5M4YA

Crystal structure of the sec3/sso2 complex at 2.20 angstrom resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
177
Chain Sequence
SHMDFVAFMNKINSINANLSRYENIINQIDAQHKDLLTQVSEEQEMELRRSLDDYISQATDLQYQLKADIKDAQRDGLHDSNKQAQAENCRQKFLKLIQDYRIIDSNYKEESKEQAKRQYTIIQPEATDEEVEAAINDVNGQKTALAEVQARHQELLKLEKTMAELTQLFNDMEELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sec3 promotes the initial binary t-SNARE complex assembly and membrane fusion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Structural protein
molecule keywords Protein SSO2
total genus 80
structure length 177
sequence length 193
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2016-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5m4yA00
1EZ3A 1S94A 2DNXA 2XHEB 1HS7A 4JEUB 4JEHB 3C98B 1FIOA 5M4YA 1FEWA 3LG7A 1BR0A 4TX5A 1G73A 5LG4A
chains in the Genus database with same CATH superfamily
3SS1A 4X62T 4YT0A 1W09A 4I50E 5LP6E 4B3TT 3OYXA 1FMWA 1D1CA 2D2SA 3AE3A 2B76A 3K8PC 4IDNA 1KFYA 2X67A 3Q5EA 5HEOA 2H88A 2IHR1 3P8CD 4HEAA 2BG9E 4YJ3E 5KX5E 5L3EB 5LMUT 1J5ET 2WDVA 2QYWA 1MMGA 2KWIB 2PFVA 3B13A 1D1AA 3UUBA 5L3DB 2WMNA 5L47A 2K48A 1D0XA 1SUMB 2ODVA 4HFDA 5E0OA 2YN6A 5FXZA 4U7YA 5JRCB 3CIRA 2V6YA 2HHHT 4P1NA 1XNQT 2ZM2A 5KXJA 1LRZA 1W9RA 3BQLA 3MJXA 4IL4A 1XWMA 3KVBA 4JI1T 4IDZA 1XMOT 3MZKB 1HNWT 5AQRB 3AVSA 4J2CA 1IBKT 2DL1A 4OK0A 3QNUA 3R6NA 5L3GB 3ONLC 1CHUA 2YINA 3ZT7A 3ONJA 5LA6E 4EZ4A 5JDNA 1MIWA 3ETUA 5ETWA 1MMAA 2BBJA 2Q9QD 3ZMSB 2X0YA 4DV1T 3VRAA 2VWAA 3RIUC 5AQUB 2HH7A 2QRXA 1IJ6A 2BVLA 4B3ST 4HFVA 3P7IA 2JMHA 3ABVA 3ZSTA 2VK9A 3HKEE 4EXTA 4YY3T 3SRZA 1WFDA 2OA5A 4Z90A 2A3DA 2VKDA 4U72A 3C4WA 2DCFA 3PTRB 1US7B 2UXDT 3EABA 5L3CB 3ZCJA 1XDPA 4DUZT 2QGSA 3NKZA 4ZZBA 5C3JA 2H89A 4HFIA 5DQVA 3SFEA 5JTGA 3ZCIA 2NW7A 2CXLA 2Y6XA 3AAEB 5FVLA 4ZI3C 4ZEYA 5AQIB 5JDHA 4K0UA 2LT3A 2FUPA 3FB2A 3LG7A 5HWYA 5LG3A 3AECA 4IDOA 4F6RC 4EGWA 2CEAA 2ACXA 2EHOB 2ZM0A 3PUGA 3ZT5A 1IJ5A 3VKGA 3GN5B 3OVUA 2WZIA 3AAIA 2R6GF 4GYSA 2CWOA 2NW9A 5ABFB 4KHZF 3RHWA 1W0AA 3H3AA 1KNZA 4ILAA 4IE6A 1N32T 1T98A 4I55E 2H7OA 5F5WA 4ILBA 3PUXF 5LOVE 1MNEA 5FVKA 2XAFB 5HAXA 5LHHB 4JLEA 1T8BA 3AE5A 1CUNA 3VRBA 3W15B 1AJ3A 3AE9A 2WB5A 4EIWA 3PJAA 4YHHT 2RP4A 1D1BA 2WQYA 5HWXA 3AA7B 2YKSA 5H6QB 3TLSA 4TWFA 4OFZA 1E1HB 2BS2A 2BVMA 4I0UA 1SA0E 4PJJA 4YTPA 5HYAA 5LNKA 5M4YA 4YFSA 2KINB 4AQFA 2J1DG 2W61A 3FZKB 4LFBT 2DNXA 3IA3A 5AQMB 5DABA 2VVSA 4YLHA 4KHPT 3OJAA 2DI4A 2XJ7A 4PJLA 5JDQA 3OYZA 3A5XA 4DV5T 3FBZA 2W63A 3PUZF 4LMLA 5LBQB 4U2YA 5LJNA 2CLYC 1UUSA 3EHZA 3LJCA 5BR8T 3EVYA 2UUCT 3PE0A 4ASKA 2X9YA 1J5WA 3B5MA 4H9OC 4YSYA 4CXYA 3RH3A 1HCIA 2FJBA 1ZV4X 1D0ZA 2IDOB 3JADA 2JRKA 5ADXL 5JR9C 4CXWA 2MBGA 3L8RA 4NPPA 3C51A 4PFOA 2YU1A 3ZSSA 2XQ9A 5LHIB 3AVRA 1HNXT 3BQKA 3H37A 3PUVF 3GWHA 3LBXB 1OEDE 2YDRA 4ZXLA 4P09A 1YQ4A 4YSXA 3N9LA 2E9XB 2VKJA 2NTYA 2BKNA 1M7KA 1YKHB 2DHRA 2LM9A 4WYVA 3NVOA 3SOLA 4JEUB 1NAFA 3ZEFB 4JI3T 3ETVA 3J7Yq 5LMNT 1LVKA 4GK0E 4HFEA 3JC6C 4CI2B 2F4VT 4A97A 2X9HA 5AQNB 2NTXA 5AQGB 2IIUA 3I0OA 4JUYA 2JQ9A 3N9NA 4L9IA 3C50A 4DBRA 2V7LA 1OEDC 1KK7A 5FL1A 2LSYA 4IDQA 4AKIA 3BQIA 4GYRA 3DTOA 1U4QA 1HFAA 1HF8A 2Z6EA 4KI0F 1G8XA 5HCMA 2E8IA 2VASA 4MBQA 4UVCB 4DMVA 2VL0A 4QH5A 5CJ5A 4QKNA 3K3QC 3RLFF 1NENA 4COFA 5HEUA 4GIWA 2VKHA 4TN7B 3UU4A 4WBNE 5L4EA 2Q9QC 3HA4A 3S4UA 4UIGA 4JV5T 2FBWA 3N2OA 3L09A 2PBIA 5JR9A 5LYJE 1EZ3A 1WCRA 1SE7A 1W0BA 2L9QA 1DU2A 4KMCA 1QSDA 2BS4A 2XY8B 3KVAA 4IT4A 2WWVA 4ZI7E 3PUQA 4ZHQE 2KWHA 3CX8B 5HEGA 2V7IA 1ZHCA 4A56A 3PU8A 4YHJA 2N1GA 1T7SA 3MK7C 2XAHB 3D0TA 1ZEEA 3E0ZA 3PUAA 3CX6B 2NWBA 2VVNA 3CQGB 2LEHA 3LDQB 5HEHA 2A2FX 4JBWF 5CA0E 4DV7T 2E9XA 4AIUA 2KSRA 3QOFA 1X79A 3WI3A 3Q5XA 4JI6T 1XMQT 4PW8A 3KV6A 4DR1T 2XUEA 5L3BB 5J1GA 4B3RT 4ZI2C 5AQKB 3TKLB 3U78A 3PV0F 5HXSA 3P4QA 4TWHA 4U2ZA 2J62A 2MPKA 2PG8A 2H7VC 2WU5A 3CPZA 3DJBA 3O1IA 4BJMA 1E7PA 2WU2A 1FMVA 4MLKA 2XHEB 2RPAA 2V7KA 3ZMZB 3QUJA 4HTEA 4NXMT 2UUBT 2V6XA 1YXRA 3NZPA 4JI4T 3FXDB 4IE0A 2M6IA 4ZI2D 4DNDA 2C5JA 5HXEA 1BR4A 4ILCA 5L2LA 4K0KT 2MTQA 5AFUL 3MACA 4O4LE 5KMGP 3ANWA 2C0SA 1N34T 3GMIA 4YJ2E 1VCTA 2W62A 1FIOA 3RI5A 2ZMAA 1I94T 4IE7A 4GKKT 3UUNA 1Z0PA 2LJLA 3HKDE 3LFMA 3N2GE 3OTOT 2JQQA 2XQ8A 3MA9A 3RRCA 2KZ7B 5AQQB 2CA5A 2YEVC 2D5UA 4XAXB 1UX5A 1E2AA 1D0YA 4UXNB 4BAYB 