5M4YA

Crystal structure of the sec3/sso2 complex at 2.20 angstrom resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
177
Chain Sequence
SHMDFVAFMNKINSINANLSRYENIINQIDAQHKDLLTQVSEEQEMELRRSLDDYISQATDLQYQLKADIKDAQRDGLHDSNKQAQAENCRQKFLKLIQDYRIIDSNYKEESKEQAKRQYTIIQPEATDEEVEAAINDVNGQKTALAEVQARHQELLKLEKTMAELTQLFNDMEELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SSO2
publication title Sec3 promotes the initial binary t-SNARE complex assembly and membrane fusion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Structural protein
total genus 80
structure length 177
sequence length 193
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2016-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5m4yA00
4JEHB 4TX5A 4JEUB 3LG7A 1FIOA 1EZ3A 1HS7A 1FEWA 2XHEB 1BR0A 1G73A 5M4YA 1S94A 3C98B 5LG4A 2DNXA
chains in the Genus database with same CATH superfamily
5LXTE 3AA0B 4MHCA 4U2ZA 5EK2A 5EK3A 2YU1A 5IYZE 1YW0A 3ZT5A 4AKRB 2QVAA 3LK42 3NVOA 5LG4A 5IUXA 5JQGE 2EHOD 2NR4A 2SPCA 4HWIB 4UXNB 4CXWA 1WRDA 3HKCE 2V8SV 2CXDA 1NEKA 4LMLA 2G0UA 4L0RA 4U74A 3PUAA 2JMHA 3RIUC 2C5JA 3RKGA 5FL1A 4JI8T 2LOSA 2ODVA 1UK5A 3AVRA 1J5WA 3P4WA 3AE3A 4EGWA 2DL1A 5LMUT 3BK9A 2BVMA 3AEFA 4EZHA 3MJXA 4UVBB 2UXDT 3PU8A 3UU3A 5LHGB 4TWDA 1FEWA 2CHNA 2BKPA 1D1CA 3C51A 4B3ST 1KF6A 4EIWA 4IDPA 3AECA 2KSRA 3AE6A 3ZPOA 4P09A 3U3IA 3KV9A 4AQFA 3AB3B 4GK0E 4O2AE 3CK6A 1HX1B 4XZCA 2BS2A 2ZLYA 4A97A 2E2AA 4TZ4C 1XMOT 4IE5A 5C3JA 2I6HA 3CQCB 4TWHA 5LGUB 4NUVA 3ZMVB 2HH7A 1WYBA 1OXZA 1FJGT 1IZNB 2Y6XA 4TN7B 1QSDA 4HWHA 5AQGB 2GK9A 5A1LA 2IC6A 2N9DA 3ZYMA 3E22E 2XHEB 4UIGA 3UU4A 5AQPB 2K9AA 2LKHA 3N5LA 3ETVA 3ESLA 2RP4A 2PG8A 1SE7A 3ONJA 2XQYA 4ERRA 2LEHA 1XNRT 4HWCA 2LM2A 4V1Av 3B13A 2KNDA 2X67A 1N36T 4F8HA 4O4IE 1KFYA 5CB4E 5LP6E 4WNKA 1VCSA 2C5KT 3EVYA 5HEJA 2CPTA 4DV3T 5BR8T 3P8CD 4ZS2A 3R84B 3RIFA 4DV0T 1WFDA 2BKOA 3ZLIA 4KI0F 3KV5A 4DR2T 4DMWA 3ZKRA 2CCQA 4E7ZA 3C4WA 3RH3A 2YK0A 4AIUA 2XQ3A 3IEEA 4I4TE 1HF8A 5FKYA 2RPAA 2WDRA 4UR9A 4EOZB 2BG9B 1IJ6A 2X66A 5AQRB 2H89A 3AA6B 4IL9A 1HG5A 1D0YA 4O2BE 1LVFA 4DNDA 3PU3A 4CQIA 3FZMB 4YJ2E 3HR0A 3UULA 3ZC0A 1J5ET 3CIRA 2CMRA 4DUYT 2DHRA 4G63A 4YY3T 1H7CA 3C64A 4ZEYA 2XY8B 2XSBA 4YTPA 5CGMA 2YINA 1WR0A 2CBIA 3C4ZA 5JDLA 2XJ7A 4LMKA 2CWYA 3RLFF 4PJJA 1ZHCA 3QNUA 5FXZA 2WM9A 5AQJB 2C5IT 4P0BA 4LFBT 5JVDE 4AI6A 3CQXC 2BS3A 2XAQB 4JI4T 3AAEB 4DV5T 2BG9C 3TKLB 2NP9A 5F8PA 4N78D 5J1GA 4EYYR 1MMNA 3UUNA 3AAIA 2W4XA 2XAFB 5BMVE 4EEDA 2XQ6A 4ANJA 3Q5DA 4QXCB 3CX7B 5GONE 3FBZA 2C0SA 2NWBA 2W00A 5FXVA 1SA0E 3CX6B 4U33A 4K0KT 2FBWA 2V6XA 1UX4A 4IE0A 2YDQA 4E7SA 5HCMA 4NXMT 2KMFA 3RIAA 1O3XA 3PUYF 4O4JE 5FY7A 1VCTA 1W0BA 3I0QA 2M67A 1MIYA 1HNXT 1XDPA 3ZMZB 2KWHA 4GK5E 3O4XE 1OWAA 4HFIA 4O4LE 4K0UA 2JQ9A 2BVLA 4KMCA 2X9WA 3TLWA 2W66A 3PE0A 4ZI3C 4QH5A 3CKDA 3HKEE 2X51A 3CX8B 2IW5B 3NZQA 4BA9A 2YN6A 2YU2A 3AEEA 2FUPA 2H7VC 1FMVA 5JH7E 3PUGA 3UUBA 3GMIA 4JUYA 4IHJE 4IT4A 3FBLA 4QXHB 2HN2A 4UEMA 4IGUA 3N9OA 1BR1A 4NPPA 5AQQB 2E5VA 3DTOA 4MALA 4F6RC 5HEOA 5JDQA 2QA7A 4PJNA 3PUWF 3KVAA 3C98B 2RA1A 4JV5T 5HXHA 4MFRA 3LK2B 1T72A 2CXLA 5AQFB 5DQVA 1E2AA 2WU5A 5LCYA 5ABFB 4PAGA 4EEBA 3N2GE 3LBXB 1M7KA 5JREA 1EZ3A 2XQ8A 4H9NC 4ZHQE 2F4VT 4UV9B 3AAAB 2WMOA 3D0TA 3RIUA 4ZI2D 2XAHB 3K8PC 1G73A 2UU9T 4ILBA 1BR2A 3N2KE 4B6XA 1FMWA 2BG9E 3AEBA 3VKGA 3WAJA 4KUMB 3ZJ1A 3PUXF 1T7SA 4BJMA 1HR0T 4LF6T 3KBTA 4OHFA 2ZM0A 1IBKT 3K1SA 1T98A 1YKHB 4PK6A 3KV6A 1UURA 3JAEA 5LBQB 2IHR1 2NW9A 3N2OA 5AFUL 2KZ7B 3PDYA 1U5PA 1HS7A 2LE8A 3OBVE 1X9BA 2W2UA 3RPUA 4M1PA 5FYMA 4X1KE 1XMQT 4LF5T 4GOUA 1YKEB 4P0AA 3GN5B 1AJ3A 2V6YB 5HXCA 5LB7B 5L3BB 2UUBT 3RC8A 2M6BA 2XAJB 2DCFA 1W09A 5CJ5A 4JEUB 5CFBA 2W63A 1Y64B 5AQUB 5FP3A 4WBOA 2X68A 2J62A 3R6NA 1HNWT 3SS1A 4QHOA 1BR4A 3UQ4A 2OV9A 4LF7T 2LSYA 3KBUA 1MMGA 4QH1A 2HPJA 3ZN0B 2CHOA 5CA1E 4DBQA 1JNZA 3QB5A 3P4PA 2UUAT 3FZFB 5JRCA 4IREA 2XTLA 3AEDA 1R8IA 3PUVF 5AQKB 4ZZCA 2WCAA 1XDOA 2V7IA 1N34T 4DO0A 2QYWA 4IDQA 4UELA 5LYJE 3V5UA 1WLXA 1WYCA 2B76A 4NIQA 4Z91A 1MIVA 4IL4A 2MOZA 3OKQA 5AQVB 4H63H 4DBRA 4PK4A 4EAHA 3VHLA 2BS4A 1LRZA 3AE4A 5JR9A 2J1DG 1E7PA 2XQ9A 2VKJA 2IDOB 4XBFB 1ZP0A 2JJ9A 3EAMA 3RHWA 1HNZT 1QLBA 2PBIA 3E0ZA 4AKIA 3ZSSA 5LNKA 2H7OA 4TUYE 4NUUA 3AE5A 4CI2B 1HG2A 1US7B 3AA1B 1B7TA 5L3DB 2ODUA 2PJQA 