4LFCT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfcT00
5BR8T 4DV2T 4DR2T 4DR4T 4DV7T 1I94T 4LF4T 2UUBT 2E5LT 2UXCT 1N32T 4B3ST 4LF6T 4B3TT 4AQYT 1XMOT 5LMUT 3T1HT 2VQET 4JV5T 4JI2T 2VQFT 4LFCT 2UXDT 4X62T 4NXMT 1IBMT 4GKKT 1IBKT 4B3RT 4K0KT 4DV6T 4B3MT 4LF8T 2UXBT 2ZM6T 4DR6T 4JI0T 4X66T 4DUYT 1HNXT 1XNQT 4JI4T 4JI8T 4DV0T 4JYAT 1HNWT 5IWAT 2F4VT 3OTOT 1N34T 4DV5T 4DV4T 4YHHT 4KHPT 1XMQT 2UUAT 1FJGT 2UUCT 1N36T 4LF7T 3T1YT 2UU9T 5LMNT 4DV3T 4LFAT 4JI5T 1HR0T 4DUZT 4DV1T 4JI1T 4OX9T 2HHHT 4DR5T 1J5ET 4DR1T 1XNRT 4LF5T 4X64T 4X65T 1HNZT 4LFBT 1IBLT 4DR3T 4JI3T 4JI6T 4LF9T 4JI7T 4NXNT 4DR7T 4GKJT 1N33T 4YY3T
chains in the Genus database with same CATH superfamily
1UCUA 4KX6A 2BKPA 2E5LT 3O1IA 4B3ST 2KINB 2NOXA 5LMUT 2KT9A 3N9LA 2MPKA 2YDRA 3PDYA 2BG9E 1G8XA 2A3DA 4ERRA 4E7ZA 1G73A 3PUYF 1XNQT 4YJ2E 2LSJA 4EGWA 5JDNA 3KBUA 3SOLA 4KHZF 3KV5A 2E9XB 4HN9A 5FYMA 1XMQT 5AQGB 1WR6A 1Y64B 2CA5A 3TLVA 2CMRA 5HCMA 2FBWA 4PNIA 3FBLA 4K0UA 1KFYA 5EK3A 5AQKB 1SA0E 5ABGA 4V1Av 4ZS3A 4DNDA 3C4ZA 4DMWA 2BDEA 1HNZT 5HYAA 3I0QA 4QKNA 3UUNA 2LEHA 2PBIA 5HEOA 5JQGE 3CQXC 2WS3A 3FXDB 2UXCT 4HWIB 3AA0B 5LA6E 1R8IA 5HWXA 5M4YA 2CHNA 5F8PA 2B76A 3IEEA 3KV6A 3MZKB 2V7MA 4J2CA 1B7TA 3C51A 5AQIB 2VQFT 4X62T 2M6BA 4TWHA 4QWNB 4B3RT 2DWKA 2EHOD 1NENA 4IGUA 4I50E 2FJBA 2WZHA 3VRBA 3CVRA 4O2BE 2M67A 4IT4A 4EV6A 5JRCA 2CLYB 4HWCA 2WU2A 3AA6B 3H3AA 4H63V 4QH1A 2XAGB 4ILBA 3RLFF 5FY1A 5HCJA 4DVDA 4NPPA 4X20E 2K24A 3MKDA 4YXDA 5LG4A 2WWUA 4IE0A 3AEDA 4GIWA 4G2AA 3MA9A 3O9XA 2SPCA 1WFDA 3OYZA 3UQ7A 1YKEB 2XQ8A 4ISSA 2RP4A 2XAQB 2ZLYA 1YXRA 1W09A 3ZMTB 3B57A 3SS1A 1N33T 4YY3T 3FXEB 3VR9A 5L3FB 3RIUC 5L2LA 3AVRA 3PUQA 3ANWA 2LHRA 3OVUA 2W67A 1Z8UA 4FJOA 2KMFA 2XY8B 5JRCB 5J1GA 3PUAA 3RQUA 2LKHA 4WZXA 5KX5E 1D1AA 3NRXA 4HFCA 3ZLIA 1US7B 4ADZA 3P4WA 3PE0A 4O4JE 5ADXL 2IAKA 4DV0T 3AAEB 2ZM0A 3OTOT 1YW0A 4MHCA 1N34T 5KDMC 3NKZA 2WAUA 5JDMA 3AAAB 4EEBA 4MLKA 1O3XA 1SE7A 1E7PA 1BR1A 4QXBB 2BKOA 5HXEA 4L0RA 4ZS2A 2K5BB 1E2AA 4EAHA 3AE4A 4F6RC 3Q5DA 1MNDA 4O4HE 2ZM8A 4EZHA 3UUMA 1ZP0A 4NUUA 4AQFA 2VK9A 3LJCA 4YTMA 3IF8B 4DR2T 1X9BA 2UXXB 3LBXA 2QYWA 1QUUA 5AQNB 2E8IA 3AE9A 2H7VC 1MIVA 4ZZCA 5CFBA 5C8YE 2CWYA 5LYJE 5TAOA 3GN5A 1XWMA 3G06A 5FKYA 1IBMT 3VKGA 2LLYA 3C50A 3GWHA 4PW8A 5LNKA 4AKHA 1W9RA 1FMVA 4C90A 4U74A 3ZKRA 4JI8T 4PK5A 4G63A 3HA4A 4TNVA 3GA8A 3K3OA 2E5VA 2XUEA 3RI5A 2UUAT 1FJGT 2WCAA 4LF7T 4ZXLA 4IL4A 1NAFA 4HGAA 3AE7A 2OLTA 3N2OA 2EHOB 4LFAT 2V5DA 4A97A 5JDFA 4GK5E 4GYRA 2Q9QD 1BR2A 4N78D 3HKCE 3QC9A 5HWYA 3IBPA 4X1YE 3Q2MA 5GONE 1D0XA 2YN6A 3I9YA 2ODUA 3JC6C 4X1IE 4TZ4C 4NXNT 4U31A 3CQGB 2VVSA 5JTGA 2NWBA 3RRCA 5AQFB 5LHGB 1UX4A 3GN5B 4PJLA 3FZKB 5AQQB 2BVLA 3B5MA 4ZI3D 2NTXA 3OBVE 2L9QA 3UUBA 3CX8B 2XQ7A 3U78A 2VQET 2BG9A 1XZYA 3I9WA 4Z8XA 4HFBA 2V7KA 5ABEA 2KWHA 2VKHA 2CM0A 2CBJA 2W2UA 2RA1A 4TWDA 2KWIB 2NTYA 3Q5EA 5HXCA 4QH5A 2WDQA 2DL1A 4JEHB 4X66T 4JI4T 2X0LB 1MMGA 3ONJA 2BVMA 3L8RA 4LMJA 4JYAT 1HNWT 2I0MA 2VKJA 5CA0E 