3UFEA 5IWAT 2XSBA 1YKEB 2FJDA 2CXFA 2KXPB 3L39A 5IYZE 3RKOA 5ABFA 4H63H 4HWCA 1B7TA 4JEHB 2WDQA 2CCQA 4I4TE 2JQKA 4QX7B 4UV8B 3KBTA 4EEBA 5CA1E 5A1LA 5J2UE 3FHNA 2LSJA 2E9XC 1XDOA 3AEBA 3AE4A 2V26A 1OEDA 3I1AA 2CXDA 3N9MA 5FY1A 3UU6A 5JDMA 4AKLA 2GK9A 2EHOC 3AA1B 2RA1A 2VQFT 3AAAB 4NXNT 3PU3A 1MMNA 5KDMC 2K3WA 4Z8XA 5AQPB 2W67A 4O2BE 3QC9A 1KEYA 2LHRA 2LOPA 3C4XA 3Q5WA 4ERRA 3J9X1 2K24A 4HKAA 4LFCT 2WCAA 1YQ3A 4JI7T 4X64T 3UUXB 3HL6A 3NRYA 4ISSA 4UR9A 3GA8A 2LRKA 5IHYA 1LVFA 3FBLA 4LFAT 4GKJT 1WRDA 3UT5E 3ZYLA 4DR2T 5AQJB 3ZPOA 4X20E 3I9YA 3ZC1A 1WLXA 5LB7B 1Z8UA 3FZLB 4MHCA 4P0BA 4ADZA 4G63A 4X5TA 3OBVE 1VCSA 1YD8G 4HFHA 3RIAA 4YTNA 2P9BA 4OYJA 3KFWX 3DP7A 3M3ZB 4V1Av 4LF5T 4X65T 3AXJA 4P0AA 4XZCA 5ABGA 2XAJB 1BR1A 4HWHA 2X9XA 3L3PA 4KBMB 3FZMB 2V8SV 2UXXB 3EDVA 4UELA 5AQTB 2V6YB 4HWIB 2K9AA 5C2TA 5FXVA 3NRXA 3EDUA 5LXTE 2V7MA 2PTFA 5L3FB 2ZM6T 3M65A 3LK3B 3E22E 2EHOA 4PJMA 1IZNB 4WBOA 4DMWA 4OYKA 2N2NA 5L4HA 3RYFE 4PNIA 3LK2B 4HFBA 3RQWA 3ZMTB 2W2UA 1HNZT 3RIUA 2E5LT 2IMLA 4TZ4C 4PAGA 5AQFB 4BJNA 3KV9A 4JI5T 1WYCA 2WAUA 2MOZA 3P50A 3FZHB 4NUUA 2CLYB 1VRBA 4DIDB 2BKPA 2I0MA 3RYCE 3ONXA 5EK4A 4N78D 3ZLIA 1N36T 2W66A 1OEDB 4IDPA 1JNZA 1WR6A 2BBHA 3VHLA 3EUHA 2E5VA 3UULA 1Y64B 2V1DB 3Q2MA 1HR0T 3LBXA 2D0UA 2CMRA 2ODUA 4ZOLE 4LF8T 4WW0A 3ZJ1A 2J47A 3HKCE 4B3MT 1JNRA 2LSGA 3NWIA 4HFCA 4O8SA 3QB5A 5FXWA 2WP9A 4AQGA 1N33T 1IBLT 5JVDE 5LGNB 4EV6A 4AQYT 2I59A 4EYYR 1UCUA 2HPLA 3QK6A 4H9SE 2Q9QA 4TNWA 3TLWA 3CWZB 4UEMA 4AKGA 2IUBA 4KP3C 4AKHA 3HKBE 3O1HA 1S35A 4DV6T 2C5IT 2E9XD 2VB6A 2XAQB 5DQWA 4PK6A 3N9OA 2D9DA 1T72A 2JQHA 2XTLA 5LBMA 3ZT6A 4TX5A 4LF6T 2YOEA 3IF8B 4DR5T 1HS7A 4TV9E 2BG9A 3C98B 3A7MA 5EZYE 3ZJ2A 2QVAA 2VQET 1U5PA 2ACZA 4XBFB 4QXCB 1HX8A 3RPUA 1HX1B 2CHNA 3JCFA 3TLVA 3OKQA 2BKOA 1L0VA 1QUUA 3H3MA 3CVRA 3ZMUB 2BDEA 2BS3A 4IIJE 4X1YE 4ZI3D 4DV0T 4M1PA 1X9BA 2WS3A 2VURA 3AA6B 4IE5A 4PK5A 4X1IE 4O4IE 3U3IA 3UU8A 2SPCA 3RC3A 4CN4A 4U33A 2CM0A 3E08A 3MXZA 3K3OA 4PFPA 4QX8B 3SFDA 4U31A 3UU3A 4EYUA 1XNRT 1KNPA 3KINB 3ZMVB 3BK9A 3IEEA 4U7IA 4UV9B 3RF1A 3V5SA 5FP3A 3QB5K 3B57A 3KV5A 3PDYA 4AI6A 3IHRA 3RQUA 2FJEA 3VU7H 3ZC0A 3N5LA 2IW5B 5AQVB 2XASB 3LSVA 3AE7A 3NZQA 3O4XE 1HG5A 4AISA 3T1HT 4JI8T 2XQ6A 3SWHA 2CBIA 5LCYA 3JC6D 2K5BB 2CPTA 3F31A 2YU2A 4IE4A 2IAKA 4QH1A 3ZN0B 2KLQA 2NR4A 1MNDA 2A72A 1UX4A 2G0UA 2W0GA 3AEEA 3PUYF 4UF0A 5JR9B 1I6ZA 4B6XA 3KV4A 3ZYKA 4WZXA 3UQ7A 4QH4A 2XPKA 2Y8DA 1YW0A 5FL0A 3UQ4A 1GQEA 2X68A 3T1YT 3KDSE 2BG9C 4H63V 4HWFA 3Q5DA 1J1JA 5CGMA 4ZS3A 4CN1A 1MMDA 2CBJA 3OPCA 2LM2A 3GN5A 3CKDA 4HGAA 2JMKA 4TWDA 5AQHB 3O9XA 2D0TA 2LSKA 2N9DA 2LSIA 2JJ9A 2XQAA 4O4JE 3R84B 1OWAA 4I43B 4EZHA 2PJQA 3AEAA 4QXHB 5LGTB 1NWMX 4CZZB 1FJGT 3I9WA 5FYMA 4G2AA 2XM2A 3AE6A 5AQSB 3EI0A 2XZEA 5DJQC 4QXBB 4DVDA 4CQIA 2E2AA 4FJOA 2XQ5A 5JDFA 4U3CA 4A98A 3VKHA 3N2KE 4E7ZA 5J2TE 3FZFB 2V7JA 4YTMA 1ZOYA 3I0QA 4OHFA 3PURA 5HXHA 2WMOA 3ZKRA 4C90A 5F3JA 4PJNA 4CN6A 2XQ7A 5JRCA 3TLTA 2WY2A 4EAHA 2CE7A 2L3LA 2WBLA 2NOXA 3N9PA 5IUXA 4DUYT 1UGOA 4CI1B 2MAWA 5GONE 5BMVE 1G73A 2X66A 1VOMA 4H9PC 3CQXC 3HI2A 3AEFA 4Z91A 2X9WA 2I6HA 4DBQA 3UFGA 5JQGE 2V5CA 1UK5A 2M67A 4IREA 5TAOA 4CXXA 2KMFA 4QWNB 2WSSV 3IBPA 2LKGA 3KBUA 3P4SA 1UURA 2MYSA 2OLTA 3HR0A 4E7SA 2LLYA 2OV9A 2V5DA 1IAPA 3JAFA 4LF4T 2UXCT 2LE8A 2UXBT 4HWDA 4EEDA 4ISTA 4DV4T 3P4RA 2XSAA 4F8HA 2Q9QB 4TNVA 3RRWA 5LHGB 3A8YC 4EB6E 3F2EA 2YDQA 2LKHA 3PUWF 4MFRA 3EAMA 3X1DA 1R8IA 2XQ4A 2X51A 3WAJA 4O4HE 2JIWA 5ABHA 4Q25A 5AQLB 2A9UA 4UVBB 2CHOA 1QLBA 3UUMA 5JDGA 5JH7E 2HPJA 2NW8A 2YDSA 5FY0A 3AEGA 3LK42 4CI3B 4EOZB 3RYHE 5FKYA 1WR0A 3CX7B 1S94A 3AE1A 3CQCB 4LMJA 4BA9A 3C4ZA 2HN1A 3CMLA 1KF6A 2L8KA 3AE2A 5H6RB 5HXRA 4JI2T 4HN9A 3V5UA 3JAEA 4DR7T 4ZZCA 5F8PA 2UU9T 4JYAT 4O2AE 3N9QA 5J0ZA 4X1KE 4DR4T 5LGUB 4TUYE 2W4XA 5HXCA 5JDLA 2DWGA 4LF9T 2DLRA 3ESLA 4GK5E 1MIVA 1WYBA 4H9NC 5FMNA 4YXDA 4AQFC 4ANJA 2VL8A 2QA7A 3RYIE 2X0LB 2KT9A 2AE9A 4KUMB 3AEDA 1V9DA 3G06A 2FJAA 3Q9DA 4X66T 2WZHA 2UUAT 3AXJB 3P4PA 3K3NA 4GOUA 4IL9A 4L0RA 4YSZA 4ZS2A 2ES0A 3ZYMA 4OX9T 1HTJF 1XZYA 2WWUA 5JREA 1BR0A 2CWYA 3TLUA 2IC9A 2JPFA 1LKXA 2B1EA 2KNDA 3K1SA 1IBMT 1HG2A 3PJAJ 5EK2A 2CRBA 3FXEB 2EHOD 4NUVA 2C5KT 3F57A 4IHJE 4MALA 4NIQA 3P4WA 2M6BA 2XQ3A 3RC8A 1H7CA 1BR2A 2LHNA 4UVAB 3C64A 4ILUA 4PK4A 3RIFA 2W00A 2BG9B 4HE8A 4DV2T 4LF7T 1OXZA 2XM1A 2UXNB 1FEWA 1SHZC 2ZLYA 3AE8A 4L5GA 3WAKA 4DO0A 5AQOB 5HEJA 2Y48B 2YK0A 4H9RC 1Y01A 2IC6A 2WM9A 5HCJA 1ZP0A 4C91A 2BZBA 3VR8A 1ZKEA 3UU5A 4U74A 1M62A 4DR3T 2HN2A 2XQYA 1O3XA 4UF0B 5CB4E 2XAGB 5EK3A 5FY7A 5LJMA 4JI0T 2ZM8A 4AXPA 3CK6A 4WNKA 5C8YE 2WDRA 3UTKA 1NEKA 3AA0B 4QHOA 4DV3T 3PUSA 3O1JA 4FI5A 3MKDA 3AB3B 2LOSA 4H9QC 2X0HA 3RGLA 3RX6A 5FXXA 5CFBA 4KX6A 3ZN1B 1MIYA 3RKGA 5ABEA 4LMKA 2DWKA 5LG4A 2AXDS 3VR9A 5FNVE 2J4GA 4IGUA 2H3RA 4A5XA 4DR6T 3NBXX 4TV8E 2LRLA 3ANWB 1KNRA 2NP9A 4AKRB 3T8OA 2VKOA