5CA0E 1WR6A 3A7MA 3H3AA 3PTRB 4JBWF 4YTMA 3EDUA 3UFGA 3AA7B 2CEAA 3QOFA 2DLRA 4YSXA 3CMLA 3CWZB 2A3DA 4LF4T 1N32T 2LM9A 4DV7T 5JDGA 4JYAT 3M3ZB 2XAGB 3OYXA 2CLYB 1OEDE 4QKNA 4UF0A 5ABGA 2LSJA 5HXRA 2W67A 3KDSE 4GIWA 4Z90A 4DR4T 4EYUA 3OJAA 3A8YC 5L47A 5JTGA 4IE4A 2D2SA 4WYVA 2HPLA 2PTFA 4ISTA 5EK4A 4JLEA 1NENA 2X0LB 3KVBA 4JI2T 2JMKA 3ETUA 2L9QA 4AQFC 1LVKA 2UXCT 5LHHB 3ANWA 4X1YE 1T8BA 2WBLA 1W9RA 3M65A 5DABA 4DV4T 4DMVA 2XPKA 2Q9QB 2WY2A 4AISA 4HFVA 3TLSA 3RRWA 3UU8A 5LGTB 4XAXB 2K3WA 5EZYE 2K24A 4Z8XA 2IUBA 2MAWA 2CLYC 2LJLA 1KNZA 2NTYA 4P1NA 4QX7B 2VVSA 5F3JA 5C8YE 4I43B 5AQNB 2VVNA 1E1HB 3CPZA 4HN9A 3WAKA 4GKKT 3TLVA 4ILCA 3MA9A 2HHHT 2UXBT 4X5TA 3AE2A 3UTKA 2CM0A 5FNVE 3UU6A 3BQLA 3PUZF 1JNRA 3DJBA 2XM1A 2BBJA 3Q9DA 3HL6A 4U7IA 3P50A 3P7IA 5HAXA 3TLTA 2Q9QC 3IBPA 4DR3T 2MPKA 4PFOA 2VKDA 2FJAA 2MBGA 5M4YA 4WBNE 4GKJT 3IA3A 4U7YA 2B1EA 3C4XA 3RYHE 2V5CA 2WZIA 1GQEA 1QUUA 2M6IA 2V7MA 4IDNA 4O8SA 4H9RC 2AE9A 2VKOA 4MLKA 1SHZC 3T1HT 2JPFA 4TWFA 4HWDA 4X65T 2VK9A 4JI0T 3S4UA 2XQ5A 2W62A 3CVRA 4I55E 1HX8A 1VOMA 4U2YA 2VL0A 2Z6EA 2VASA 4CN4A 3ZYLA 4DIDB 5L3EB 2VWAA 2WAUA 4DVDA 2CA5A 3FB2A 3ONXA 1MMDA 3O1JA 3PURA 4HGAA 3T8OA 3ZCJA 4U72A 2LSGA 3BQIA 4ISSA 2D0UA 1BR0A 3RRCA 4YSYA 3TLUA 4LF9T 5ABFA 2VKHA 5HYAA 2FJEA 5ABEA 1CHUA 2WQYA 3FZKB 1I6ZA 4HWFA 3AE7A 1XNQT 3PUQA 4L9IA 4JI7T 1IJ5A 3SOLA 2XM2A 3SWHA 3UT5E 5L3CB 3AEAA 1I94T 4FJOA 4GYRA 2IC9A 1HFAA 1OEDB 2D9DA 5DQWA 3JC6D 4X62T 4ZS3A 2VL8A 2X0YA 1X79A 2D0TA 1CUNA 2H88A 1Y01A 4Q25A 4TV9E 4X64T 3AXJB 5JDNA 2CE7A 4A5XA 1Z0PA 5ADXL 2K5BB 3FZLB 1YQ4A 3W15B 1IBLT 3KINB 4CN1A 2ZM8A 5KX5E 2E9XB 2DNXA 4X20E 3EDVA 2QRXA 2XZEA 2YOEA 3BQKA 4YXDA 2X9YA 4U31A 2MTQA 3FZHB 3NWIA 3Q2MA 4A98A 1SUMB 3X1DA 2DI4A 3F31A 4EXTA 4B3TT 3H3MA 3UUXB 3NKZA 4UV8B 2KWIB 2MYSA 5LG3A 1L0VA 1OEDC 2EHOB 2LOPA 1KEYA 2WB5A 2KLQA 4CI1B 4KHPT 2V7JA 4IE7A 4IIJE 4ILAA 3K3OA 3ZT7A 2XSAA 5ETWA 4AKGA 3UQ7A 5AQLB 4YT0A 2BZBA 2UUCT 4HFCA 5HEGA 3GA8A 2E9XC 4A56A 4H9SE 4KP3C 3O1HA 2OLTA 3I9YA 3F2EA 1MIWA 2WDVA 5HCJA 3I9WA 4J2CA 4C90A 5KMGP 1YQ3A 3SFEA 4YFSA 1D0ZA 1UCUA 3EUHA 4QH4A 4FI5A 5J2TE 5IWAT 3LSVA 3N9NA 5HXEA 3MK7C 3L8RA 1UX5A 1S35A 3A5XA 3LDQB 2UXXB 2D5UA 3KV4A 4CXXA 2R6GF 2EHOC 4HE8A 5KXJA 1U4QA 2E5LT 3ZN1B 3NBXX 4JI3T 1M62A 2N2NA 5JDHA 1IAPA 3ABVA 4HFHA 5HWYA 1G8XA 5AQTB 4KX6A 2CRBA 2XUEA 3Q5EA 3U78A 2W61A 3HKBE 2IAKA 2CBJA 3ZEFB 4IDZA 1KK7A 4U3CA 4H9PC 5LJNA 3J9X1 4DV2T 3FXEB 5L3FB 4PJMA 4HTEA 4PNIA 3RYCE 4HEAA 5LA6E 1ZOYA 1J1JA 3L3PA 4LMJA 4LF8T 3CQGB 4H9OC 3LJCA 4CZZB 4AKLA 3P4SA 1N33T 1Z8UA 5LJMA 3C50A 4AKHA 5IHYA 4OYKA 5AQSB 2I59A 3SFDA 3RC3A 3MKDA 2JIWA 1UUSA 2I0MA 5FL0A 5JRCB 3HA4A 4TNVA 4BAYB 5LGNB 3RYFE 5FVLA 3MXZA 5FY1A 3MACA 3ONLC 4HKAA 5FMNA 4O4HE 2YDRA 2L3LA 4QWNB 4EZ4A 3T1YT 2DWKA 3K3NA 4B3MT 4QX8B 3RX6A 2KXPB 2VQFT 4DUZT 4X1IE 5FXWA 4KBMB 5JR9B 1DU2A 2BG9A 4ZXLA 1VRBA 3AE8A 4OX9T 2X0HA 4DV6T 4ZZBA 3PJAA 4ZOLE 2WU2A 3HKDE 1W0AA 4LFCT 3QK6A 2A9UA 4EB6E 3J7Yq 3RYIE 2A2FX 2JRKA 2Q9QA 5LMNT 3PJAJ 3IHRA 2W0GA 3ZSTA 4HFBA 3N9QA 5LBMA 3ZMUB 5AQHB 3RQWA 2V26A 2ACZA 1YXRA 4I50E 4AXPA 3FXDB 3QB5K 1ZKEA 3RGLA 2LHNA 5L2LA 3EI0A 4WW0A 2ACXA 4DR7T 5HWXA 2KT9A 2LRLA 3PV0F 3UU5A 4KHZF 4DR1T 3JADA 4OFZA 2X9XA 3H37A 3P4RA 2NTXA 5HEHA 3QC9A 2KINB 3JCFA 2V5DA 4PJLA 3RF1A 5AQIB 3PUSA 3K3QC 5JR9C 1D0XA 5DJQC 5FY0A 4UF0B 4AQGA 5AQOB 5FXXA 2V7KA 5JDMA 3EABA 2CXFA 2L8KA 2IMLA 3L39A 3UUMA 2LKGA 3RI5A 1LKXA 4DV1T 2XQ7A 5E0OA 1HCIA 4YHHT 3ANWB 3G06A 3WI3A 2FJDA 4COFA 2JQKA 2DWGA 2QGSA 1NWMX 2Q9QD 3GWHA 5H6RB 5J2UE 4DR6T 4PW8A 4OYJA 4YJ3E 2CWOA 4BJNA 1S94A 3OYZA 3E08A 4YSZA 4MBQA 2WP9A 2A72A 1NAFA 2YKSA 1IBMT 5HEUA 4ILUA 2LT3A 4PFPA 2ES0A 2Y48B 4TX5A 2WWVA 3ZJ2A 3NRXA 4L5GA 1D1BA 2LRKA 3UFEA 2WWUA 3F57A 3SRZA 5L4HA 2ZMAA 4H9QC 4ASKA 4C91A 3OVUA 2WDQA 2ZM2A 4ADZA 1MMAA 2XASB 2K48A 3AEGA 2JQQA 3LG7A 3B57A 4TV8E 2LSKA 3Q5XA 4PK5A 4CN6A 3JAFA 1D1AA 1XWMA 3AE1A 1XZYA 4LFAT 2ZM6T 3N9MA 5L3GB 4ZI3D 3B5MA 2NOXA 2LSIA 2NW8A 2Y8DA 4EV6A 3MZKB 4JI6T 3OPCA 2WS3A 2VURA 3VKHA 3QUJA 3ZT6A 4ZI7E 3O1IA 2IIUA 4YLHA 1WCRA 3FHNA 3VR8A 4JEHB 4NXNT 2LHRA 4HFDA 2AXDS 2YDSA 2N1GA 2NW7A 4DR5T 2LLYA 1HTJF 2WSSV 3I0OA 3LFMA 1FIOA 5HXSA 2V7LA 3L09A 1OEDA 3LBXA 4UVCB 3IF8B 1KNPA 5FVKA 1V9DA 2P9BA 5ABHA 3VR9A 2BDEA 2JQHA 5C2TA 2VQET 2BBHA 3AXJA 4IDOA 4WZXA 3ZYKA 4H63V 3ZMSB 1KNRA 4HFEA 4CI3B 3NZPA 3HI2A 2E9XA 2E8IA 2UXNB 3O9XA 3OTOT 3NRYA 5AQMB 1YD8G 4JI5T 3AE9A 3RKOA 5JDFA 5F5WA 5L4EA 4X66T 2V1DB 5LHIB 3I1AA 3N9LA 4I0UA 3VRAA 3V5SA 4AQYT 2PFVA 4JI1T 3AVSA 4B3RT 1UGOA 2EHOA 3LK3B 3JC6C 2XQAA 4G2AA 2WZHA 2J47A 3VU7H 3EHZA 4ZI2C 4GYSA 2WMNA 2H3RA 3VRBA 4IE6A 5J0ZA 4CXYA 2YEVC 4OK0A 1MNEA 3P4QA 5TAOA 4UVAB 4TNWA 2FJBA 3GN5A 2V6YA 5KDMC 2HN1A 4QXBB 3ZC1A 3N9PA 4YHJA 2XQ4A 3ZMTB 1ZV4X 3KFWX 3ZCIA 2E9XD 4YTNA 2BKNA 2VB6A 3DP7A 5H6QB 2X9HA 3Q5WA 5LOVE 1ZEEA 2J4GA 3RQUA 1MNDA 2OA5A
