4LFCT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfcT00
4X66T 2HHHT 4LF4T 1HR0T 1FJGT 2F4VT 3T1HT 4JI6T 4DV4T 5LMUT 4X65T 4DV7T 3OTOT 4DR3T 5LMNT 4NXMT 4JI1T 4X62T 1N33T 4LFAT 1N36T 2UXBT 1J5ET 2UXDT 4GKKT 4JI0T 2ZM6T 2VQET 4LFBT 1IBMT 4DR1T 1HNZT 2VQFT 2UUCT 4JYAT 4NXNT 4JI2T 4DV1T 3T1YT 1I94T 4B3MT 4DR5T 4K0KT 4X64T 4GKJT 1IBKT 4JI5T 4LF5T 2UUBT 2UU9T 2UUAT 4B3RT 4DV3T 4DV6T 4JV5T 4DR7T 1IBLT 4LF9T 4LF6T 4JI7T 2E5LT 4B3TT 4YY3T 2UXCT 4DV2T 1HNWT 1N32T 5BR8T 1XMQT 4DR4T 4OX9T 4LF8T 4JI3T 1HNXT 1XNQT 4DR2T 4DV5T 4DV0T 4YHHT 1XMOT 4LF7T 4DUZT 1N34T 1XNRT 4DR6T 4KHPT 4JI8T 4AQYT 4B3ST 4JI4T 4DUYT 5IWAT 4LFCT
chains in the Genus database with same CATH superfamily
4MLKA 3UQ4A 1YQ4A 4PJMA 4DVDA 4H9NC 3EAMA 4YSXA 3RQWA 1WR6A 2R6GF 1SE7A 4GYSA 2A2FX 4OK0A 2WWVA 3TLWA 3RLFF 3X1DA 5JDMA 4TNWA 2NP9A 4P0BA 4UVBB 2IC6A 2RPAA 2E8IA 2X67A 3F2EA 4TV8E 5LNKA 4J2CA 4X65T 4EGWA 3FZFB 2CHOA 2EHOA 4UEMA 4AISA 1UX5A 3CK6A 3RPUA 1HG5A 4EEDA 4QXHB 4DR3T 3N2KE 5LMNT 4CN4A 2H7OA 2WU5A 5FVLA 4NXMT 3N5LA 4ASKA 4LMJA 1UX4A 2XQ6A 2J4GA 3RIUA 2BZBA 1KEYA 3SS1A 1SHZC 3PJAJ 4U2YA 3ABVA 4YT0A 4LFAT 2EHOB 2E9XC 3PUYF 5FXXA 2UXDT 3RHWA 3NVOA 2J47A 3EUHA 4GKKT 4P09A 4F6RC 5LGTB 2X0YA 4U31A 5JDHA 2VQET 1T8BA 2LRLA 2VWAA 3AEDA 3LJCA 3UUNA 1IBMT 1IJ6A 2A9UA 1W09A 4O2BE 3ZSTA 4NIQA 2LKGA 2LSGA 4DBRA 5HYAA 2UUCT 3AA6B 2DWGA 5C8YE 4JYAT 4N78D 3HL6A 2KZ7B 2V7JA 3V5UA 3UU8A 3ZMSB 3LK3B 4ISSA 2WDQA 1QLBA 1ZKEA 4HGAA 1X9BA 5FL1A 4EYUA 3UU3A 3FZLB 3AVRA 4QX7B 4ZOLE 4QHOA 1T98A 5KXJA 4IE0A 2VASA 4UELA 1FIOA 4MHCA 4H63H 4ZI3C 4AKRB 2BKOA 1DU2A 1NENA 4GKJT 3N9LA 2YINA 1D1BA 1X79A 5LOVE 1G73A 4JI5T 1IBKT 2E5VA 4UR9A 2UU9T 4TUYE 5IUXA 3AEFA 3F57A 2UUAT 3PURA 1HF8A 3PUSA 5GONE 5DABA 3RGLA 4WZXA 2EHOC 2EHOD 2H88A 2CHNA 2QGSA 3CX7B 3EABA 2Q9QB 3MJXA 3N9PA 3NBXX 4HWCA 5AQNB 4UV8B 3SFEA 2CWYA 5JDNA 2CA5A 4YJ3E 4B3TT 3BQIA 3O1IA 3E22E 3C98B 3AA0B 2P9BA 3AEBA 2V5CA 3PV0F 3D0TA 2XY8B 4IGUA 1NAFA 3C50A 2WP9A 2WZHA 5ETWA 4K0UA 2ODUA 2YEVC 3Q9DA 3F31A 4GYRA 4QX8B 4BA9A 5LCYA 3J9X1 4A97A 4WNKA 4TWFA 4YTPA 3OJAA 4F8HA 3AE3A 1S94A 5L3FB 3ANWB 3NKZA 3V5SA 1XWMA 4C90A 2PJQA 4ILBA 4LF8T 1OEDE 4JI3T 3ZCJA 1BR0A 4L9IA 4OFZA 2QYWA 3P7IA 4EYYR 2K9AA 5J2UE 5JDGA 2XASB 4ZS2A 2ZM0A 5LJNA 1G8XA 3KV9A 5C2TA 3RIAA 2XAJB 4HKAA 3CX6B 3P4PA 4UIGA 3ZT7A 3RX6A 5AQSB 5EK2A 2ACZA 4O4IE 4DUZT 5H6QB 1IAPA 1OEDC 4IREA 2ZM8A 2VK9A 5BMVE 2DCFA 3JAFA 2K48A 4AQYT 2LSKA 2N2NA 2FUPA 1LVFA 2V26A 3K8PC 3P4RA 1J5WA 1SA0E 1HS7A 2CXLA 3P4SA 5TAOA 4LFCT 2BKPA 2BG9E 2KWHA 2HPJA 5HEOA 4QH5A 2HHHT 1D0XA 1VRBA 2LEHA 2MPKA 5IHYA 5LJMA 2NW7A 5JQGE 3AAAB 3RRWA 4E7ZA 1FJGT 2F4VT 4AQFC 3JC6C 2VL8A 4KUMB 2LRKA 2XAHB 3ZJ2A 3C64A 2PG8A 3TLVA 3SRZA 4A98A 1B7TA 2Q9QA 2XSBA 4YHJA 1US7B 3P50A 2IUBA 3CVRA 5F8PA 1WYBA 1YKHB 3AA7B 4O4LE 4CXXA 3ESLA 4CI3B 4WBNE 3VKGA 3A5XA 1WR0A 3GWHA 1Z8UA 3UQ7A 3QUJA 1FMWA 2SPCA 2WU2A 2XQ8A 4PNIA 3ONJA 3T8OA 4YXDA 2RP4A 3UFGA 4ANJA 1W0BA 4AIUA 3LBXA 5FXWA 1HG2A 3Q2MA 4A56A 