4LFCT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfcT00
5BR8T 4LFBT 5LMUT 2UUAT 1FJGT 2VQFT 4JI5T 2UXCT 1HR0T 4JI6T 4DR5T 4DUZT 4LF8T 4X64T 1I94T 1N33T 1N32T 4JI1T 4K0KT 1N36T 2HHHT 1IBKT 4LF4T 2UU9T 5IWAT 4AQYT 5LMNT 4DV1T 4JYAT 4DR4T 4LF5T 4DR7T 1IBLT 1IBMT 4DV4T 4JI3T 4NXMT 4JI0T 2UXBT 4YY3T 1HNZT 3T1YT 4DR6T 4DV6T 1N34T 2UUCT 4JI8T 4DR2T 1J5ET 4DR3T 4DV3T 4DV2T 4DUYT 4X62T 4B3RT 4GKJT 4JI4T 4JV5T 1XNQT 1XMQT 4GKKT 3T1HT 4B3TT 1HNWT 1XNRT 4JI7T 4NXNT 2VQET 2ZM6T 1HNXT 4JI2T 2UUBT 4LF6T 4B3MT 4DR1T 1XMOT 2E5LT 3OTOT 2F4VT 4KHPT 4DV0T 4X66T 4LFAT 4DV5T 2UXDT 4B3ST 4DV7T 4YHHT 4LF7T 4LFCT 4OX9T 4LF9T 4X65T
chains in the Genus database with same CATH superfamily
2L3LA 1XWMA 5AQFB 4LFBT 5H6QB 3Q2MA 1SE7A 3H37A 5IYZE 4IDNA 5JDMA 4H9QC 4HEAA 1HCIA 3OPCA 1BR0A 2PJQA 4BJNA 5FL0A 5AQPB 2UXNB 2YN6A 1R8IA 3U3IA 3AXJB 3AE9A 2BVLA 3TLTA 2DWGA 2CXLA 3EHZA 3KDSE 1IBLT 4DBQA 2FJBA 2YDRA 5EK3A 4DR6T 5AQRB 5AQJB 3FBZA 2V26A 2YEVC 2WSSV 2E9XA 2ODVA 5KMGP 3C64A 4OYJA 1KNPA 2NWBA 4YTNA 2SPCA 1D0YA 4DV2T 1VOMA 5HAXA 3I9YA 4ISTA 2LSIA 4NIQA 2IIUA 3P4WA 5LP6E 2LOPA 5HXCA 3CX8B 2HPJA 1IJ5A 1E7PA 2XJ7A 4CZZB 3KBUA 2KXPB 3ZC1A 2WY2A 4A97A 4CXXA 3HR0A 3QOFA 4TN7B 5FY1A 3AE2A 4YHHT 4LF7T 3VKHA 3OKQA 4QKNA 3WI3A 2JMKA 1HTJF 2CRBA 2IHR1 4EGWA 5LBQB 3ABVA 4Z8XA 5TAOA 3WAKA 2K5BB 3G06A 2DNXA 2W0GA 5JRCB 3B5MA 5FXWA 5LG4A 1OXZA 5FKYA 4ZS2A 4IL9A 4PFPA 4LF5T 3GN5A 4CXYA 3PUQA 3A5XA 4HWHA 3O9XA 3UUNA 5LGNB 2V7MA 4WZXA 4PJMA 3NZQA 4ZS3A 3AE1A 1LRZA 3P8CD 5L3BB 5KDMC 4E7ZA 4ILBA 2BKNA 3SS1A 2X68A 4EOZB 1YKHB 2JQ9A 2W67A 2WP9A 1NAFA 4JBWF 2JQKA 1B7TA 5FL1A 4ZZBA 1HNXT 2NW9A 3ETVA 3V5UA 2F4VT 3Q5DA 5AQKB 4G63A 5FXVA 1T8BA 2E9XB 5DJQC 2D5UA 4YFSA 2WDVA 2UUAT 1FJGT 2LLYA 3OBVE 4L5GA 1BR1A 3ZYMA 2BKOA 2PFVA 4X64T 2LM2A 5IUXA 3CKDA 1D1BA 1ZOYA 2FJEA 4K0UA 2JJ9A 3ANWB 2GK9A 4G2AA 5JR9A 3RPUA 3LDQB 2CBJA 5IWAT 2XQ8A 3VR9A 3PUAA 3ZT5A 1UX4A 1WYCA 4DR4T 2PG8A 4ILUA 3C50A 5L3CB 2VWAA 3P4QA 5HXRA 1FMVA 4HFHA 3QK6A 3LK3B 2H89A 3PUYF 3VRBA 1GQEA 1JNZA 2ACXA 3IHRA 3CPZA 3ZN1B 2XQ7A 2V7KA 3FZHB 4GKKT 3T1HT 5EZYE 2ACZA 3KINB 3AE6A 3ZLIA 4YJ3E 2V6YB 2UUBT 3AA6B 4NUUA 1QSDA 1X79A 3N9QA 1CHUA 3PUGA 2ES0A 4YSZA 4X66T 2XQ4A 4DV5T 3LJCA 3B57A 4TWDA 4LF9T 1G8XA 5JH7E 5FY0A 5HEHA 3UUXB 4WYVA 3RHWA 3B13A 3N2GE 1HX8A 4PW8A 2XAHB 3Q9DA 4DBRA 4AISA 2B1EA 4MFRA 1OEDC 3MJXA 2X0HA 2E5VA 3C51A 4KBMB 4X1KE 5AQMB 5L3DB 4QH5A 4L9IA 3KV4A 3RKGA 5ADXL 4NXMT 2XAFB 3MA9A 5L4HA 3R6NA 1L0VA 4JLEA 4AKLA 3AEAA 2OV9A 1KEYA 4DUYT 1OEDA 1XZYA 4UXNB 5JR9B 4A98A 2WWVA 2OLTA 1YKEB 2J62A 2EHOB 3PJAA 1G73A 2JQHA 2DI4A 4JI7T 4NXNT 4JEUB 2XQ3A 2NR4A 4LF6T 4U74A 5JDNA 5LYJE 5LNKA 4DV0T 3C4WA 3UU6A 3HI2A 2RA1A 4OX9T 2CPTA 3EDUA 2B76A 2WBLA 2AXDS 5HEUA 2I6HA 3KVAA 4HE8A 2QA7A 4HFEA 2DWKA 1BR4A 3CQGB 4DUZT 1UK5A 2JQQA 4TWHA 3RQWA 4CN1A 3P4RA 4I4TE 4UF0A 1VRBA 5LCYA 4AKGA 2VKOA 4JYAT 2VKJA 2C5IT 5HXSA 3AECA 3FZFB 5JTGA 2ODUA 4JI3T 4GYRA 1VCTA 5F3JA 3T1YT 2LKHA 3UQ4A 4BA9A 3ZMSB 3LBXA 