I9W A;  3NZQ A;  4TZ4 C;  2WB5 A;  4UEL A;  2NR4 A;  4YHJ A;  5FMN A;  5ABG A;  2QGS A;  2W61 A;  3PUR A;  3RF1 A;  4DV7 T;  2XUE A;  3BQK A;  4JI6 T;  3AB3 B;  3PE0 A;  4MFR A;  3UU5 A;  3ZMT B;  3NWI A;  4JI1 T;  3N2K E;  3UTK A;  5LMN T;  2HH7 A;  3AEA A;  1YW0 A;  2XSB A;  3ESL A;  1O3X A;  2NWB A;  3TKL B;  3ZYK A;  5CJ5 A;  3O1H A;  3PJA A;  1YKE B;  3RQU A;  5C8Y E;  4DR1 T;  2CEA A;  4ZHQ E;  3MKD A;  2EHO B;  4AKL A;  2JRK A;  3AE4 A;  4GK5 E;  4QHO A;  1BR4 A;  3RKO A;  4DVD A;  2Y8D A;  2K3W A;  2ACZ A;  3R84 B;  4TNW A;  2LSG A;  4YJ3 E;  5AQJ B;  3RYI E;  5AQK B;  4QH4 A;  5E0O A;  3VR8 A;  5ABF B;  1FMV A;  3IHR A;  4TV8 E;  2P9B A;  1KEY A;  3MJX A;  4AQF A;  2LHN A;  3K1S A;  1EZ3 A;  3Q5X A;  2E2A A;  4O4J E;  4Z91 A;  3CX8 B;  1MNE A;  3ZPO A;  2WDV A;  1D1A A;  2J1D G;  1M7K A;  3DTO A;  2MTQ A;  4O8S A;  4WZX A;  3N9P A;  4YY3 T;  5BR8 T;  5H6R B;  2ZM8 A;  4ZXL A;  3CML A;  3FZL B;  2NW8 A;  1T8B A;  5LJM A;  2VKO A;  5LJN A;  1D1C A;  2XPK A;  4LF4 T;  5J2U E;  3S4U A;  3HA4 A;  4JI0 T;  1KNR A;  1SA0 E;  2XM2 A;  4LMK A;  4IIJ E;  5FXZ A;  4ZOL E;  4KX6 A;  5JDL A;  4F6R C;  2XQ7 A;  2VQF T;  3RGL A;  1XWM A;  1R8I A;  3FZH B;  5EZY E;  4E7S A;  3LG7 A;  3AE7 A;  4YJ2 E;  3QOF A;  2WCA A;  2IUB A;  3F57 A;  1E1H B;  3R6N A;  4WYV A;  4X64 T;  3OTO T;  2LSK A;  3AEC A;  2V5D A;  5AQR B;  2JMH A;  2PG8 A;  3UUN A;  4KMC A;  4JLE A;  4EIW A;  4A56 A;  4I4T E;  2W66 A;  2WDQ A;  4IRE A;  3M3Z B;  1WR0 A;  2VQE T;  2E9X C;  1MMD A;  2XQ3 A;  2Y6X A;  4FJO A;  3ZCJ A;  3Q2M A;  2W0G A;  4HWF A;  3ZMU B;  4C90 A;  4EB6 E;  2DI4 A;  2V26 A;  2DHR A;  1JNR A;  1YQ4 A;  2IC9 A;  3IBP A;  2UU9 T;  1FJG T;  2CPT A;  2LHR A;  1Y01 A;  2LLY A;  3P4S A;  5F3J A;  2CMR A;  4UVB B;  1N34 T;  2XQY A;  2DCF A;  3UUM A;  1HTJ F;  3AE3 A;  3QNU A;  4HFV A;  4JI2 T;  4EV6 A;  4LFA T;  2A9U A;  2XQ6 A;  4AXP A;  1J5W A;  2D0T A;  3FBL A;  3L8R A;  5HEG A;  1NEK A;  4A97 A;  2V7L A;  5FL0 A;  4I55 E;  4BA9 A;  4AI6 A;  2X51 A;  4BJN A;  2YK0 A;  3EAM A;  4AQY T;  2ZLY A;  4ERR A;  1KFY A;  2LOP A; 
#chains in the Genus database with same CATH homology