chains in the Genus database with same CATH topology
3SS1A 4I50E 5LP6E 3OYXA 1FMWA 1D1CA 2D2SA 3K8PC 3WI3A 3ZCJA 2X67A 5KX5E 3P8CD 4HEAA 4YJ3E 5L3EB 5L3DB 1MMGA 2KWIB 2PFVA 3B13A 1D1AA 2WMNA 2K48A 1D0XA 2ODVA 5FXZA 5E0OA 5JRCB 2ZM2A 1LRZA 3BQLA 3MJXA 3KVBA 4IDZA 3MZKB 3AVSA 4J2CA 4OK0A 5L3GB 3R6NA 5JDNA 2YINA 5LA6E 4EZ4A 1MIWA 3ETUA 5ETWA 1MMAA 2Q9QD 3ZMSB 2VWAA 2HH7A 1IJ6A 2BVLA 4HFVA 3P7IA 2JMHA 2VK9A 3HKEE 4EXTA 3SRZA 2OA5A 2A3DA 2VKDA 4U72A 3C4WA 2DCFA 3PTRB 1US7B 5L3CB 2QGSA 5DQVA 3ZCIA 2NW7A 2CXLA 2Y6XA 3AAEB 4ZI3C 5JDHA 4K0UA 2LT3A 3FB2A 3LG7A 5HWYA 4F6RC 2CEAA 2ACXA 2EHOB 2ZM0A 3PUGA 1IJ5A 3VKGA 3GN5B 3AAIA 4GYSA 2CWOA 2NW9A 3H3AA 1KNZA 4IE6A 1T98A 4I55E 2H7OA 5LOVE 3WAJA 1MNEA 5HAXA 2XAFB 5LHHB 4JLEA 1CUNA 3W15B 1AJ3A 4EIWA 2RP4A 1D1BA 5HWXA 3AA7B 5H6QB 4OFZA 1E1HB 4PJJA 2BVMA 5HYAA 1SA0E 5LNKA 5M4YA 4YFSA 2KINB 4AQFA 2J1DG 2W61A 2DNXA 5DABA 4YLHA 3OJAA 2DI4A 4PJLA 5JDQA 3OYZA 3A5XA 3FBZA 2W63A 5LBQB 5LJNA 2CLYC 3LJCA 3EVYA 3PE0A 4ASKA 2X9YA 4H9OC 4CXYA 3RH3A 1HCIA 1ZV4X 1D0ZA 2JRKA 5ADXL 5JR9C 4CXWA 2MBGA 4PFOA 3C51A 2YU1A 5LHIB 3AVRA 3BQKA 3H37A 3GWHA 3LBXB 4P09A 3N9LA 2E9XB 2VKJA 2NTYA 1YKHB 2DHRA 2LM9A 3SOLA 4JEUB 1NAFA 3ZEFB 3ETVA 3J7Yq 1LVKA 4GK0E 3JC6C 4CI2B 2X9HA 2NTXA 3I0OA 4JUYA 3N9NA 4L9IA 4DBRA 3C50A 2V7LA 1KK7A 2LSYA 4AKIA 3BQIA 4GYRA 3DTOA 1U4QA 1HFAA 1HF8A 2Z6EA 1G8XA 2E8IA 2VASA 4MBQA 4UVCB 4DMVA 4QKNA 3K3QC 4GIWA 2VKHA 4TN7B 4WBNE 2Q9QC 3HA4A 3S4UA 4UIGA 3N2OA 5JR9A 3L09A 2PBIA 5LYJE 1EZ3A 2L9QA 4KMCA 1QSDA 3KVAA 4ZHQE 4ZI7E 3PUQA 2KWHA 3CX8B 2V7IA 1ZHCA 4A56A 3PU8A 4YHJA 2N1GA 3MK7C 2XAHB 3D0TA 1ZEEA 3E0ZA 3PUAA 3CX6B 2NWBA 3CQGB 5CA0E 2LEHA 5HXSA 2A2FX 2E9XA 1X79A 3Q5XA 4PW8A 3KV6A 2XUEA 5L3BB 5J1GA 4ZI2C 3TKLB 3U78A 2PG8A 3CPZA 2H7VC 3DJBA 3O1IA 4BJMA 1FMVA 4MLKA 2XHEB 2V7KA 3ZMZB 3QUJA 4HTEA 3NZPA 3FXDB 4IE0A 4ZI2D 4DNDA 2C5JA 5HXEA 1BR4A 5L2LA 2MTQA 5AFUL 3MACA 4O4LE 5KMGP 3ANWA 2C0SA 3GMIA 4YJ2E 2W62A 1FIOA 2ZMAA 4IE7A 3UUNA 1Z0PA 2LJLA 3HKDE 3LFMA 3N2GE 2JQQA 3MA9A 3RRCA 2KZ7B 2CA5A 2YEVC 2D5UA 4XAXB 1UX5A 1D0YA 4UXNB 4BAYB 3UFEA 1YKEB 2CXFA 2KXPB 5IYZE 3RKOA 4H63H 1B7TA 4JEHB 4I4TE 2CCQA 4QX7B 4UV8B 5CA1E 5J2UE 3KBTA 5A1LA 3FHNA 2LSJA 2E9XC 3I1AA 5FY1A 3N9MA 2V26A 2CXDA 5JDMA 4AKLA 2GK9A 2EHOC 3AA1B 2RA1A 3AAAB 3PU3A 1MMNA 5KDMC 4Z8XA 4O2BE 3QC9A 2LHRA 2LOPA 3C4XA 3Q5WA 4ERRA 3J9X1 2K24A 4HKAA 3UUXB 3HL6A 3NRYA 4ISSA 3GA8A 5IHYA 1LVFA 3FBLA 1WRDA 3UT5E 3ZYLA 3ZPOA 4X20E 3I9YA 3ZC1A 1WLXA 4P0BA 4MHCA 4ADZA 4G63A 3OBVE 1YD8G 2P9BA 4OYJA 3KFWX 3DP7A 4V1Av 4P0AA 4XZCA 2XAJB 1BR1A 2X9XA 3L3PA 4KBMB 4UELA 2UXXB 3EDVA 2K9AA 5FXVA 3NRXA 3EDUA 5LXTE 2V7MA 5L3FB 3M65A 3LK3B 3E22E 2EHOA 4PJMA 1IZNB 4WBOA 4DMWA 4OYKA 2N2NA 3RYFE 4PNIA 3LK2B 3ZMTB 4TZ4C 4PAGA 4BJNA 3KV9A 1WYCA 2WAUA 2MOZA 4NUUA 2CLYB 1VRBA 3RYCE 3ONXA 5EK4A 4N78D 3ZLIA 1WR6A 3VHLA 3EUHA 3UULA 1Y64B 2V1DB 3Q2MA 3LBXA 2D0UA 2CMRA 2ODUA 4ZOLE 3ZJ1A 4WW0A 3HKCE 2LSGA 4O8SA 4AQGA 5FXWA 5JVDE 5LGNB 2I59A 4EYYR 1UCUA 2HPLA 3QK6A 4H9SE 2Q9QA 4AKGA 3CWZB 4UEMA 4KP3C 4AKHA 3HKBE 3O1HA 1S35A 2C5IT 2E9XD 2VB6A 2XAQB 5DQWA 4PK6A 3N9OA 2XTLA 5LBMA 4TX5A 3IF8B 1HS7A 4TV9E 3C98B 5EZYE 3ZJ2A 4XBFB 1U5PA 4QXCB 1HX8A 3RPUA 3ZMUB 3OKQA 1QUUA 3CVRA 2BDEA 4IIJE 4X1YE 4ZI3D 4M1PA 3AA6B 4IE5A 3U3IA 4PK5A 4X1IE 4O4IE 2SPCA 3RC3A 2CM0A 3E08A 3MXZA 3K3OA 4PFPA 4QX8B 4EYUA 3KINB 3ZMVB 3BK9A 3IEEA 4UV9B 3V5SA 5FP3A 3B57A 3KV5A 3PDYA 4AI6A 3IHRA 3VU7H 3ZC0A 3N5LA 2IW5B 2XASB 3NZQA 3O4XE 1HG5A 3SWHA 5LCYA 3JC6D 2K5BB 3F31A 2YU2A 4IE4A 2IAKA 3ZN0B 2KLQA 1MNDA 2A72A 1UX4A 2G0UA 2W0GA 4UF0A 5JR9B 4B6XA 3KV4A 3ZYKA 2Y8DA 1YW0A 2X68A 3KDSE 4H63V 4ZS3A 1MMDA 3GN5A 3CKDA 4HGAA 2JMKA 3O9XA 2D0TA 2LSKA 2N9DA 2LSIA 2JJ9A 3R84B 4O4JE 1OWAA 4I43B 4EZHA 