4LFCT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfcT00
2UU9T 1HNWT 4DV3T 4NXNT 1J5ET 4B3TT 4DR2T 4JI4T 1XMQT 4LF8T 5LMNT 1IBKT 2UXBT 1N36T 4DV6T 1IBLT 2HHHT 5BR8T 4DR4T 4DV5T 3T1YT 4DV2T 4JI1T 4X62T 1N32T 1N34T 5LMUT 2VQET 4AQYT 4JI0T 1XNRT 4DR7T 2F4VT 4JI7T 4NXMT 4JV5T 4YHHT 4DV4T 1HR0T 4DV1T 4DR1T 4KHPT 4LFBT 4YY3T 4LF9T 2UXDT 4DV7T 4JYAT 4OX9T 1XNQT 2VQFT 2UUCT 4JI5T 4DR5T 4B3RT 4LFAT 3T1HT 1FJGT 4JI8T 1I94T 2UUAT 2UXCT 4JI2T 4LF4T 4LFCT 4GKKT 4LF5T 4DUZT 5IWAT 3OTOT 2E5LT 4LF7T 1HNXT 1N33T 1HNZT 4B3MT 4DUYT 4K0KT 4JI6T 4DR3T 4X65T 4X66T 4DR6T 4JI3T 4X64T 2UUBT 4GKJT 4DV0T 4B3ST 4LF6T 1IBMT 1XMOT 2ZM6T
chains in the Genus database with same CATH superfamily
3L3PA 4HFCA 3N9LA 5TAOA 3VKHA 4IDNA 3UUMA 2MAWA 5LG3A 4X1YE 3ZKRA 1WR6A 2L8KA 2X66A 3NRYA 1N36T 2NW8A 2QVAA 4UVCB 2DCFA 4IDQA 4YJ3E 2KT9A 5J2TE 1Y64B 3ETUA 2UXNB 2XPKA 2VURA 5AQIB 4YXDA 4LMLA 4DR7T 5AQOB 4AQFA 1IJ5A 4JI7T 1W0AA 1BR0A 2ZM2A 4ZI3D 4ZHQE 4KHPT 4YY3T 2ZM0A 3RLFF 2BS4A 5FL1A 1HCIA 4HKAA 4QH4A 2LSYA 4DBRA 2XQ9A 1E7PA 2X0HA 4DR5T 2VKHA 4LMKA 3ONJA 2XHEB 4P0AA 4JI8T 3ZLIA 4JI2T 4UF0B 5JDMA 2CE7A 3OTOT 4LF7T 3UT5E 5ABEA 3FBZA 4IDOA 3PUSA 2I0MA 3BK9A 3CX8B 4JEHB 3C4ZA 4HFIA 3JAFA 3AVRA 4CXXA 2IC6A 5HEUA 3WAJA 1UURA 3EABA 2SPCA 2X0YA 3RIFA 3P4WA 2FJBA 3P4SA 3A8YC 5FY7A 3PDYA 5EZYE 1MIYA 3PUAA 4HFVA 3UUBA 4AIUA 1QLBA 3E0ZA 2BDEA 4UVAB 1N32T 4X20E 3ETVA 2IDOB 4BJNA 2BG9A 3UU6A 2ACXA 1UUSA 2CLYC 5FXZA 1YQ4A 2DLRA 2VASA 4TWFA 3PUGA 3B5MA 2ODUA 2XTLA 2JQHA 4YSXA 5HXCA 2J1DG 5CFBA 5HWYA 4H9PC 3S4UA 2LSGA 4CN6A 3TLUA 5FKYA 5EK4A 1MMAA 2UUAT 5HEGA 3VKGA 3A5XA 3K8PC 3BQLA 5LHIB 3VR8A 1N33T 2CMRA 3ZMTB 4K0KT 2A2FX 3QUJA 3FZLB 3N9NA 2ZMAA 4TX5A 2C0SA 3GA8A 2H89A 3HI2A 4CXYA 2AE9A 5KX5E 3UFGA 4YLHA 2XSBA 4PAGA 4YHJA 3VHLA 2CRBA 2A3DA 1MNEA 1UX4A 2XQ3A 2VWAA 2XAFB 3GWHA 2XY8B 2WWUA 3CX7B 4PK6A 2VVNA 4OHFA 3A7MA 1Z8UA 1T72A 4DV2T 2Y8DA 5L3EB 2VQET 3HA4A 3AE4A 3TLTA 1OEDC 3V5UA 4FJOA 3F2EA 1XWMA 2F4VT 4OYKA 4DV4T 5DABA 4O8SA 2N1GA 3KVBA 1FMWA 4UEMA 2LRKA 4F8HA 2LEHA 2E5VA 3ZT7A 1ZOYA 5DQWA 4O4HE 2ZLYA 2WU5A 1FMVA 4BA9A 2V6YB 3KFWX 5FXXA 3AA0B 5HWXA 2IUBA 2A72A 1G73A 2C5KT 1US7B 2YINA 1VRBA 1HNXT 4U7YA 1R8IA 3CK6A 1U4QA 5ADXL 5L4EA 4EV6A 2IC9A 2V7IA 2DWGA 5AQFB 2B1EA 4YFSA 3AECA 2JQQA 3N5LA 4B3ST 1IBMT 1MMNA 4EXTA 3ZYMA 5HCJA 2UU9T 3ONLC 4EYYR 3LBXA 1JNZA 4PK4A 3RIAA 1HG5A 4NPPA 4DVDA 2WSSV 3LDQB 3MKDA 3ABVA 3LBXB 4DMWA 3K3NA 2D9DA 5LJNA 1D0XA 5LBMA 3RYHE 2FJEA 2WMNA 5LMUT 2FUPA 4ILUA 4IE0A 4ZI2D 3G06A 4UR9A 2YU1A 3CPZA 2KWIB 4COFA 2KNDA 1HTJF 2AXDS 3CQCB 1MIWA 3AXJB 1KF6A 4KMCA 4MFRA 4QX8B 