chains in the Genus database with same CATH topology
2L3LA 4QX7B 5LXTE 3AA0B 4QWNB 4EZ4A 3FBLA 5F3JA 4QXHB 5C8YE 2DWKA 4MHCA 4I43B 5EK2A 3K3NA 2YU1A 4UEMA 5EK3A 5IYZE 4IGUA 3N9OA 1E1HB 3CPZA 1YW0A 4HN9A 4AKRB 4QX8B 3WAKA 1BR1A 3RX6A 2KXPB 3LK42 3DTOA 5LG4A 3MA9A 4MALA 3UTKA 4F6RC 5JQGE 5JDQA 2CM0A 2QA7A 4PJNA 5FNVE 3KVAA 2EHOD 4CXWA 2SPCA 3C98B 4UXNB 3BQLA 1WRDA 2RA1A 3HKCE 3DJBA 5HXHA 4X1IE 3Q9DA 3HL6A 4MFRA 4KBMB 3LK2B 3P7IA 5FXWA 2CXDA 5HAXA 5JR9B 2G0UA 2Q9QC 3IBPA 4L0RA 4U74A 2CXLA 1VRBA 3PUAA 2VKDA 2JMHA 4PFOA 2C5JA 5DQVA 2MBGA 5M4YA 4WBNE 5LCYA 2LOSA 4PAGA 4ZOLE 2ODVA 2B1EA 3C4XA 3HKDE 3N2GE 3LBXB 3AVRA 3QK6A 5JREA 4EB6E 3J7Yq 1EZ3A 2A2FX 2JRKA 3RYIE 3RYHE 1QUUA 4H9NC 2V7MA 3BK9A 2BVMA 4ZHQE 4O8SA 2Q9QA 3IHRA 4H9RC 4UV9B 4EZHA 2VKOA 3MJXA 4UVBB 2W0GA 4MLKA 3PU8A 1SHZC 3AAAB 2JPFA 2WMOA 3D0TA 5LHGB 3N9QA 5LBMA 3ZMUB 4ZI2D 2VK9A 1FEWA 2V26A 2XAHB 4I50E 4AXPA 3FXDB 1ZKEA 5L2LA 2LHNA 3S4UA 3K8PC 4WW0A 1G73A 2ACXA 2W62A 4B6XA 1BR2A 3CVRA 3N2KE 4I55E 5HWXA 1HX8A 1VOMA 2KT9A 1D1CA 2Z6EA 3C51A 2VASA 1FMWA 4OFZA 4EIWA 2X9XA 3H37A 2NTXA 3QC9A 3VKGA 2KINB 3WAJA 4KUMB 4PJLA 3ZJ1A 3ZYLA 5L3EB 3PUSA 4BJMA 3K3QC 5JR9C 1D0XA 5DJQC 3KBTA 4OHFA 5FY0A 3ZPOA 2VWAA 2ZM0A 4P09A 2WAUA 4UF0B 3U3IA 4AQGA 5FXXA 3KV9A 4DVDA 4AQFA 3AB3B 2V7KA 4GK0E 5JDMA 4O2AE 2CXFA 2CA5A 2L8KA 1T98A 1YKHB 4PK6A 3FB2A 4XZCA 3UUMA 3ONXA 1MMDA 2ZLYA 3O1JA 3PURA 3KV6A 4TZ4C 1LKXA 4HGAA 4IE5A 3T8OA 3CQCB 5LGUB 5LBQB 3ZCJA 4U72A 2LSGA 3BQIA 4NUVA 3ZMVB 4ISSA 2D0UA 2HH7A 2NW9A 1WYBA 3N2OA 1OXZA 1IZNB 2KZ7B 5E0OA 5AFUL 1BR0A 3PDYA 2Y6XA 1U5PA 4TN7B 1HS7A 2LE8A 1QSDA 1HCIA 3RRCA 3OBVE 2VKHA 3ANWB 5HYAA 3RPUA 2GK9A 4M1PA 5FYMA 4X1KE 5A1LA 2IC6A 3WI3A 2N9DA 3E22E 4GOUA 1YKEB 2XHEB 4UIGA 3ZYMA 2DWGA 4P0AA 2QGSA 2K9AA 1NWMX 2Q9QD 3GWHA 3N5LA 3ETVA 5H6RB 5J2UE 4PW8A 4OYJA 3ESLA 3GN5B 4YJ3E 2RP4A 2PG8A 3PUQA 2CWOA 4L9IA 1AJ3A 5HXCA 1IJ5A 4BJNA 1S94A 3OYZA 5L3BB 3E08A 3RC8A 2XAJB 3SOLA 2DCFA 2XQYA 4MBQA 2LEHA 3SWHA 3UT5E 4ERRA 5L3CB 2A72A 4JEUB 4V1Av 4FJOA 1NAFA 3B13A 2W63A 1Y64B 4GYRA 2IC9A 5FP3A 1HFAA 2LT3A 4ILUA 4PFPA 4WBOA 2ES0A 2X68A 2Y48B 4TX5A 5DQWA 2KNDA 2X67A 3JC6D 3ZJ2A 3R6NA 3NRXA 4L5GA 4O4IE 1D1BA 4ZS3A 3UFEA 3SS1A 2VL8A 2WWUA 3F57A 4QHOA 5CB4E 5LP6E 4WNKA 1BR4A 3SRZA 1X79A 2D0TA 2ZMAA 2LSYA 2C5KT 4H9QC 3EVYA 4ASKA 1CUNA 3KBUA 1MMGA 4C91A 4TV9E 3P8CD 4ZS2A 2ZM2A 3R84B 2CE7A 5JDNA 2HPJA 4ADZA 3ZN0B 1MMAA 2XASB 1Z0PA 5ADXL 5CA1E 4DBQA 2K48A 2K5BB 3W15B 3ZLIA 5JRCA 2JQQA 3LG7A 3B57A 4TV8E 2XTLA 3KINB 3KV5A 2LSKA 3Q5XA 4DMWA 4PK5A 2ZM8A 2CCQA 1D1AA 2E9XB 5KX5E 2DNXA 3C4WA 4X20E 3EDVA 4E7ZA 3RH3A 2YK0A 3N9MA 3BQKA 5L3GB 4ZI3D 2X9YA 2NOXA 2LSIA 2MTQA 3IEEA 4I4TE 1HF8A 2NW8A 2V7IA 4EOZB 3Q2MA 1IJ6A 2X66A 2Y8DA 3MZKB 4DO0A 4UELA 5LYJE 2DI4A 3AA6B 3F31A 4EXTA 3V5UA 1WLXA 1HG5A 1WYCA 1D0YA 4O2BE 3VKHA 1LVFA 3QUJA 4DNDA 3UUXB 3PU3A 4CQIA 1MIVA 4ZI7E 4UV8B 3O1IA 3HR0A 3UULA 4YJ2E 3ZC0A 2MOZA 2KWIB 2MYSA 3OKQA 4YLHA 2CMRA 4H63H 2EHOB 4DBRA 2DHRA 2LOPA 4G63A 4PK4A 4EAHA 3FHNA 1H7CA 3C64A 4JEHB 2LHRA 2KLQA 3VHLA 4CI1B 1LRZA 2V7JA 2N1GA 4IE7A 2YINA 5JR9A 2J1DG 2NW7A 3C4ZA 4IIJE 5JDLA 2CWYA 3K3OA 1HTJF 4PJJA 1ZHCA 5ETWA 2VKJA 4AKGA 4XBFB 2WSSV 3I0OA 2JJ9A 3LFMA 1FIOA 2BZBA 5HXSA 2V7LA 5FXZA 3L09A 2WM9A 3LBXA 4UVCB 3E0ZA 2PBIA 3GA8A 4AKIA 2C5IT 4P0BA 3IF8B 2E9XC 5JVDE 5LNKA 2H7OA 4TUYE 4NUUA 4CI2B 1HG2A 1V9DA 3CQXC 2P9BA 4AI6A 1US7B 4A56A 4H9SE 2XAQB 3AA1B 4KP3C 1B7TA 3O1HA 5L3DB 3I9YA 2ODUA 3F2EA 2PJQA 4O4HE 1MIWA 2BDEA 5CA0E 1WR6A 3AAEB 3TKLB 3H3AA 2NP9A 5F8PA 3PTRB 4N78D 3I9WA 3EDUA 3ZYKA 4J2CA 5J1GA 4H63V 3ZMSB 4C90A 4EYYR 5KMGP 3AA7B 1MMNA 3UUNA 3AAIA 4YFSA 1D0ZA 1UCUA 2XAFB 3EUHA 4CI3B 5BMVE 4FI5A 3NZPA 5J2TE 3N9NA 5HXEA 4ANJA 2CEAA 3HI2A 2DLRA 3MK7C 2E9XA 