2PJQA 4QXHB 5LGTB 1NWMX 4CZZB 3I9WA 5FYMA 4G2AA 5DJQC 4QXBB 4DVDA 4CQIA 4FJOA 5JDFA 3VKHA 3N2KE 4E7ZA 5J2TE 2V7JA 3I0QA 4OHFA 3PURA 5HXHA 2WMOA 4C90A 5F3JA 4PJNA 5JRCA 4EAHA 2CE7A 2L3LA 2WBLA 2NOXA 3N9PA 4CI1B 5GONE 5BMVE 1G73A 2X66A 1VOMA 4H9PC 3CQXC 3HI2A 4DBQA 2X9WA 5JQGE 2M67A 5TAOA 4CXXA 2KMFA 4QWNB 2WSSV 3IBPA 3KBUA 2MYSA 3HR0A 4E7SA 1IAPA 2LE8A 4ISTA 2Q9QB 3RRWA 5LHGB 4EB6E 3F2EA 4MFRA 2X51A 4O4HE 4UVBB 3UUMA 5JH7E 5JDGA 2HPJA 2NW8A 5FY0A 4CI3B 3LK42 4EOZB 3RYHE 3CX7B 1S94A 3CQCB 4BA9A 3C4ZA 3CMLA 5H6RB 2L8KA 5HXRA 3V5UA 4HN9A 5F8PA 4O2AE 3N9QA 4X1KE 5LGUB 4TUYE 5HXCA 5JDLA 2DWGA 2DLRA 3ESLA 4GK5E 1MIVA 1WYBA 4H9NC 5FMNA 4AQFC 4ANJA 2VL8A 2QA7A 3RYIE 2X0LB 2KT9A 4KUMB 3Q9DA 1V9DA 3K3NA 4GOUA 4L0RA 4ZS2A 2ES0A 3ZYMA 1HTJF 5JREA 2WWUA 1BR0A 2CWYA 2IC9A 2JPFA 1LKXA 2B1EA 2KNDA 1HG2A 5EK2A 3FXEB 2EHOD 4NUVA 2C5KT 3F57A 4IHJE 4MALA 3RC8A 1H7CA 1BR2A 2LHNA 4UVAB 3C64A 4ILUA 4PK4A 2W00A 4HE8A 1OXZA 3WAKA 2UXNB 1FEWA 1SHZC 2ZLYA 4L5GA 4DO0A 2Y48B 2YK0A 4H9RC 2IC6A 2WM9A 4C91A 2BZBA 1ZKEA 4U74A 2XQYA 1O3XA 4UF0B 5CB4E 2XAGB 5EK3A 5FY7A 5LJMA 2ZM8A 4AXPA 4WNKA 5C8YE 3UTKA 4QHOA 3AA0B 3PUSA 3O1JA 4FI5A 3MKDA 3AB3B 2LOSA 4H9QC 3RX6A 5FXXA 3ZN1B 1MIYA 2DWKA 5LG4A 5FNVE 4IGUA 2H3RA 3NBXX 4TV8E 3ANWB 2NP9A 4AKRB 3T8OA 2VKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZ3 A;  1S94 A;  2DNX A;  2XHE B;  1HS7 A;  4JEU B;  4JEH B;  3C98 B;  1FIO A;  5M4Y A;  1FEW A;  3LG7 A;  1BR0 A;  4TX5 A;  1G73 A;  5LG4 A; 
#chains in the Genus database with same CATH topology
 3SS1 A;  4X62 T;  4YT0 A;  1W09 A;  4I50 E;  5LP6 E;  4B3T T;  3OYX A;  1FMW A;  1D1C A;  2D2S A;  3AE3 A;  2B76 A;  3K8P C;  4IDN A;  1KFY A;  2X67 A;  3Q5E A;  5HEO A;  2H88 A;  2IHR 1;  3P8C D;  4HEA A;  2BG9 E;  4YJ3 E;  5KX5 E;  5L3E B;  5LMU T;  1J5E T;  2WDV A;  2QYW A;  1MMG A;  2KWI B;  2PFV A;  3B13 A;  1D1A A;  3UUB A;  5L3D B;  2WMN A;  5L47 A;  2K48 A;  1D0X A;  1SUM B;  2ODV A;  4HFD A;  5E0O A;  2YN6 A;  5FXZ A;  4U7Y A;  5JRC B;  3CIR A;  2V6Y A;  2HHH T;  4P1N A;  1XNQ T;  2ZM2 A;  5KXJ A;  1LRZ A;  1W9R A;  3BQL A;  3MJX A;  4IL4 A;  1XWM A;  3KVB A;  4JI1 T;  4IDZ A;  1XMO T;  3MZK B;  1HNW T;  5AQR B;  3AVS A;  4J2C A;  1IBK T;  2DL1 A;  4OK0 A;  3QNU A;  3R6N A;  5L3G B;  3ONL C;  1CHU A;  2YIN A;  3ZT7 A;  3ONJ A;  5LA6 E;  4EZ4 A;  5JDN A;  1MIW A;  3ETU A;  5ETW A;  1MMA A;  2BBJ A;  2Q9Q D;  3ZMS B;  2X0Y A;  4DV1 T;  3VRA A;  2VWA A;  3RIU C;  5AQU B;  2HH7 A;  2QRX A;  1IJ6 A;  2BVL A;  4B3S T;  4HFV A;  3P7I A;  2JMH A;  3ABV A;  3ZST A;  2VK9 A;  3HKE E;  4EXT A;  4YY3 T;  3SRZ A;  1WFD A;  2OA5 A;  4Z90 A;  2A3D A;  2VKD A;  4U72 A;  3C4W A;  2DCF A;  3PTR B;  1US7 B;  2UXD T;  3EAB A;  5L3C B;  3ZCJ A;  1XDP A;  4DUZ T;  2QGS A;  3NKZ A;  4ZZB A;  5C3J A;  2H89 A;  4HFI A;  5DQV A;  3SFE A;  5JTG A;  3ZCI A;  2NW7 A;  2CXL A;  2Y6X A;  3AAE B;  5FVL A;  4ZI3 C;  4ZEY A;  5AQI B;  5JDH A;  4K0U A;  2LT3 A;  2FUP A;  3FB2 A;  3LG7 A;  5HWY A;  5LG3 A;  3AEC A;  4IDO A;  4F6R C;  4EGW A;  2CEA A;  2ACX A;  2EHO B;  2ZM0 A;  3PUG A;  3ZT5 A;  1IJ5 A;  3VKG A;  3GN5 B;  3OVU A;  2WZI A;  3AAI A;  2R6G F;  4GYS A;  2CWO A;  2NW9 A;  5ABF B;  4KHZ F;  3RHW A;  1W0A A;  3H3A A;  1KNZ A;  4ILA A;  4IE6 A;  1N32 T;  1T98 A;  4I55 E;  2H7O A;  5F5W A;  4ILB A;  3PUX F;  5LOV E;  1MNE A;  5FVK A;  2XAF B;  5HAX A;  5LHH B;  4JLE A;  1T8B A;  3AE5 A;  1CUN A;  3VRB A;  3W15 B;  1AJ3 A;  3AE9 A;  2WB5 A;  4EIW A;  3PJA A;  4YHH T;  2RP4 A;  1D1B A;  2WQY A;  5HWX A;  3AA7 B;  2YKS A;  5H6Q B;  3TLS A;  4TWF A;  4OFZ A;  1E1H B;  2BS2 A;  2BVM A;  4I0U A;  1SA0 E;  4PJJ A;  4YTP A;  5HYA A;  5LNK A;  5M4Y A;  4YFS A;  2KIN B;  4AQF A;  2J1D G;  2W61 A;  3FZK B;  4LFB T;  2DNX A;  3IA3 A;  5AQM B;  5DAB A;  2VVS A;  4YLH A;  4KHP T;  3OJA A;  2DI4 A;  2XJ7 A;  4PJL A;  5JDQ A;  3OYZ A;  3A5X A;  4DV5 T;  3FBZ A;  2W63 A;  3PUZ F;  4LML A;  5LBQ B;  4U2Y A;  5LJN A;  2CLY C;  1UUS A;  3EHZ A;  3LJC A;  5BR8 T;  3EVY A;  2UUC T;  3PE0 A;  4ASK A;  2X9Y A;  1J5W A;  3B5M A;  4H9O C;  4YSY A;  4CXY A;  3RH3 A;  1HCI A;  2FJB A;  1ZV4 X;  1D0Z A;  2IDO B;  3JAD A;  2JRK A;  5ADX L;  5JR9 C;  4CXW A;  2MBG A;  3L8R A;  4NPP A;  3C51 A;  4PFO A;  2YU1 A;  