 3OYZ A;  1U5P A;  2L9Q A;  4ISS A;  5LNK A;  1US7 B;  1HFA A;  2ES0 A;  4H9R C;  3E08 A;  2H3R A;  4KBM B;  2W00 A;  4YLH A;  4P0B A;  5FNV E;  2CWY A;  1LKX A;  5LHI B;  4AKI A;  3HKC E;  3N9Q A;  5L3G B;  5JH7 E;  1UX5 A;  2EHO C;  2KZ7 B;  1MND A;  4H9O C;  4ZI7 E;  3AA0 B;  4UF0 A;  2YEV C;  3E0Z A;  1ZHC A;  1ZV4 X;  3CQC B;  3MZK B;  4IE7 A;  4QXB B;  3CVR A;  2CCQ A;  2L3L A;  2OA5 A;  4H9S E;  3AAI A;  5L3F B;  2VKJ A;  4AQG A;  5LOV E;  1MMA A;  3MAC A;  1B7T A;  5EK2 A;  4IHJ E;  4EYU A;  4XBF B;  2X67 A;  2D0U A;  2EHO D;  5JR9 A;  2WSS V;  5LCY A;  3ZEF B;  4PW8 A;  3CX6 B;  2V1D B;  1V9D A;  3VHL A;  5A1L A;  2Z6E A;  3HI2 A;  3O1J A;  4HKA A;  3VKH A;  4CXX A;  5DQV A;  4PK4 A;  4P09 A;  2NW9 A;  2NP9 A;  4ANJ A;  5GON E;  3RYC E;  1VOM A;  5JQG E;  4GIW A;  3GN5 B;  3FB2 A;  4HTE A;  2DLR A;  2WM9 A;  5DQW A;  2LM9 A;  3AA7 B;  3N9M A;  5HWY A;  5FY0 A;  3U78 A;  1D0X A;  4HN9 A;  1QSD A;  5EK4 A;  1WYB A;  4DBR A;  5IYZ E;  3WAK A;  2RA1 A;  3CQG B;  1WYC A;  3FBZ A;  2VWA A;  4PJM A;  4O2A E;  5HWX A;  2V7I A;  3LBX B;  4ASK A;  1MMG A;  3CKD A;  3LJC A;  3KBU A;  4HE8 A;  4WBO A;  4B6X A;  2WMN A;  3VU7 H;  1Z0P A;  4V1A v;  3A5X A;  2UXN B;  1WR6 A;  3N5L A;  3C4W A;  1HCI A;  4QXH B;  2E9X D;  2X9H A;  3F31 A;  2WAU A;  2KIN B;  3AAA B;  4AQF C;  4QKN A;  3C98 B;  4X1K E;  5L3B B;  2SPC A;  2CXF A;  4PAG A;  3L09 A;  3P8C D;  5KMG P;  3V5U A;  4ZI2 C;  3N9L A;  4M1P A;  5IHY A;  4WW0 A;  3ZYL A;  3ZMS B;  4IE0 A;  5FY7 A;  3MK7 C;  2E8I A;  1IJ5 A;  1WLX A;  3E22 E;  4X1I E;  5ETW A;  2Q9Q A;  1S94 A;  5FP3 A;  5LBM A;  4OFZ A;  5JRC B;  2G0U A;  2PFV A;  3CWZ B;  2ZMA A;  3GA8 A;  4UVC B;  3AVR A;  5KX5 E;  1ZKE A;  2A72 A;  3BQI A;  2NOX A;  4ADZ A;  2LSJ A;  3FXE B;  3K3O A;  2DWK A;  4MBQ A;  4UVA B;  2YU2 A;  4EXT A;  3C4Z A;  5M4Y A;  2LE8 A;  3ONX A;  2VB6 A;  3UUX B;  4K0U A;  1OXZ A;  4AKH A;  3AAE B;  3RC8 A;  4H9P C;  3Q5W A;  3DJB A;  3CPZ A;  1X79 A;  2K24 A;  5AFU L;  4PFP A;  3UFE A;  3J7Y q;  3PDY A;  2CLY B;  2YIN A;  1T98 A;  2WWU A;  2KT9 A;  3KBT A;  4KUM B;  3KDS E;  3KFW X;  4OYK A;  2JMK A;  1IAP A;  3LFM A;  3LK2 B;  4IE5 A;  4ZI2 D;  3O9X A;  5JDH A;  1IZN B;  1D0Y A;  2C5I T;  4AKG A;  2A2F X;  3SOL A;  5FYM A;  1MMN A;  3UT5 E;  3I9Y A;  3OJA A;  2LSI A;  4IDZ A;  2HPJ A;  4N78 D;  5KDM C;  2KWH A;  1YD8 G;  2K48 A;  5HXS A;  2EHO A;  4PJJ A;  3AVS A;  5HYA A;  1LRZ A;  2NW7 A;  4CZZ B;  2MOZ A;  2DNX A;  3KV5 A;  4UEM A;  5H6Q B;  5LP6 E;  2K9A A;  1BR2 A;  1HX8 A;  4EZH A;  3AA6 B;  3ZC1 A;  2CWO A;  2LSY A;  4H9Q C;  3ZYM A;  3ZLI A;  4EYY R;  