4QXCB 2E8IA 2UXNB 3CMLA 1UX5A 1S35A 3A5XA 3CX7B 3CWZB 2UXXB 2D5UA 3KV4A 2A3DA 3O9XA 4CXXA 3NRYA 1YD8G 5GONE 2LM9A 3FBZA 2EHOC 4HE8A 2C0SA 2NWBA 5JDGA 3RKOA 5JDFA 2W00A 1U4QA 5FXVA 1SA0E 3CX6B 3ZN1B 2V1DB 5LHIB 3I1AA 3NBXX 2XAGB 2N2NA 3OYXA 5JDHA 1IAPA 2CLYB 4QKNA 3N9LA 4UF0A 2LSJA 5HXRA 3KDSE 4GIWA 5HWYA 1G8XA 1UX4A 4IE0A 4E7SA 3V5SA 2XUEA 2KMFA 4EYUA 2PFVA 3OJAA 1O3XA 3AVSA 4O4JE 5FY7A 2EHOA 4IE4A 2D2SA 3LK3B 3JC6C 3U78A 2W61A 3HKBE 2IAKA 2HPLA 4ISTA 3ZEFB 3I0QA 4IDZA 1KK7A 4G2AA 5EK4A 1MIYA 2M67A 4JLEA 4H9PC 3ZMZB 2X0LB 5LJNA 3KVBA 2KWHA 4GK5E 3J9X1 2JMKA 3ETUA 2L9QA 3O4XE 1OWAA 3FXEB 3VU7H 4PJMA 5L3FB 4HTEA 4AQFC 4PNIA 3RYCE 4HEAA 1LVKA 3L3PA 5LA6E 4ZI2C 5LHHB 3ANWA 4O4LE 4GYSA 4K0UA 3CQGB 2WMNA 2H3RA 4X1YE 4IE6A 2WBLA 4H9OC 2BVLA 3LJCA 4CZZB 4AKLA 4KMCA 2X9WA 4CXYA 2YEVC 3M65A 4OK0A 1MNEA 5DABA 3PE0A 4ZI3C 4DMVA 5TAOA 4UVAB 2Q9QB 5LJMA 3C50A 4AKHA 5IHYA 4HFVA 3CKDA 3HKEE 4OYKA 2X51A 3CX8B 3GN5A 5KDMC 2IW5B 3RRWA 4QXBB 5LGTB 2I59A 3NZQA 3ZC1A 3N9PA 4XAXB 4YHJA 3MKDA 5EZYE 3RC3A 2K24A 4BA9A 4Z8XA 5JRCB 3HA4A 3ZMTB 2CLYC 1ZV4X 2YU2A 2LJLA 4BAYB 3KFWX 3ZCIA 2E9XD 2H7VC 1FMVA 5JH7E 5LGNB 2VB6A 3PUGA 3DP7A 5H6QB 3RYFE 3GMIA 3MXZA 4JUYA 2X9HA 3Q5WA 5LOVE 5FY1A 3MACA 1ZEEA 1KNZA 2NTYA 4HKAA 5FMNA 1MNDA 2OA5A 4IHJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEH B;  4TX5 A;  4JEU B;  3LG7 A;  1FIO A;  1EZ3 A;  1HS7 A;  1FEW A;  2XHE B;  1BR0 A;  1G73 A;  5M4Y A;  1S94 A;  3C98 B;  5LG4 A;  2DNX A; 
#chains in the Genus database with same CATH topology
 5LXT E;  3AA0 B;  4MHC A;  4U2Z A;  5EK2 A;  5EK3 A;  2YU1 A;  5IYZ E;  1YW0 A;  3ZT5 A;  4AKR B;  2QVA A;  3LK4 2;  3NVO A;  5LG4 A;  5IUX A;  5JQG E;  2EHO D;  2NR4 A;  2SPC A;  4HWI B;  4UXN B;  4CXW A;  1WRD A;  3HKC E;  2V8S V;  2CXD A;  1NEK A;  4LML A;  2G0U A;  4L0R A;  4U74 A;  3PUA A;  2JMH A;  3RIU C;  2C5J A;  3RKG A;  5FL1 A;  4JI8 T;  2LOS A;  2ODV A;  1UK5 A;  3AVR A;  1J5W A;  3P4W A;  3AE3 A;  4EGW A;  2DL1 A;  5LMU T;  3BK9 A;  2BVM A;  3AEF A;  4EZH A;  3MJX A;  4UVB B;  2UXD T;  3PU8 A;  3UU3 A;  5LHG B;  4TWD A;  1FEW A;  2CHN A;  2BKP A;  1D1C A;  3C51 A;  4B3S T;  1KF6 A;  4EIW A;  4IDP A;  3AEC A;  2KSR A;  3AE6 A;  3ZPO A;  4P09 A;  3U3I A;  3KV9 A;  4AQF A;  3AB3 B;  4GK0 E;  4O2A E;  3CK6 A;  1HX1 B;  4XZC A;  2BS2 A;  2ZLY A;  4A97 A;  2E2A A;  4TZ4 C;  1XMO T;  4IE5 A;  5C3J A;  2I6H A;  3CQC B;  4TWH A;  5LGU B;  4NUV A;  3ZMV B;  2HH7 A;  1WYB A;  1OXZ A;  1FJG T;  1IZN B;  2Y6X A;  4TN7 B;  1QSD A;  4HWH A;  5AQG B;  2GK9 A;  5A1L A;  2IC6 A;  2N9D A;  3ZYM A;  3E22 E;  2XHE B;  4UIG A;  3UU4 A;  5AQP B;  2K9A A;  2LKH A;  3N5L A;  3ETV A;  3ESL A;  2RP4 A;  2PG8 A;  1SE7 A;  3ONJ A;  2XQY A;  4ERR A;  2LEH A;  1XNR T;  4HWC A;  2LM2 A;  4V1A v;  3B13 A;  2KND A;  2X67 A;  1N36 T;  4F8H A;  4O4I E;  1KFY A;  5CB4 E;  5LP6 E;  4WNK A;  1VCS A;  2C5K T;  3EVY A;  5HEJ A;  2CPT A;  4DV3 T;  5BR8 T;  3P8C D;  4ZS2 A;  3R84 B;  3RIF A;  4DV0 T;  1WFD A;  2BKO A;  3ZLI A;  4KI0 F;  3KV5 A;  4DR2 T;  4DMW A;  3ZKR A;  2CCQ A;  4E7Z A;  3C4W A;  3RH3 A;  2YK0 A;  4AIU A;  2XQ3 A;  3IEE A;  4I4T E;  1HF8 A;  5FKY A;  2RPA A;  2WDR A;  4UR9 A;  4EOZ B;  2BG9 B;  1IJ6 A;  2X66 A;  5AQR B;  2H89 A;  3AA6 B;  4IL9 A;  1HG5 A;  1D0Y A;  4O2B E;  1LVF A;  4DND A;  3PU3 A;  4CQI A;  3FZM B;  4YJ2 E;  3HR0 A;  3UUL A;  3ZC0 A;  1J5E T;  3CIR A;  2CMR A;  4DUY T;  2DHR A;  4G63 A;  4YY3 T;  1H7C A;  3C64 A;  4ZEY A;  2XY8 B;  2XSB A;  4YTP A;  5CGM A;  2YIN A;  1WR0 A;  2CBI A;  3C4Z A;  5JDL A;  2XJ7 A;  4LMK A;  2CWY A;  3RLF F;  4PJJ A;  1ZHC A;  3QNU A;  5FXZ A;  2WM9 A;  5AQJ B;  2C5I T;  4P0B A;  4LFB T;  5JVD E;  4AI6 A;  3CQX C;  2BS3 A;  2XAQ B;  4JI4 T;  3AAE B;  4DV5 T;  2BG9 C;  3TKL B;  2NP9 A;  5F8P A;  4N78 D;  5J1G A;  4EYY R;  1MMN A;  3UUN A;  3AAI A;  2W4X A;  2XAF B;  5BMV E;  4EED A;  2XQ6 A;  4ANJ A;  3Q5D A;  4QXC B;  3CX7 B;  5GON E;  3FBZ A;  2C0S A;  2NWB A;  2W00 A;  5FXV A;  1SA0 E;  3CX6 B;  4U33 A;  4K0K T;  2FBW A;  2V6X A;  1UX4 A;  4IE0 A;  2YDQ A;  4E7S A;  5HCM A;  4NXM T;  2KMF A;  3RIA A;  1O3X A;  3PUY F;  4O4J E;  5FY7 A;  1VCT A;  1W0B A;  3I0Q A;  2M67 A;  1MIY A;  1HNX T;  1XDP A;  3ZMZ B;  2KWH A;  4GK5 E;  3O4X