2JRKA 4KHPT 2XQ4A 2CRBA 4O2AE 3JAEA 2DLRA 2W62A 5AQRB 4ANJA 4NUVA 4TV9E 3QUJA 3ONLC 2DNXA 2W00A 1Z0PA 3OKQA 1IAPA 3U3IA 2HPJA 4JEUB 4HTEA 1FIOA 2CXDA 2YK0A 3RX6A 4TWFA 2HPLA 4DR3T 1YKHB 4ZOLE 2A2FX 2IHR1 2JJ9A 1T8BA 4WYVA 4GYSA 3CX7B 3A7MA 3ZSTA 3LSVA 1YQ4A 4PFPA 4QH4A 2D2SA 2AXDS 3B13A 3L39A 1XMOT 4U2YA 2WY2A 4KI0F 2JQHA 1HF8A 3Q9DA 5JR9A 3UFGA 5L4HA 1CUNA 2WDRA 5C2TA 4QXHB 2LHNA 3OPCA 4I43B 4A5XA 3KINB 1OEDA 3RC8A 2V7JA 3AAIA 4PFOA 2XQ5A 1X79A 3J7Yq 3C98B 3N5LA 5FMNA 2XSAA 3L3PA 1H7CA 3L09A 1VRBA 3T1YT 1LRZA 2C5KT 4CI1B 4AKGA 3O4XE 4QX8B 3AE1A 5J2TE 5LJNA 5AQVB 4P1NA 2KXPB 1HR0T 2IIUA 4OX9T 4AI6A 3MXZA 3DJBA 3MACA 1OXZA 4DO0A 1VCTA 1KEYA 4ZZBA 2Y8DA 5HXSA 3QOFA 1AJ3A 2W61A 1LVKA 2V6YA 2BKNA 4JLEA 1UX5A 1KNZA 3H37A 3PV0F 1HTJF 5BR8T 2MYSA 3C4WA 2CWOA 5JR9B 1WRDA 2Q9QB 4H63H 1ZOYA 5J2UE 5ABFA 2R6GF 2X51A 3CK6A 1I6ZA 5LP6E 1OEDB 3ZT6A 2NW7A 1FMWA 1SHZC 4I55E 5LBQB 4IDQA 4YJ3E 4AISA 2G0UA 1HNXT 3E0ZA 2LT3A 2NW8A 3SFDA 3EI0A 4HE8A 4IDPA 3QB5K 3TLWA 5LGTB 3ZSSA 2C5IT 4U7YA 4YHHT 5IUXA 2N9DA 4DBQA 3WAJA 3ESLA 3Q5XA 1D0YA 1WCRA 3RYCE 5AFUL 4HFHA 3JADA 2VWAA 3PTRB 1YQ3A 2XQ9A 3O1JA 5FL1A 4PK4A 1NWMX 4UV9B 3JAFA 3P4QA 4YSZA 1J5ET 3RYFE 1MMAA 4LF5T 4PAGA 3QNUA 1GQEA 4CXXA 4Q25A 3K3NA 5JDHA 3F57A 4YFSA 3VR8A 1WLXA 4ZI2C 2FJEA 2HN1A 2RPAA 4ZHQE 5JVDE 1I94T 2WP9A 5FY7A 1S94A 4U72A 4LF6T 4B3TT 5ABHA 2LRKA 2ACXA 5LCYA 3N2GE 4LFCT 2VL0A 3ZMVB 4ASKA 1BR4A 3RHWA 4OFZA 2DWGA 4H9PC 1UUSA 1MIWA 2H3RA 2WQYA 3FZMB 4BA9A 4JI0T 2X66A 2UXNB 3S4UA 4YSYA 1HS7A 5AQMB 5F5WA 4DV5T 3FBZA 1HFAA 5ETWA 2NW9A 4YT0A 4IDNA 4A56A 5C3JA 3LFMA 5E0OA 5AQSB 2YKSA 3ONXA 2FJAA 3PUGA 4JI5T 3CKDA 2WM9A 4CN6A 3ZYMA 5FXXA 1KNPA 3EHZA 3EDUA 2VASA 2V7LA 3Q5WA 3QK6A 5BMVE 2JIWA 1T98A 4BJMA 5FXZA 3HKBE 4E7SA 3RIAA 1J1JA 3GMIA 2K9AA 1ZKEA 3OJAA 3PUSA 3KBTA 4HFDA 2N1GA 4OK0A 3ANWB 3LK2B 2D0TA 3E22E 4YLHA 3T1HT 1UURA 1KF6A 2LM9A 2XSBA 2VKOA 3RIUA 4HKAA 5JH7E 4UEMA 2XAFB 3RPUA 4LF8T 2CBIA 3ZC1A 4X1KE 2L3LA 3ZJ1A 1YD8G 3EUHA 4MALA 3RH3A 2CPTA 3VKHA 3HI2A 4AXPA 3NRYA 5DABA 1MMNA 2BS2A 1J5WA 2MBGA 3JC6D 5LG3A 3TLTA 5CB4E 4BAYB 5J0ZA 2I6HA 3ZT7A 3N9NA 3RIFA 3P4SA 4EZ4A 1T72A 3LK3B 3O1HA 1KNRA 2XAHB 1HG2A 4DR1T 4X64T 5HAXA 4YTNA 3TKLB 5KMGP 1VOMA 1IBLT 5FXVA 3FHNA 2B1EA 4EB6E 5L3CB 3EAMA 3AEEA 4GOUA 1D1BA 4COFA 1OWAA 4EEDA 1LVFA 4AQGA 2LOPA 1N32T 3LBXB 4AQYT 3RQWA 2JQ9A 3A8YC 2UXDT 1HX1B 4NXMT 2N2NA 2XPKA 3ZC0A 4PJJA 1S35A 5CGMA 4K0KT 4UF0A 3ZN0B 4B3MT 4XZCA 4MFRA 2ACZA 4UVCB 4DUYT 1U5PA 2ODVA 2OV9A 2E9XC 3AE8A 2V26A 2W4XA 4AKRB 4EYYR 3CX6B 2JMHA 4WNKA 4PJMA 4IDOA 2Y6XA 2C0SA 4U33A 2V5CA 2YU1A 1HG5A 1T7SA 5DQVA 4IHJE 2LOSA 4QHOA 2XM1A 2ZM2A 4X65T 2DCFA 4H9QC 5L3BB 2CXLA 3AE3A 2XQ6A 4Z91A 3PU8A 1W0AA 3RYIE 3RKGA 3X1DA 1IZNB 1ZV4X 5LBMA 4AKLA 1IJ6A 5FXWA 1ZEEA 2V1DB 5DQWA 4UF0B 2J1DG 4PJNA 3FZFB 2BS4A 2IUBA 4GKKT 2BG9B 3F31A 3PJAA 3NZPA 2X9XA 4PK6A 3ZMZB 3BQIA 2YINA 4IE6A 4DIDB 2UXBT 3PUZF 5CA1E 4CXYA 5EK4A 2CLYC 1KK7A 5FY0A 3ABVA 2LSIA 2WB5A 1UGOA 2XTLA 5LOVE 