4ZOLE 3Q5WA 5FVKA 3RGLA 4IE0A 1XDOA 1J5ET 5HXHA 5HYAA 2Q9QD 4DR3T 3RLFF 3E0ZA 2LSGA 2K48A 4TV8E 4TNVA 1MNDA 3BK9A 4UVAB 5JDGA 4HTEA 4LMLA 4YLHA 2KT9A 3F2EA 4QXCB 1QLBA 4U2ZA 3IEEA 4PK6A 4CQIA 4UV8B 3LFMA 3ZSSA 3ZT6A 3N9PA 3UUBA 2VKDA 4AIUA 2N1GA 4LFAT 1I6ZA 2YK0A 3S4UA 5BMVE 5LHIB 2CCQA 1HR0T 2VKHA 3PV0F 3QB5A 4Q25A 1W0AA 2HHHT 4ADZA 2MTQA 3AEBA 5FY7A 2CMRA 4AKIA 4O4LE 1J1JA 4MHCA 2WQYA 3AA0B 3NBXX 3L09A 3ONLC 4U7IA 1NWMX 4QH1A 2CA5A 5AQTB 2LHNA 5AQUB 2Y6XA 4QXBB 5CJ5A 3OJAA 5J2TE 4HN9A 2X9YA 1IZNB 3K3NA 2LSKA 5J2UE 3K8PC 3AE4A 5AQSB 3NZPA 1HS7A 2BBHA 2X9XA 2WM9A 1XNQT 2XAJB 3RYFE 2CBIA 4L0RA 2I59A 2Q9QC 3HKCE 1MMNA 3P4PA 1ZHCA 3N2OA 5HEOA 3ZJ2A 4HWIB 3ZSTA 4IGUA 4JI2T 2X51A 2NW7A 2E2AA 4I55E 4CI1B 5EK4A 2ZLYA 4A5XA 1D1AA 3VHLA 2A72A 5ETWA 4HFIA 3N9OA 1KFYA 3AE3A 5LXTE 2VQFT 4HWFA 2WAUA 3GWHA 2W4XA 3E08A 3SFDA 1H7CA 5LBMA 4LF8T 5JDQA 4H9SE 4N78D 4LF4T 4WNKA 3MXZA 2XASB 5JDHA 4ZXLA 2LSYA 4O2BE 3CX6B 4GK0E 4AQGA 1QUUA 4DR7T 2M67A 2BG9C 2XQ5A 4UV9B 1M62A 5LJMA 5JDLA 4DV6T 1WCRA 2K9AA 4HFDA 5HWYA 5AQHB 2WDQA 1NEKA 1YQ4A 5CB4E 4DO0A 5LOVE 2LHRA 4X62T 3X1DA 4EYUA 3UU5A 3PURA 1MIYA 2XSAA 3AEFA 2WU2A 3DP7A 3QNUA 2BG9A 4ZI2D 2VQET 3I1AA 1XMOT 1XDPA 4CN6A 4IDPA 4KP3C 1UCUA 4PFOA 1ZP0A 3PU3A 3PUZF 5AQIB 3CK6A 3ZJ1A 1MMDA 2YINA 4DR5T 3RYHE 4Z90A 2XQAA 4EZ4A 3FHNA 1N36T 2WS3A 4O2AE 3RH3A 5CA0E 5ABHA 1E1HB 2VASA 2KZ7B 4O4JE 4TX5A 2VVNA 1IJ6A 1IBMT 2V7IA 5FVLA 5L4EA 3I0OA 2BDEA 4OYKA 4YTMA 1MIWA 2KMFA 3UFEA 2A9UA 3HL6A 2WZIA 3ETUA 2CLYC 1Y64B 2KWHA 3C4ZA 3AE8A 4DV3T 3UFGA 4WBNE 2DHRA 4DVDA 3CQXC 4I0UA 4IIJE 5C3JA 3JC6D 4BAYB 4XZCA 1MNEA 2CXDA 2VK9A 2D0UA 4P0AA 4EAHA 3H3MA 3KV9A 3EUHA 4DR1T 4EEBA 2X0LB 1W9RA 2UXDT 4DV7T 5H6RB 4ZI2C 2X67A 3R84B 4ASKA 3AEGA 4BJMA 4HWCA 2PTFA 3HKDE 4UIGA 4AXPA 4YSXA 4JI6T 2J4GA 3GN5B 3UQ7A 1N32T 4K0KT 4CXWA 2H3RA 2MOZA 4IHJE 5DABA 1LVFA 3I9WA 5L3FB 5LJNA 3RKOA 4AQYT 2DCFA 2BS4A 4YHJA 2KSRA 1HG5A 4XAXB 2MPKA 3KBTA 4UELA 4CN4A 1O3XA 2W61A 1U4QA 4KX6A 4F8HA 3T8OA 2XSBA 4HWDA 4HGAA 4IL4A 5J1GA 3NRYA 5F8PA 1HF8A 2IC9A 2VL0A 2W2UA 1D1CA 5HCJA 4B3RT 2YU2A 2W00A 3K3QC 3NWIA 2J1DG 4PJJA 1YXRA 3I0QA 4MLKA 1XNRT 3ZEFB 1WRDA 2CWOA 3BQIA 2X9WA 1EZ3A 4UVBB 3MACA 2C5JA 3JC6C 3SWHA 2H88A 4HFCA 2IC6A 3DJBA 4B3ST 2BKPA 2QYWA 5BR8T 3GA8A 3WAJA 4H63V 2UXCT 4U2YA 3ZKRA 4DNDA 2H7OA 2V6XA 3PUVF 5ABFA 3RIAA 5LA6E 5GONE 4ILAA 2G0UA 3PJAJ 1HG2A 5CGMA 2HPLA 3CMLA 3KV6A 3A8YC 3LK42 3HKBE 1LVKA 2XM1A 1SA0E 4PNIA 2IAKA 2QRXA 4MALA 3IBPA 4DV4T 3AB3B 4UEMA 3OVUA 3CVRA 3ZYKA 2CE7A 2CHNA 3JCFA 2FJDA 1FMWA 2N9DA 5AQVB 2M6BA 3N9LA 5FXZA 4I43B 1Z0PA 4JI8T 4P0BA 4DR2T 4H9PC 3TLWA 4LMJA 4EZHA 3AXJA 2VVSA 3TKLB 5CFBA 1FEWA 5FNVE 2FUPA 3MK7C 3M3ZB 2E9XD 2ZM0A 3AE5A 1XMQT 4YXDA 2JMHA 4OHFA 3Q5EA 3UU3A 4DMVA 4M1PA 3GMIA 1ZKEA 5KX5E 2E5LT 2CM0A 2W63A 2WCAA 2XQ9A 3FXDB 4WW0A 4H9OC 2LRKA 4X65T 5AQOB 3IF8B 3E22E 1FIOA 5JVDE 3PU8A 1W0BA 4DIDB 1N33T 5LGTB 3PE0A 1WR0A 3ZMTB 3MKDA 3RC8A 3EAMA 2IUBA 2K3WA 3SRZA 1T98A 4C90A 4U7YA 5J0ZA 