3ZSS A;  2XQ9 A;  5LHI B;  3AVR A;  1HNX T;  3BQK A;  3H37 A;  3PUV F;  3GWH A;  3LBX B;  1OED E;  2YDR A;  4ZXL A;  4P09 A;  1YQ4 A;  4YSX A;  3N9L A;  2E9X B;  2VKJ A;  2NTY A;  2BKN A;  1M7K A;  1YKH B;  2DHR A;  2LM9 A;  4WYV A;  3NVO A;  3SOL A;  4JEU B;  1NAF A;  3ZEF B;  4JI3 T;  3ETV A;  3J7Y q;  5LMN T;  1LVK A;  4GK0 E;  4HFE A;  3JC6 C;  4CI2 B;  2F4V T;  4A97 A;  2X9H A;  5AQN B;  2NTX A;  5AQG B;  2IIU A;  3I0O A;  4JUY A;  2JQ9 A;  3N9N A;  4L9I A;  3C50 A;  4DBR A;  2V7L A;  1OED C;  1KK7 A;  5FL1 A;  2LSY A;  4IDQ A;  4AKI A;  3BQI A;  4GYR A;  3DTO A;  1U4Q A;  1HFA A;  1HF8 A;  2Z6E A;  4KI0 F;  1G8X A;  5HCM A;  2E8I A;  2VAS A;  4MBQ A;  4UVC B;  4DMV A;  2VL0 A;  4QH5 A;  5CJ5 A;  4QKN A;  3K3Q C;  3RLF F;  1NEN A;  4COF A;  5HEU A;  4GIW A;  2VKH A;  4TN7 B;  3UU4 A;  4WBN E;  5L4E A;  2Q9Q C;  3HA4 A;  3S4U A;  4UIG A;  4JV5 T;  2FBW A;  3N2O A;  3L09 A;  2PBI A;  5JR9 A;  5LYJ E;  1EZ3 A;  1WCR A;  1SE7 A;  1W0B A;  2L9Q A;  1DU2 A;  4KMC A;  1QSD A;  2BS4 A;  2XY8 B;  3KVA A;  4IT4 A;  2WWV A;  4ZI7 E;  3PUQ A;  4ZHQ E;  2KWH A;  3CX8 B;  5HEG A;  2V7I A;  1ZHC A;  4A56 A;  3PU8 A;  4YHJ A;  2N1G A;  1T7S A;  3MK7 C;  2XAH B;  3D0T A;  1ZEE A;  3E0Z A;  3PUA A;  3CX6 B;  2NWB A;  2VVN A;  3CQG B;  2LEH A;  3LDQ B;  5HEH A;  2A2F X;  4JBW F;  5CA0 E;  4DV7 T;  2E9X A;  4AIU A;  2KSR A;  3QOF A;  1X79 A;  3WI3 A;  3Q5X A;  4JI6 T;  1XMQ T;  4PW8 A;  3KV6 A;  4DR1 T;  2XUE A;  5L3B B;  5J1G A;  4B3R T;  4ZI2 C;  5AQK B;  3TKL B;  3U78 A;  3PV0 F;  5HXS A;  3P4Q A;  4TWH A;  4U2Z A;  2J62 A;  2MPK A;  2PG8 A;  2H7V C;  2WU5 A;  3CPZ A;  3DJB A;  3O1I A;  4BJM A;  1E7P A;  2WU2 A;  1FMV A;  4MLK A;  2XHE B;  2RPA A;  2V7K A;  3ZMZ B;  3QUJ A;  4HTE A;  4NXM T;  2UUB T;  2V6X A;  1YXR A;  3NZP A;  4JI4 T;  3FXD B;  4IE0 A;  2M6I A;  4ZI2 D;  4DND A;  2C5J A;  5HXE A;  1BR4 A;  4ILC A;  5L2L A;  4K0K T;  2MTQ A;  5AFU L;  3MAC A;  4O4L E;  5KMG P;  3ANW A;  2C0S A;  1N34 T;  3GMI A;  4YJ2 E;  1VCT A;  2W62 A;  1FIO A;  3RI5 A;  2ZMA A;  1I94 T;  4IE7 A;  4GKK T;  3UUN A;  1Z0P A;  2LJL A;  3HKD E;  3LFM A;  3N2G E;  3OTO T;  2JQQ A;  2XQ8 A;  3MA9 A;  3RRC A;  2KZ7 B;  5AQQ B;  2CA5 A;  2YEV C;  2D5U A;  4XAX B;  1UX5 A;  1E2A A;  1D0Y A;  4UXN B;  4BAY B;  3UFE A;  5IWA T;  2XSB A;  1YKE B;  2FJD A;  2CXF A;  2KXP B;  3L39 A;  5IYZ E;  3RKO A;  5ABF A;  4H63 H;  4HWC A;  1B7T A;  4JEH B;  2WDQ A;  2CCQ A;  4I4T E;  2JQK A;  4QX7 B;  4UV8 B;  3KBT A;  4EEB A;  5CA1 E;  5A1L A;  5J2U E;  3FHN A;  2LSJ A;  2E9X C;  1XDO A;  3AEB A;  3AE4 A;  2V26 A;  1OED A;  3I1A A;  2CXD A;  3N9M A;  5FY1 A;  3UU6 A;  5JDM A;  4AKL A;  2GK9 A;  2EHO C;  3AA1 B;  2RA1 A;  2VQF T;  3AAA B;  4NXN T;  3PU3 A;  1MMN A;  5KDM C;  2K3W A;  4Z8X A;  5AQP B;  2W67 A;  4O2B E;  3QC9 A;  1KEY A;  2LHR A;  2LOP A;  3C4X A;  3Q5W A;  4ERR A;  3J9X 1;  2K24 A;  4HKA A;  4LFC T;  2WCA A;  1YQ3 A;  4JI7 T;  4X64 T;  3UUX B;  3HL6 A;  3NRY A;  4ISS A;  4UR9 A;  3GA8 A;  2LRK A;  5IHY A;  1LVF A;  3FBL A;  4LFA T;  4GKJ T;  1WRD A;  3UT5 E;  3ZYL A;  4DR2 T;  5AQJ B;  3ZPO A;  4X20 E;  3I9Y A;  3ZC1 A;  1WLX A;  5LB7 B;  1Z8U A;  3FZL B;  4MHC A;  4P0B A;  4ADZ A;  4G63 A;  4X5T A;  3OBV E;  1VCS A;  1YD8 G;  4HFH A;  3RIA A;  4YTN A;  2P9B A;  4OYJ A;  3KFW X;  3DP7 A;  3M3Z B;  4V1A v;  4LF5 T;  4X65 T;  3AXJ A;  4P0A A;  4XZC A;  5ABG A;  2XAJ B;  1BR1 A;  4HWH A;  2X9X A;  3L3P A;  4KBM B;  3FZM B;  2V8S V;  2UXX B;  3EDV A;  4UEL A;  5AQT B;  2V6Y B;  4HWI B;  2K9A A;  5C2T A;  5FXV A;  3NRX A;  3EDU A;  5LXT E;  2V7M A;  2PTF A;  5L3F B;  2ZM6 T;  3M65 A;  3LK3 B;  3E22 E;  2EHO A;  4PJM A;  1IZN B;  4WBO A;  4DMW A;  4OYK A;  2N2N A;  5L4H A;  3RYF E;  4PNI A;  3LK2 B;  4HFB A;  3RQW A;  3ZMT B;  2W2U A;  1HNZ T;  3RIU A;  2E5L T;  2IML A;  4TZ4 C;  4PAG A;  5AQF B;  4BJN A;  3KV9 A;  4JI5 T;  1WYC A;  2WAU A;  2MOZ A;  3P50 A;  3FZH B;  4NUU A;  2CLY B;  1VRB A;  4DID B;  2BKP A;  2I0M A;  3RYC E;  3ONX A;  5EK4 A;  4N78 D;  3ZLI A;  1N36 T;  2W66 A;  1OED B;  4IDP A;  1JNZ A;  1WR6 A;  2BBH A;  3VHL A;  3EUH A;  2E5V A;  3UUL A;  1Y64 B;  2V1D B;  3Q2M A;  1HR0 T;  3LBX A;  2D0U A;  2CMR A;  2ODU A;  4ZOL E;  4LF8 T;  4WW0 A;  3ZJ1 