2F4VT 2V6XA 4TN7B 5L3GB 3M65A 4L5GA 3VHLA 4CQIA 4UELA 3PURA 3ZPOA 2W0GA 1LKXA 3ZYLA 1NEKA 2YDQA 4EIWA 3KV9A 4ILAA 2UU9T 2PFVA 4NIQA 1D1CA 5JREA 4U7IA 4DV1T 2ES0A 4HFEA 5JDQA 1M62A 3P7IA 3J9X1 2Y48B 2PTFA 5LXTE 3AB3B 2LKGA 3HR0A 3AEBA 2H89A 4DBRA 4IE7A 4IREA 2DHRA 3SWHA 3UU6A 5JDGA 4DV2T 4XBFB 3UFEA 3PUXF 4UR9A 1HCIA 3CWZB 4EOZB 2KZ7B 5AQTB 3VRAA 4JV5T 3T8OA 3AE5A 5FVLA 2XAJB 3K3QC 3DP7A 4H9NC 1IBKT 3C64A 3KVBA 2YOEA 2VURA 3UTKA 2VKDA 2GK9A 5IYZE 3UULA 4YSXA 2D5UA 3ZYKA 3MJXA 2QVAA 5AQUB 3FZHB 2QRXA 3CIRA 5L3DB 2WZIA 3BK9A 3AA7B 3ZCJA 2X9HA 3EABA 1MIYA 1E1HB 2JPFA 2V7IA 4ZI2D 2IC6A 3PUWF 4WBOA 4AIUA 4OHFA 2LRLA 3HKEE 2ZMAA 3CQCB 4DR5T 2XQ3A 4XAXB 4MBQA 2C5JA 3UUXB 3KVAA 4I0UA 4OYJA 3RGLA 3UQ4A 2PG8A 2NP9A 4LMLA 3NZQA 4CZZB 4IE4A 3AE2A 3V5SA 4DR4T 2V6YB 3HKDE 2FUPA 2FJDA 3WI3A 4CN4A 1OEDE 2J47A 2LM2A 3ZEFB 2CCQA 4JI2T 5ABFB 1MNEA 2IDOB 2L8KA 2I59A 4DMVA 4A98A 3BQLA 1WYBA 3EVYA 3C4XA 3BQKA 2D0UA 2ZM6T 3F2EA 2AE9A 3A5XA 3MK7C 2Z6EA 4YHJA 4UV8B 2KNDA 3N9MA 1UK5A 5IWAT 4ISTA 4JUYA 2QGSA 3JCFA 4CN1A 4WBNE 1JNRA 1D0ZA 2BZBA 2XJ7A 2EHOC 2WSSV 5LMNT 2CXFA 4X5TA 5AQPB 4AQFC 3CPZA 4O8SA 2QA7A 2HHHT 3UT5E 4U3CA 3NBXX 5EZYE 2CEAA 4EXTA 2J4GA 2LSGA 3FB2A 3NVOA 4O4LE 4JI6T 4JI7T 4GK0E 2KLQA 5A1LA 3NWIA 4IL9A 3H3MA 1FEWA 3TLSA 3ZJ2A 2WWVA 3R84B 5H6QB 5AQLB 4CI2B 4H9RC 4DV7T 3N9QA 2UUBT 5LGUB 3V5UA 3VU7H 2NR4A 4Z90A 2LE8A 4P09A 1JNZA 1CHUA 5L3EB 2LJLA 3I0OA 3K8PC 2JQQA 2XZEA 4TX5A 2BBJA 3P50A 2V8SV 2W63A 3AEFA 1IJ5A 5LJMA 3AEGA 2H88A 2HH7A 3AXJA 3ZMUB 3AE6A 4H9SE 3PU3A 4KMCA 1VCSA 3P8CD 3W15B 2JMKA 3IA3A 4LMKA 2VB6A 3K1SA 2EHOA 4TUYE 2MTQA 2H7OA 4UVAB 4DV3T 2JQKA 3IHRA 2X68A 4H9OC 1QSDA 5HEHA 4DUZT 4JI1T 5KXJA 3EDVA 5HEUA 4OYKA 2D9DA 3UU3A 4LFBT 2WMNA 2CE7A 4LF9T 4ILCA 2X0HA 1DU2A 2HN2A 4ZEYA 1W0BA 4HFVA 4F8HA 2XQYA 5L47A 4DR7T 2BG9C 2K48A 3LDQB 3PUVF 3SRZA 4LF4T 2LSKA 3ZMSB 5LGNB 3UU4A 2XASB 5LHIB 2P9BA 4JBWF 3DTOA 5HEGA 3RC3A 5AQJB 4AKIA 1XDPA 4HWFA 3KFWX 2E9XD 4IDZA 3ETUA 2W66A 5LB7B 1M7KA 3R6NA 4HWHA 2WU5A 4YTPA 5L4EA 3AXJB 2CHOA 3AVSA 5DJQC 2IMLA 2BS3A 4DV6T 3P4RA 3UU8A 1V9DA 3UU5A 4UIGA 3LG7A 5IHYA 4DR6T 3P4PA 1WR0A 2YEVC 2OA5A 3PJAJ 3WAKA 5HEJA 2J62A 2X0YA 4KBMB 3N9OA 4DV4T 4C91A 4IIJE 1SUMB 3FZLB 2BBHA 2M6IA 5FVKA 5HXHA 2MAWA 2YU2A 3RRWA 1ZHCA 5EK2A 2VL8A 4TNWA 2XHEB 5H6RB 1QLBA 3TLUA 4HFIA 3RF1A 4CI3B 1HX8A 4WW0A 4L9IA 2KSRA 5AQHB 5CJ5A 2A9UA 2MOZA 4JI3T 4B6XA 4FI5A 2A72A 2K3WA 3CMLA 1Y01A 3AECA 4UXNB 4ZI7E 4CXWA 1MMDA 3AA1B 3N2KE 2X67A 4U2ZA 5JR9C 2Q9QC 1WYCA 3ZT5A 4EYUA 1OEDC 5LHHB 4M1PA 4HEAA 1XDOA 2WMOA 2PJQA 2IW5B 2WBLA 3SFEA 3ZN1B 4KP3C 3RYHE 2YDSA 4ILUA 2X9YA 4BJNA 2DI4A 3E08A 3N9PA 4O4IE 4ZI3C 5FNVE 5AQOB 3AEAA 1EZ3A 4P0AA 3M3ZB 3I1AA 3QB5A 4QX7B 1BR0A 5JDLA 1L0VA 3HL6A 5F3JA 2X9WA 1U4QA 2UUCT 5HXRA 4I4TE 1N36T 3LK42 2XM2A 3OYXA 4QXCB 2XQAA 2E9XA 5FP3A 5FL0A 4P0BA 3KV4A 2LSYA 1XNRT 3D0TA 2WDVA 4HWDA 4TV8E 2IC9A 3ZCIA 4UVBB 3RKOA 2E2AA 3KDSE 4GKJT 4KUMB 4IE5A 3ETVA 2Q9QA 2VVNA
chains in the Genus database with same CATH topology
5BR8T 4DV2T 4DR2T 4DR4T 4DV7T 1I94T 4LF4T 2UUBT 2E5LT 2UXCT 1N32T 4B3ST 4LF6T 4B3TT 4AQYT 1XMOT 5LMUT 3T1HT 2VQET 4JV5T 4JI2T 2VQFT 4LFCT 2UXDT 4X62T 4NXMT 1IBMT 4GKKT 1IBKT 4B3RT 4K0KT 4DV6T 4B3MT 4LF8T 2UXBT 2ZM6T 4DR6T 4JI0T 4X66T 4DUYT 1HNXT 1XNQT 4JI4T 4JI8T 4DV0T 4JYAT 1HNWT 5IWAT 2F4VT 3OTOT 1N34T 4DV5T 4DV4T 4YHHT 4KHPT 1XMQT 2UUAT 1FJGT 2UUCT 1N36T 4LF7T 3T1YT 2UU9T 5LMNT 4DV3T 4LFAT 4JI5T 1HR0T 4DUZT 4DV1T 4JI1T 4OX9T 2HHHT 4DR5T 1J5ET 4DR1T 1XNRT 4LF5T 4X64T 4X65T 1HNZT 4LFBT 1IBLT 4DR3T 4JI3T 4JI6T 4LF9T 4JI7T 4NXNT 4DR7T 4GKJT 1N33T 4YY3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 T;  4DV2 T;  4DR2 T;  4DR4 T;  4DV7 T;  1I94 T;  4LF4 T;  2UUB T;  2E5L T;  2UXC T;  1N32 T;  4B3S T;  4LF6 T;  4B3T T;  4AQY T;  1XMO T;  5LMU T;  3T1H T;  2VQE T;  4JV5 T;  4JI2 T;  2VQF T;  4LFC T;  2UXD T;  4X62 T;  4NXM T;  1IBM T;  4GKK T;  1IBK T;  4B3R T;  4K0K T;  4DV6 T;  4B3M T;  4LF8 T;  2UXB T;  2ZM6 T;  4DR6 T;  4JI0 T;  4X66 T;  4DUY T;  1HNX T;  1XNQ T;  4JI4 T;  4JI8 T;  4DV0 T;  4JYA T;  1HNW T;  5IWA T;  2F4V T;  3OTO T;  1N34 T;  4DV5 T;  4DV4 T;  4YHH T;  4KHP T;  1XMQ T;  2UUA T;  1FJG T;  2UUC T;  1N36 T;  4LF7 T;  3T1Y T;  2UU9 T;  5LMN T;  4DV3 T;  4LFA T;  4JI5 T;  1HR0 T;  4DUZ T;  4DV1 T;  4JI1 T;  4OX9 T;  2HHH T;  4DR5 T;  1J5E T;  4DR1 T;  1XNR T;  4LF5 T;  4X64 T;  4X65 T;  1HNZ T;  4LFB T;  1IBL T;  4DR3 T;  4JI3 T;  4JI6 T;  4LF9 T;  4JI7 T;  4NXN T;  4DR7 T;  4GKJ T;  1N33 T;  4YY3 T; 
#chains in the Genus database with same CATH topology
 1UCU A;  4KX6 A;  2BKP A;  2E5L T;  3O1I A;  4B3S T;  2KIN B;  2NOX A;  5LMU T;  2KT9 A;  3N9L A;  2MPK A;  2YDR A;  3PDY A;  2BG9 E;  1G8X A;  2A3D A;  4ERR A;  4E7Z A;  1G73 A;  3PUY F;  1XNQ T;  4YJ2 E;  2LSJ A;  4EGW A;  5JDN A;  3KBU A;  3SOL A;  4KHZ F;  3KV5 A;  2E9X B;  4HN9 A;  5FYM A;  1XMQ T;  5AQG B;  1WR6 A;  1Y64 B;  2CA5 A;  3TLV A;  2CMR A;  5HCM A;  2FBW A;  4PNI A;  3FBL A;  4K0U A;  1KFY A;  5EK3 A;  5AQK B;  1SA0 E;  5ABG A;  4V1A v;  4ZS3 A;  4DND A;  3C4Z A;  4DMW A;  2BDE A;  1HNZ T;  5HYA A;  3I0Q A;  4QKN A;  3UUN A;  2LEH A;  2PBI A;  5HEO A;  5JQG E;  3CQX C;  2WS3 A;  3FXD B;  2UXC T;  4HWI B;  3AA0 B;  5LA6 E;  1R8I A;  5HWX A;  5M4Y A;  2CHN A;  5F8P A;  2B76 A;  3IEE A;  3KV6 A;  3MZK B;  2V7M A;  4J2C A;  1B7T A;  3C51 A;  5AQI B;  2VQF T;  4X62 T;  2M6B A;  4TWH A;  4QWN B;  4B3R T;  2DWK A;  2EHO D;  1NEN A;  4IGU A;  4I50 E;  2FJB A;  2WZH A;  3VRB A;  3CVR A;  4O2B E;  2M67 A;  4IT4 A;  4EV6 A;  5JRC A;  2CLY B;  4HWC A;  2WU2 A;  3AA6 B;  3H3A A;  4H63 V;  4QH1 A;  2XAG B;  4ILB A;  3RLF F;  5FY1 A;  5HCJ A;  4DVD A;  4NPP A;  4X20 E;  2K24 A;  3MKD A;  4YXD A;  5LG4 A;  2WWU A;  4IE0 A;  3AED A;  4GIW A;  4G2A A;  3MA9 A;  3O9X A;  2SPC A;  1WFD A;  3OYZ A;  3UQ7 A;  1YKE B;  2XQ8 A;  4ISS A;  2RP4 A;  2XAQ B;  2ZLY A;  1YXR A;  1W09 A;  3ZMT B;  3B57 A;  3SS1 