E;  1OWA A;  4HFI A;  4O4L E;  4K0U A;  2JQ9 A;  2BVL A;  4KMC A;  2X9W A;  3TLW A;  2W66 A;  3PE0 A;  4ZI3 C;  4QH5 A;  3CKD A;  3HKE E;  2X51 A;  3CX8 B;  2IW5 B;  3NZQ A;  4BA9 A;  2YN6 A;  2YU2 A;  3AEE A;  2FUP A;  2H7V C;  1FMV A;  5JH7 E;  3PUG A;  3UUB A;  3GMI A;  4JUY A;  4IHJ E;  4IT4 A;  3FBL A;  4QXH B;  2HN2 A;  4UEM A;  4IGU A;  3N9O A;  1BR1 A;  4NPP A;  5AQQ B;  2E5V A;  3DTO A;  4MAL A;  4F6R C;  5HEO A;  5JDQ A;  2QA7 A;  4PJN A;  3PUW F;  3KVA A;  3C98 B;  2RA1 A;  4JV5 T;  5HXH A;  4MFR A;  3LK2 B;  1T72 A;  2CXL A;  5AQF B;  5DQV A;  1E2A A;  2WU5 A;  5LCY A;  5ABF B;  4PAG A;  4EEB A;  3N2G E;  3LBX B;  1M7K A;  5JRE A;  1EZ3 A;  2XQ8 A;  4H9N C;  4ZHQ E;  2F4V T;  4UV9 B;  3AAA B;  2WMO A;  3D0T A;  3RIU A;  4ZI2 D;  2XAH B;  3K8P C;  1G73 A;  2UU9 T;  4ILB A;  1BR2 A;  3N2K E;  4B6X A;  1FMW A;  2BG9 E;  3AEB A;  3VKG A;  3WAJ A;  4KUM B;  3ZJ1 A;  3PUX F;  1T7S A;  4BJM A;  1HR0 T;  4LF6 T;  3KBT A;  4OHF A;  2ZM0 A;  1IBK T;  3K1S A;  1T98 A;  1YKH B;  4PK6 A;  3KV6 A;  1UUR A;  3JAE A;  5LBQ B;  2IHR 1;  2NW9 A;  3N2O A;  5AFU L;  2KZ7 B;  3PDY A;  1U5P A;  1HS7 A;  2LE8 A;  3OBV E;  1X9B A;  2W2U A;  3RPU A;  4M1P A;  5FYM A;  4X1K E;  1XMQ T;  4LF5 T;  4GOU A;  1YKE B;  4P0A A;  3GN5 B;  1AJ3 A;  2V6Y B;  5HXC A;  5LB7 B;  5L3B B;  2UUB T;  3RC8 A;  2M6B A;  2XAJ B;  2DCF A;  1W09 A;  5CJ5 A;  4JEU B;  5CFB A;  2W63 A;  1Y64 B;  5AQU B;  5FP3 A;  4WBO A;  2X68 A;  2J62 A;  3R6N A;  1HNW T;  3SS1 A;  4QHO A;  1BR4 A;  3UQ4 A;  2OV9 A;  4LF7 T;  2LSY A;  3KBU A;  1MMG A;  4QH1 A;  2HPJ A;  3ZN0 B;  2CHO A;  5CA1 E;  4DBQ A;  1JNZ A;  3QB5 A;  3P4P A;  2UUA T;  3FZF B;  5JRC A;  4IRE A;  2XTL A;  3AED A;  1R8I A;  3PUV F;  5AQK B;  4ZZC A;  2WCA A;  1XDO A;  2V7I A;  1N34 T;  4DO0 A;  2QYW A;  4IDQ A;  4UEL A;  5LYJ E;  3V5U A;  1WLX A;  1WYC A;  2B76 A;  4NIQ A;  4Z91 A;  1MIV A;  4IL4 A;  2MOZ A;  3OKQ A;  5AQV B;  4H63 H;  4DBR A;  4PK4 A;  4EAH A;  3VHL A;  2BS4 A;  1LRZ A;  3AE4 A;  5JR9 A;  2J1D G;  1E7P A;  2XQ9 A;  2VKJ A;  2IDO B;  4XBF B;  1ZP0 A;  2JJ9 A;  3EAM A;  3RHW A;  1HNZ T;  1QLB A;  2PBI A;  3E0Z A;  4AKI A;  3ZSS A;  5LNK A;  2H7O A;  4TUY E;  4NUU A;  3AE5 A;  4CI2 B;  1HG2 A;  1US7 B;  3AA1 B;  1B7T A;  5L3D B;  2ODU A;  2PJQ A;  5CA0 E;  1WR6 A;  3A7M A;  3H3A A;  3PTR B;  4JBW F;  4YTM A;  3EDU A;  3UFG A;  3AA7 B;  2CEA A;  3QOF A;  2DLR A;  4YSX A;  3CML A;  3CWZ B;  2A3D A;  4LF4 T;  1N32 T;  2LM9 A;  4DV7 T;  5JDG A;  4JYA T;  3M3Z B;  2XAG B;  3OYX A;  2CLY B;  1OED E;  4QKN A;  4UF0 A;  5ABG A;  2LSJ A;  5HXR A;  2W67 A;  3KDS E;  4GIW A;  4Z90 A;  4DR4 T;  4EYU A;  3OJA A;  3A8Y C;  5L47 A;  5JTG A;  4IE4 A;  2D2S A;  4WYV A;  2HPL A;  2PTF A;  4IST A;  5EK4 A;  4JLE A;  1NEN A;  2X0L B;  3KVB A;  4JI2 T;  2JMK A;  3ETU A;  2L9Q A;  4AQF C;  1LVK A;  2UXC T;  5LHH B;  3ANW A;  4X1Y E;  1T8B A;  2WBL A;  1W9R A;  3M65 A;  5DAB A;  4DV4 T;  4DMV A;  2XPK A;  2Q9Q B;  2WY2 A;  4AIS A;  4HFV A;  3TLS A;  3RRW A;  3UU8 A;  5LGT B;  4XAX B;  2K3W A;  5EZY E;  2K24 A;  4Z8X A;  2IUB A;  2MAW A;  2CLY C;  2LJL A;  1KNZ A;  2NTY A;  4P1N A;  4QX7 B;  2VVS A;  5F3J A;  5C8Y E;  4I43 B;  5AQN B;  2VVN A;  1E1H B;  3CPZ A;  4HN9 A;  3WAK A;  4GKK T;  3TLV A;  4ILC A;  3MA9 A;  2HHH T;  2UXB T;  4X5T A;  3AE2 A;  3UTK A;  2CM0 A;  5FNV E;  3UU6 A;  3BQL A;  3PUZ F;  1JNR A;  3DJB A;  2XM1 A;  2BBJ A;  3Q9D A;  3HL6 A;  4U7I A;  3P50 A;  3P7I A;  5HAX A;  3TLT A;  2Q9Q C;  3IBP A;  4DR3 T;  2MPK A;  4PFO A;  2VKD A;  2FJA A;  2MBG A;  5M4Y A;  4WBN E;  4GKJ T;  3IA3 A;  4U7Y A;  2B1E A;  3C4X A;  3RYH E;  2V5C A;  2WZI A;  1GQE A;  1QUU A;  2M6I A;  2V7M A;  4IDN A;  4O8S A;  4H9R C;  2AE9 A;  2VKO A;  4MLK A;  1SHZ C;  3T1H T;  2JPF A;  4TWF A;  4HWD A;  4X65 T;  2VK9 A;  4JI0 T;  3S4U A;  2XQ5 A;  2W62 A;  3CVR A;  4I55 E;  1HX8 A;  1VOM A;  4U2Y A;  2VL0 A;  2Z6E A;  2VAS A;  4CN4 A;  3ZYL A;  4DID B;  5L3E B;  2VWA A;  2WAU A;  4DVD A;  2CA5 A;  3FB2 A;  3ONX A;  1MMD A;  3O1J A;  3PUR A;  4HGA A;  3T8O A;  3ZCJ A;  4U72 A;  2LSG A;  3BQI A;  4ISS A;  2D0U A;  1BR0 A;  3RRC A;  4YSY A;  3TLU A;  4LF9 T;  5ABF A;  2VKH A;  5HYA A;  2FJE A;  5ABE A;  1CHU A;  2WQY A;  3FZK