4WW0A 4WZXA 3B57A 5LNKA 4IGUA 4JI5T 4B3RT 4WBOA 3EVYA 3HKEE 4Z8XA 4MALA 2XM2A 1Z0PA 4LFCT 3ZJ1A 1NEKA 3NVOA 4PNIA 3EI0A 1ZP0A 1KEYA 2ODVA 3IEEA 4UVBB 4QKNA 3EUHA 3RF1A 4JI6T 4X65T 2NP9A 2P9BA 1J5WA 2Q9QD 2BKPA 4X64T 2ZM6T 1UX5A 5H6QB 3J9X1 3RHWA 4AQFC 2XQ4A 2LKGA 3PU8A 5LHGB 5AQJB 3CKDA 4TV8E 5ETWA 5FP3A 2NTYA 2LHNA 3KV6A 5LYJE 3KDSE 2E9XD 3RQWA 1HF8A 1SUMB 1X9BA 4I0UA 2V5CA 4QXCB 5L4HA 3PUYF 3U78A 4IE6A 4CI2B 4AKRB 4HE8A 5L3FB 4HFHA 3AEDA 2KZ7B 4X1KE 1MIVA 2XAHB 4QH1A 3LK42 5CGMA 1UCUA 4H9NC 4I4TE 3SRZA 3IBPA 3SWHA 3CQGB 5L47A 5FNVE 3K3QC 1ZKEA 3JAEA 3N9OA 5LGUB 4JEUB 4O4LE 2Q9QB 2IHR1 3RIUC 4ZI3C 2C5JA 2UUBT 4GKJT 4DV0T 1LKXA 2JMHA 2PFVA 4DV3T 2BG9C 4AQGA 4C90A 3UU8A 2WU2A 5JDGA 3VU7H 1BR4A 5JRCB 4AKGA 3MA9A 2NWBA 3FZKB 2E9XB 4K0UA 5C8YE 2XQ6A 5FVKA 4DV5T 3EDUA 2VKDA 2WZIA 1ZEEA 1N34T 2LM2A 3EDVA 3EHZA 3IA3A 3P7IA 4TNVA 4QWNB 3MZKB 5JDNA 4I55E 2V26A 3NWIA 3ZMUB 5LGNB 3VRBA 4TN7B 3KVAA 2VL0A 4U33A 1BR1A 4LFAT 5AQGB 2CXFA 4A56A 5C3JA 1WYCA 2VKJA 1FJGT 2L3LA 3P4PA 2UXCT 5FY1A 3ESLA 4OK0A 5A1LA 4EYUA 4EEDA 4IL9A 5DQVA 4UF0A 3RC8A 4HEAA 5EK2A 3KV4A 1T98A 3C4XA 1KFYA 2PTFA 4ZXLA 4IE4A 4U31A 3M65A 2NOXA 2V7JA 1MMDA 4QX7B 2M67A 1G8XA 1IJ6A 5C2TA 4U3CA 2H3RA 4ZS2A 2V5DA 1WR0A 2K48A 2QRXA 1S35A 3JC6D 3HKBE 4FI5A 4GK0E 2KXPB 4UV8B 1VCTA 3UTKA 1WFDA 2V6XA 3HR0A 5LG4A 3MACA 3RI5A 4X5TA 4J2CA 5LHHB 1QSDA 3ZN1B 3TKLB 5ABGA 4EOZB 2YK0A 3RIUA 1OXZA 3L09A 2D0UA 2OV9A 2W62A 2X51A 3AA6B 2LSKA 3PUXF 1W09A 2XAGB 3HL6A 4HWDA 4ADZA 4LF5T 2CEAA 2IAKA 1AJ3A 4BJMA 4U74A 4AXPA 3I9WA 2H7OA 1QUUA 2N9DA 3PU3A 1HNZT 2HPLA 4IE7A 3AB3B 2JJ9A 2W2UA 5M4YA 4ISTA 5IHYA 4MBQA 1HFAA 2CPTA 4CI3B 4LF6T 2BZBA 2XQAA 3RPUA 2UXXB 3ZCIA 3ZMVB 1O3XA 2WBLA 1YKEB 3AE2A 5AQQB 3AEBA 3QB5A 4DV6T 1IBLT 1SA0E 3RYCE 2JIWA 2YEVC 4JLEA 1UK5A 2Z6EA 4ILBA 3ZT5A 2BBHA 4ZZCA 5CJ5A 3I0OA 5EK3A 2YDQA 3PJAA 4JV5T 5CA1E 4DV1T 3L8RA 2A9UA 4L0RA 3AEEA 4AKHA 3ANWB 1I6ZA 2NW7A 1D1CA 4O4IE 2D2SA 2W00A 4E7SA 1T8BA 3C64A 4HFEA 3MXZA 5KDMC 4HWCA 2V6YA 3BQIA 5HYAA 4U2YA 5F3JA 1HG2A 4ZI2C 2E5LT 1CHUA 1OEDE 4B3MT 1T7SA 2M6IA 5BMVE 3OKQA 4HFBA 1WRDA 2CCQA 1D1AA 3NBXX 4CZZB 1NAFA 5HXHA 3RRCA 4P1NA 4YSZA 1D0YA 2CBIA 2EHOD 1S94A 4DBQA 5FL0A 1LVFA 4EAHA 3AEGA 1YQ3A 4XBFB 3CWZB 1B7TA 4PFOA 2Q9QC 3L39A 1X79A 3LSVA 4KBMB 5J0ZA 3SOLA 2HN2A 2VKOA 4U72A 4Z90A 3IF8B 3DTOA 3PURA 3RGLA 4TWHA 4NIQA 5JDHA 3AE6A 3OJAA 4GIWA 1ZV4X 2J4GA 4EEBA 3DP7A 2E2AA 4A98A 3AXJA 4JYAT 1VCSA 3ZYLA 1XNQT 5JR9B 2V7LA 3AA1B 5KXJA 3AE7A 4IE5A 5HCMA 4EZ4A 4O2BE 2E9XC 2CLYB 2XAQB 4N78D 3KBUA 3SFEA 5ABFA 3FXEB 4P0BA 2ACZA 3AVSA 2XM1A 5CB4E 3OVUA 4DNDA 4YTMA 