2JIWA 3A8YC 5LHHB 3G06A 5L4HA 3NWIA 2C5IT 3RF1A 5HXHA 4EIWA 4JI1T 2V8SV 2Y8DA 2YU2A 2XQ3A 1MIYA 5FMNA 2B1EA 3RYFE 5JR9A 1MMNA 5JR9C 5AQLB 3OYXA 2UXBT 3FZKB 4TNVA 4YJ2E 2A3DA 3RC8A 1HX8A 2M6BA 2IW5B 2K5BB 3PU8A 3TLUA 4LMKA 4ZXLA 3CQXC 2IC9A 5FY0A 2I6HA 4HFBA 4DMVA 3TKLB 5CFBA 2NOXA 3O9XA 4LFBT 4IIJE 2BG9B 5IYZE 4O2AE 2X0HA 2YK0A 1FMVA 2LOSA 3EDUA 3P4QA 4P0AA 4HFEA 5AQPB 3ZT5A 3LFMA 3T1HT 3HI2A 3O1HA 1MMAA 5LG3A 2OLTA 3I0QA 2UXXB 4XAXB 3RI5A 3PUXF 2WM9A 2FJBA 3CKDA 4ZI2D 1HCIA 1VOMA 5JRCA 3B57A 3UT5E 1IZNB 2CM0A 4CI2B 2H7VC 3BK9A 1XDOA 3N9QA 4GK0E 4ILCA 4O8SA 3SOLA 2MBGA 4HFCA 2BVMA 5FVKA 1D0YA 2JMKA 3AE9A 3UFEA 3MA9A 2W61A 4EOZB 4TZ4C 3ZN1B 5AQFB 1MNDA 1BR4A 5A1LA 4EEBA 4HFIA 5DQVA 1KF6A 2LSJA 2FJEA 3CPZA 2YDRA 2YOEA 3OVUA 2J62A 3RYIE 2UUBT 2XM2A 3NRYA 1OXZA 2DL1A 4H9QC 2VVSA 5FL0A 4YSZA 4IHJE 3PE0A 4FI5A 2V6XA 5H6RB 3RQUA 2WMOA 2XQYA 5LXTE 1MMGA 4PW8A 3VU7H 4JV5T 3CIRA 4IDQA 5M4YA 4AI6A 4LF6T 5FXVA 5FY1A 5KX5E 2GK9A 4EXTA 3NZPA 2BS3A 2M6IA 3RRCA 3ZYLA 1VCTA 2PFVA 3UUXB 3CQGB 5EK3A 3HKCE 3LBXB 5LBMA 3EI0A 2JQ9A 4JUYA 4CI1B 5CB4E 1NWMX 4DV2T 2G0UA 4UVCB 2VL0A 3NRXA 4ZI3D 1ZEEA 3RYCE 4DIDB 4IE4A 4CZZB 5BR8T 2HN1A 4CN1A 1W9RA 2ACXA 4I50E 3KINB 2V5DA 5JDFA 1VCSA 2Y6XA 5L3EB 2E9XD 2YKSA 3ZMTB 1XDPA 3ZLIA 3O1JA 4HWIB 2H89A 2N9DA 3PDYA 4EV6A 2LE8A 3Q5WA 3R84B 2LKHA 3ANWA 3L09A 3RKOA 5AQHB 3W15B 1XNQT 3BQKA 1GQEA 4DR2T 5HXSA 3FB2A 1HTJF 2KSRA 3BQLA 3VRAA 3B5MA 3GN5B 3IHRA 1XMOT 2X9HA 3AXJA 1MNEA 3WI3A 3L39A 4PJNA 4LF7T 4IE7A 3RIUC 5JRCB 4JBWF 2K24A 2NWBA 2XUEA 1KNPA 5DJQC 3K1SA 2W2UA 5KDMC 4KHPT 3GMIA 3N2GE 4B3ST 3KV5A 3M65A 3JC6D 4QXBB 1J5ET 3OPCA 4QH1A 4TN7B 2XAFB 4JI4T 2BBHA 2JQQA 4G63A 4IDZA 3KDSE 5LB7B 2B76A 4I4TE 2I0MA 4X1KE 5C3JA 4GIWA 4NUUA 1LRZA 3LK2B 3OYZA 3MKDA 2DI4A 2CBJA 4X1YE 4LF4T 3VR9A 2WDRA 1YD8G 3VRBA 1HR0T 5ABFA 2JQHA 3ZPOA 4PFPA 5FKYA 2XQ4A 3IEEA 3ZCIA 3KV4A 4PK6A 5AQKB 4PK5A 4XBFB 3MZKB 2M67A 2VKDA 2XSAA 2KMFA 3M3ZB 3KVAA 4AKIA 1E7PA 4I55E 5JDQA 2N1GA 3I0OA 4AKLA 2XJ7A 1U4QA 1OWAA 3K3QC 4H9PC 4TX5A 5KMGP 3O4XE 1YXRA 1H7CA 2KINB 3EVYA 3ONXA 3AE8A 2JRKA 5L3DB 4KBMB 3Q5DA 2W66A 2X51A 2YU1A 5AQQB 2HPLA 1J1JA 1IJ5A 4PK4A 2V6YA 4X62T 3UU5A 3N9NA 2I59A 4CXWA 2Y48B 4NPPA 4YSYA 3OBVE 3AEGA 4KI0F 1AJ3A 2KNDA 2C5KT 1JNZA 2C0SA 2VKJA 3UTKA 5HXCA 1N36T 1Y01A 2IDOB 2K3WA 3QNUA 4FJOA 2D5UA 5FP3A 2CXFA 3R6NA 3ZJ1A 4AQFA 3AAIA 4OYJA 5ABEA 4DV6T 1D1AA 5L3BB 4U2ZA 1FEWA 1Y64B 2A72A 3AEEA 2V6YB 3PUWF 2VKHA 2CMRA 3DJBA 3KFWX 4M1PA 3SWHA 2MOZA 4PFOA 2IIUA 3SFDA 4B6XA 2CXDA 4HFHA 3E0ZA 4KMCA 2QVAA 3AAEB 2KXPB 2KLQA 2V1DB 1JNRA 3AECA 5JVDE 2ZM2A 4HFDA 2LM2A 5LYJE 3KV6A 2NTYA 4JI2T 4UF0B 4Z8XA 3RH3A 5JREA 1LKXA 1OEDB 3AA1B 2CE7A 2DNXA 3IA3A 1YQ3A 1CHUA 1ZOYA 3MACA 5AQOB 3J7Yq 3PTRB 2X0LB 3FXDB 4U7IA 3ZT6A 1I94T 2AE9A 2QRXA 1L0VA 2FJDA 1M7KA 2MYSA 3PUAA 4DR5T 3S4UA 2H3RA 4CN6A 4C91A 2CRBA 3C4ZA 4TWDA 3AE4A 4U72A 5HEHA 4DMWA 5LP6E 4HEAA 5HXEA 4EZ4A 2D0UA 4NUVA 5L4EA 1UGOA 2LHRA 5ABFB 4UF0A 3AE2A 1E2AA 3HKEE 5AQMB 