B;  1I6Z A;  4HWF A;  3AE7 A;  1XNQ T;  3PUQ A;  4L9I A;  4JI7 T;  1IJ5 A;  3SOL A;  2XM2 A;  3SWH A;  3UT5 E;  5L3C B;  3AEA A;  1I94 T;  4FJO A;  4GYR A;  2IC9 A;  1HFA A;  1OED B;  2D9D A;  5DQW A;  3JC6 D;  4X62 T;  4ZS3 A;  2VL8 A;  2X0Y A;  1X79 A;  2D0T A;  1CUN A;  2H88 A;  1Y01 A;  4Q25 A;  4TV9 E;  4X64 T;  3AXJ B;  5JDN A;  2CE7 A;  4A5X A;  1Z0P A;  5ADX L;  2K5B B;  3FZL B;  1YQ4 A;  3W15 B;  1IBL T;  3KIN B;  4CN1 A;  2ZM8 A;  5KX5 E;  2E9X B;  2DNX A;  4X20 E;  3EDV A;  2QRX A;  2XZE A;  2YOE A;  3BQK A;  4YXD A;  2X9Y A;  4U31 A;  2MTQ A;  3FZH B;  3NWI A;  3Q2M A;  4A98 A;  1SUM B;  3X1D A;  2DI4 A;  3F31 A;  4EXT A;  4B3T T;  3H3M A;  3UUX B;  3NKZ A;  4UV8 B;  2KWI B;  2MYS A;  5LG3 A;  1L0V A;  1OED C;  2EHO B;  2LOP A;  1KEY A;  2WB5 A;  2KLQ A;  4CI1 B;  4KHP T;  2V7J A;  4IE7 A;  4IIJ E;  4ILA A;  3K3O A;  3ZT7 A;  2XSA A;  5ETW A;  4AKG A;  3UQ7 A;  5AQL B;  4YT0 A;  2BZB A;  2UUC T;  4HFC A;  5HEG A;  3GA8 A;  2E9X C;  4A56 A;  4H9S E;  4KP3 C;  3O1H A;  2OLT A;  3I9Y A;  3F2E A;  1MIW A;  2WDV A;  5HCJ A;  3I9W A;  4J2C A;  4C90 A;  5KMG P;  1YQ3 A;  3SFE A;  4YFS A;  1D0Z A;  1UCU A;  3EUH A;  4QH4 A;  4FI5 A;  5J2T E;  5IWA T;  3LSV A;  3N9N A;  5HXE A;  3MK7 C;  3L8R A;  1UX5 A;  1S35 A;  3A5X A;  3LDQ B;  2UXX B;  2D5U A;  3KV4 A;  4CXX A;  2R6G F;  2EHO C;  4HE8 A;  5KXJ A;  1U4Q A;  2E5L T;  3ZN1 B;  3NBX X;  4JI3 T;  1M62 A;  2N2N A;  5JDH A;  1IAP A;  3ABV A;  4HFH A;  5HWY A;  1G8X A;  5AQT B;  4KX6 A;  2CRB A;  2XUE A;  3Q5E A;  3U78 A;  2W61 A;  3HKB E;  2IAK A;  2CBJ A;  3ZEF B;  4IDZ A;  1KK7 A;  4U3C A;  4H9P C;  5LJN A;  3J9X 1;  4DV2 T;  3FXE B;  5L3F B;  4PJM A;  4HTE A;  4PNI A;  3RYC E;  4HEA A;  5LA6 E;  1ZOY A;  1J1J A;  3L3P A;  4LMJ A;  4LF8 T;  3CQG B;  4H9O C;  3LJC A;  4CZZ B;  4AKL A;  3P4S A;  1N33 T;  1Z8U A;  5LJM A;  3C50 A;  4AKH A;  5IHY A;  4OYK A;  5AQS B;  2I59 A;  3SFD A;  3RC3 A;  3MKD A;  2JIW A;  1UUS A;  2I0M A;  5FL0 A;  5JRC B;  3HA4 A;  4TNV A;  4BAY B;  5LGN B;  3RYF E;  5FVL A;  3MXZ A;  5FY1 A;  3MAC A;  3ONL C;  4HKA A;  5FMN A;  4O4H E;  2YDR A;  2L3L A;  4QWN B;  4EZ4 A;  3T1Y T;  2DWK A;  3K3N A;  4B3M T;  4QX8 B;  3RX6 A;  2KXP B;  2VQF T;  4DUZ T;  4X1I E;  5FXW A;  4KBM B;  5JR9 B;  1DU2 A;  2BG9 A;  4ZXL A;  1VRB A;  3AE8 A;  4OX9 T;  2X0H A;  4DV6 T;  4ZZB A;  3PJA A;  4ZOL E;  2WU2 A;  3HKD E;  1W0A A;  4LFC T;  3QK6 A;  2A9U A;  4EB6 E;  3J7Y q;  3RYI E;  2A2F X;  2JRK A;  2Q9Q A;  5LMN T;  3PJA J;  3IHR A;  2W0G A;  3ZST A;  4HFB A;  3N9Q A;  5LBM A;  3ZMU B;  5AQH B;  3RQW A;  2V26 A;  2ACZ A;  1YXR A;  4I50 E;  4AXP A;  3FXD B;  3QB5 K;  1ZKE A;  3RGL A;  2LHN A;  5L2L A;  3EI0 A;  4WW0 A;  2ACX A;  4DR7 T;  5HWX A;  2KT9 A;  2LRL A;  3PV0 F;  3UU5 A;  4KHZ F;  4DR1 T;  3JAD A;  4OFZ A;  2X9X A;  3H37 A;  3P4R A;  2NTX A;  5HEH A;  3QC9 A;  2KIN B;  3JCF A;  2V5D A;  4PJL A;  3RF1 A;  5AQI B;  3PUS A;  3K3Q C;  5JR9 C;  1D0X A;  5DJQ C;  5FY0 A;  4UF0 B;  4AQG A;  5AQO B;  5FXX A;  2V7K A;  5JDM A;  3EAB A;  2CXF A;  2L8K A;  2IML A;  3L39 A;  3UUM A;  2LKG A;  3RI5 A;  1LKX A;  4DV1 T;  2XQ7 A;  5E0O A;  1HCI A;  4YHH T;  3ANW B;  3G06 A;  3WI3 A;  2FJD A;  4COF A;  2JQK A;  2DWG A;  2QGS A;  1NWM X;  2Q9Q D;  3GWH A;  5H6R B;  5J2U E;  4DR6 T;  4PW8 A;  4OYJ A;  4YJ3 E;  2CWO A;  4BJN A;  1S94 A;  3OYZ A;  3E08 A;  4YSZ A;  4MBQ A;  2WP9 A;  2A72 A;  1NAF A;  2YKS A;  1IBM T;  5HEU A;  4ILU A;  2LT3 A;  4PFP A;  2ES0 A;  2Y48 B;  4TX5 A;  2WWV A;  3ZJ2 A;  3NRX A;  4L5G A;  1D1B A;  2LRK A;  3UFE A;  2WWU A;  3F57 A;  3SRZ A;  5L4H A;  2ZMA A;  4H9Q C;  4ASK A;  4C91 A;  3OVU A;  2WDQ A;  2ZM2 A;  4ADZ A;  1MMA A;  2XAS B;  2K48 A;  3AEG A;  2JQQ A;  3LG7 A;  3B57 A;  4TV8 E;  2LSK A;  3Q5X A;  4PK5 A;  4CN6 A;  3JAF A;  1D1A A;  1XWM A;  3AE1 A;  1XZY A;  4LFA T;  2ZM6 T;  3N9M A;  5L3G B;  4ZI3 D;  3B5M A;  2NOX A;  2LSI A;  2NW8 A;  2Y8D A;  4EV6 A;  3MZK B;  4JI6 T;  3OPC A;  2WS3 A;  2VUR A;  3VKH A;  3QUJ A;  3ZT6 A;  4ZI7 E;  3O1I A;  2IIU A;  4YLH A;  1WCR A;  3FHN A;  3VR8 A;  4JEH B;  4NXN T;  2LHR A;  4HFD A;  2AXD S;  2YDS A;  2N1G A;  2NW7 A;  4DR5 T;  2LLY A;  1HTJ F;  2WSS V;  3I0O A;  3LFM A;  1FIO A;  5HXS A;  2V7L