3H3AA 5JH7E 2EHOB 1HNWT 3H3MA 4H9RC 3RH3A 4EB6E 4YTPA 1WLXA 3AE3A 5L3CB 5ABFB 1KNZA 4DR2T 1SHZC 2JMKA 2W66A 1SE7A 4MHCA 5CA0E 3QOFA 1DU2A 5JDFA 5AQLB 3HKCE 4ERRA 2VL8A 3UUXB 2DHRA 3T1YT 2JQKA 3KINB 4I43B 5JQGE 5FY0A 3LFMA 3R84B 1FIOA 3P50A 4AQYT 3AE5A 5HXSA 2KLQA 4QHOA 4UELA 3E22E 2WZHA 5J2UE 1HR0T 1OWAA 5KMGP 2XQ8A 1CUNA 1KNRA 2WAUA 4LFBT 1JNRA 1VOMA 4GK5E 1L0VA 5E0OA 3AE1A 3D0TA 4WNKA 1UGOA 5AFUL 3PUWF 2LOSA 5HEHA 1OEDB 3LG7A 2OA5A 3MK7C 4GKKT 2IW5B 2W67A 1U5PA 2WY2A 2XASB 2X9WA 4MLKA 2LHRA 2XAJB 3UQ7A 2CM0A 5FXVA 4X66T 4UIGA 2WDVA 3P8CD 2Q9QA 2X67A 3N2KE 3B13A 4WBNE 3O1IA 1XMOT 2NR4A 5AQRB 4IHJE 4LMJA 4A97A 4QH5A 2VB6A 3I0QA 4B3TT 4WYVA 3ZEFB 2HH7A 4UV9B 2NW9A 3Q5WA 4HN9A 3AAAB 4JI4T 5LMNT 2PBIA 4ISSA 2LRLA 1IBKT 2J47A 2LSIA 1XDPA 5JRCA 3OBVE 2HHHT 1KK7A 2LLYA 4KHZF 4CI1B 4L9IA 3ZC0A 3NZPA 2XQYA 3RC3A 3ZPOA 3FZFB 2E9XA 2RPAA 2JRKA 4Z91A 2K5BB 5DJQC 2CXLA 3FB2A 3X1DA 4JI0T 3FZHB 4ZOLE 3P4RA 4G2AA 4NXMT 4YSYA 3JC6C 2MTQA 2BG9E 2K9AA 3KV5A 3Q5EA 4DR1T 5L3GB 4LF9T 3Q2MA 3N2OA 3NRXA 4JUYA 3RYFE 2YDSA 4O4JE 4PJNA 3T1HT 1I94T 3VR9A 2DNXA 3KBTA 3ZC1A 2KWHA 3CQXC 3KV9A 2K3WA 4DR3T 2MBGA 3U3IA 3ZMZB 3E08A 4UXNB 3GN5A 5JVDE 4Q25A 4JI3T 1W0BA 5JTGA 4E7ZA 4PJMA 3MJXA 3WAKA 2JQ9A 2J62A 3RX6A 3H37A 1W9RA 3PUZF 4TZ4C 5LA6E 5F8PA 2YN6A 2LOPA 3V5SA 3GN5B 5LXTE 5AQSB 4LF8T 3N9PA 3PTRB 2BBJA 5JDQA 3Q5XA 4NUUA 2R6GF 4H9OC 1XDOA 1ZHCA 3I9YA 3ZSSA 3JCFA 2MOZA 3RKOA 1XNRT 3RRWA 2CBJA 3BQKA 2X9HA 3AE9A 2HPJA 4YHHT 3UUNA 4AKLA 2LT3A 1J1JA 5AQHB 2FBWA 2DWKA 2Y6XA 4G63A 2WP9A 3CMLA 2IMLA 3O9XA 4OX9T 3ZT6A 5LB7B 2WS3A 2VQFT 3AEFA 4H63H 2W4XA 2I6HA 2FJDA 2PJQA 4ASKA 2D0TA 5FXWA 4I50E 2KSRA 2CWOA 3PUQA 3WI3A 4CN4A 5AQUB 2N2NA 3UQ4A 4M1PA 3C98B 2X9XA 3N9QA 2V7MA 2OLTA 4X1IE 4NXNT 4YT0A 2I59A 2YDRA 5JR9C 2QGSA 4EGWA 3I1AA 4H9QC 4DIDB 4YTNA 2WQYA 4PJJA 3UU4A 5FMNA 2L9QA 2NTXA 4KX6A 4A5XA 3RKGA 4DO0A 4HTEA 4IL4A 4DMVA 2XQ7A 4DR4T 3SS1A 5L2LA 3Q5DA 2CA5A 3HKDE 2KMFA 2BG9B 5IUXA 2ES0A 2YOEA 4V1Av 1YW0A 2EHOC 1H7CA 5HXRA 5IYZE 2X0LB 3QB5K 1IZNB 2YKSA 4ZEYA 1E2AA 2LJLA 2BVMA 2UXDT 2X9YA 3CX6B 5AQPB 2UUCT 3ANWA 3O4XE 3P4QA 4NUVA 4DUZT 1MMGA 5IWAT 5F5WA 3GMIA 1KNPA 3ZMSB 5ABHA 3C51A 2K24A 2B76A 4HFDA 5L3DB 3W15B 4ZS3A 3T8OA 2V7KA 1GQEA 2LSJA 2DI4A 3AE8A 4IDZA 3ONXA 3K3OA 1EZ3A 1YXRA 2E8IA 3OYZA 4HWIB 2VVSA 2XZEA 1XMQT 4GYSA 2UXBT 4BAYB 1YD8G 3RYIE 3AAEB 1WYBA 5BR8T 3J7Yq 5LBQB 2D5UA 3PV0F 2M6BA 3TLSA 1BR2A 1NENA 3AA7B 4U7IA 3PJAJ 3SFDA 3TLWA 4KUMB 4CXWA 2W0GA 3C50A 1HX1B 4YJ2E 5HEOA 5LOVE 4ANJA 1XZYA 1M7KA 1D0ZA 2WB5A 2ZM8A 4ILAA 4XZCA 4DV7T 4ILCA 4HWFA 3ZCJA 3UU3A 4QXHB 3JADA 4IT4A 