A;  1N33 T;  4YY3 T;  3FXE B;  3VR9 A;  5L3F B;  3RIU C;  5L2L A;  3AVR A;  3PUQ A;  3ANW A;  2LHR A;  3OVU A;  2W67 A;  1Z8U A;  4FJO A;  2KMF A;  2XY8 B;  5JRC B;  5J1G A;  3PUA A;  3RQU A;  2LKH A;  4WZX A;  5KX5 E;  1D1A A;  3NRX A;  4HFC A;  3ZLI A;  1US7 B;  4ADZ A;  3P4W A;  3PE0 A;  4O4J E;  5ADX L;  2IAK A;  4DV0 T;  3AAE B;  2ZM0 A;  3OTO T;  1YW0 A;  4MHC A;  1N34 T;  5KDM C;  3NKZ A;  2WAU A;  5JDM A;  3AAA B;  4EEB A;  4MLK A;  1O3X A;  1SE7 A;  1E7P A;  1BR1 A;  4QXB B;  2BKO A;  5HXE A;  4L0R A;  4ZS2 A;  2K5B B;  1E2A A;  4EAH A;  3AE4 A;  4F6R C;  3Q5D A;  1MND A;  4O4H E;  2ZM8 A;  4EZH A;  3UUM A;  1ZP0 A;  4NUU A;  4AQF A;  2VK9 A;  3LJC A;  4YTM A;  3IF8 B;  4DR2 T;  1X9B A;  2UXX B;  3LBX A;  2QYW A;  1QUU A;  5AQN B;  2E8I A;  3AE9 A;  2H7V C;  1MIV A;  4ZZC A;  5CFB A;  5C8Y E;  2CWY A;  5LYJ E;  5TAO A;  3GN5 A;  1XWM A;  3G06 A;  5FKY A;  1IBM T;  3VKG A;  2LLY A;  3C50 A;  3GWH A;  4PW8 A;  5LNK A;  4AKH A;  1W9R A;  1FMV A;  4C90 A;  4U74 A;  3ZKR A;  4JI8 T;  4PK5 A;  4G63 A;  3HA4 A;  4TNV A;  3GA8 A;  3K3O A;  2E5V A;  2XUE A;  3RI5 A;  2UUA T;  1FJG T;  2WCA A;  4LF7 T;  4ZXL A;  4IL4 A;  1NAF A;  4HGA A;  3AE7 A;  2OLT A;  3N2O A;  2EHO B;  4LFA T;  2V5D A;  4A97 A;  5JDF A;  4GK5 E;  4GYR A;  2Q9Q D;  1BR2 A;  4N78 D;  3HKC E;  3QC9 A;  5HWY A;  3IBP A;  4X1Y E;  3Q2M A;  5GON E;  1D0X A;  2YN6 A;  3I9Y A;  2ODU A;  3JC6 C;  4X1I E;  4TZ4 C;  4NXN T;  4U31 A;  3CQG B;  2VVS A;  5JTG A;  2NWB A;  3RRC A;  5AQF B;  5LHG B;  1UX4 A;  3GN5 B;  4PJL A;  3FZK B;  5AQQ B;  2BVL A;  3B5M A;  4ZI3 D;  2NTX A;  3OBV E;  2L9Q A;  3UUB A;  3CX8 B;  2XQ7 A;  3U78 A;  2VQE T;  2BG9 A;  1XZY A;  3I9W A;  4Z8X A;  4HFB A;  2V7K A;  5ABE A;  2KWH A;  2VKH A;  2CM0 A;  2CBJ A;  2W2U A;  2RA1 A;  4TWD A;  2KWI B;  2NTY A;  3Q5E A;  5HXC A;  4QH5 A;  2WDQ A;  2DL1 A;  4JEH B;  4X66 T;  4JI4 T;  2X0L B;  1MMG A;  3ONJ A;  2BVM A;  3L8R A;  4LMJ A;  4JYA T;  1HNW T;  2I0M A;  2VKJ A;  5CA0 E;  2JRK A;  4KHP T;  2XQ4 A;  2CRB A;  4O2A E;  3JAE A;  2DLR A;  2W62 A;  5AQR B;  4ANJ A;  4NUV A;  4TV9 E;  3QUJ A;  3ONL C;  2DNX A;  2W00 A;  1Z0P A;  3OKQ A;  1IAP A;  3U3I A;  2HPJ A;  4JEU B;  4HTE A;  1FIO A;  2CXD A;  2YK0 A;  3RX6 A;  4TWF A;  2HPL A;  4DR3 T;  1YKH B;  4ZOL E;  2A2F X;  2IHR 1;  2JJ9 A;  1T8B A;  4WYV A;  4GYS A;  3CX7 B;  3A7M A;  3ZST A;  3LSV A;  1YQ4 A;  4PFP A;  4QH4 A;  2D2S A;  2AXD S;  3B13 A;  3L39 A;  1XMO T;  4U2Y A;  2WY2 A;  4KI0 F;  2JQH A;  1HF8 A;  3Q9D A;  5JR9 A;  3UFG A;  5L4H A;  1CUN A;  2WDR A;  5C2T A;  4QXH B;  2LHN A;  3OPC A;  4I43 B;  4A5X A;  3KIN B;  1OED A;  3RC8 A;  2V7J A;  3AAI A;  4PFO A;  2XQ5 A;  1X79 A;  3J7Y q;  3C98 B;  3N5L A;  5FMN A;  2XSA A;  3L3P A;  1H7C A;  3L09 A;  1VRB A;  3T1Y T;  1LRZ A;  2C5K T;  4CI1 B;  4AKG A;  3O4X E;  4QX8 B;  3AE1 A;  5J2T E;  5LJN A;  5AQV B;  4P1N A;  2KXP B;  1HR0 T;  2IIU A;  4OX9 T;  4AI6 A;  