A;  3L09 A;  1OED A;  3LBX A;  4UVC B;  3IF8 B;  1KNP A;  5FVK A;  1V9D A;  2P9B A;  5ABH A;  3VR9 A;  2BDE A;  2JQH A;  5C2T A;  2VQE T;  2BBH A;  3AXJ A;  4IDO A;  4WZX A;  3ZYK A;  4H63 V;  3ZMS B;  1KNR A;  4HFE A;  4CI3 B;  3NZP A;  3HI2 A;  2E9X A;  2E8I A;  2UXN B;  3O9X A;  3OTO T;  3NRY A;  5AQM B;  1YD8 G;  4JI5 T;  3AE9 A;  3RKO A;  5JDF A;  5F5W A;  5L4E A;  4X66 T;  2V1D B;  5LHI B;  3I1A A;  3N9L A;  4I0U A;  3VRA A;  3V5S A;  4AQY T;  2PFV A;  4JI1 T;  3AVS A;  4B3R T;  1UGO A;  2EHO A;  3LK3 B;  3JC6 C;  2XQA A;  4G2A A;  2WZH A;  2J47 A;  3VU7 H;  3EHZ A;  4ZI2 C;  4GYS A;  2WMN A;  2H3R A;  3VRB A;  4IE6 A;  5J0Z A;  4CXY A;  2YEV C;  4OK0 A;  1MNE A;  3P4Q A;  5TAO A;  4UVA B;  4TNW A;  2FJB A;  3GN5 A;  2V6Y A;  5KDM C;  2HN1 A;  4QXB B;  3ZC1 A;  3N9P A;  4YHJ A;  2XQ4 A;  3ZMT B;  1ZV4 X;  3KFW X;  3ZCI A;  2E9X D;  4YTN A;  2BKN A;  2VB6 A;  3DP7 A;  5H6Q B;  2X9H A;  3Q5W A;  5LOV E;  1ZEE A;  2J4G A;  3RQU A;  1MND A;  2OA5 A; 
#chains in the Genus database with same CATH homology
 2L3L A;  4QX7 B;  5LXT E;  3AA0 B;  4QWN B;  4EZ4 A;  3FBL A;  5F3J A;  4QXH B;  5C8Y E;  2DWK A;  4MHC A;  4I43 B;  5EK2 A;  3K3N A;  2YU1 A;  4UEM A;  5EK3 A;  5IYZ E;  4IGU A;  3N9O A;  1E1H B;  3CPZ A;  1YW0 A;  4HN9 A;  4AKR B;  4QX8 B;  3WAK A;  1BR1 A;  3RX6 A;  2KXP B;  3LK4 2;  3DTO A;  5LG4 A;  3MA9 A;  4MAL A;  3UTK A;  4F6R C;  5JQG E;  5JDQ A;  2CM0 A;  2QA7 A;  4PJN A;  5FNV E;  3KVA A;  2EHO D;  4CXW A;  2SPC A;  3C98 B;  4UXN B;  3BQL A;  1WRD A;  2RA1 A;  3HKC E;  3DJB A;  5HXH A;  4X1I E;  3Q9D A;  3HL6 A;  4MFR A;  4KBM B;  3LK2 B;  3P7I A;  5FXW A;  2CXD A;  5HAX A;  5JR9 B;  2G0U A;  2Q9Q C;  3IBP A;  4L0R A;  4U74 A;  2CXL A;  1VRB A;  3PUA A;  2VKD A;  2JMH A;  4PFO A;  2C5J A;  5DQV A;  2MBG A;  5M4Y A;  4WBN E;  5LCY A;  2LOS A;  4PAG A;  4ZOL E;  2ODV A;  2B1E A;  3C4X A;  3HKD E;  3N2G E;  3LBX B;  3AVR A;  3QK6 A;  5JRE A;  4EB6 E;  3J7Y q;  1EZ3 A;  2A2F X;  2JRK A;  3RYI E;  3RYH E;  1QUU A;  4H9N C;  2V7M A;  3BK9 A;  2BVM A;  4ZHQ E;  4O8S A;  2Q9Q A;  3IHR A;  4H9R C;  4UV9 B;  4EZH A;  2VKO A;  3MJX A;  4UVB B;  2W0G A;  4MLK A;  3PU8 A;  1SHZ C;  3AAA B;  2JPF A;  2WMO A;  3D0T A;  5LHG B;  3N9Q A;  5LBM A;  3ZMU B;  4ZI2 D;  2VK9 A;  1FEW A;  2V26 A;  2XAH B;  4I50 E;  4AXP A;  3FXD B;  1ZKE A;  5L2L A;  2LHN A;  3S4U A;  3K8P C;  4WW0 A;  1G73 A;  2ACX A;  2W62 A;  4B6X A;  1BR2 A;  3CVR A;  3N2K E;  4I55 E;  5HWX A;  1HX8 A;  1VOM A;  2KT9 A;  1D1C A;  2Z6E A;  3C51 A;  2VAS A;  1FMW A;  4OFZ A;  4EIW A;  2X9X A;  3H37 A;  2NTX A;  3QC9 A;  3VKG A;  2KIN B;  3WAJ A;  4KUM B;  4PJL A;  3ZJ1 A;  3ZYL A;  5L3E B;  3PUS A;  4BJM A;  3K3Q C;  5JR9 C;  1D0X A;  5DJQ C;  3KBT A;  4OHF A;  5FY0 A;  3ZPO A;  2VWA A;  2ZM0 A;  4P09 A;  2WAU A;  4UF0 B;  3U3I A;  4AQG A;  5FXX A;  3KV9 A;  4DVD A;  4AQF A;  3AB3 B;  2V7K A;  4GK0 E;  5JDM A;  4O2A E;  2CXF A;  2CA5 A;  2L8K A;  1T98 A;  1YKH B;  4PK6 A;  3FB2 A;  4XZC A;  3UUM A;  3ONX A;  1MMD A;  2ZLY A;  3O1J A;  3PUR A;  3KV6 A;  4TZ4 C;  1LKX A;  4HGA A;  4IE5 A;  3T8O A;  3CQC B;  5LGU B;  5LBQ B;  3ZCJ A;  4U72 A;  2LSG A;  3BQI A;  4NUV A;  3ZMV B;  4ISS A;  2D0U A;  2HH7 A;  2NW9 A;  1WYB A;  3N2O A;  1OXZ A;  1IZN B;  2KZ7 B;  5E0O A;  5AFU L;  1BR0 A;  3PDY A;  2Y6X A;  1U5P A;  4TN7 B;  1HS7 A;  2LE8 A;  1QSD A;  1HCI A;  3RRC A;  3OBV E;  2VKH A;  3ANW B;  5HYA A;  3RPU A;  2GK9 A;  4M1P A;  5FYM A;  4X1K E;  5A1L A;  2IC6 A;  3WI3 A;  2N9D A;  3E22 E;  4GOU A;  1YKE B;  2XHE B;  4UIG A;  3ZYM A;  2DWG A;  4P0A A;  2QGS A;  2K9A A;  1NWM X;  2Q9Q D;  3GWH A;  3N5L A;  3ETV A;  5H6R B;  5J2U E;  4PW8 A;  4OYJ A;  3ESL A;  3GN5 B;  4YJ3 E;  2RP4 A;  2PG8 A;  3PUQ A;  2CWO A;  4L9I A;  1AJ3 A;  5HXC A;  1IJ5 A;  4BJN A;  1S94 A;  3OYZ A;  5L3B B;  3E08 A;  3RC8 A;  2XAJ B;  3SOL A;  2DCF A;  2XQY A;  4MBQ A;  2LEH A;  3SWH A;  3UT5 E;  4ERR A;  5L3C B;  2A72 A;  4JEU B;  4V1A v;  4FJO A;  1NAF A;  3B13 A;  2W63 A;  1Y64 B;  4GYR A;  2IC9 A;  5FP3 A;  1HFA A;  2LT3 A;  4ILU A;  4PFP A;  4WBO A;  2ES0 A;  2X68 A;  2Y48 B;  4TX5 A;  5DQW A;  2KND A;  2X67 A;  3JC6 D;  3ZJ2 A;  3R6N A;  3NRX A;  4L5G A;  4O4I E;  1D1B A;  4ZS3 A;  3UFE