A;  2J47 A;  3HKC E;  4B3M T;  1JNR A;  2LSG A;  3NWI A;  4HFC A;  4O8S A;  3QB5 A;  5FXW A;  2WP9 A;  4AQG A;  1N33 T;  1IBL T;  5JVD E;  5LGN B;  4EV6 A;  4AQY T;  2I59 A;  4EYY R;  1UCU A;  2HPL A;  3QK6 A;  4H9S E;  2Q9Q A;  4TNW A;  3TLW A;  3CWZ B;  4UEM A;  4AKG A;  2IUB A;  4KP3 C;  4AKH A;  3HKB E;  3O1H A;  1S35 A;  4DV6 T;  2C5I T;  2E9X D;  2VB6 A;  2XAQ B;  5DQW A;  4PK6 A;  3N9O A;  2D9D A;  1T72 A;  2JQH A;  2XTL A;  5LBM A;  3ZT6 A;  4TX5 A;  4LF6 T;  2YOE A;  3IF8 B;  4DR5 T;  1HS7 A;  4TV9 E;  2BG9 A;  3C98 B;  3A7M A;  5EZY E;  3ZJ2 A;  2QVA A;  2VQE T;  1U5P A;  2ACZ A;  4XBF B;  4QXC B;  1HX8 A;  3RPU A;  1HX1 B;  2CHN A;  3JCF A;  3TLV A;  3OKQ A;  2BKO A;  1L0V A;  1QUU A;  3H3M A;  3CVR A;  3ZMU B;  2BDE A;  2BS3 A;  4IIJ E;  4X1Y E;  4ZI3 D;  4DV0 T;  4M1P A;  1X9B A;  2WS3 A;  2VUR A;  3AA6 B;  4IE5 A;  4PK5 A;  4X1I E;  4O4I E;  3U3I A;  3UU8 A;  2SPC A;  3RC3 A;  4CN4 A;  4U33 A;  2CM0 A;  3E08 A;  3MXZ A;  3K3O A;  4PFP A;  4QX8 B;  3SFD A;  4U31 A;  3UU3 A;  4EYU A;  1XNR T;  1KNP A;  3KIN B;  3ZMV B;  3BK9 A;  3IEE A;  4U7I A;  4UV9 B;  3RF1 A;  3V5S A;  5FP3 A;  3QB5 K;  3B57 A;  3KV5 A;  3PDY A;  4AI6 A;  3IHR A;  3RQU A;  2FJE A;  3VU7 H;  3ZC0 A;  3N5L A;  2IW5 B;  5AQV B;  2XAS B;  3LSV A;  3AE7 A;  3NZQ A;  3O4X E;  1HG5 A;  4AIS A;  3T1H T;  4JI8 T;  2XQ6 A;  3SWH A;  2CBI A;  5LCY A;  3JC6 D;  2K5B B;  2CPT A;  3F31 A;  2YU2 A;  4IE4 A;  2IAK A;  4QH1 A;  3ZN0 B;  2KLQ A;  2NR4 A;  1MND A;  2A72 A;  1UX4 A;  2G0U A;  2W0G A;  3AEE A;  3PUY F;  4UF0 A;  5JR9 B;  1I6Z A;  4B6X A;  3KV4 A;  3ZYK A;  4WZX A;  3UQ7 A;  4QH4 A;  2XPK A;  2Y8D A;  1YW0 A;  5FL0 A;  3UQ4 A;  1GQE A;  2X68 A;  3T1Y T;  3KDS E;  2BG9 C;  4H63 V;  4HWF A;  3Q5D A;  1J1J A;  5CGM A;  4ZS3 A;  4CN1 A;  1MMD A;  2CBJ A;  3OPC A;  2LM2 A;  3GN5 A;  3CKD A;  4HGA A;  2JMK A;  4TWD A;  5AQH B;  3O9X A;  2D0T A;  2LSK A;  2N9D A;  2LSI A;  2JJ9 A;  2XQA A;  4O4J E;  3R84 B;  1OWA A;  4I43 B;  4EZH A;  2PJQ A;  3AEA A;  4QXH B;  5LGT B;  1NWM X;  4CZZ B;  1FJG T;  3I9W A;  5FYM A;  4G2A A;  2XM2 A;  3AE6 A;  5AQS B;  3EI0 A;  2XZE A;  5DJQ C;  4QXB B;  4DVD A;  4CQI A;  2E2A A;  4FJO A;  2XQ5 A;  5JDF A;  4U3C A;  4A98 A;  3VKH A;  3N2K E;  4E7Z A;  5J2T E;  3FZF B;  2V7J A;  4YTM A;  1ZOY A;  3I0Q A;  4OHF A;  3PUR A;  5HXH A;  2WMO A;  3ZKR A;  4C90 A;  5F3J A;  4PJN A;  4CN6 A;  2XQ7 A;  5JRC A;  3TLT A;  2WY2 A;  4EAH A;  2CE7 A;  2L3L A;  2WBL A;  2NOX A;  3N9P A;  5IUX A;  4DUY T;  1UGO A;  4CI1 B;  2MAW A;  5GON E;  5BMV E;  1G73 A;  2X66 A;  1VOM A;  4H9P C;  3CQX C;  3HI2 A;  3AEF A;  4Z91 A;  2X9W A;  2I6H A;  4DBQ A;  3UFG A;  5JQG E;  2V5C A;  1UK5 A;  2M67 A;  4IRE A;  5TAO A;  4CXX A;  2KMF A;  4QWN B;  2WSS V;  3IBP A;  2LKG A;  3KBU A;  3P4S A;  1UUR A;  2MYS A;  2OLT A;  3HR0 A;  4E7S A;  2LLY A;  2OV9 A;  2V5D A;  1IAP A;  3JAF A;  4LF4 T;  2UXC T;  2LE8 A;  2UXB T;  4HWD A;  4EED A;  4IST A;  4DV4 T;  3P4R A;  2XSA A;  4F8H A;  2Q9Q B;  4TNV A;  3RRW A;  5LHG B;  3A8Y C;  4EB6 E;  3F2E A;  2YDQ A;  2LKH A;  3PUW F;  4MFR A;  3EAM A;  3X1D A;  1R8I A;  2XQ4 A;  2X51 A;  3WAJ A;  4O4H E;  2JIW A;  5ABH A;  4Q25 A;  5AQL B;  2A9U A;  4UVB B;  2CHO A;  1QLB A;  3UUM A;  5JDG A;  5JH7 E;  2HPJ A;  2NW8 A;  2YDS A;  5FY0 A;  3AEG A;  3LK4 2;  4CI3 B;  4EOZ B;  3RYH E;  5FKY A;  1WR0 A;  3CX7 B;  1S94 A;  3AE1 A;  3CQC B;  4LMJ A;  4BA9 A;  3C4Z A;  2HN1 A;  3CML A;  1KF6 A;  2L8K A;  3AE2 A;  5H6R B;  5HXR A;  4JI2 T;  4HN9 A;  3V5U A;  3JAE A;  4DR7 T;  4ZZC A;  5F8P A;  2UU9 T;  4JYA T;  4O2A E;  3N9Q A;  5J0Z A;  4X1K E;  4DR4 T;  5LGU B;  4TUY E;  2W4X A;  5HXC A;  5JDL A;  2DWG A;  4LF9 T;  2DLR A;  3ESL A;  4GK5 E;  1MIV A;  1WYB A;  4H9N C;  5FMN A;  4YXD A;  4AQF C;  4ANJ A;  2VL8 A;  2QA7 A;  3RYI E;  2X0L B;  2KT9 A;  2AE9 A;  4KUM B;  3AED A;  1V9D A;  3G06 A;  2FJA A;  3Q9D A;  4X66 T;  2WZH A;  2UUA T;  3AXJ B;  3P4P A;  3K3N A;  4GOU A;  4IL9 A;  4L0R A;  4YSZ A;  4ZS2 A;  2ES0 A;  3ZYM A;  4OX9 T;  1HTJ F;  1XZY A;  2WWU A;  5JRE A;  1BR0 A;  2CWY A;  3TLU A;  2IC9 A;  2JPF A;  1LKX A;  2B1E A;  2KND A;  3K1S A;  1IBM T;  1HG2 A;  3PJA J;  5EK2 A;  2CRB A;  3FXE B;  2EHO D;  4NUV A;  2C5K