3ZN0B 4X1IE 2X9YA 2PBIA 2E9XA 2XQAA 4UVAB 1UURA 2ODVA 4DV3T 5LBQB 3PU3A 5JDLA 3K3OA 4DR7T 2C5JA 1HFAA 4ZI2C 5ABGA 1IBLT 2IAKA 3KBTA 4HWHA 2E5LT 1MMDA 2KWIB 1O3XA 4JI7T 4AKGA 3PUGA 3ZMZB 2BVLA 3AE7A 2X68A 4CQIA 4HWFA 5ADXL 4IE5A 5EZYE 5J1GA 2BKNA 2XM1A 1NEKA 2BG9A 3C4WA 2XAQB 2E9XB 5CA0E 3QC9A 2JQKA 3GA8A 3PUZF 2FBWA 4KP3C 4QXCB 3I1AA 2XHEB 5AQGB 4ERRA 5HEJA 4LMLA 3E08A 4JEHB 2NW8A 3N9MA 2Q9QC 3ZSSA 1XMQT 1UCUA 4BJNA 4U33A 4DV0T 3ETUA 4V1Av 4OX9T 2IHR1 4OYKA 4X20E 4I43B 2CLYC 4X5TA 1KNZA 3RIFA 5E0OA 2BBJA 2YDSA 5AQRB 4QWNB 2HH7A 3ETVA 3N9OA 5HEGA 3UUBA 2J1DG 2WSSV 3ONLC 4UV9B 1HNXT 1MIVA 2X9XA 1T7SA 2XAGB 3Q5XA 4HN9A 2XQ5A 4JEUB 4KX6A 4YTMA 3ZMUB 1I6ZA 4H9OC 1KNRA 4PJLA 2NW9A 3I9WA 2X66A 2LSYA 2V7IA 2IMLA 1YKEB 3ZC1A 2FJAA 4ZEYA 4ISTA 1OEDA 2MTQA 2PTFA 5FY7A 5CJ5A 1LVKA 5JH7E 4WBOA 1XNRT 4DR6T 3GN5A 2L3LA 4HTEA 4IDPA 3AXJB 3MXZA 4ADZA 3C51A 2WBLA 3QB5A 2L8KA 2WAUA 3LSVA 4WYVA 3UU6A 2V7KA 5AFUL 5HAXA 5L47A 3HR0A 3I9YA 4O4JE 2LHNA 5F3JA 5J0ZA 2XQ9A 5L3GB 1HX1B 1W0AA 3A7MA 2XPKA 3NZQA 1D0ZA 3AVSA 4H9RC 3DTOA 4YLHA 5L2LA 4X66T 2Q9QD 4BJMA 2Z6EA 1QUUA 3LG7A 5LGUB 2LT3A 2JPFA 2AXDS 1ZP0A 2ES0A 2ZLYA 5AQTB 5FXZA 3TLTA 4DV4T 2V7MA 2W63A 2VB6A 4JI6T 1V9DA 3JCFA 5LMUT 2QA7A 2VQFT 2OA5A 4MALA 4U74A 3TLSA 4YTNA 1ZV4X 4A5XA 5ABHA 2D2SA 5HXRA 4DV7T 2XQ7A 4QKNA 2LLYA 3U78A 4BAYB 2BG9C 4H63V 4ZZCA 4U3CA 3OTOT 3AEAA 1KFYA 2V7LA 1D1CA 4DNDA 2HN2A 5JR9B 3Q5EA 3ZEFB 1ZHCA 3AE5A 3H3AA 3CMLA 3RC3A 4AKHA 1N33T 2JMHA 1WFDA 3IBPA 5LHGB 1SUMB 2OV9A 4WW0A 2WMNA 3MK7C 4MBQA 2LM9A 2CBIA 3QK6A 5EK4A 5AQUB 4EAHA 4PAGA 2NTXA 1XZYA 4JI0T 3ZC0A 2ZM6T 3JAEA 3OKQA 2W67A 5AQIB 1YW0A 2VVNA 2X9WA 1M62A 1S35A 2MAWA 4DR1T 1E1HB 2UXNB 1QSDA 5HCMA 1HNZT 3PJAA 4TWHA 2WDVA 4QH4A 4UXNB 2LSIA 2YN6A 2CPTA 3FXEB 3PUVF 3VHLA 2W62A 3DP7A 4NXNT 3L3PA 5FYMA 5HWYA 4Q25A 2CWOA 4L0RA 4DV1T 3WAJA 4IL9A 2WS3A 3FZMB 4L5GA 5F5WA 4AQGA 4ZHQE 3CX8B 3EDVA 4COFA 2CCQA 5J2TE 2W0GA 3T1YT 4DV5T 4B3MT 4K0KT 2YDQA 4E7SA 3B13A 4Z90A 3RYHE 5LHIB 4X64T 3KBUA 1KK7A 1R8IA 3AE6A 2WCAA 2DHRA 4H9SE 4MFRA 4DBQA 2VKOA 5LG4A 4LF5T 5JTGA 2D0TA 3FZHB 4CXYA 2JJ9A 4B3RT 2DLRA 4IDNA 3ZMVB 4GOUA 3C4XA 5HWXA 2CLYB 2WB5A 1Z0PA 2VURA 3UUMA 4AXPA 4LF9T 3CQCB 5CA1E 5L3CB 3RKGA 5FNVE 3ZYKA 3HKBE 3H37A 3HKDE 3VR8A 3ZKRA 4IT4A 2XTLA 4YY3T 2UXCT 4OHFA 5CGMA 3FHNA 3LK42 3QOFA 3U3IA 4HE8A 4IDOA 1HNWT 3VKHA 2BS2A 3FBZA 2WQYA 1WLXA 4U7YA 3L8RA 1WCRA 1N32T 5AQVB 4HFVA 5HCJA 1BR1A 3LDQB 2LJLA 4P1NA 1U5PA 4O4HE 3KVBA 4Z91A 4ZS3A 4ZZBA 1MIWA 3N2OA 4EZHA 3AB3B 4IE6A 3K3NA 4ILAA 4EB6E 2ZMAA 4DR4T 1UUSA 4JLEA 5HEUA 2WY2A 1UK5A 2W4XA 3H3MA 1T72A 4XZCA 4G2AA 3EHZA 4TV9E 3AE1A 3P8CD 1WYCA 2BS4A 2BDEA 3P4WA 4YFSA 3QB5K 2XZEA 4DO0A 3WAKA 2LOPA 2DWKA 4GK5E 4YHHT 3UULA 2L9QA 4KHZF 5DQWA 4PJJA 2E2AA 3FBLA 4IL4A 2RA1A 1N34T 3HA4A 4HWDA 4ZI7E 1BR2A 1CUNA 3PUQA 2D9DA 4ILUA 5LGNB 3ZYMA 2WZIA 3IF8B 4I0UA 3JADA 5LA6E 2WWUA 4JI8T 1WRDA 3CWZB 5AQJB 1EZ3A 2W00A 3UU4A 2NR4A 2CEAA 4DUYT 5IWAT 2KT9A