4DV1T 3AA1B 1OEDB 5FYMA 4XBFB 4JI0T 1HNZT 5CA1E 4TZ4C 5AQNB 1U5PA 5JRCA 1N34T 2A2FX 4EIWA 1WLXA 2XM2A 3JAFA 3ZCIA 2R6GF 2X9HA 3FBLA 4V1Av 3L3PA 2PBIA 3AVRA 3ZMUB 2UXXB 2WB5A 4NUVA 3AAIA 1HNWT 2Y48B 4IDOA 4ZHQE 3N9MA 4ZZCA 2E9XC 2ZM6T 2YDSA 2LE8A 3N5LA 2YKSA 2XHEB 3OYZA 2AE9A 5HEGA 1J5WA 2Y8DA 4UF0B 4YSYA 1HFAA 1Z8UA 3RIFA 1E2AA 4GYSA 5EK2A 4C91A 3J7Yq 2ZM2A 4ZI7E 1I94T 4O4HE 3AEDA 3LBXB 3V5SA 2UU9T 2KWIB 4EXTA 2LSJA 4AI6A 1S35A 4YT0A 2BZBA 3PTRB 4U3CA 3PUXF 1D0ZA 2EHOD 2Q9QA 3ANWA 3Q5XA 4WBOA 3SFEA 5AQGB 3UT5E 3NKZA 3VU7H 2LJLA 3RC3A 4QWNB 1MMAA 3ZYLA 2C5KT 1T7SA 4ZI3D 4JEHB 1D0XA 3P4SA 5HWXA 3J9X1 4LMKA 3ZN0B 2L8KA 2NTYA 1OEDE 3L8RA 4HFBA 3UTKA 3OTOT 2BVMA 1UGOA 2WMOA 5ABEA 2V1DB 4CI3B 4H9RC 3A7MA 3LK2B 2FJAA 3K1SA 4TUYE 5LGUB 2LEHA 3PUSA 5LHHB 3HA4A 1ZV4X 4I50E 2V6YA 2BBJA 3H3AA 2WZHA 4JI1T 2A3DA 2D9DA 3RF1A 4U72A 2JIWA 3C98B 3ZC0A 2DL1A 1SHZC 4YTPA 2CXFA 3AA7B 2CEAA 2M6IA 3EDVA 3F57A 1SUMB 1MIVA 5E0OA 2XTLA 3JAEA 5DQWA 5JREA 5M4YA 3QC9A 2XQYA 4X1YE 2I0MA 3O1HA 4X1IE 4PAGA 5JR9C 1Y01A 3F31A 4GK5E 2CHOA 4P1NA 2EHOC 4PK4A 3RRCA 5AQQB 2W62A 4GKJT 5L3EB 4JI4T 4JV5T 4Z91A 4P09A 2XPKA 3EABA 1UURA 3KFWX 4B3TT 3VKGA 2VB6A 3ESLA 2BS2A 2C0SA 3FZKB 2H7VC 2X0YA 3EVYA 3O1JA 2IW5B 4A56A 4OK0A 2KNDA 5JQGE 2HN2A 4B3MT 1UUSA 4ZI3C 2NW8A 2Q9QB 2V7JA 2KLQA 4GIWA 3AE7A 2HH7A 4LFCT 4YJ2E 2EHOA 5LG3A 5LMUT 4CI2B 3OYXA 1M7KA 3ZMZB 3W15B 3RRWA 4AKRB 1LKXA 3TLSA 3ZT7A 3NRXA 1OWAA 3JADA 4J2CA 2JRKA 3CX7B 1UX5A 4PK5A 3MZKB 1BR2A 3PDYA 2XUEA 4ZEYA 3CIRA 2K24A 1IAPA 2W66A 3PUWF 1YQ3A 2UXBT 4YY3T 1KF6A 3BQKA 3K3OA 3UU4A 5FP3A 3ONXA 4PJNA 3ZMVB 2BG9B 5HEJA 4KMCA 2HN1A 2LM9A 2WU5A 4O4IE 3U78A 3KV5A 3P50A 4ISSA 3ZCJA 2LKGA 4COFA 4FJOA 3TLUA 3KVBA 2ZMAA 3LG7A 2YU1A 2NOXA 2LRLA 1KK7A 2DLRA 3RYIE 4X20E 1S94A 5IHYA 3AEEA 4KHPT 4IDQA 3NVOA 3EI0A 2LOSA 2XZEA 2V7LA 2MBGA 4QXHB 4H63H 5JDFA 2RPAA 4JI5T 3N9NA 2IMLA 3HKEE 4KHZF 4ERRA 3QUJA 3VR8A 5AQLB 3P7IA 4U31A 3AVSA 3L39A 1KNZA 4IE4A 1IBKT 5AFUL 4TV9E 2IDOB 5LMNT 4PJLA 4QH4A 3CQCB 3RQUA 3TLVA 4O8SA 2OA5A 2XQ6A 1WR6A 2YDQA 2NP9A 2V5CA 3RX6A 4TNWA 4IE7A 2MYSA 1YW0A 2VL8A 4DMWA 5KXJA 3RYCE 1W09A 3N2KE 2RP4A 2KINB 1WYBA 2XAQB 3O1IA 3M65A 2XAGB 4NPPA 1US7B 4MBQA 4QHOA 2CLYB 1HX1B 5C2TA 1YD8G 3CWZB 4OFZA 3FB2A 1CUNA 4KUMB 2P9BA 1DU2A 4H9NC 3UU8A 3FXEB 3LSVA 2J47A 2MAWA 1JNRA 2JPFA 1ZEEA 2D2SA 3RI5A 1AJ3A 1WFDA 5L47A 4QX8B 2XY8B 2Z6EA 3AAEB 3O4XE 2NTXA 2BG9E 4IDZA 3D0TA 4IE6A 4JUYA 2D0TA 3IA3A 4IT4A 2FBWA 5FMNA 5HXEA 4U33A 2V5DA 1T72A 2WWUA 2YOEA 5HCMA 4UR9A 5LB7B 3BQLA 4HFVA 2CWYA 2E8IA 4FI5A 3FZMB 4EV6A 1V9DA 5DQVA 4GOUA 4HKAA 4EYYR 2V8SV 5ABGA 1X9BA 1MMGA 4AQFC 4QX7B 5L2LA 1VCSA 2WMNA 4ILCA 5FXXA 3UULA 4X5TA 3SOLA 2UUCT 5A1LA 3RIUC 5C8YE 3ONJA 5L3GB 3VRAA 2BS3A 2N2NA 2VURA 3ZPOA 4IE5A 5LHGB 4F6RC 4E7SA 4KI0F 4ANJA 2LT3A 3FZLB 4TWFA 2X66A 4AQFA 4EEDA 4IREA 2L9QA 2QGSA 3DTOA 2WDRA 3AAAB 5ABFB 3C4XA 2ZM8A 3QB5K 4AKHA 3UUMA 4B6XA 4UVCB 4EB6E 1NENA 2QVAA 3RIUA 1KNRA 5F5WA
chains in the Genus database with same CATH topology
5BR8T 4LFBT 5LMUT 2UUAT 1FJGT 2VQFT 4JI5T 2UXCT 1HR0T 4JI6T 4DR5T 4DUZT 4LF8T 4X64T 1I94T 1N33T 1N32T 4JI1T 4K0KT 1N36T 2HHHT 1IBKT 4LF4T 2UU9T 5IWAT 4AQYT 5LMNT 4DV1T 4JYAT 4DR4T 4LF5T 4DR7T 1IBLT 1IBMT 4DV4T 4JI3T 4NXMT 4JI0T 2UXBT 4YY3T 1HNZT 3T1YT 4DR6T 4DV6T 1N34T 2UUCT 4JI8T 4DR2T 1J5ET 4DR3T 4DV3T 4DV2T 4DUYT 4X62T 4B3RT 4GKJT 4JI4T 4JV5T 1XNQT 1XMQT 4GKKT 3T1HT 4B3TT 1HNWT 1XNRT 4JI7T 4NXNT 2VQET 2ZM6T 1HNXT 4JI2T 2UUBT 4LF6T 4B3MT 4DR1T 1XMOT 2E5LT 3OTOT 2F4VT 4KHPT 4DV0T 4X66T 4LFAT 4DV5T 2UXDT 4B3ST 4DV7T 4YHHT 4LF7T 4LFCT 4OX9T 4LF9T 4X65T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 T;  4LFB T;  5LMU T;  2UUA T;  1FJG T;  2VQF T;  4JI5 T;  2UXC T;  1HR0 T;  4JI6 T;  4DR5 T;  4DUZ T;  4LF8 T;  4X64 T;  1I94 T;  1N33 T;  1N32 T;  4JI1 T;  4K0K T;  1N36 T;  2HHH T;  1IBK T;  4LF4 T;  2UU9 T;  5IWA T;  4AQY T;  5LMN T;  4DV1 T;  4JYA T;  4DR4 T;  4LF5 T;  4DR7 T;  1IBL T;  1IBM T;  4DV4 T;  4JI3 T;  4NXM T;  4JI0 T;  2UXB T;  4YY3 T;  1HNZ T;  3T1Y T;  4DR6 T;  4DV6 T;  1N34 T;  2UUC T;  4JI8 T;  4DR2 T;  1J5E T;  4DR3 T;  4DV3 T;  4DV2 T;  4DUY T;  4X62 T;  4B3R T;  4GKJ T;  4JI4 T;  4JV5 T;  1XNQ T;  1XMQ T;  4GKK T;  3T1H T;  4B3T T;  1HNW T;  1XNR T;  4JI7 T;  4NXN T;  2VQE T;  2ZM6 T;  1HNX T;  4JI2 T;  2UUB T;  4LF6 T;  4B3M T;  4DR1 T;  1XMO T;  2E5L T;  3OTO T;  2F4V T;  4KHP T;  4DV0 T;  4X66 T;  4LFA T;  4DV5 T;  2UXD T;  4B3S T;  4DV7 T;  4YHH T;  4LF7 T;  4LFC T;  4OX9 T;  4LF9 T;  4X65 T; 
#chains in the Genus database with same CATH topology
 2L3L A;  1XWM A;  5AQF B;  4LFB T;  5H6Q B;  3Q2M A;  1SE7 A;  3H37 A;  5IYZ E;  4IDN A;  5JDM A;  4H9Q C;  4HEA A;  1HCI A;  3OPC A;  1BR0 A;  2PJQ A;  4BJN A;  5FL0 A;  5AQP B;  2UXN B;  2YN6 A;  1R8I A;  3U3I A;  3AXJ B;  3AE9 A;  2BVL A;  3TLT A;  2DWG A;  2CXL A;  3EHZ A;  3KDS E;  1IBL T;  4DBQ A;  2FJB A;  2YDR A;  5EK3 A;  4DR6 T;  5AQR B;  5AQJ B;  3FBZ A;  2V26 A;  2YEV C;  2WSS V;  2E9X A;  2ODV A;  5KMG P;  3C64 A;  4OYJ A;  1KNP A;  2NWB A;  4YTN A;  2SPC A;  1D0Y A;  4DV2 T;  1VOM A;  5HAX A;  3I9Y A;  4IST A;  2LSI A;  4NIQ A;  2IIU A;  3P4W A;  5LP6 E;  2LOP A;  5HXC A;  3CX8 B;  2HPJ A;  1IJ5 A;  1E7P A;  2XJ7 A;  4CZZ B;  3KBU A;  2KXP B;  3ZC1 A;  2WY2 A;  4A97 A;  4CXX A;  3HR0 A;  3QOF A;  4TN7 B;  5FY1 A;  3AE2 A;  4YHH T;  4LF7 T;  3VKH A;  3OKQ A;  4QKN A;  3WI3 A;  2JMK A;  1HTJ F;  2CRB A;  2IHR 1;  4EGW A;  5LBQ B;  3ABV A;  4Z8X A;  5TAO A;  3WAK A;  2K5B B;  3G06 A;  2DNX A;  2W0G A;  5JRC B;  3B5M A;  5FXW A;  5LG4 A;  1OXZ A;  5FKY A;  4ZS2 A;  4IL9 A;  4PFP A;  4LF5 T;  3GN5 A;  4CXY A;  3PUQ A;  3A5X A;  4HWH A;  3O9X A;  3UUN A;  5LGN B;  2V7M A;  4WZX A;  4PJM A;  3NZQ A;  4ZS3 A;  3AE1 A;  1LRZ A;  3P8C D;  5L3B B;  5KDM C;  4E7Z A;  4ILB A;  2BKN A;  3SS1 A;  2X68 A;  4EOZ B;  1YKH B;  2JQ9 A;  2W67 A;  2WP9 A;  1NAF A;  4JBW F;  2JQK A;  1B7T A;  5FL1 A;  4ZZB