A;  3SS1 A;  2VL8 A;  2WWU A;  3F57 A;  4QHO A;  5CB4 E;  5LP6 E;  4WNK A;  1BR4 A;  3SRZ A;  1X79 A;  2D0T A;  2ZMA A;  2LSY A;  2C5K T;  4H9Q C;  3EVY A;  4ASK A;  1CUN A;  3KBU A;  1MMG A;  4C91 A;  4TV9 E;  3P8C D;  4ZS2 A;  2ZM2 A;  3R84 B;  2CE7 A;  5JDN A;  2HPJ A;  4ADZ A;  3ZN0 B;  1MMA A;  2XAS B;  1Z0P A;  5ADX L;  5CA1 E;  4DBQ A;  2K48 A;  2K5B B;  3W15 B;  3ZLI A;  5JRC A;  2JQQ A;  3LG7 A;  3B57 A;  4TV8 E;  2XTL A;  3KIN B;  3KV5 A;  2LSK A;  3Q5X A;  4DMW A;  4PK5 A;  2ZM8 A;  2CCQ A;  1D1A A;  2E9X B;  5KX5 E;  2DNX A;  3C4W A;  4X20 E;  3EDV A;  4E7Z A;  3RH3 A;  2YK0 A;  3N9M A;  3BQK A;  5L3G B;  4ZI3 D;  2X9Y A;  2NOX A;  2LSI A;  2MTQ A;  3IEE A;  4I4T E;  1HF8 A;  2NW8 A;  2V7I A;  4EOZ B;  3Q2M A;  1IJ6 A;  2X66 A;  2Y8D A;  3MZK B;  4DO0 A;  4UEL A;  5LYJ E;  2DI4 A;  3AA6 B;  3F31 A;  4EXT A;  3V5U A;  1WLX A;  1HG5 A;  1WYC A;  1D0Y A;  4O2B E;  3VKH A;  1LVF A;  3QUJ A;  4DND A;  3UUX B;  3PU3 A;  4CQI A;  1MIV A;  4ZI7 E;  4UV8 B;  3O1I A;  3HR0 A;  3UUL A;  4YJ2 E;  3ZC0 A;  2MOZ A;  2KWI B;  2MYS A;  3OKQ A;  4YLH A;  2CMR A;  4H63 H;  2EHO B;  4DBR A;  2DHR A;  2LOP A;  4G63 A;  4PK4 A;  4EAH A;  3FHN A;  1H7C A;  3C64 A;  4JEH B;  2LHR A;  2KLQ A;  3VHL A;  4CI1 B;  1LRZ A;  2V7J A;  2N1G A;  4IE7 A;  2YIN A;  5JR9 A;  2J1D G;  2NW7 A;  3C4Z A;  4IIJ E;  5JDL A;  2CWY A;  3K3O A;  1HTJ F;  4PJJ A;  1ZHC A;  5ETW A;  2VKJ A;  4AKG A;  4XBF B;  2WSS V;  3I0O A;  2JJ9 A;  3LFM A;  1FIO A;  2BZB A;  5HXS A;  2V7L A;  5FXZ A;  3L09 A;  2WM9 A;  3LBX A;  4UVC B;  3E0Z A;  2PBI A;  3GA8 A;  4AKI A;  2C5I T;  4P0B A;  3IF8 B;  2E9X C;  5JVD E;  5LNK A;  2H7O A;  4TUY E;  4NUU A;  4CI2 B;  1HG2 A;  1V9D A;  3CQX C;  2P9B A;  4AI6 A;  1US7 B;  4A56 A;  4H9S E;  2XAQ B;  3AA1 B;  4KP3 C;  1B7T A;  3O1H A;  5L3D B;  3I9Y A;  2ODU A;  3F2E A;  2PJQ A;  4O4H E;  1MIW A;  2BDE A;  5CA0 E;  1WR6 A;  3AAE B;  3TKL B;  3H3A A;  2NP9 A;  5F8P A;  3PTR B;  4N78 D;  3I9W A;  3EDU A;  3ZYK A;  4J2C A;  5J1G A;  4H63 V;  3ZMS B;  4C90 A;  4EYY R;  5KMG P;  3AA7 B;  1MMN A;  3UUN A;  3AAI A;  4YFS A;  1D0Z A;  1UCU A;  2XAF B;  3EUH A;  4CI3 B;  5BMV E;  4FI5 A;  3NZP A;  5J2T E;  3N9N A;  5HXE A;  4ANJ A;  2CEA A;  3HI2 A;  2DLR A;  3MK7 C;  2E9X A;  4QXC B;  2E8I A;  2UXN B;  3CML A;  1UX5 A;  1S35 A;  3A5X A;  3CX7 B;  3CWZ B;  2UXX B;  2D5U A;  3KV4 A;  2A3D A;  3O9X A;  4CXX A;  3NRY A;  1YD8 G;  5GON E;  2LM9 A;  3FBZ A;  2EHO C;  4HE8 A;  2C0S A;  2NWB A;  5JDG A;  3RKO A;  5JDF A;  2W00 A;  1U4Q A;  5FXV A;  1SA0 E;  3CX6 B;  3ZN1 B;  2V1D B;  5LHI B;  3I1A A;  3NBX X;  2XAG B;  2N2N A;  3OYX A;  5JDH A;  1IAP A;  2CLY B;  4QKN A;  3N9L A;  4UF0 A;  2LSJ A;  5HXR A;  3KDS E;  4GIW A;  5HWY A;  1G8X A;  1UX4 A;  4IE0 A;  4E7S A;  3V5S A;  2XUE A;  2KMF A;  4EYU A;  2PFV A;  3OJA A;  1O3X A;  3AVS A;  4O4J E;  5FY7 A;  2EHO A;  4IE4 A;  2D2S A;  3LK3 B;  3JC6 C;  3U78 A;  2W61 A;  3HKB E;  2IAK A;  2HPL A;  4IST A;  3ZEF B;  3I0Q A;  4IDZ A;  1KK7 A;  4G2A A;  5EK4 A;  1MIY A;  2M67 A;  4JLE A;  4H9P C;  3ZMZ B;  2X0L B;  5LJN A;  3KVB A;  2KWH A;  4GK5 E;  3J9X 1;  2JMK A;  3ETU A;  2L9Q A;  3O4X E;  1OWA A;  3FXE B;  3VU7 H;  4PJM A;  5L3F B;  4HTE A;  4AQF C;  4PNI A;  3RYC E;  4HEA A;  1LVK A;  3L3P A;  5LA6 E;  4ZI2 C;  5LHH B;  3ANW A;  4O4L E;  4GYS A;  4K0U A;  3CQG B;  2WMN A;  2H3R A;  4X1Y E;  4IE6 A;  2WBL A;  4H9O C;  2BVL A;  3LJC A;  4CZZ B;  4AKL A;  4KMC A;  2X9W A;  4CXY A;  2YEV C;  3M65 A;  4OK0 A;  1MNE A;  5DAB A;  3PE0 A;  4ZI3 C;  4DMV A;  5TAO A;  4UVA B;  2Q9Q B;  5LJM A;  3C50 A;  4AKH A;  5IHY A;  4HFV A;  3CKD A;  3HKE E;  4OYK A;  2X51 A;  3CX8 B;  3GN5 A;  5KDM C;  2IW5 B;  3RRW A;  4QXB B;  5LGT B;  2I59 A;  3NZQ A;  3ZC1 A;  3N9P A;  4XAX B;  4YHJ A;  3MKD A;  5EZY E;  3RC3 A;  2K24 A;  4BA9 A;  4Z8X A;  5JRC B;  3HA4 A;  3ZMT B;  2CLY C;  1ZV4 X;  2YU2 A;  2LJL A;  4BAY B;  3KFW X;  3ZCI A;  2E9X D;  2H7V C;  1FMV A;  5JH7 E;  5LGN B;  2VB6 A;  3PUG A;  3DP7 A;  5H6Q B;  3RYF E;  3GMI A;  3MXZ A;  4JUY A;  2X9H A;  3Q5W A;  5LOV E;  5FY1 A;  3MAC A;  1ZEE A;  1KNZ A;  2NTY A;  4HKA A;  5FMN A;  1MND A;  2OA5 A;  4IHJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...