chains in the Genus database with same CATH topology
4X66T 2HHHT 4LF4T 1HR0T 1FJGT 2F4VT 3T1HT 4JI6T 4DV4T 5LMUT 4X65T 4DV7T 3OTOT 4DR3T 5LMNT 4NXMT 4JI1T 4X62T 1N33T 4LFAT 1N36T 2UXBT 1J5ET 2UXDT 4GKKT 4JI0T 2ZM6T 2VQET 4LFBT 1IBMT 4DR1T 1HNZT 2VQFT 2UUCT 4JYAT 4NXNT 4JI2T 4DV1T 3T1YT 1I94T 4B3MT 4DR5T 4K0KT 4X64T 4GKJT 1IBKT 4JI5T 4LF5T 2UUBT 2UU9T 2UUAT 4B3RT 4DV3T 4DV6T 4JV5T 4DR7T 1IBLT 4LF9T 4LF6T 4JI7T 2E5LT 4B3TT 4YY3T 2UXCT 4DV2T 1HNWT 1N32T 5BR8T 1XMQT 4DR4T 4OX9T 4LF8T 4JI3T 1HNXT 1XNQT 4DR2T 4DV5T 4DV0T 4YHHT 1XMOT 4LF7T 4DUZT 1N34T 1XNRT 4DR6T 4KHPT 4JI8T 4AQYT 4B3ST 4JI4T 4DUYT 5IWAT 4LFCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 T;  2HHH T;  4LF4 T;  1HR0 T;  1FJG T;  2F4V T;  3T1H T;  4JI6 T;  4DV4 T;  5LMU T;  4X65 T;  4DV7 T;  3OTO T;  4DR3 T;  5LMN T;  4NXM T;  4JI1 T;  4X62 T;  1N33 T;  4LFA T;  1N36 T;  2UXB T;  1J5E T;  2UXD T;  4GKK T;  4JI0 T;  2ZM6 T;  2VQE T;  4LFB T;  1IBM T;  4DR1 T;  1HNZ T;  2VQF T;  2UUC T;  4JYA T;  4NXN T;  4JI2 T;  4DV1 T;  3T1Y T;  1I94 T;  4B3M T;  4DR5 T;  4K0K T;  4X64 T;  4GKJ T;  1IBK T;  4JI5 T;  4LF5 T;  2UUB T;  2UU9 T;  2UUA T;  4B3R T;  4DV3 T;  4DV6 T;  4JV5 T;  4DR7 T;  1IBL T;  4LF9 T;  4LF6 T;  4JI7 T;  2E5L T;  4B3T T;  4YY3 T;  2UXC T;  4DV2 T;  1HNW T;  1N32 T;  5BR8 T;  1XMQ T;  4DR4 T;  4OX9 T;  4LF8 T;  4JI3 T;  1HNX T;  1XNQ T;  4DR2 T;  4DV5 T;  4DV0 T;  4YHH T;  1XMO T;  4LF7 T;  4DUZ T;  1N34 T;  1XNR T;  4DR6 T;  4KHP T;  4JI8 T;  4AQY T;  4B3S T;  4JI4 T;  4DUY T;  5IWA T;  4LFC T; 
#chains in the Genus database with same CATH topology
 4MLK A;  3UQ4 A;  1YQ4 A;  4PJM A;  4DVD A;  4H9N C;  3EAM A;  4YSX A;  3RQW A;  1WR6 A;  2R6G F;  1SE7 A;  4GYS A;  2A2F X;  4OK0 A;  2WWV A;  3TLW A;  3RLF F;  3X1D A;  5JDM A;  4TNW A;  2NP9 A;  4P0B A;  4UVB B;  2IC6 A;  2RPA A;  2E8I A;  2X67 A;  3F2E A;  4TV8 E;  5LNK A;  4J2C A;  4X65 T;  4EGW A;  3FZF B;  2CHO A;  2EHO A;  4UEM A;  4AIS A;  1UX5 A;  3CK6 A;  3RPU A;  1HG5 A;  4EED A;  4QXH B;  4DR3 T;  3N2K E;  5LMN T;  4CN4 A;  2H7O A;  2WU5 A;  5FVL A;  4NXM T;  3N5L A;  4ASK A;  4LMJ A;  1UX4 A;  2XQ6 A;  2J4G A;  3RIU A;  2BZB A;  1KEY A;  3SS1 A;  1SHZ C;  3PJA J;  4U2Y A;  3ABV A;  4YT0 A;  4LFA T;  2EHO B;  2E9X C;  3PUY F;  5FXX A;  2UXD T;  3RHW A;  3NVO A;  2J47 A;  3EUH A;  4GKK T;  4P09 A;  4F6R C;  5LGT B;  2X0Y A;  4U31 A;  5JDH A;  2VQE T;  1T8B A;  2LRL A;  2VWA A;  3AED A;  3LJC A;  3UUN A;  1IBM T;  1IJ6 A;  2A9U A;  1W09 A;  4O2B E;  3ZST A;  4NIQ A;  2LKG A;  2LSG A;  4DBR A;  5HYA A;  2UUC T;  3AA6 B;  2DWG A;  5C8Y E;  4JYA T;  4N78 D;  3HL6 A;  2KZ7 B;  2V7J A;  3V5U A;  3UU8 A;  3ZMS B;  3LK3 B;  4ISS A;  2WDQ A;  1QLB A;  1ZKE A;  4HGA A;  1X9B A;  5FL1 A;  4EYU A;  3UU3 A;  3FZL B;  3AVR A;  4QX7 B;  4ZOL E;  4QHO A;  1T98 A;  5KXJ A;  4IE0 A;  2VAS A;  4UEL A;  1FIO A;  4MHC A;  4H63 H;  4ZI3 C;  4AKR B;  2BKO A;  1DU2 A;  1NEN A;  4GKJ T;  3N9L A;  2YIN A;  1D1B