2LE8A 2HN1A 5JR9A 4IDPA 2WDQA 4TWDA 5FYMA 2V1DB 3EAMA 2WDRA 4TUYE 3IHRA 5HEJA 5AQNB 3TLVA 4KP3C 2BS2A 4DUYT 2H7VC 4DR6T 4H63V 4OYJA 5H6RB 5LJMA 2V8SV 4PFPA 4XAXB 1FEWA 3ZJ2A 4F6RC 1HX8A 4AKIA 2XSAA 1LRZA 2WWVA 1J5ET 2EHOA 3ZN0B 2CHNA 3O1JA 1NWMX 2YU2A 2WM9A 5AQMB 2PG8A 3AEAA 1IAPA 3UU5A 4EIWA 2JPFA 4JI1T 1LVKA 4X62T 4GYRA 5LP6E 3VRAA 3Q9DA 3NKZA 2W61A 5J1GA 4AI6A 3FZMB 3FBLA 2BKNA 2IIUA 5AQTB 3K1SA 2RP4A 4AISA 2BKOA 3N2GE 2MPKA 1V9DA 2LM9A 3FXDB 3LJCA 2QA7A 2WMOA 4PJLA 2GK9A 4HGAA 5JDLA 3ZSTA 4CQIA 4LF4T 1OEDA 4P09A 2Y48B 3AAIA 5JREA 2H88A 4IIJE 4QXBB 4GOUA 3LK3B 3M3ZB 4ZI7E 5FVLA 5LGTB 3QC9A 3FHNA 2G0UA 1E1HB 5AQKB 4IREA 2CWYA 2XJ7A 1HS7A 2CHOA 4B6XA 2CXDA 5AQVB 2KINB 4L5GA 2W63A 3F31A 2MYSA 2QYWA 1Y01A 4PW8A 2VK9A 1WCRA 4KI0F 3DJBA 3LK2B 5HXEA 4O2AE 3OPCA 3OYXA 1D1BA 5GONE 3C4WA 2XUEA 4U2ZA 3PE0A 4PK5A 4TV9E 3CIRA 3RQUA 1MNDA 4JBWF 2FJAA 4OFZA 4ZZBA 2RA1A 4HWHA 3PUVF 2X68A 5HAXA 2LKHA 3O1HA 4H9SE 4C91A 3CVRA 2XQ5A 2C5IT 2WCAA 3F57A 3QNUA 3QK6A 3UULA 5L3BB 5LCYA 3ZYKA 4EZHA 3N9MA 2BVLA 1YKHB 1M62A 4CN1A 3UFEA 2DL1A 3R6NA 2BS3A 4TNWA 3NZQA
chains in the Genus database with same CATH topology
2UU9T 1HNWT 4DV3T 4NXNT 1J5ET 4B3TT 4DR2T 4JI4T 1XMQT 4LF8T 5LMNT 1IBKT 2UXBT 1N36T 4DV6T 1IBLT 2HHHT 5BR8T 4DR4T 4DV5T 3T1YT 4DV2T 4JI1T 4X62T 1N32T 1N34T 5LMUT 2VQET 4AQYT 4JI0T 1XNRT 4DR7T 2F4VT 4JI7T 4NXMT 4JV5T 4YHHT 4DV4T 1HR0T 4DV1T 4DR1T 4KHPT 4LFBT 4YY3T 4LF9T 2UXDT 4DV7T 4JYAT 4OX9T 1XNQT 2VQFT 2UUCT 4JI5T 4DR5T 4B3RT 4LFAT 3T1HT 1FJGT 4JI8T 1I94T 2UUAT 2UXCT 4JI2T 4LF4T 4LFCT 4GKKT 4LF5T 4DUZT 5IWAT 3OTOT 2E5LT 4LF7T 1HNXT 1N33T 1HNZT 4B3MT 4DUYT 4K0KT 4JI6T 4DR3T 4X65T 4X66T 4DR6T 4JI3T 4X64T 2UUBT 4GKJT 4DV0T 4B3ST 4LF6T 1IBMT 1XMOT 2ZM6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 T;  1HNW T;  4DV3 T;  4NXN T;  1J5E T;  4B3T T;  4DR2 T;  4JI4 T;  1XMQ T;  4LF8 T;  5LMN T;  1IBK T;  2UXB T;  1N36 T;  4DV6 T;  1IBL T;  2HHH T;  5BR8 T;  4DR4 T;  4DV5 T;  3T1Y T;  4DV2 T;  4JI1 T;  4X62 T;  1N32 T;  1N34 T;  5LMU T;  2VQE T;  4AQY T;  4JI0 T;  1XNR T;  4DR7 T;  2F4V T;  4JI7 T;  4NXM T;  4JV5 T;  4YHH T;  4DV4 T;  1HR0 T;  4DV1 T;  4DR1 T;  4KHP T;  4LFB T;  4YY3 T;  4LF9 T;  2UXD T;  4DV7 T;  4JYA T;  4OX9 T;  1XNQ T;  2VQF T;  2UUC T;  4JI5 T;  4DR5 T;  4B3R T;  4LFA T;  3T1H T;  1FJG T;  4JI8 T;  1I94 T;  2UUA T;  2UXC T;  4JI2 T;  4LF4 T;  4LFC T;  4GKK T;  4LF5 T;  4DUZ T;  5IWA T;  3OTO T;  2E5L T;  4LF7 T;  1HNX T;  1N33 T;  1HNZ T;  4B3M T;  4DUY T;  4K0K T;  4JI6 T;  4DR3 T;  4X65 T;  4X66 T;  4DR6 T;  4JI3 T;  4X64 T;  2UUB T;  4GKJ T;  4DV0 T;  4B3S T;  4LF6 T;  1IBM T;  1XMO T;  2ZM6 T; 