3MXZ A;  3DJB A;  3MAC A;  1OXZ A;  4DO0 A;  1VCT A;  1KEY A;  4ZZB A;  2Y8D A;  5HXS A;  3QOF A;  1AJ3 A;  2W61 A;  1LVK A;  2V6Y A;  2BKN A;  4JLE A;  1UX5 A;  1KNZ A;  3H37 A;  3PV0 F;  1HTJ F;  5BR8 T;  2MYS A;  3C4W A;  2CWO A;  5JR9 B;  1WRD A;  2Q9Q B;  4H63 H;  1ZOY A;  5J2U E;  5ABF A;  2R6G F;  2X51 A;  3CK6 A;  1I6Z A;  5LP6 E;  1OED B;  3ZT6 A;  2NW7 A;  1FMW A;  1SHZ C;  4I55 E;  5LBQ B;  4IDQ A;  4YJ3 E;  4AIS A;  2G0U A;  1HNX T;  3E0Z A;  2LT3 A;  2NW8 A;  3SFD A;  3EI0 A;  4HE8 A;  4IDP A;  3QB5 K;  3TLW A;  5LGT B;  3ZSS A;  2C5I T;  4U7Y A;  4YHH T;  5IUX A;  2N9D A;  4DBQ A;  3WAJ A;  3ESL A;  3Q5X A;  1D0Y A;  1WCR A;  3RYC E;  5AFU L;  4HFH A;  3JAD A;  2VWA A;  3PTR B;  1YQ3 A;  2XQ9 A;  3O1J A;  5FL1 A;  4PK4 A;  1NWM X;  4UV9 B;  3JAF A;  3P4Q A;  4YSZ A;  1J5E T;  3RYF E;  1MMA A;  4LF5 T;  4PAG A;  3QNU A;  1GQE A;  4CXX A;  4Q25 A;  3K3N A;  5JDH A;  3F57 A;  4YFS A;  3VR8 A;  1WLX A;  4ZI2 C;  2FJE A;  2HN1 A;  2RPA A;  4ZHQ E;  5JVD E;  1I94 T;  2WP9 A;  5FY7 A;  1S94 A;  4U72 A;  4LF6 T;  4B3T T;  5ABH A;  2LRK A;  2ACX A;  5LCY A;  3N2G E;  4LFC T;  2VL0 A;  3ZMV B;  4ASK A;  1BR4 A;  3RHW A;  4OFZ A;  2DWG A;  4H9P C;  1UUS A;  1MIW A;  2H3R A;  2WQY A;  3FZM B;  4BA9 A;  4JI0 T;  2X66 A;  2UXN B;  3S4U A;  4YSY A;  1HS7 A;  5AQM B;  5F5W A;  4DV5 T;  3FBZ A;  1HFA A;  5ETW A;  2NW9 A;  4YT0 A;  4IDN A;  4A56 A;  5C3J A;  3LFM A;  5E0O A;  5AQS B;  2YKS A;  3ONX A;  2FJA A;  3PUG A;  4JI5 T;  3CKD A;  2WM9 A;  4CN6 A;  3ZYM A;  5FXX A;  1KNP A;  3EHZ A;  3EDU A;  2VAS A;  2V7L A;  3Q5W A;  3QK6 A;  5BMV E;  2JIW A;  1T98 A;  4BJM A;  5FXZ A;  3HKB E;  4E7S A;  3RIA A;  1J1J A;  3GMI A;  2K9A A;  1ZKE A;  3OJA A;  3PUS A;  3KBT A;  4HFD A;  2N1G A;  4OK0 A;  3ANW B;  3LK2 B;  2D0T A;  3E22 E;  4YLH A;  3T1H T;  1UUR A;  1KF6 A;  2LM9 A;  2XSB A;  2VKO A;  3RIU A;  4HKA A;  5JH7 E;  4UEM A;  2XAF B;  3RPU A;  4LF8 T;  2CBI A;  3ZC1 A;  4X1K E;  2L3L A;  3ZJ1 A;  1YD8 G;  3EUH A;  4MAL A;  3RH3 A;  2CPT A;  3VKH A;  3HI2 A;  4AXP A;  3NRY A;  5DAB A;  1MMN A;  2BS2 A;  1J5W A;  2MBG A;  3JC6 D;  5LG3 A;  3TLT A;  5CB4 E;  4BAY B;  5J0Z A;  2I6H A;  3ZT7 A;  3N9N A;  3RIF A;  3P4S A;  4EZ4 A;  1T72 A;  3LK3 B;  3O1H A;  1KNR A;  2XAH B;  1HG2 A;  4DR1 T;  4X64 T;  5HAX A;  4YTN A;  3TKL B;  5KMG P;  1VOM A;  1IBL T;  5FXV A;  3FHN A;  2B1E A;  4EB6 E;  5L3C B;  3EAM A;  3AEE A;  4GOU A;  1D1B A;  4COF A;  1OWA A;  4EED A;  1LVF A;  4AQG A;  2LOP A;  1N32 T;  3LBX B;  4AQY T;  3RQW A;  2JQ9 A;  3A8Y C;  2UXD T;  1HX1 B;  4NXM T;  2N2N A;  2XPK A;  3ZC0 A;  4PJJ A;  1S35 A;  5CGM A;  4K0K T;  4UF0 A;  3ZN0 B;  4B3M T;  4XZC A;  4MFR A;  2ACZ A;  4UVC B;  4DUY T;  1U5P A;  2ODV A;  2OV9 A;  2E9X C;  3AE8 A;  2V26 A;  2W4X A;  4AKR B;  4EYY R;  3CX6 B;  2JMH A;  4WNK A;  4PJM A;  4IDO A;  2Y6X A;  2C0S A;  4U33 A;  2V5C A;  2YU1 A;  1HG5 A;  1T7S A;  5DQV A;  4IHJ E;  2LOS