A;  1X79 A;  5LOV E;  1G73 A;  4JI5 T;  1IBK T;  2E5V A;  4UR9 A;  2UU9 T;  4TUY E;  5IUX A;  3AEF A;  3F57 A;  2UUA T;  3PUR A;  1HF8 A;  3PUS A;  5GON E;  5DAB A;  3RGL A;  4WZX A;  2EHO C;  2EHO D;  2H88 A;  2CHN A;  2QGS A;  3CX7 B;  3EAB A;  2Q9Q B;  3MJX A;  3N9P A;  3NBX X;  4HWC A;  5AQN B;  4UV8 B;  3SFE A;  2CWY A;  5JDN A;  2CA5 A;  4YJ3 E;  4B3T T;  3BQI A;  3O1I A;  3E22 E;  3C98 B;  3AA0 B;  2P9B A;  3AEB A;  2V5C A;  3PV0 F;  3D0T A;  2XY8 B;  4IGU A;  1NAF A;  3C50 A;  2WP9 A;  2WZH A;  5ETW A;  4K0U A;  2ODU A;  2YEV C;  3Q9D A;  3F31 A;  4GYR A;  4QX8 B;  4BA9 A;  5LCY A;  3J9X 1;  4A97 A;  4WNK A;  4TWF A;  4YTP A;  3OJA A;  4F8H A;  3AE3 A;  1S94 A;  5L3F B;  3ANW B;  3NKZ A;  3V5S A;  1XWM A;  4C90 A;  2PJQ A;  4ILB A;  4LF8 T;  1OED E;  4JI3 T;  3ZCJ A;  1BR0 A;  4L9I A;  4OFZ A;  2QYW A;  3P7I A;  4EYY R;  2K9A A;  5J2U E;  5JDG A;  2XAS B;  4ZS2 A;  2ZM0 A;  5LJN A;  1G8X A;  3KV9 A;  5C2T A;  3RIA A;  2XAJ B;  4HKA A;  3CX6 B;  3P4P A;  4UIG A;  3ZT7 A;  3RX6 A;  5AQS B;  5EK2 A;  2ACZ A;  4O4I E;  4DUZ T;  5H6Q B;  1IAP A;  1OED C;  4IRE A;  2ZM8 A;  2VK9 A;  5BMV E;  2DCF A;  3JAF A;  2K48 A;  4AQY T;  2LSK A;  2N2N A;  2FUP A;  1LVF A;  2V26 A;  3K8P C;  3P4R A;  1J5W A;  1SA0 E;  1HS7 A;  2CXL A;  3P4S A;  5TAO A;  4LFC T;  2BKP A;  2BG9 E;  2KWH A;  2HPJ A;  5HEO A;  4QH5 A;  2HHH T;  1D0X A;  1VRB A;  2LEH A;  2MPK A;  5IHY A;  5LJM A;  2NW7 A;  5JQG E;  3AAA B;  3RRW A;  4E7Z A;  1FJG T;  2F4V T;  4AQF C;  3JC6 C;  2VL8 A;  4KUM B;  2LRK A;  2XAH B;  3ZJ2 A;  3C64 A;  2PG8 A;  3TLV A;  3SRZ A;  4A98 A;  1B7T A;  2Q9Q A;  2XSB A;  4YHJ A;  1US7 B;  3P50 A;  2IUB A;  3CVR A;  5F8P A;  1WYB A;  1YKH B;  3AA7 B;  4O4L E;  4CXX A;  3ESL A;  4CI3 B;  4WBN E;  3VKG A;  3A5X A;  1WR0 A;  3GWH A;  1Z8U A;  3UQ7 A;  3QUJ A;  1FMW A;  2SPC A;  2WU2 A;  2XQ8 A;  4PNI A;  3ONJ A;  3T8O A;  4YXD A;  2RP4 A;  3UFG A;  4ANJ A;  1W0B A;  4AIU A;  3LBX A;  5FXW A;  1HG2 A;  3Q2M A;  4A56 A;  2JIW A;  3A8Y C;  5LHH B;  3G06 A;  5L4H A;  3NWI A;  2C5I T;  3RF1 A;  5HXH A;  4EIW A;  4JI1 T;  2V8S V;  2Y8D A;  2YU2 A;  2XQ3 A;  1MIY A;  5FMN A;  2B1E A;  3RYF E;  5JR9 A;  1MMN A;  5JR9 C;  5AQL B;  3OYX A;  2UXB T;  3FZK B;  4TNV A;  4YJ2 E;  2A3D A;  3RC8 A;  1HX8 A;  2M6B A;  2IW5 B;  2K5B B;  3PU8 A;  3TLU A;  4LMK A;  4ZXL A;  3CQX C;  2IC9 A;  5FY0 A;  2I6H A;  4HFB A;  4DMV A;  3TKL B;  5CFB A;  2NOX A;  3O9X A;  4LFB T;  4IIJ E;  2BG9 B;  5IYZ E;  4O2A E;  2X0H A;  2YK0 A;  1FMV A;  2LOS A;  3EDU A;  3P4Q A;  4P0A A;  4HFE A;  5AQP B;  3ZT5 A;  3LFM A;  3T1H T;  3HI2 A;  3O1H A;  1MMA A;  5LG3 A;  2OLT A;  3I0Q A;  2UXX B;  4XAX B;  3RI5 A;  3PUX F;  2WM9 A;  2FJB A;  3CKD A;  4ZI2 D;  1HCI A;  1VOM A;  5JRC A;  3B57 A;  3UT5 E;  1IZN B;  2CM0 A;  4CI2 B;  2H7V C;  3BK9 A;  1XDO A;  3N9Q A;  4GK0 E;  4ILC A;  4O8S A;  3SOL A;  2MBG A;  4HFC A;  2BVM A;  5FVK A;  1D0Y A;  2JMK A;  