A;  1HNX T;  2NW9 A;  3ETV A;  3V5U A;  2F4V T;  3Q5D A;  5AQK B;  4G63 A;  5FXV A;  1T8B A;  2E9X B;  5DJQ C;  2D5U A;  4YFS A;  2WDV A;  2UUA T;  1FJG T;  2LLY A;  3OBV E;  4L5G A;  1BR1 A;  3ZYM A;  2BKO A;  2PFV A;  4X64 T;  2LM2 A;  5IUX A;  3CKD A;  1D1B A;  1ZOY A;  2FJE A;  4K0U A;  2JJ9 A;  3ANW B;  2GK9 A;  4G2A A;  5JR9 A;  3RPU A;  3LDQ B;  2CBJ A;  5IWA T;  2XQ8 A;  3VR9 A;  3PUA A;  3ZT5 A;  1UX4 A;  1WYC A;  4DR4 T;  2PG8 A;  4ILU A;  3C50 A;  5L3C B;  2VWA A;  3P4Q A;  5HXR A;  1FMV A;  4HFH A;  3QK6 A;  3LK3 B;  2H89 A;  3PUY F;  3VRB A;  1GQE A;  1JNZ A;  2ACX A;  3IHR A;  3CPZ A;  3ZN1 B;  2XQ7 A;  2V7K A;  3FZH B;  4GKK T;  3T1H T;  5EZY E;  2ACZ A;  3KIN B;  3AE6 A;  3ZLI A;  4YJ3 E;  2V6Y B;  2UUB T;  3AA6 B;  4NUU A;  1QSD A;  1X79 A;  3N9Q A;  1CHU A;  3PUG A;  2ES0 A;  4YSZ A;  4X66 T;  2XQ4 A;  4DV5 T;  3LJC A;  3B57 A;  4TWD A;  4LF9 T;  1G8X A;  5JH7 E;  5FY0 A;  5HEH A;  3UUX B;  4WYV A;  3RHW A;  3B13 A;  3N2G E;  1HX8 A;  4PW8 A;  2XAH B;  3Q9D A;  4DBR A;  4AIS A;  2B1E A;  4MFR A;  1OED C;  3MJX A;  2X0H A;  2E5V A;  3C51 A;  4KBM B;  4X1K E;  5AQM B;  5L3D B;  4QH5 A;  4L9I A;  3KV4 A;  3RKG A;  5ADX L;  4NXM T;  2XAF B;  3MA9 A;  5L4H A;  3R6N A;  1L0V A;  4JLE A;  4AKL A;  3AEA A;  2OV9 A;  1KEY A;  4DUY T;  1OED A;  1XZY A;  4UXN B;  5JR9 B;  4A98 A;  2WWV A;  2OLT A;  1YKE B;  2J62 A;  2EHO B;  3PJA A;  1G73 A;  2JQH A;  2DI4 A;  4JI7 T;  4NXN T;  4JEU B;  2XQ3 A;  2NR4 A;  4LF6 T;  4U74 A;  5JDN A;  5LYJ E;  5LNK A;  4DV0 T;  3C4W A;  3UU6 A;  3HI2 A;  2RA1 A;  4OX9 T;  2CPT A;  3EDU A;  2B76 A;  2WBL A;  2AXD S;  5HEU A;  2I6H A;  3KVA A;  4HE8 A;  2QA7 A;  4HFE A;  2DWK A;  1BR4 A;  3CQG B;  4DUZ T;  1UK5 A;  2JQQ A;  4TWH A;  3RQW A;  4CN1 A;  3P4R A;  4I4T E;  4UF0 A;  1VRB A;  5LCY A;  4AKG A;  2VKO A;  4JYA T;  2VKJ A;  2C5I T;  5HXS A;  3AEC A;  3FZF B;  5JTG A;  2ODU A;  4JI3 T;  4GYR A;  1VCT A;  5F3J A;  3T1Y T;  2LKH A;  3UQ4 A;  4BA9 A;  3ZMS B;  3LBX A;  4ZOL E;  3Q5W A;  5FVK A;  3RGL A;  4IE0 A;  1XDO A;  1J5E T;  5HXH A;  5HYA A;  2Q9Q D;  4DR3 T;  3RLF F;  3E0Z A;  2LSG A;  2K48 A;  4TV8 E;  4TNV A;  1MND A;  3BK9 A;  4UVA B;  5JDG A;  4HTE A;  4LML A;  4YLH A;  2KT9 A;  3F2E A;  4QXC B;  1QLB A;  4U2Z A;  3IEE A;  4PK6 A;  4CQI A;  4UV8 B;  3LFM A;  3ZSS A;  3ZT6 A;  3N9P A;  3UUB A;  2VKD A;  4AIU A;  2N1G A;  4LFA T;  1I6Z A;  2YK0 A;  3S4U A;  5BMV E;  5LHI B;  2CCQ A;  1HR0 T;  2VKH A;  3PV0 F;  3QB5 A;  4Q25 A;  1W0A A;  2HHH T;  4ADZ A;  2MTQ A;  3AEB A;  5FY7 A;  2CMR A;  4AKI A;  4O4L E;  1J1J A;  4MHC A;  2WQY A;  3AA0 B;  3NBX X;  3L09 A;  3ONL C;  4U7I A;  1NWM X;  4QH1 A;  2CA5 A;  5AQT B;  2LHN A;  5AQU B;  2Y6X A;  4QXB B;  5CJ5 A;  3OJA A;  5J2T E;  4HN9 A;  2X9Y A;  1IZN B;  3K3N A;  2LSK A;  5J2U E;  3K8P C;  3AE4 A;  5AQS B;  3NZP A;  1HS7 A;  2BBH A;  2X9X A;  2WM9 A;  1XNQ T;  2XAJ B;  3RYF E;  2CBI A;  4L0R A;  2I59 A;  