#chains in the Genus database with same CATH topology
 3L3P A;  4HFC A;  3N9L A;  5TAO A;  3VKH A;  4IDN A;  3UUM A;  2MAW A;  5LG3 A;  4X1Y E;  3ZKR A;  1WR6 A;  2L8K A;  2X66 A;  3NRY A;  1N36 T;  2NW8 A;  2QVA A;  4UVC B;  2DCF A;  4IDQ A;  4YJ3 E;  2KT9 A;  5J2T E;  1Y64 B;  3ETU A;  2UXN B;  2XPK A;  2VUR A;  5AQI B;  4YXD A;  4LML A;  4DR7 T;  5AQO B;  4AQF A;  1IJ5 A;  4JI7 T;  1W0A A;  1BR0 A;  2ZM2 A;  4ZI3 D;  4ZHQ E;  4KHP T;  4YY3 T;  2ZM0 A;  3RLF F;  2BS4 A;  5FL1 A;  1HCI A;  4HKA A;  4QH4 A;  2LSY A;  4DBR A;  2XQ9 A;  1E7P A;  2X0H A;  4DR5 T;  2VKH A;  4LMK A;  3ONJ A;  2XHE B;  4P0A A;  4JI8 T;  3ZLI A;  4JI2 T;  4UF0 B;  5JDM A;  2CE7 A;  3OTO T;  4LF7 T;  3UT5 E;  5ABE A;  3FBZ A;  4IDO A;  3PUS A;  2I0M A;  3BK9 A;  3CX8 B;  4JEH B;  3C4Z A;  4HFI A;  3JAF A;  3AVR A;  4CXX A;  2IC6 A;  5HEU A;  3WAJ A;  1UUR A;  3EAB A;  2SPC A;  2X0Y A;  3RIF A;  3P4W A;  2FJB A;  3P4S A;  3A8Y C;  5FY7 A;  3PDY A;  5EZY E;  1MIY A;  3PUA A;  4HFV A;  3UUB A;  4AIU A;  1QLB A;  3E0Z A;  2BDE A;  4UVA B;  1N32 T;  4X20 E;  3ETV A;  2IDO B;  4BJN A;  2BG9 A;  3UU6 A;  2ACX A;  1UUS A;  2CLY C;  5FXZ A;  1YQ4 A;  2DLR A;  2VAS A;  4TWF A;  3PUG A;  3B5M A;  2ODU A;  2XTL A;  2JQH A;  4YSX A;  5HXC A;  2J1D G;  5CFB A;  5HWY A;  4H9P C;  3S4U A;  2LSG A;  4CN6 A;  3TLU A;  5FKY A;  5EK4 A;  1MMA A;  2UUA T;  5HEG A;  3VKG A;  3A5X A;  3K8P C;  3BQL A;  5LHI B;  3VR8 A;  1N33 T;  2CMR A;  3ZMT B;  4K0K T;  2A2F X;  3QUJ A;  3FZL B;  3N9N A;  2ZMA A;  4TX5 A;  2C0S A;  3GA8 A;  2H89 A;  3HI2 A;  4CXY A;  2AE9 A;  5KX5 E;  3UFG A;  4YLH A;  2XSB A;  4PAG A;  4YHJ A;  3VHL A;  2CRB A;  2A3D A;  1MNE A;  1UX4 A;  2XQ3 A;  2VWA A;  2XAF B;  3GWH A;  2XY8 B;  2WWU A;  3CX7 B;  4PK6 A;  2VVN A;  4OHF A;  3A7M A;  1Z8U A;  1T72 A;  4DV2 T;  2Y8D A;  5L3E B;  2VQE T;  3HA4 A;  3AE4 A;  3TLT A;  1OED C;  3V5U A;  4FJO A;  3F2E A;  1XWM A;  2F4V T;  4OYK A;  4DV4 T;  5DAB A;  4O8S A;  2N1G A;  3KVB A;  1FMW A;  4UEM A;  2LRK A;  4F8H A;  2LEH A;  2E5V A;  3ZT7 A;  1ZOY A;  5DQW A;  4O4H E;  2ZLY A;  2WU5 A;  1FMV A;  4BA9 A;  2V6Y B;  3KFW X;  5FXX A;  3AA0 B;  5HWX A;  2IUB A;  2A72 A;  1G73 A;  2C5K T;  1US7 B;  2YIN A;  1VRB A;  1HNX T;  4U7Y A;  1R8I A;  3CK6 A;  1U4Q A;  5ADX L;  5L4E A;  4EV6 A;  2IC9 A;  2V7I A;  2DWG A;  5AQF B;  2B1E A;  4YFS A;  3AEC A;  2JQQ A;  3N5L A;  4B3S T;  1IBM T;  1MMN A;  4EXT A;  3ZYM A;  5HCJ A;  2UU9 T;  3ONL C;  4EYY R;  3LBX A;  1JNZ A;  4PK4 A;  3RIA A;  