3AE9 A;  3UFE A;  3MA9 A;  2W61 A;  4EOZ B;  4TZ4 C;  3ZN1 B;  5AQF B;  1MND A;  1BR4 A;  5A1L A;  4EEB A;  4HFI A;  5DQV A;  1KF6 A;  2LSJ A;  2FJE A;  3CPZ A;  2YDR A;  2YOE A;  3OVU A;  2J62 A;  3RYI E;  2UUB T;  2XM2 A;  3NRY A;  1OXZ A;  2DL1 A;  4H9Q C;  2VVS A;  5FL0 A;  4YSZ A;  4IHJ E;  3PE0 A;  4FI5 A;  2V6X A;  5H6R B;  3RQU A;  2WMO A;  2XQY A;  5LXT E;  1MMG A;  4PW8 A;  3VU7 H;  4JV5 T;  3CIR A;  4IDQ A;  5M4Y A;  4AI6 A;  4LF6 T;  5FXV A;  5FY1 A;  5KX5 E;  2GK9 A;  4EXT A;  3NZP A;  2BS3 A;  2M6I A;  3RRC A;  3ZYL A;  1VCT A;  2PFV A;  3UUX B;  3CQG B;  5EK3 A;  3HKC E;  3LBX B;  5LBM A;  3EI0 A;  2JQ9 A;  4JUY A;  4CI1 B;  5CB4 E;  1NWM X;  4DV2 T;  2G0U A;  4UVC B;  2VL0 A;  3NRX A;  4ZI3 D;  1ZEE A;  3RYC E;  4DID B;  4IE4 A;  4CZZ B;  5BR8 T;  2HN1 A;  4CN1 A;  1W9R A;  2ACX A;  4I50 E;  3KIN B;  2V5D A;  5JDF A;  1VCS A;  2Y6X A;  5L3E B;  2E9X D;  2YKS A;  3ZMT B;  1XDP A;  3ZLI A;  3O1J A;  4HWI B;  2H89 A;  2N9D A;  3PDY A;  4EV6 A;  2LE8 A;  3Q5W A;  3R84 B;  2LKH A;  3ANW A;  3L09 A;  3RKO A;  5AQH B;  3W15 B;  1XNQ T;  3BQK A;  1GQE A;  4DR2 T;  5HXS A;  3FB2 A;  1HTJ F;  2KSR A;  3BQL A;  3VRA A;  3B5M A;  3GN5 B;  3IHR A;  1XMO T;  2X9H A;  3AXJ A;  1MNE A;  3WI3 A;  3L39 A;  4PJN A;  4LF7 T;  4IE7 A;  3RIU C;  5JRC B;  4JBW F;  2K24 A;  2NWB A;  2XUE A;  1KNP A;  5DJQ C;  3K1S A;  2W2U A;  5KDM C;  4KHP T;  3GMI A;  3N2G E;  4B3S T;  3KV5 A;  3M65 A;  3JC6 D;  4QXB B;  1J5E T;  3OPC A;  4QH1 A;  4TN7 B;  2XAF B;  4JI4 T;  2BBH A;  2JQQ A;  4G63 A;  4IDZ A;  3KDS E;  5LB7 B;  2B76 A;  4I4T E;  2I0M A;  4X1K E;  5C3J A;  4GIW A;  4NUU A;  1LRZ A;  3LK2 B;  3OYZ A;  3MKD A;  2DI4 A;  2CBJ A;  4X1Y E;  4LF4 T;  3VR9 A;  2WDR A;  1YD8 G;  3VRB A;  1HR0 T;  5ABF A;  2JQH A;  3ZPO A;  4PFP A;  5FKY A;  2XQ4 A;  3IEE A;  3ZCI A;  3KV4 A;  4PK6 A;  5AQK B;  4PK5 A;  4XBF B;  3MZK B;  2M67 A;  2VKD A;  2XSA A;  2KMF A;  3M3Z B;  3KVA A;  4AKI A;  1E7P A;  4I55 E;  5JDQ A;  2N1G A;  3I0O A;  4AKL A;  2XJ7 A;  1U4Q A;  1OWA A;  3K3Q C;  4H9P C;  4TX5 A;  5KMG P;  3O4X E;  1YXR A;  1H7C A;  2KIN B;  3EVY A;  3ONX A;  3AE8 A;  2JRK A;  5L3D B;  4KBM B;  3Q5D A;  2W66 A;  2X51 A;  2YU1 A;  5AQQ B;  2HPL A;  1J1J A;  1IJ5 A;  4PK4 A;  2V6Y A;  4X62 T;  3UU5 A;  3N9N A;  2I59 A;  4CXW A;  2Y48 B;  4NPP A;  4YSY A;  3OBV E;  3AEG A;  4KI0 F;  1AJ3 A;  2KND A;  2C5K T;  1JNZ A;  2C0S A;  2VKJ A;  3UTK A;  5HXC A;  1N36 T;  1Y01 A;  2IDO B;  2K3W A;  3QNU A;  4FJO A;  2D5U A;  5FP3 A;  2CXF A;  3R6N A;  3ZJ1 A;  4AQF A;  3AAI A;  4OYJ A;  5ABE A;  4DV6 T;  1D1A A;  5L3B B;  4U2Z A;  1FEW A;  1Y64 B;  2A72 A;  3AEE A;  2V6Y B;  3PUW F;  2VKH A;  2CMR A;  3DJB A;  3KFW X;  4M1P A;  3SWH A;  2MOZ A;  4PFO A;  2IIU A;  3SFD A;  4B6X A;  2CXD A;  4HFH A;  3E0Z A;  4KMC A;  2QVA A;  3AAE B;  2KXP B;  2KLQ A;  2V1D B;  1JNR A;  3AEC A;  5JVD E;  2ZM2 A;  4HFD A;  2LM2 A;  5LYJ E;  3KV6 A;  2NTY