2X9X A;  3IF8 B;  5FXW A;  3W15 B;  5BMV E;  3C4X A;  3WAJ A;  3I1A A;  5L2L A;  4HEA A;  2YU1 A;  5LGN B;  2ZM2 A;  3J9X 1;  5FY1 A;  1MIY A;  5ADX L;  3PUS A;  3H37 A;  3LK3 B;  5HXR A;  2CXD A;  1OWA A;  2CE7 A;  2DWG A;  3LBX A;  1MIV A;  2K5B B;  3KVB A;  3EDV A;  3ZN0 B;  1G73 A;  3MXZ A;  4ZS2 A;  3ZJ1 A;  2X68 A;  2Y48 B;  3FXD B;  4DMV A;  2NTX A;  4CXW A;  2IC6 A;  5JDN A;  3ZJ2 A;  3L3P A;  2ACX A;  1G8X A;  4MLK A;  2XAF B;  4NUU A;  1U4Q A;  3ANW B;  4KP3 C;  2XTL A;  2E9X A;  1WRD A;  2HPL A;  2XHE B;  3QC9 A;  3C51 A;  5JDF A;  5JDG A;  4I50 E;  2N1G A;  4O4I E;  2X66 A;  4IE6 A;  4EZ4 A;  2BDE A;  4Z8X A;  2LT3 A;  5LA6 E;  5FXV A;  3FHN A;  4I43 B;  2XAQ B;  2UXX B;  1HS7 A;  3GWH A;  5JDQ A;  1NAF A;  3HR0 A;  5HXH A;  5L3C B;  1S35 A;  4HGA A;  5L3E B;  4UV9 B;  3ZMV B;  2IAK A;  2Q9Q D;  4QX7 B;  1FMW A;  3PU8 A;  4MAL A;  2WBL A;  3SWH A;  4YFS A;  4PNI A;  4OYJ A;  2H7V C;  4TUY E;  4QXC B;  3SS1 A;  4E7Z A;  3PUQ A;  1KK7 A;  2VAS A;  4UIG A;  2VKH A;  4O4H E;  4JUY A;  1BR0 A;  4O2B E;  1AJ3 A;  2E9X B;  3EDU A;  5LXT E;  2N9D A;  3GN5 A;  2LJL A;  5LG4 A;  4AKR B;  3KV4 A;  4L9I A;  2V7K A;  3RYH E;  4O4L E;  4EAH A;  3UUL A;  5JVD E;  4QX8 B;  3VKG A;  5JR9 C;  4DO0 A;  5HXE A;  3B13 A;  3GMI A;  3V5S A;  2MBG A;  3RPU A;  3RYF E;  3LK4 2;  4C91 A;  5LGU B;  3RX6 A;  5CA1 E;  2H7O A;  5HXC A;  2JQQ A;  4H9N C;  1SHZ C;  4ZS3 A;  2JPF A;  3O4X E;  3T8O A;  3K3N A;  3QUJ A;  4JEH B;  5F8P A;  1CUN A;  3NBX X;  5LYJ E;  3EVY A;  4GYS A;  2ODU A;  2VKD A;  3PUG A;  3RC3 A;  3OYX A;  2CLY C;  4X20 E;  4ILU A;  2RP4 A;  3N9O A;  3RH3 A;  3ZN1 B;  2L8K A;  1Y64 B;  2XAG B;  4GK0 E;  4CQI A;  1NWM X;  2LEH A;  3Q9D A;  4UF0 B;  3N9N A;  1QUU A;  3F2E A;  2C5K T;  4CI3 B;  3IEE A;  1HG2 A;  4IST A;  5JRC A;  5JR9 B;  4IGU A;  2Q9Q B;  2CM0 A;  2LOS A;  1UCU A;  4ZI3 C;  4UXN B;  5LHH B;  2CA5 A;  2JJ9 A;  4PJL A;  4OHF A;  1KNZ A;  5JRE A;  2BVL A;  1MIW A;  5J2T E;  2NTY A;  5L3D B;  2W63 A;  2XAS B;  3CX7 B;  3PUA A;  2X9Y A;  3ZCI A;  3EUH A;  4L0R A;  2KMF A;  2QA7 A;  1D0Z A;  4GYR A;  3RRC A;  2VL8 A;  3P7I A;  1HF8 A;  4JEU B;  3C50 A;  3WI3 A;  3ZMZ B;  2D5U A;  2VK9 A;  2X9W A;  2MYS A;  4L5G A;  3M65 A;  5J1G A;  4GOU A;  2X0L B;  3HL6 A;  2BVM A;  3B57 A;  2KLQ A;  1IJ6 A;  4CXY A;  2Q9Q C;  3KV6 A;  2PBI A;  4CI1 B;  2C0S A;  4P0A A;  2ZM0 A;  3NRX A;  3BQL A;  3MA9 A;  2B1E A;  3NRY A;  4TN7 B;  3CQX C;  3C64 A;  4TX5 A;  4PFO A;  2M67 A;  2V7M A;  2XAJ B;  2V7J A;  4IE4 A;  4PK5 A;  4G2A A;  4XAX B;  3N2G E;  3K8P C;  2W62 A;  3DP7 A;  4J2C A;  4U72 A;  3RRW A;  4PK6 A;  4G63 A;  3AA1 B;  2XAH B;  3BK9 A;  4WBN E;  1FIO A;  2I59 A;  5FXX A;  4DND A;  5CA0 E;  3O1I A;  4NUV A;  1VRB A;  1FEW A;  3HKD E;  2N2N A;  4BJM A;  3QK6 A;  3I0O A;  5LHG B;  1ZEE A;  1LVK A;  4PJN A;  3ETV A;  4EOZ B;  3I0Q A;  3HKE E;  3KV9 A;  1H7C A;  5DJQ C;  3JC6 D;  2D2S A;  2PJQ A;  5EK3 A;  1HG5 A;  4XZC A;  5CB4 E;  1D1B A;  3U3I A;  2KND A;  3H3A A;  2CXL A;  4BAY B;  3ETU A;  4UV8 B;  5LBQ B;  2A3D A;  4H63 V;  1LVF A;  3SRZ A;  4H63 H;  5DAB A;  4X1Y E;  3NZP A;  3OBV E;  2ODV A;  3PU3 A;  4QWN B;  2KWI B;  3ZC0 A;  3PTR B;  2C5J A;  4DMW A;  3HKB E;  4CI2 B;  4DBQ A;  3N2O A;  5TAO A;  3OKQ A;  3KVA A;  3JC6 C;  4FI5 A;  3ANW A;  3KIN B;  4MHC A;  4OK0 A;  5HAX A;  4ZI3 D;  2GK9 A;  3D0T A;  1BR1 A;  2BZB A;  4TV9 E;  4U74 A;  4WNK A;  3S4U A;  5JDM A;  5LGT B;  1UX4 A;  2KXP B;  2IW5 B;  2WMO A;  3K3Q C;  1YKH B;  3I9W A;  3NZQ A;  5FMN A;  4TZ4 C;  4UEL A;  4YHJ A;  2QGS A;  2W61 A;  3PUR A;  2XUE A;  3BQK A;  3AB3 B;  3PE0 A;  4MFR A;  3ZMT B;  3N2K E;  3UTK A;  2HH7 A;  3ESL A;  1YW0 A;  1O3X A;  2NWB A;  3TKL B;  3ZYK A;  3O1H A;  5C8Y E;  1YKE B;  2CEA A;  4ZHQ E;  3MKD A;  2EHO B;  4AKL A;  2JRK A;  4GK5 E;  4QHO A;  1BR4 A;  3RKO A;  4DVD A;  2Y8D A;  3R84 B;  2LSG A;  4YJ3 E;  3RYI E;  5E0O A;  1FMV A;  3IHR A;  4TV8 E;  2P9B A;  3MJX A;  4AQF A;  2LHN A;  1EZ3 A;  3Q5X A;  4O4J E;  3ZPO A;  3CX8 B;  1MNE A;  1D1A A;  2J1D G;  3DTO A;  4O8S A;  2MTQ A;  3N9P A;  5H6R B;  2ZM8 A;  5LJN A;  3CML A;  2NW8 A;  5LJM A;  2VKO A;  1D1C A;  5J2U E;  3HA4 A;  1SA0 E;  5FXZ A;  4IIJ E;  4ZOL E;  5JDL A;  4F6R C;  5EZY E;  4E7S A;  4YJ2 E;  3LG7 A;  3F57 A;  3R6N A;  1E1H B;  2LSK A;  2JMH A;  2PG8 A;  3UUN A;  4KMC A;  4JLE A;  4EIW A;  4A56 A;  4I4T E;  2E9X C;  1MMD A;  3ZCJ A;  2Y6X A;  4FJO A;  3Q2M A;  2W0G A;  3ZMU B;  4C90 A;  4EB6 E;  2DI4 A;  2V26 A;  2DHR A;  2IC9 A;  3IBP A;  2LHR A;  5F3J A;  2CMR A;  4UVB B;  2XQY A;  2DCF A;  3UUM A;  1HTJ F;  4HFV A;  4AXP A;  2D0T A;  3FBL A;  2V7L A;  4BA9 A;  4I55 E;  4AI6 A;  2X51 A;  4BJN A;  2YK0 A;  2ZLY A;  4ERR A;  2LOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...