2Q9Q C;  3HKC E;  1MMN A;  3P4P A;  1ZHC A;  3N2O A;  5HEO A;  3ZJ2 A;  4HWI B;  3ZST A;  4IGU A;  4JI2 T;  2X51 A;  2NW7 A;  2E2A A;  4I55 E;  4CI1 B;  5EK4 A;  2ZLY A;  4A5X A;  1D1A A;  3VHL A;  2A72 A;  5ETW A;  4HFI A;  3N9O A;  1KFY A;  3AE3 A;  5LXT E;  2VQF T;  4HWF A;  2WAU A;  3GWH A;  2W4X A;  3E08 A;  3SFD A;  1H7C A;  5LBM A;  4LF8 T;  5JDQ A;  4H9S E;  4N78 D;  4LF4 T;  4WNK A;  3MXZ A;  2XAS B;  5JDH A;  4ZXL A;  2LSY A;  4O2B E;  3CX6 B;  4GK0 E;  4AQG A;  1QUU A;  4DR7 T;  2M67 A;  2BG9 C;  2XQ5 A;  4UV9 B;  1M62 A;  5LJM A;  5JDL A;  4DV6 T;  1WCR A;  2K9A A;  4HFD A;  5HWY A;  5AQH B;  2WDQ A;  1NEK A;  1YQ4 A;  5CB4 E;  4DO0 A;  5LOV E;  2LHR A;  4X62 T;  3X1D A;  4EYU A;  3UU5 A;  3PUR A;  1MIY A;  2XSA A;  3AEF A;  2WU2 A;  3DP7 A;  3QNU A;  2BG9 A;  4ZI2 D;  2VQE T;  3I1A A;  1XMO T;  1XDP A;  4CN6 A;  4IDP A;  4KP3 C;  1UCU A;  4PFO A;  1ZP0 A;  3PU3 A;  3PUZ F;  5AQI B;  3CK6 A;  3ZJ1 A;  1MMD A;  2YIN A;  4DR5 T;  3RYH E;  4Z90 A;  2XQA A;  4EZ4 A;  3FHN A;  1N36 T;  2WS3 A;  4O2A E;  3RH3 A;  5CA0 E;  5ABH A;  1E1H B;  2VAS A;  2KZ7 B;  4O4J E;  4TX5 A;  2VVN A;  1IJ6 A;  1IBM T;  2V7I A;  5FVL A;  5L4E A;  3I0O A;  2BDE A;  4OYK A;  4YTM A;  1MIW A;  2KMF A;  3UFE A;  2A9U A;  3HL6 A;  2WZI A;  3ETU A;  2CLY C;  1Y64 B;  2KWH A;  3C4Z A;  3AE8 A;  4DV3 T;  3UFG A;  4WBN E;  2DHR A;  4DVD A;  3CQX C;  4I0U A;  4IIJ E;  5C3J A;  3JC6 D;  4BAY B;  4XZC A;  1MNE A;  2CXD A;  2VK9 A;  2D0U A;  4P0A A;  4EAH A;  3H3M A;  3KV9 A;  3EUH A;  4DR1 T;  4EEB A;  2X0L B;  1W9R A;  2UXD T;  4DV7 T;  5H6R B;  4ZI2 C;  2X67 A;  3R84 B;  4ASK A;  3AEG A;  4BJM A;  4HWC A;  2PTF A;  3HKD E;  4UIG A;  4AXP A;  4YSX A;  4JI6 T;  2J4G A;  3GN5 B;  3UQ7 A;  1N32 T;  4K0K T;  4CXW A;  2H3R A;  2MOZ A;  4IHJ E;  5DAB A;  1LVF A;  3I9W A;  5L3F B;  5LJN A;  3RKO A;  4AQY T;  2DCF A;  2BS4 A;  4YHJ A;  2KSR A;  1HG5 A;  4XAX B;  2MPK A;  3KBT A;  4UEL A;  4CN4 A;  1O3X A;  2W61 A;  1U4Q A;  4KX6 A;  4F8H A;  3T8O A;  2XSB A;  4HWD A;  4HGA A;  4IL4 A;  5J1G A;  3NRY A;  5F8P A;  1HF8 A;  2IC9 A;  2VL0 A;  2W2U A;  1D1C A;  5HCJ A;  4B3R T;  2YU2 A;  2W00 A;  3K3Q C;  3NWI A;  2J1D G;  4PJJ A;  1YXR A;  3I0Q A;  4MLK A;  1XNR T;  3ZEF B;  1WRD A;  2CWO A;  3BQI A;  2X9W A;  1EZ3 A;  4UVB B;  3MAC A;  2C5J A;  3JC6 C;  3SWH A;  2H88 A;  4HFC A;  2IC6 A;  3DJB A;  4B3S T;  2BKP A;  2QYW A;  5BR8 T;  3GA8 A;  3WAJ A;  4H63 V;  2UXC T;  4U2Y A;  3ZKR A;  4DND A;  2H7O A;  2V6X A;  3PUV F;  5ABF A;  3RIA A;  5LA6 E;  5GON E;  4ILA A;  2G0U A;  3PJA J;  1HG2 A;  5CGM A;  2HPL A;  3CML A;  3KV6 A;  3A8Y C;  3LK4 2;  3HKB E;  1LVK A;  2XM1 A;  1SA0 E;  4PNI A;  2IAK A;  2QRX A;  4MAL A;  3IBP A;  4DV4 T;  3AB3 B;  4UEM A;  3OVU A;  3CVR A;  3ZYK A;  2CE7 A;  2CHN A;  3JCF A;  2FJD A;  1FMW A;  2N9D A;  5AQV B;  2M6B A;  3N9L A;  5FXZ A;  4I43 B;  1Z0P A;  4JI8 T;  4P0B A;  4DR2 T;  4H9P C;  3TLW A;  4LMJ A;  4EZH A;  3AXJ A;  2VVS A;  3TKL B;  5CFB A;  1FEW A;  5FNV E;  2FUP A;  3MK7 C;  3M3Z B;  2E9X D;  2ZM0 A;  3AE5 A;  1XMQ T;  4YXD A;  2JMH A;  4OHF A;  3Q5E A;  3UU3 A;  4DMV A;  4M1P A;  3GMI A;  1ZKE A;  5KX5 E;  2E5L T;  2CM0 A;  2W63 A;  2WCA A;  2XQ9 A;  3FXD B;  4WW0 A;  4H9O C;  2LRK A;  4X65 T;  5AQO B;  3IF8 B;  3E22 E;  1FIO A;  5JVD E;  3PU8 A;  1W0B A;  4DID B;  1N33 T;  5LGT B;  3PE0 A;  1WR0 A;  3ZMT B;  3MKD A;  3RC8 A;  3EAM A;  2IUB A;  2K3W A;  3SRZ A;  1T98 A;  4C90 A;  4U7Y A;  5J0Z A;  4DV1 T;  3AA1 B;  1OED B;  5FYM A;  4XBF B;  4JI0 T;  1HNZ T;  5CA1 E;  4TZ4 C;  5AQN B;  1U5P A;  5JRC A;  1N34 T;  2A2F X;  4EIW A;  1WLX A;  2XM2 A;  3JAF A;  3ZCI A;  2R6G F;  2X9H A;  3FBL A;  4V1A v;  3L3P A;  2PBI A;  3AVR A;  3ZMU B;  2UXX B;  2WB5 A;  4NUV A;  3AAI A;  1HNW T;  2Y48 B;  4IDO A;  4ZHQ E;  3N9M A;  4ZZC A;  2E9X C;  2ZM6 T;  2YDS A;  2LE8 A;  3N5L A;  2YKS A;  2XHE B;  3OYZ A;  2AE9 A;  5HEG A;  1J5W A;  2Y8D A;  4UF0 B;  4YSY A;  1HFA A;  1Z8U A;  3RIF A;  1E2A A;  4GYS A;  5EK2 A;  4C91 A;  3J7Y q;  2ZM2 A;  4ZI7 E;  1I94 T;  4O4H E;  3AED A;  3LBX B;  3V5S A;  2UU9 T;  2KWI B;  4EXT A;  2LSJ A;  4AI6 A;  1S35 A;  4YT0 A;  2BZB A;  3PTR B;  4U3C A;  3PUX F;  1D0Z A;  2EHO D;  2Q9Q A;  3ANW A;  3Q5X A;  4WBO A;  3SFE A;  5AQG B;  3UT5 E;  3NKZ A;  3VU7 H;  2LJL A;  3RC3 A;  4QWN B;  1MMA A;  3ZYL A;  2C5K T;  1T7S A;  4ZI3 D;  4JEH B;  1D0X A;  3P4S A;  5HWX A;  3J9X 1;  4LMK A;  3ZN0 B;  2L8K A;  2NTY A;  1OED E;  3L8R A;  4HFB A;  3UTK A;  3OTO T;  2BVM A;  1UGO A;  2WMO A;  5ABE A;  2V1D B;  4CI3 B;  4H9R C;  3A7M A;  3LK2 B;  2FJA A;  3K1S A;  4TUY E;  5LGU B;  2LEH A;  3PUS A;  5LHH B;  3HA4 A;  1ZV4 X;  4I50 E;  2V6Y A;  2BBJ A;  3H3A A;  2WZH A;  4JI1 T;  2A3D A;  2D9D A;  3RF1 A;  4U72 A;  2JIW A;  3C98 B;  3ZC0 A;  2DL1 A;  1SHZ C;  4YTP A;  2CXF A;  3AA7 B;  2CEA A;  2M6I A;  3EDV A;  3F57 A;  1SUM B;  1MIV A;  5E0O A;  2XTL A;  3JAE A;  5DQW A;  5JRE A;  5M4Y A;  3QC9 A;  2XQY A;  4X1Y E;  2I0M A;  3O1H A;  4X1I E;  4PAG A;  5JR9 C;  1Y01 A;  3F31 A;  4GK5 E;  2CHO A;  4P1N A;  2EHO C;  4PK4 A;  3RRC A;  5AQQ B;  2W62 A;  4GKJ T;  5L3E B;  4JI4 T;  4JV5 T;  4Z91 A;  4P09 A;  2XPK A;  3EAB A;  1UUR A;  3KFW X;  4B3T T;  3VKG A;  2VB6 A;  3ESL A;  2BS2 A;  2C0S A;  3FZK B;  2H7V C;  2X0Y A;  3EVY A;  3O1J A;  2IW5 B;  4A56 A;  4OK0 A;  2KND A;  5JQG E;  2HN2 A;  4B3M T;  1UUS A;  4ZI3 C;  2NW8 A;  2Q9Q B;  2V7J A;  2KLQ A;  4GIW A;  3AE7 A;  2HH7 A;  4LFC T;  4YJ2 E;  2EHO A;  5LG3 A;  5LMU T;  4CI2 B;  3OYX A;  1M7K A;  3ZMZ B;  3W15 B;  3RRW A;  4AKR B;  1LKX A;  3TLS A;  3ZT7 A;  3NRX A;  1OWA A;  3JAD A;  4J2C A;  2JRK A;  3CX7 B;  1UX5 A;  4PK5 A;  3MZK B;  1BR2 A;  3PDY A;  2XUE A;  4ZEY A;  3CIR A;  2K24 A;  1IAP A;  2W66 A;  3PUW F;  1YQ3 A;  2UXB T;  4YY3 T;  1KF6 A;  3BQK A;  3K3O A;  3UU4 A;  5FP3 A;  3ONX A;  4PJN A;  3ZMV B;  2BG9 B;  5HEJ A;  4KMC