A;  4QHO A;  2XM1 A;  2ZM2 A;  4X65 T;  2DCF A;  4H9Q C;  5L3B B;  2CXL A;  3AE3 A;  2XQ6 A;  4Z91 A;  3PU8 A;  1W0A A;  3RYI E;  3RKG A;  3X1D A;  1IZN B;  1ZV4 X;  5LBM A;  4AKL A;  1IJ6 A;  5FXW A;  1ZEE A;  2V1D B;  5DQW A;  4UF0 B;  2J1D G;  4PJN A;  3FZF B;  2BS4 A;  2IUB A;  4GKK T;  2BG9 B;  3F31 A;  3PJA A;  3NZP A;  2X9X A;  4PK6 A;  3ZMZ B;  3BQI A;  2YIN A;  4IE6 A;  4DID B;  2UXB T;  3PUZ F;  5CA1 E;  4CXY A;  5EK4 A;  2CLY C;  1KK7 A;  5FY0 A;  3ABV A;  2LSI A;  2WB5 A;  1UGO A;  2XTL A;  5LOV E;  2F4V T;  2V6X A;  4TN7 B;  5L3G B;  3M65 A;  4L5G A;  3VHL A;  4CQI A;  4UEL A;  3PUR A;  3ZPO A;  2W0G A;  1LKX A;  3ZYL A;  1NEK A;  2YDQ A;  4EIW A;  3KV9 A;  4ILA A;  2UU9 T;  2PFV A;  4NIQ A;  1D1C A;  5JRE A;  4U7I A;  4DV1 T;  2ES0 A;  4HFE A;  5JDQ A;  1M62 A;  3P7I A;  3J9X 1;  2Y48 B;  2PTF A;  5LXT E;  3AB3 B;  2LKG A;  3HR0 A;  3AEB A;  2H89 A;  4DBR A;  4IE7 A;  4IRE A;  2DHR A;  3SWH A;  3UU6 A;  5JDG A;  4DV2 T;  4XBF B;  3UFE A;  3PUX F;  4UR9 A;  1HCI A;  3CWZ B;  4EOZ B;  2KZ7 B;  5AQT B;  3VRA A;  4JV5 T;  3T8O A;  3AE5 A;  5FVL A;  2XAJ B;  3K3Q C;  3DP7 A;  4H9N C;  1IBK T;  3C64 A;  3KVB A;  2YOE A;  2VUR A;  3UTK A;  2VKD A;  2GK9 A;  5IYZ E;  3UUL A;  4YSX A;  2D5U A;  3ZYK A;  3MJX A;  2QVA A;  5AQU B;  3FZH B;  2QRX A;  3CIR A;  5L3D B;  2WZI A;  3BK9 A;  3AA7 B;  3ZCJ A;  2X9H A;  3EAB A;  1MIY A;  1E1H B;  2JPF A;  2V7I A;  4ZI2 D;  2IC6 A;  3PUW F;  4WBO A;  4AIU A;  4OHF A;  2LRL A;  3HKE E;  2ZMA A;  3CQC B;  4DR5 T;  2XQ3 A;  4XAX B;  4MBQ A;  2C5J A;  3UUX B;  3KVA A;  4I0U A;  4OYJ A;  3RGL A;  3UQ4 A;  2PG8 A;  2NP9 A;  4LML A;  3NZQ A;  4CZZ B;  4IE4 A;  3AE2 A;  3V5S A;  4DR4 T;  2V6Y B;  3HKD E;  2FUP A;  2FJD A;  3WI3 A;  4CN4 A;  1OED E;  2J47 A;  2LM2 A;  3ZEF B;  2CCQ A;  4JI2 T;  5ABF B;  1MNE A;  2IDO B;  2L8K A;  2I59 A;  4DMV A;  4A98 A;  3BQL A;  1WYB A;  3EVY A;  3C4X A;  3BQK A;  2D0U A;  2ZM6 T;  3F2E A;  2AE9 A;  3A5X A;  3MK7 C;  2Z6E A;  4YHJ A;  4UV8 B;  2KND A;  3N9M A;  1UK5 A;  5IWA T;  4IST A;  4JUY A;  2QGS A;  3JCF A;  4CN1 A;  4WBN E;  1JNR A;  1D0Z A;  2BZB A;  2XJ7 A;  2EHO C;  2WSS V;  5LMN T;  2CXF A;  4X5T A;  5AQP B;  4AQF C;  3CPZ A;  4O8S A;  2QA7 A;  2HHH T;  3UT5 E;  4U3C A;  3NBX X;  5EZY E;  2CEA A;  4EXT A;  2J4G A;  2LSG A;  3FB2 A;  3NVO A;  4O4L E;  4JI6 T;  4JI7 T;  4GK0 E;  2KLQ A;  5A1L A;  3NWI A;  4IL9 A;  3H3M A;  1FEW A;  3TLS A;  3ZJ2 A;  2WWV A;  3R84 B;  5H6Q B;  5AQL B;  4CI2 B;  4H9R C;  4DV7 T;  3N9Q A;  2UUB T;  5LGU B;  3V5U A;  3VU7 H;  2NR4 A;  4Z90 A;  2LE8 A;  4P09 A;  1JNZ A;  1CHU A;  5L3E B;  2LJL A;  3I0O A;  3K8P C;  2JQQ A;  2XZE A;  4TX5 A;  2BBJ A;  3P50 A;  2V8S V;  2W63 A;  3AEF A;  1IJ5 A;  5LJM A;  3AEG A;  2H88 A;  2HH7 A;  3AXJ A;  3ZMU B;  3AE6 A;  4H9S E;  3PU3 A;  4KMC A;  1VCS A;  3P8C D;  3W15 B;  2JMK A;  3IA3 A;  4LMK A;  2VB6 A;  3K1S A;  2EHO A;  4TUY E;  2MTQ A;  2H7O A;  