A;  4JI2 T;  4UF0 B;  4Z8X A;  3RH3 A;  5JRE A;  1LKX A;  1OED B;  3AA1 B;  2CE7 A;  2DNX A;  3IA3 A;  1YQ3 A;  1CHU A;  1ZOY A;  3MAC A;  5AQO B;  3J7Y q;  3PTR B;  2X0L B;  3FXD B;  4U7I A;  3ZT6 A;  1I94 T;  2AE9 A;  2QRX A;  1L0V A;  2FJD A;  1M7K A;  2MYS A;  3PUA A;  4DR5 T;  3S4U A;  2H3R A;  4CN6 A;  4C91 A;  2CRB A;  3C4Z A;  4TWD A;  3AE4 A;  4U72 A;  5HEH A;  4DMW A;  5LP6 E;  4HEA A;  5HXE A;  4EZ4 A;  2D0U A;  4NUV A;  5L4E A;  1UGO A;  2LHR A;  5ABF B;  4UF0 A;  3AE2 A;  1E2A A;  3HKE E;  5AQM B;  3ZN0 B;  4X1I E;  2X9Y A;  2PBI A;  2E9X A;  2XQA A;  4UVA B;  1UUR A;  2ODV A;  4DV3 T;  5LBQ B;  3PU3 A;  5JDL A;  3K3O A;  4DR7 T;  2C5J A;  1HFA A;  4ZI2 C;  5ABG A;  1IBL T;  2IAK A;  3KBT A;  4HWH A;  2E5L T;  1MMD A;  2KWI B;  1O3X A;  4JI7 T;  4AKG A;  3PUG A;  3ZMZ B;  2BVL A;  3AE7 A;  2X68 A;  4CQI A;  4HWF A;  5ADX L;  4IE5 A;  5EZY E;  5J1G A;  2BKN A;  2XM1 A;  1NEK A;  2BG9 A;  3C4W A;  2XAQ B;  2E9X B;  5CA0 E;  3QC9 A;  2JQK A;  3GA8 A;  3PUZ F;  2FBW A;  4KP3 C;  4QXC B;  3I1A A;  2XHE B;  5AQG B;  4ERR A;  5HEJ A;  4LML A;  3E08 A;  4JEH B;  2NW8 A;  3N9M A;  2Q9Q C;  3ZSS A;  1XMQ T;  1UCU A;  4BJN A;  4U33 A;  4DV0 T;  3ETU A;  4V1A v;  4OX9 T;  2IHR 1;  4OYK A;  4X20 E;  4I43 B;  2CLY C;  4X5T A;  1KNZ A;  3RIF A;  5E0O A;  2BBJ A;  2YDS A;  5AQR B;  4QWN B;  2HH7 A;  3ETV A;  3N9O A;  5HEG A;  3UUB A;  2J1D G;  2WSS V;  3ONL C;  4UV9 B;  1HNX T;  1MIV A;  2X9X A;  1T7S A;  2XAG B;  3Q5X A;  4HN9 A;  2XQ5 A;  4JEU B;  4KX6 A;  4YTM A;  3ZMU B;  1I6Z A;  4H9O C;  1KNR A;  4PJL A;  2NW9 A;  3I9W A;  2X66 A;  2LSY A;  2V7I A;  2IML A;  1YKE B;  3ZC1 A;  2FJA A;  4ZEY A;  4IST A;  1OED A;  2MTQ A;  2PTF A;  5FY7 A;  5CJ5 A;  1LVK A;  5JH7 E;  4WBO A;  1XNR T;  4DR6 T;  3GN5 A;  2L3L A;  4HTE A;  4IDP A;  3AXJ B;  3MXZ A;  4ADZ A;  3C51 A;  2WBL A;  3QB5 A;  2L8K A;  2WAU A;  3LSV A;  4WYV A;  3UU6 A;  2V7K A;  5AFU L;  5HAX A;  5L47 A;  3HR0 A;  3I9Y A;  4O4J E;  2LHN A;  5F3J A;  5J0Z A;  2XQ9 A;  5L3G B;  1HX1 B;  1W0A A;  3A7M A;  2XPK A;  3NZQ A;  1D0Z A;  3AVS A;  4H9R C;  3DTO A;  4YLH A;  5L2L A;  4X66 T;  2Q9Q D;  4BJM A;  2Z6E A;  1QUU A;  3LG7 A;  5LGU B;  2LT3 A;  2JPF A;  2AXD S;  1ZP0 A;  2ES0 A;  2ZLY A;  5AQT B;  5FXZ A;  3TLT A;  4DV4 T;  2V7M A;  2W63 A;  2VB6 A;  4JI6 T;  1V9D A;  3JCF A;  5LMU T;  2QA7 A;  2VQF T;  2OA5 A;  4MAL A;  4U74 A;  3TLS A;  4YTN A;  1ZV4 X;  4A5X A;  5ABH A;  2D2S A;  5HXR A;  4DV7 T;  2XQ7 A;  4QKN A;  2LLY A;  3U78 A;  4BAY B;  2BG9 C;  4H63 V;  4ZZC A;  4U3C A;  3OTO T;  3AEA A;  1KFY A;  2V7L A;  1D1C A;  4DND A;  2HN2 A;  5JR9 B;  3Q5E A;  3ZEF B;  1ZHC A;  3AE5 A;  3H3A A;  3CML A;  3RC3 A;  4AKH A;  1N33 T;  2JMH A;  1WFD A;  3IBP A;  5LHG B;  1SUM B;  2OV9 A;  4WW0 A;  2WMN A;  3MK7 C;  4MBQ A;  2LM9 A;  2CBI A;  3QK6 A;  5EK4 A;  5AQU B;  4EAH A;  4PAG A;  2NTX A;  1XZY A;  4JI0 T;  3ZC0 A;  2ZM6 T;  3JAE A;  3OKQ A;  