T;  3F57 A;  4IHJ E;  4MAL A;  4NIQ A;  3P4W A;  2M6B A;  2XQ3 A;  3RC8 A;  1H7C A;  1BR2 A;  2LHN A;  4UVA B;  3C64 A;  4ILU A;  4PK4 A;  3RIF A;  2W00 A;  2BG9 B;  4HE8 A;  4DV2 T;  4LF7 T;  1OXZ A;  2XM1 A;  2UXN B;  1FEW A;  1SHZ C;  2ZLY A;  3AE8 A;  4L5G A;  3WAK A;  4DO0 A;  5AQO B;  5HEJ A;  2Y48 B;  2YK0 A;  4H9R C;  1Y01 A;  2IC6 A;  2WM9 A;  5HCJ A;  1ZP0 A;  4C91 A;  2BZB A;  3VR8 A;  1ZKE A;  3UU5 A;  4U74 A;  1M62 A;  4DR3 T;  2HN2 A;  2XQY A;  1O3X A;  4UF0 B;  5CB4 E;  2XAG B;  5EK3 A;  5FY7 A;  5LJM A;  4JI0 T;  2ZM8 A;  4AXP A;  3CK6 A;  4WNK A;  5C8Y E;  2WDR A;  3UTK A;  1NEK A;  3AA0 B;  4QHO A;  4DV3 T;  3PUS A;  3O1J A;  4FI5 A;  3MKD A;  3AB3 B;  2LOS A;  4H9Q C;  2X0H A;  3RGL A;  3RX6 A;  5FXX A;  5CFB A;  4KX6 A;  3ZN1 B;  1MIY A;  3RKG A;  5ABE A;  4LMK A;  2DWK A;  5LG4 A;  2AXD S;  3VR9 A;  5FNV E;  2J4G A;  4IGU A;  2H3R A;  4A5X A;  4DR6 T;  3NBX X;  4TV8 E;  2LRL A;  3ANW B;  1KNR A;  2NP9 A;  4AKR B;  3T8O A;  2VKO A; 
#chains in the Genus database with same CATH homology
 3SS1 A;  4I50 E;  5LP6 E;  3OYX A;  1FMW A;  1D1C A;  2D2S A;  3K8P C;  3WI3 A;  3ZCJ A;  2X67 A;  5KX5 E;  3P8C D;  4HEA A;  4YJ3 E;  5L3E B;  5L3D B;  1MMG A;  2KWI B;  2PFV A;  3B13 A;  1D1A A;  2WMN A;  2K48 A;  1D0X A;  2ODV A;  5FXZ A;  5E0O A;  5JRC B;  2ZM2 A;  1LRZ A;  3BQL A;  3MJX A;  3KVB A;  4IDZ A;  3MZK B;  3AVS A;  4J2C A;  4OK0 A;  5L3G B;  3R6N A;  5JDN A;  2YIN A;  5LA6 E;  4EZ4 A;  1MIW A;  3ETU A;  5ETW A;  1MMA A;  2Q9Q D;  3ZMS B;  2VWA A;  2HH7 A;  1IJ6 A;  2BVL A;  4HFV A;  3P7I A;  2JMH A;  2VK9 A;  3HKE E;  4EXT A;  3SRZ A;  2OA5 A;  2A3D A;  2VKD A;  4U72 A;  3C4W A;  2DCF A;  3PTR B;  1US7 B;  5L3C B;  2QGS A;  5DQV A;  3ZCI A;  2NW7 A;  2CXL A;  2Y6X A;  3AAE B;  4ZI3 C;  5JDH A;  4K0U A;  2LT3 A;  3FB2 A;  3LG7 A;  5HWY A;  4F6R C;  2CEA A;  2ACX A;  2EHO B;  2ZM0 A;  3PUG A;  1IJ5 A;  3VKG A;  3GN5 B;  3AAI A;  4GYS A;  2CWO A;  2NW9 A;  3H3A A;  1KNZ A;  4IE6 A;  1T98 A;  4I55 E;  2H7O A;  5LOV E;  3WAJ A;  1MNE A;  5HAX A;  2XAF B;  5LHH B;  4JLE A;  1CUN A;  3W15 B;  1AJ3 A;  4EIW A;  2RP4 A;  1D1B A;  5HWX A;  3AA7 B;  5H6Q B;  4OFZ A;  1E1H B;  4PJJ A;  2BVM A;  5HYA A;  1SA0 E;  5LNK A;  5M4Y A;  4YFS A;  2KIN B;  4AQF A;  2J1D G;  2W61 A;  2DNX A;  5DAB A;  4YLH A;  3OJA A;  2DI4 A;  4PJL A;  5JDQ A;  3OYZ A;  3A5X A;  3FBZ A;  2W63 A;  5LBQ B;  5LJN A;  2CLY C;  3LJC A;  3EVY A;  3PE0 A;  4ASK A;  2X9Y A;  4H9O C;  4CXY A;  3RH3 A;  1HCI A;  1ZV4 X;  1D0Z A;  2JRK A;  5ADX L;  5JR9 C;  4CXW A;  2MBG A;  4PFO A;  3C51 A;  2YU1 A;  5LHI B;  3AVR A;  3BQK A;  3H37 A;  3GWH A;  3LBX B;  4P09 A;  3N9L A;  2E9X B;  2VKJ A;  2NTY A;  1YKH B;  2DHR A;  2LM9 A;  3SOL A;  4JEU B;  1NAF A;  3ZEF B;  3ETV A;  3J7Y q;  1LVK A;  4GK0 E;  3JC6 C;  4CI2 B;  2X9H A;  2NTX A;  3I0O A;  4JUY A;  3N9N A;  4L9I A;  4DBR A;  3C50 A;  2V7L A;  1KK7 A;  2LSY A;  4AKI A;  3BQI A;  4GYR A;  3DTO A;  1U4Q A;  1HFA A;  1HF8 A;  2Z6E A;  1G8X A;  2E8I A;  2VAS A;  4MBQ A;  4UVC B;  4DMV A;  4QKN A;  3K3Q C;  4GIW A;  2VKH A;  4TN7 B;  4WBN E;  2Q9Q C;  3HA4 A;  3S4U A;  4UIG A;  3N2O A;  5JR9 A;  3L09 A;  2PBI A;  5LYJ E;  1EZ3 A;  2L9Q A;  4KMC A;  1QSD A;  3KVA A;  4ZHQ E;  4ZI7 E;  3PUQ A;  2KWH A;  3CX8 B;  2V7I A;  1ZHC A;  4A56 A;  3PU8 A;  4YHJ A;  2N1G A;  3MK7 C;  2XAH B;  3D0T A;  1ZEE A;  3E0Z A;  3PUA A;  3CX6 B;  2NWB A;  3CQG B;  5CA0 E;  2LEH A;  5HXS A;  2A2F X;  2E9X A;  1X79 A;  3Q5X A;  4PW8 A;  3KV6 A;  2XUE A;  5L3B B;  5J1G A;  4ZI2 C;  3TKL B;  3U78 A;  2PG8 A;  3CPZ A;  2H7V C;  3DJB A;  3O1I A;  4BJM A;  1FMV A;  4MLK A;  2XHE B;  2V7K A;  3ZMZ B;  3QUJ A;  4HTE A;  3NZP A;  3FXD B;  4IE0 A;  4ZI2 D;  4DND A;  2C5J A;  5HXE A;  1BR4 A;  5L2L A;  2MTQ A;  5AFU L;  3MAC A;  4O4L E;  5KMG P;  3ANW A;  2C0S A;  3GMI A;  4YJ2 E;  2W62 A;  1FIO A;  2ZMA A;  4IE7 A;  3UUN A;  1Z0P A;  2LJL A;  3HKD E;  3LFM A;  3N2G E;  2JQQ A;  3MA9 A;  3RRC A;  2KZ7 B;  2CA5 A;  2YEV C;  2D5U A;  4XAX B;  1UX5 A;  1D0Y A;  4UXN B;  4BAY B;  3UFE A;  1YKE B;  2CXF A;  2KXP B;  5IYZ E;  3RKO A;  4H63 H;  1B7T A;  4JEH B;  4I4T E;  2CCQ A;  4QX7 B;  4UV8 B;  5CA1 E;  5J2U E;  3KBT A;  5A1L A;  3FHN A;  2LSJ A;  2E9X C;  3I1A A;  5FY1 A;  3N9M A;  2V26 A;  2CXD A;  5JDM A;  4AKL A;  2GK9 A;  2EHO C;  3AA1 B;  2RA1 A;  3AAA B;  3PU3 A;  1MMN A;  5KDM C;  4Z8X A;  4O2B E;  3QC9 A;  2LHR A;  2LOP A;  3C4X A;  3Q5W A;  4ERR A;  3J9X 1;  2K24 A;  4HKA A;  3UUX B;  3HL6 A;  3NRY A;  4ISS A;  3GA8 A;  5IHY A;  1LVF A;  3FBL A;  1WRD A;  3UT5 E;  3ZYL A;  3ZPO A;  4X20 E;  3I9Y A;  3ZC1 A;  1WLX A;  4P0B A;  4MHC A;  4ADZ A;  4G63 A;  3OBV E;  1YD8 G;  2P9B A;  4OYJ A;  3KFW X;  3DP7 A;  4V1A v;  4P0A A;  4XZC A;  2XAJ B;  1BR1 A;  2X9X A;  3L3P A;  4KBM B;  4UEL A;  2UXX B;  3EDV A;  2K9A A;  5FXV A;  3NRX A;  3EDU A;  5LXT E;  2V7M A;  5L3F B;  3M65 A;  3LK3 B;  3E22 E;  2EHO A;  4PJM A;  1IZN B;  4WBO A;  4DMW A;  4OYK A;  2N2N A;  3RYF E;  4PNI A;  3LK2 B;  3ZMT B;  4TZ4 C;  4PAG A;  4BJN A;  3KV9 A;  1WYC A;  2WAU A;  2MOZ A;  4NUU A;  2CLY B;  1VRB A;  3RYC E;  3ONX A;  5EK4 A;  4N78 D;  3ZLI A;  1WR6 A;  3VHL A;  3EUH A;  3UUL A;  1Y64 B;  2V1D B;  3Q2M A;  3LBX A;  2D0U A;  2CMR A;  2ODU A;  4ZOL E;  3ZJ1 A;  4WW0 A;  3HKC E;  2LSG A;  4O8S A;  4AQG A;  5FXW A;  5JVD E;  5LGN B;  2I59 A;  4EYY R;  1UCU A;  2HPL A;  3QK6 A;  4H9S E;  2Q9Q A;  4AKG A;  3CWZ B;  4UEM A;  4KP3 C;  4AKH A;  3HKB E;  3O1H A;  1S35 A;  2C5I T;  2E9X D;  2VB6 A;  2XAQ B;  5DQW A;  4PK6 A;  3N9O A;  2XTL A;  5LBM A;  4TX5 A;  3IF8 B;  1HS7 A;  4TV9 E;  3C98 B;  5EZY E;  3ZJ2 A;  4XBF B;  1U5P A;  4QXC B;  1HX8 A;  3RPU A;  3ZMU B;  3OKQ A;  1QUU A;  3CVR A;  2BDE A;  4IIJ E;  4X1Y E;  4ZI3 D;  4M1P A;  3AA6 B;  4IE5 A;  3U3I A;  4PK5 A;  4X1I E;  4O4I E;  2SPC A;  3RC3 A;  2CM0 A;  3E08 A;  3MXZ A;  3K3O A;  4PFP A;  4QX8 B;  4EYU A;  3KIN B;  3ZMV B;  3BK9 A;  3IEE A;  4UV9 B;  3V5S A;  5FP3 A;  3B57 A;  3KV5 A;  3PDY A;  4AI6 A;  3IHR A;  3VU7 H;  3ZC0 A;  3N5L A;  2IW5 B;  2XAS B;  3NZQ A;  3O4X E;  1HG5 A;  3SWH A;  5LCY A;  3JC6 D;  2K5B B;  3F31 A;  2YU2 A;  4IE4 A;  2IAK A;  3ZN0 B;  2KLQ A;  1MND A;  2A72 A;  1UX4 A;  2G0U A;  2W0G A;  4UF0 A;  5JR9 B;  4B6X A;  3KV4 A;  3ZYK A;  2Y8D A;  1YW0 A;  2X68 A;  3KDS E;  4H63 V;  4ZS3 A;  1MMD A;  3GN5 A;  3CKD A;  4HGA A;  2JMK A;  3O9X A;  2D0T A;  2LSK A;  2N9D A;  2LSI A;  2JJ9 A;  3R84 B;  4O4J E;  1OWA A;  4I43 B;  4EZH A;  2PJQ A;  4QXH B;  5LGT B;  1NWM X;  4CZZ B;  3I9W A;  5FYM A;  4G2A A;  5DJQ C;  4QXB B;  4DVD A;  4CQI A;  4FJO A;  5JDF A;  3VKH A;  3N2K E;  4E7Z A;  5J2T E;  2V7J A;  3I0Q A;  4OHF A;  3PUR A;  5HXH A;  2WMO A;  4C90 A;  5F3J A;  4PJN A;  5JRC A;  4EAH A;  2CE7 A;  2L3L A;  2WBL A;  2NOX A;  3N9P A;  4CI1 B;  5GON E;  5BMV E;  1G73 A;  2X66 A;  1VOM A;  4H9P C;  3CQX C;  3HI2 A;  4DBQ A;  2X9W A;  5JQG E;  2M67 A;  5TAO A;  4CXX A;  2KMF A;  4QWN B;  2WSS V;  3IBP A;  3KBU A;  2MYS A;  3HR0 A;  4E7S A;  1IAP A;  2LE8 A;  4IST A;  2Q9Q B;  3RRW A;  5LHG B;  4EB6 E;  3F2E A;  4MFR A;  2X51 A;  4O4H E;  4UVB B;  3UUM A;  5JH7 E;  5JDG A;  2HPJ A;  2NW8 A;  5FY0 A;  4CI3 B;  3LK4 2;  4EOZ B;  3RYH E;  3CX7 B;  1S94 A;  3CQC B;  4BA9 A;  3C4Z A;  3CML A;  5H6R B;  2L8K A;  5HXR A;  3V5U A;  4HN9 A;  5F8P A;  4O2A E;  3N9Q A;  4X1K E;  5LGU B;  4TUY E;  5HXC A;  5JDL A;  2DWG A;  2DLR A;  3ESL A;  4GK5 E;  1MIV A;  1WYB A;  4H9N C;  5FMN A;  4AQF C;  4ANJ A;  2VL8 A;  2QA7 A;  3RYI E;  2X0L B;  2KT9 A;  4KUM B;  3Q9D A;  1V9D A;  3K3N A;  4GOU A;  4L0R A;  4ZS2 A;  2ES0 A;  3ZYM A;  1HTJ F;  5JRE A;  2WWU A;  1BR0 A;  2CWY A;  2IC9 A;  2JPF A;  1LKX A;  2B1E A;  2KND A;  1HG2 A;  5EK2 A;  3FXE B;  2EHO D;  4NUV A;  2C5K T;  3F57 A;  4IHJ E;  4MAL A;  3RC8 A;  1H7C A;  1BR2 A;  2LHN A;  4UVA B;  3C64 A;  4ILU A;  4PK4 A;  2W00 A;  4HE8 A;  1OXZ A;  3WAK A;  2UXN B;  1FEW A;  1SHZ C;  2ZLY A;  4L5G A;  4DO0 A;  2Y48 B;  2YK0 A;  4H9R C;  2IC6 A;  2WM9 A;  4C91 A;  2BZB A;  1ZKE A;  4U74 A;  2XQY A;  1O3X A;  4UF0 B;  5CB4 E;  2XAG B;  5EK3 A;  5FY7 A;  5LJM A;  2ZM8 A;  4AXP A;  4WNK A;  5C8Y E;  3UTK A;  4QHO A;  3AA0 B;  3PUS A;  3O1J A;  4FI5 A;  3MKD A;  3AB3 B;  2LOS A;  4H9Q C;  3RX6 A;  5FXX A;  3ZN1 B;  1MIY A;  2DWK A;  5LG4 A;  5FNV E;  4IGU A;  2H3R A;  3NBX X;  4TV8 E;  3ANW B;  2NP9 A;  4AKR B;  3T8O A;  2VKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...