A;  2HN1 A;  2LM9 A;  2WU5 A;  4O4I E;  3U78 A;  3KV5 A;  3P50 A;  4ISS A;  3ZCJ A;  2LKG A;  4COF A;  4FJO A;  3TLU A;  3KVB A;  2ZMA A;  3LG7 A;  2YU1 A;  2NOX A;  2LRL A;  1KK7 A;  2DLR A;  3RYI E;  4X20 E;  1S94 A;  5IHY A;  3AEE A;  4KHP T;  4IDQ A;  3NVO A;  3EI0 A;  2LOS A;  2XZE A;  2V7L A;  2MBG A;  4QXH B;  4H63 H;  5JDF A;  2RPA A;  4JI5 T;  3N9N A;  2IML A;  3HKE E;  4KHZ F;  4ERR A;  3QUJ A;  3VR8 A;  5AQL B;  3P7I A;  4U31 A;  3AVS A;  3L39 A;  1KNZ A;  4IE4 A;  1IBK T;  5AFU L;  4TV9 E;  2IDO B;  5LMN T;  4PJL A;  4QH4 A;  3CQC B;  3RQU A;  3TLV A;  4O8S A;  2OA5 A;  2XQ6 A;  1WR6 A;  2YDQ A;  2NP9 A;  2V5C A;  3RX6 A;  4TNW A;  4IE7 A;  2MYS A;  1YW0 A;  2VL8 A;  4DMW A;  5KXJ A;  3RYC E;  1W09 A;  3N2K E;  2RP4 A;  2KIN B;  1WYB A;  2XAQ B;  3O1I A;  3M65 A;  2XAG B;  4NPP A;  1US7 B;  4MBQ A;  4QHO A;  2CLY B;  1HX1 B;  5C2T A;  1YD8 G;  3CWZ B;  4OFZ A;  3FB2 A;  1CUN A;  4KUM B;  2P9B A;  1DU2 A;  4H9N C;  3UU8 A;  3FXE B;  3LSV A;  2J47 A;  2MAW A;  1JNR A;  2JPF A;  1ZEE A;  2D2S A;  3RI5 A;  1AJ3 A;  1WFD A;  5L47 A;  4QX8 B;  2XY8 B;  2Z6E A;  3AAE B;  3O4X E;  2NTX A;  2BG9 E;  4IDZ A;  3D0T A;  4IE6 A;  4JUY A;  2D0T A;  3IA3 A;  4IT4 A;  2FBW A;  5FMN A;  5HXE A;  4U33 A;  2V5D A;  1T72 A;  2WWU A;  2YOE A;  5HCM A;  4UR9 A;  5LB7 B;  3BQL A;  4HFV A;  2CWY A;  2E8I A;  4FI5 A;  3FZM B;  4EV6 A;  1V9D A;  5DQV A;  4GOU A;  4HKA A;  4EYY R;  2V8S V;  5ABG A;  1X9B A;  1MMG A;  4AQF C;  4QX7 B;  5L2L A;  1VCS A;  2WMN A;  4ILC A;  5FXX A;  3UUL A;  4X5T A;  3SOL A;  2UUC T;  5A1L A;  3RIU C;  5C8Y E;  3ONJ A;  5L3G B;  3VRA A;  2BS3 A;  2N2N A;  2VUR A;  3ZPO A;  4IE5 A;  5LHG B;  4F6R C;  4E7S A;  4KI0 F;  4ANJ A;  2LT3 A;  3FZL B;  4TWF A;  2X66 A;  4AQF A;  4EED A;  4IRE A;  2L9Q A;  2QGS A;  3DTO A;  2WDR A;  3AAA B;  5ABF B;  3C4X A;  2ZM8 A;  3QB5 K;  4AKH A;  3UUM A;  4B6X A;  4UVC B;  4EB6 E;  1NEN A;  2QVA A;  3RIU A;  1KNR A;  5F5W A; 
#chains in the Genus database with same CATH homology
 5BR8 T;  4LFB T;  5LMU T;  2UUA T;  1FJG T;  2VQF T;  4JI5 T;  2UXC T;  1HR0 T;  4JI6 T;  4DR5 T;  4DUZ T;  4LF8 T;  4X64 T;  1I94 T;  1N33 T;  1N32 T;  4JI1 T;  4K0K T;  1N36 T;  2HHH T;  1IBK T;  4LF4 T;  2UU9 T;  5IWA T;  4AQY T;  5LMN T;  4DV1 T;  4JYA T;  4DR4 T;  4LF5 T;  4DR7 T;  1IBL T;  1IBM T;  4DV4 T;  4JI3 T;  4NXM T;  4JI0 T;  2UXB T;  4YY3 T;  1HNZ T;  3T1Y T;  4DR6 T;  4DV6 T;  1N34 T;  2UUC T;  4JI8 T;  4DR2 T;  1J5E T;  4DR3 T;  4DV3 T;  4DV2 T;  4DUY T;  4X62 T;  4B3R T;  4GKJ T;  4JI4 T;  4JV5 T;  1XNQ T;  1XMQ T;  4GKK T;  3T1H T;  4B3T T;  1HNW T;  1XNR T;  4JI7 T;  4NXN T;  2VQE T;  2ZM6 T;  1HNX T;  4JI2 T;  2UUB T;  4LF6 T;  4B3M T;  4DR1 T;  1XMO T;  2E5L T;  3OTO T;  2F4V T;  4KHP T;  4DV0 T;  4X66 T;  4LFA T;  4DV5 T;  2UXD T;  4B3S T;  4DV7 T;  4YHH T;  4LF7 T;  4LFC T;  4OX9 T;  4LF9 T;  4X65 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...