4UVA B;  4DV3 T;  2JQK A;  3IHR A;  2X68 A;  4H9O C;  1QSD A;  5HEH A;  4DUZ T;  4JI1 T;  5KXJ A;  3EDV A;  5HEU A;  4OYK A;  2D9D A;  3UU3 A;  4LFB T;  2WMN A;  2CE7 A;  4LF9 T;  4ILC A;  2X0H A;  1DU2 A;  2HN2 A;  4ZEY A;  1W0B A;  4HFV A;  4F8H A;  2XQY A;  5L47 A;  4DR7 T;  2BG9 C;  2K48 A;  3LDQ B;  3PUV F;  3SRZ A;  4LF4 T;  2LSK A;  3ZMS B;  5LGN B;  3UU4 A;  2XAS B;  5LHI B;  2P9B A;  4JBW F;  3DTO A;  5HEG A;  3RC3 A;  5AQJ B;  4AKI A;  1XDP A;  4HWF A;  3KFW X;  2E9X D;  4IDZ A;  3ETU A;  2W66 A;  5LB7 B;  1M7K A;  3R6N A;  4HWH A;  2WU5 A;  4YTP A;  5L4E A;  3AXJ B;  2CHO A;  3AVS A;  5DJQ C;  2IML A;  2BS3 A;  4DV6 T;  3P4R A;  3UU8 A;  1V9D A;  3UU5 A;  4UIG A;  3LG7 A;  5IHY A;  4DR6 T;  3P4P A;  1WR0 A;  2YEV C;  2OA5 A;  3PJA J;  3WAK A;  5HEJ A;  2J62 A;  2X0Y A;  4KBM B;  3N9O A;  4DV4 T;  4C91 A;  4IIJ E;  1SUM B;  3FZL B;  2BBH A;  2M6I A;  5FVK A;  5HXH A;  2MAW A;  2YU2 A;  3RRW A;  1ZHC A;  5EK2 A;  2VL8 A;  4TNW A;  2XHE B;  5H6R B;  1QLB A;  3TLU A;  4HFI A;  3RF1 A;  4CI3 B;  1HX8 A;  4WW0 A;  4L9I A;  2KSR A;  5AQH B;  5CJ5 A;  2A9U A;  2MOZ A;  4JI3 T;  4B6X A;  4FI5 A;  2A72 A;  2K3W A;  3CML A;  1Y01 A;  3AEC A;  4UXN B;  4ZI7 E;  4CXW A;  1MMD A;  3AA1 B;  3N2K E;  2X67 A;  4U2Z A;  5JR9 C;  2Q9Q C;  1WYC A;  3ZT5 A;  4EYU A;  1OED C;  5LHH B;  4M1P A;  4HEA A;  1XDO A;  2WMO A;  2PJQ A;  2IW5 B;  2WBL A;  3SFE A;  3ZN1 B;  4KP3 C;  3RYH E;  2YDS A;  4ILU A;  2X9Y A;  4BJN A;  2DI4 A;  3E08 A;  3N9P A;  4O4I E;  4ZI3 C;  5FNV E;  5AQO B;  3AEA A;  1EZ3 A;  4P0A A;  3M3Z B;  3I1A A;  3QB5 A;  4QX7 B;  1BR0 A;  5JDL A;  1L0V A;  3HL6 A;  5F3J A;  2X9W A;  1U4Q A;  2UUC T;  5HXR A;  4I4T E;  1N36 T;  3LK4 2;  2XM2 A;  3OYX A;  4QXC B;  2XQA A;  2E9X A;  5FP3 A;  5FL0 A;  4P0B A;  3KV4 A;  2LSY A;  1XNR T;  3D0T A;  2WDV A;  4HWD A;  4TV8 E;  2IC9 A;  3ZCI A;  4UVB B;  3RKO A;  2E2A A;  3KDS E;  4GKJ T;  4KUM B;  4IE5 A;  3ETV A;  2Q9Q A;  2VVN A; 
#chains in the Genus database with same CATH homology
 5BR8 T;  4DV2 T;  4DR2 T;  4DR4 T;  4DV7 T;  1I94 T;  4LF4 T;  2UUB T;  2E5L T;  2UXC T;  1N32 T;  4B3S T;  4LF6 T;  4B3T T;  4AQY T;  1XMO T;  5LMU T;  3T1H T;  2VQE T;  4JV5 T;  4JI2 T;  2VQF T;  4LFC T;  2UXD T;  4X62 T;  4NXM T;  1IBM T;  4GKK T;  1IBK T;  4B3R T;  4K0K T;  4DV6 T;  4B3M T;  4LF8 T;  2UXB T;  2ZM6 T;  4DR6 T;  4JI0 T;  4X66 T;  4DUY T;  1HNX T;  1XNQ T;  4JI4 T;  4JI8 T;  4DV0 T;  4JYA T;  1HNW T;  5IWA T;  2F4V T;  3OTO T;  1N34 T;  4DV5 T;  4DV4 T;  4YHH T;  4KHP T;  1XMQ T;  2UUA T;  1FJG T;  2UUC T;  1N36 T;  4LF7 T;  3T1Y T;  2UU9 T;  5LMN T;  4DV3 T;  4LFA T;  4JI5 T;  1HR0 T;  4DUZ T;  4DV1 T;  4JI1 T;  4OX9 T;  2HHH T;  4DR5 T;  1J5E T;  4DR1 T;  1XNR T;  4LF5 T;  4X64 T;  4X65 T;  1HNZ T;  4LFB T;  1IBL T;  4DR3 T;  4JI3 T;  4JI6 T;  4LF9 T;  4JI7 T;  4NXN T;  4DR7 T;  4GKJ T;  1N33 T;  4YY3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...