2W67 A;  5AQI B;  1YW0 A;  2VVN A;  2X9W A;  1M62 A;  1S35 A;  2MAW A;  4DR1 T;  1E1H B;  2UXN B;  1QSD A;  5HCM A;  1HNZ T;  3PJA A;  4TWH A;  2WDV A;  4QH4 A;  4UXN B;  2LSI A;  2YN6 A;  2CPT A;  3FXE B;  3PUV F;  3VHL A;  2W62 A;  3DP7 A;  4NXN T;  3L3P A;  5FYM A;  5HWY A;  4Q25 A;  2CWO A;  4L0R A;  4DV1 T;  3WAJ A;  4IL9 A;  2WS3 A;  3FZM B;  4L5G A;  5F5W A;  4AQG A;  4ZHQ E;  3CX8 B;  3EDV A;  4COF A;  2CCQ A;  5J2T E;  2W0G A;  3T1Y T;  4DV5 T;  4B3M T;  4K0K T;  2YDQ A;  4E7S A;  3B13 A;  4Z90 A;  3RYH E;  5LHI B;  4X64 T;  3KBU A;  1KK7 A;  1R8I A;  3AE6 A;  2WCA A;  2DHR A;  4H9S E;  4MFR A;  4DBQ A;  2VKO A;  5LG4 A;  4LF5 T;  5JTG A;  2D0T A;  3FZH B;  4CXY A;  2JJ9 A;  4B3R T;  2DLR A;  4IDN A;  3ZMV B;  4GOU A;  3C4X A;  5HWX A;  2CLY B;  2WB5 A;  1Z0P A;  2VUR A;  3UUM A;  4AXP A;  4LF9 T;  3CQC B;  5CA1 E;  5L3C B;  3RKG A;  5FNV E;  3ZYK A;  3HKB E;  3H37 A;  3HKD E;  3VR8 A;  3ZKR A;  4IT4 A;  2XTL A;  4YY3 T;  2UXC T;  4OHF A;  5CGM A;  3FHN A;  3LK4 2;  3QOF A;  3U3I A;  4HE8 A;  4IDO A;  1HNW T;  3VKH A;  2BS2 A;  3FBZ A;  2WQY A;  1WLX A;  4U7Y A;  3L8R A;  1WCR A;  1N32 T;  5AQV B;  4HFV A;  5HCJ A;  1BR1 A;  3LDQ B;  2LJL A;  4P1N A;  1U5P A;  4O4H E;  3KVB A;  4Z91 A;  4ZS3 A;  4ZZB A;  1MIW A;  3N2O A;  4EZH A;  3AB3 B;  4IE6 A;  3K3N A;  4ILA A;  4EB6 E;  2ZMA A;  4DR4 T;  1UUS A;  4JLE A;  5HEU A;  2WY2 A;  1UK5 A;  2W4X A;  3H3M A;  1T72 A;  4XZC A;  4G2A A;  3EHZ A;  4TV9 E;  3AE1 A;  3P8C D;  1WYC A;  2BS4 A;  2BDE A;  3P4W A;  4YFS A;  3QB5 K;  2XZE A;  4DO0 A;  3WAK A;  2LOP A;  2DWK A;  4GK5 E;  4YHH T;  3UUL A;  2L9Q A;  4KHZ F;  5DQW A;  4PJJ A;  2E2A A;  3FBL A;  4IL4 A;  2RA1 A;  1N34 T;  3HA4 A;  4HWD A;  4ZI7 E;  1BR2 A;  1CUN A;  3PUQ A;  2D9D A;  4ILU A;  5LGN B;  3ZYM A;  2WZI A;  3IF8 B;  4I0U A;  3JAD A;  5LA6 E;  2WWU A;  4JI8 T;  1WRD A;  3CWZ B;  5AQJ B;  1EZ3 A;  2W00 A;  3UU4 A;  2NR4 A;  2CEA A;  4DUY T;  5IWA T;  2KT9 A; 
#chains in the Genus database with same CATH homology
 4X66 T;  2HHH T;  4LF4 T;  1HR0 T;  1FJG T;  2F4V T;  3T1H T;  4JI6 T;  4DV4 T;  5LMU T;  4X65 T;  4DV7 T;  3OTO T;  4DR3 T;  5LMN T;  4NXM T;  4JI1 T;  4X62 T;  1N33 T;  4LFA T;  1N36 T;  2UXB T;  1J5E T;  2UXD T;  4GKK T;  4JI0 T;  2ZM6 T;  2VQE T;  4LFB T;  1IBM T;  4DR1 T;  1HNZ T;  2VQF T;  2UUC T;  4JYA T;  4NXN T;  4JI2 T;  4DV1 T;  3T1Y T;  1I94 T;  4B3M T;  4DR5 T;  4K0K T;  4X64 T;  4GKJ T;  1IBK T;  4JI5 T;  4LF5 T;  2UUB T;  2UU9 T;  2UUA T;  4B3R T;  4DV3 T;  4DV6 T;  4JV5 T;  4DR7 T;  1IBL T;  4LF9 T;  4LF6 T;  4JI7 T;  2E5L T;  4B3T T;  4YY3 T;  2UXC T;  4DV2 T;  1HNW T;  1N32 T;  5BR8 T;  1XMQ T;  4DR4 T;  4OX9 T;  4LF8 T;  4JI3 T;  1HNX T;  1XNQ T;  4DR2 T;  4DV5 T;  4DV0 T;  4YHH T;  1XMO T;  4LF7 T;  4DUZ T;  1N34 T;  1XNR T;  4DR6 T;  4KHP T;  4JI8 T;  4AQY T;  4B3S T;  4JI4 T;  4DUY T;  5IWA T;  4LFC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...