1HG5 A;  4NPP A;  4DVD A;  2WSS V;  3LDQ B;  3MKD A;  3ABV A;  3LBX B;  4DMW A;  3K3N A;  2D9D A;  5LJN A;  1D0X A;  5LBM A;  3RYH E;  2FJE A;  2WMN A;  5LMU T;  2FUP A;  4ILU A;  4IE0 A;  4ZI2 D;  3G06 A;  4UR9 A;  2YU1 A;  3CPZ A;  2KWI B;  4COF A;  2KND A;  1HTJ F;  2AXD S;  3CQC B;  1MIW A;  3AXJ B;  1KF6 A;  4KMC A;  4MFR A;  4QX8 B;  4WW0 A;  4WZX A;  3B57 A;  5LNK A;  4IGU A;  4JI5 T;  4B3R T;  4WBO A;  3EVY A;  3HKE E;  4Z8X A;  4MAL A;  2XM2 A;  1Z0P A;  4LFC T;  3ZJ1 A;  1NEK A;  3NVO A;  4PNI A;  3EI0 A;  1ZP0 A;  1KEY A;  2ODV A;  3IEE A;  4UVB B;  4QKN A;  3EUH A;  3RF1 A;  4JI6 T;  4X65 T;  2NP9 A;  2P9B A;  1J5W A;  2Q9Q D;  2BKP A;  4X64 T;  2ZM6 T;  1UX5 A;  5H6Q B;  3J9X 1;  3RHW A;  4AQF C;  2XQ4 A;  2LKG A;  3PU8 A;  5LHG B;  5AQJ B;  3CKD A;  4TV8 E;  5ETW A;  5FP3 A;  2NTY A;  2LHN A;  3KV6 A;  5LYJ E;  3KDS E;  2E9X D;  3RQW A;  1HF8 A;  1SUM B;  1X9B A;  4I0U A;  2V5C A;  4QXC B;  5L4H A;  3PUY F;  3U78 A;  4IE6 A;  4CI2 B;  4AKR B;  4HE8 A;  5L3F B;  4HFH A;  3AED A;  2KZ7 B;  4X1K E;  1MIV A;  2XAH B;  4QH1 A;  3LK4 2;  5CGM A;  1UCU A;  4H9N C;  4I4T E;  3SRZ A;  3IBP A;  3SWH A;  3CQG B;  5L47 A;  5FNV E;  3K3Q C;  1ZKE A;  3JAE A;  3N9O A;  5LGU B;  4JEU B;  4O4L E;  2Q9Q B;  2IHR 1;  3RIU C;  4ZI3 C;  2C5J A;  2UUB T;  4GKJ T;  4DV0 T;  1LKX A;  2JMH A;  2PFV A;  4DV3 T;  2BG9 C;  4AQG A;  4C90 A;  3UU8 A;  2WU2 A;  5JDG A;  3VU7 H;  1BR4 A;  5JRC B;  4AKG A;  3MA9 A;  2NWB A;  3FZK B;  2E9X B;  4K0U A;  5C8Y E;  2XQ6 A;  5FVK A;  4DV5 T;  3EDU A;  2VKD A;  2WZI A;  1ZEE A;  1N34 T;  2LM2 A;  3EDV A;  3EHZ A;  3IA3 A;  3P7I A;  4TNV A;  4QWN B;  3MZK B;  5JDN A;  4I55 E;  2V26 A;  3NWI A;  3ZMU B;  5LGN B;  3VRB A;  4TN7 B;  3KVA A;  2VL0 A;  4U33 A;  1BR1 A;  4LFA T;  5AQG B;  2CXF A;  4A56 A;  5C3J A;  1WYC A;  2VKJ A;  1FJG T;  2L3L A;  3P4P A;  2UXC T;  5FY1 A;  3ESL A;  4OK0 A;  5A1L A;  4EYU A;  4EED A;  4IL9 A;  5DQV A;  4UF0 A;  3RC8 A;  4HEA A;  5EK2 A;  3KV4 A;  1T98 A;  3C4X A;  1KFY A;  2PTF A;  4ZXL A;  4IE4 A;  4U31 A;  3M65 A;  2NOX A;  2V7J A;  1MMD A;  4QX7 B;  2M67 A;  1G8X A;  1IJ6 A;  5C2T A;  4U3C A;  2H3R A;  4ZS2 A;  2V5D A;  1WR0 A;  2K48 A;  2QRX A;  1S35 A;  3JC6 D;  3HKB E;  4FI5 A;  4GK0 E;  2KXP B;  4UV8 B;  1VCT A;  3UTK A;  1WFD A;  2V6X A;  3HR0 A;  5LG4 A;  3MAC A;  3RI5 A;  4X5T A;  4J2C A;  5LHH B;  1QSD A;  3ZN1 B;  3TKL B;  5ABG A;  4EOZ B;  2YK0 A;  3RIU A;  1OXZ A;  3L09 A;  2D0U A;  2OV9 A;  2W62 A;  2X51 A;  3AA6 B;  2LSK A;  3PUX F;  1W09 A;  2XAG B;  3HL6 A;  4HWD A;  4ADZ A;  4LF5 T;  2CEA A;  2IAK A;  1AJ3 A;  4BJM A;  4U74 A;  4AXP A;  3I9W A;  2H7O A;  1QUU A;  2N9D A;  3PU3 A;  1HNZ T;  2HPL A;  4IE7 A;  3AB3 B;  2JJ9 A;  2W2U A;  5M4Y A;  4IST A;  5IHY A;  4MBQ A;  1HFA A;  2CPT A;  4CI3 B;  4LF6 T;  2BZB A;  2XQA A;  3RPU A;  2UXX B;  3ZCI A;  3ZMV B;  1O3X A;  2WBL A;  1YKE B;  3AE2 A;  5AQQ B;  3AEB A;  3QB5 A;  4DV6 T;  1IBL T;  1SA0 E;  3RYC E;  2JIW A;  2YEV C;  4JLE A;  1UK5 A;  2Z6E A;  4ILB A;  3ZT5 A;  2BBH A;  4ZZC A;  5CJ5 A;  3I0O A;  5EK3 A;  2YDQ A;  3PJA A;  4JV5 T;  5CA1 E;  4DV1 T;  3L8R A;  2A9U A;  4L0R A;  3AEE A;  4AKH A;  3ANW B;  1I6Z A;  2NW7 A;  1D1C A;  4O4I E;  2D2S A;  2W00 A;  4E7S A;  1T8B A;  3C64 A;  4HFE A;  3MXZ A;  5KDM C;  4HWC A;  2V6Y A;  3BQI A;  5HYA A;  4U2Y A;  5F3J A;  1HG2 A;  4ZI2 C;  2E5L T;  1CHU A;  1OED E;  4B3M T;  1T7S A;  2M6I A;  5BMV E;  3OKQ A;  4HFB A;  1WRD A;  2CCQ A;  1D1A A;  3NBX X;  4CZZ B;  1NAF A;  5HXH A;  3RRC A;  4P1N A;  4YSZ A;  1D0Y A;  2CBI A;  2EHO D;  1S94 A;  4DBQ A;  5FL0 A;  1LVF A;  4EAH A;  3AEG A;  1YQ3 A;  4XBF B;  3CWZ B;  1B7T A;  4PFO A;  2Q9Q C;  3L39 A;  1X79 A;  3LSV A;  4KBM B;  5J0Z A;  3SOL A;  2HN2 A;  2VKO A;  4U72 A;  4Z90 A;  3IF8 B;  3DTO A;  3PUR A;  3RGL A;  4TWH A;  4NIQ A;  5JDH A;  3AE6 A;  3OJA A;  4GIW A;  1ZV4 X;  2J4G A;  4EEB A;  3DP7 A;  2E2A A;  4A98 A;  3AXJ A;  4JYA T;  1VCS A;  3ZYL A;  1XNQ T;  5JR9 B;  2V7L A;  3AA1 B;  5KXJ A;  3AE7 A;  4IE5 A;  5HCM A;  4EZ4 A;  4O2B E;  2E9X C;  2CLY B;  2XAQ B;  4N78 D;  3KBU A;  3SFE A;  5ABF A;  3FXE B;  4P0B A;  2ACZ A;  3AVS A;  2XM1 A;  5CB4 E;  3OVU A;  4DND A;  4YTM A;  3H3A A;  5JH7 E;  2EHO B;  1HNW T;  3H3M A;  4H9R C;  3RH3 A;  4EB6 E;  4YTP A;  1WLX A;  3AE3 A;  5L3C B;  5ABF B;  1KNZ A;  4DR2 T;  1SHZ C;  2JMK A;  2W66 A;  1SE7 A;  4MHC A;  5CA0 E;  3QOF A;  1DU2 A;  5JDF A;  5AQL B;  3HKC E;  4ERR A;  2VL8 A;  3UUX B;  2DHR A;  3T1Y T;  2JQK A;  3KIN B;  4I43 B;  5JQG E;  5FY0 A;  3LFM A;  3R84 B;  1FIO A;  3P50 A;  4AQY T;  3AE5 A;  5HXS A;  2KLQ A;  4QHO A;  4UEL A;  3E22 E;  2WZH A;  5J2U E;  1HR0 T;  1OWA A;  5KMG P;  2XQ8 A;  1CUN A;  1KNR A;  2WAU A;  4LFB T;  1JNR A;  1VOM A;  4GK5 E;  1L0V A;  5E0O A;  3AE1 A;  3D0T A;  4WNK A;  1UGO A;  5AFU L;  3PUW F;  2LOS A;  5HEH A;  1OED B;  3LG7 A;  2OA5 A;  3MK7 C;  4GKK T;  2IW5 B;  2W67 A;  1U5P A;  2WY2 A;  2XAS B;  2X9W A;  4MLK A;  2LHR A;  2XAJ B;  3UQ7 A;  2CM0 A;  5FXV A;  4X66 T;  4UIG A;  2WDV A;  3P8C D;  2Q9Q A;  2X67 A;  3N2K E;  3B13 A;  4WBN E;  3O1I A;  1XMO T;  2NR4 A;  5AQR B;  4IHJ E;  4LMJ A;  4A97 A;  4QH5 A;  2VB6 A;  3I0Q A;  4B3T T;  4WYV A;  3ZEF B;  2HH7 A;  4UV9 B;  2NW9 A;  3Q5W A;  4HN9 A;  3AAA B;  4JI4 T;  5LMN T;  2PBI A;  4ISS A;  2LRL A;  1IBK T;  2J47 A;  2LSI A;  1XDP A;  5JRC A;  3OBV E;  2HHH T;  1KK7 A;  2LLY A;  4KHZ F;  4CI1 B;  4L9I A;  3ZC0 A;  3NZP A;  2XQY A;  3RC3 A;  3ZPO A;  3FZF B;  2E9X A;  2RPA A;  2JRK A;  4Z91 A;  2K5B B;  5DJQ C;  2CXL A;  3FB2 A;  3X1D A;  4JI0 T;  3FZH B;  4ZOL E;  3P4R A;  4G2A A;  4NXM T;  4YSY A;  3JC6 C;  2MTQ A;  2BG9 E;  2K9A A;  3KV5 A;  3Q5E A;  4DR1 T;  5L3G B;  4LF9 T;  3Q2M A;  3N2O A;  3NRX A;  4JUY A;  3RYF E;  2YDS A;  4O4J E;  4PJN A;  3T1H T;  1I94 T;  3VR9 A;  2DNX A;  3KBT A;  3ZC1 A;  2KWH A;  3CQX C;  3KV9 A;  2K3W A;  4DR3 T;  2MBG A;  3U3I A;  3ZMZ B;  3E08 A;  4UXN B;  3GN5 A;  5JVD E;  4Q25 A;  4JI3 T;  1W0B A;  5JTG A;  4E7Z A;  4PJM A;  3MJX A;  3WAK A;  2JQ9 A;  2J62 A;  3RX6 A;  3H37 A;  1W9R A;  3PUZ F;  4TZ4 C;  5LA6 E;  5F8P A;  2YN6 A;  2LOP A;  3V5S A;  3GN5 B;  5LXT E;  5AQS B;  4LF8 T;  3N9P A;  3PTR B;  2BBJ A;  5JDQ A;  3Q5X A;  4NUU A;  2R6G F;  4H9O C;  1XDO A;  1ZHC A;  3I9Y A;  3ZSS A;  3JCF A;  2MOZ A;  3RKO A;  1XNR T;  3RRW A;  2CBJ A;  3BQK A;  2X9H A;  3AE9 A;  2HPJ A;  4YHH T;  3UUN A;  4AKL A;  2LT3 A;  1J1J A;  5AQH B;  2FBW A;  2DWK A;  2Y6X A;  4G63 A;  2WP9 A;  3CML A;  2IML A;  3O9X A;  4OX9 T;  3ZT6 A;  5LB7 B;  2WS3 A;  2VQF T;  3AEF A;  4H63 H;  2W4X A;  2I6H A;  2FJD A;  2PJQ A;  4ASK A;  2D0T A;  5FXW A;  4I50 E;  2KSR A;  2CWO A;  3PUQ A;  3WI3 A;  4CN4 A;  5AQU B;  2N2N A;  3UQ4 A;  4M1P A;  3C98 B;  2X9X A;  3N9Q A;  2V7M A;  2OLT A;  4X1I E;  4NXN T;  4YT0 A;  2I59 A;  2YDR A;  5JR9 C;  2QGS A;  4EGW A;  3I1A A;  4H9Q C;  4DID B;  4YTN A;  2WQY A;  4PJJ A;  3UU4 A;  5FMN A;  2L9Q A;  2NTX A;  4KX6 A;  4A5X A;  3RKG A;  4DO0 A;  4HTE A;  4IL4 A;  4DMV A;  2XQ7 A;  4DR4 T;  3SS1 A;  5L2L A;  3Q5D A;  2CA5 A;  3HKD E;  2KMF A;  2BG9 B;  5IUX A;  2ES0 A;  2YOE A;  4V1A v;  1YW0 A;  2EHO C;  1H7C A;  5HXR A;  5IYZ E;  2X0L B;  3QB5 K;  1IZN B;  2YKS A;  4ZEY A;  1E2A A;  2LJL A;  2BVM A;  2UXD T;  2X9Y A;  3CX6 B;  5AQP B;  2UUC T;  3ANW A;  3O4X E;  3P4Q A;  4NUV A;  4DUZ T;  1MMG A;  5IWA T;  5F5W A;  3GMI A;  1KNP A;  3ZMS B;  5ABH A;  3C51 A;  2K24 A;  2B76 A;  4HFD A;  5L3D B;  3W15 B;  4ZS3 A;  3T8O A;  2V7K A;  1GQE A;  2LSJ A;  2DI4 A;  3AE8 A;  4IDZ A;  3ONX A;  3K3O A;  1EZ3 A;  1YXR A;  2E8I A;  3OYZ A;  4HWI B;  2VVS A;  2XZE A;  1XMQ T;  4GYS A;  2UXB T;  4BAY B;  1YD8 G;  3RYI E;  3AAE B;  1WYB A;  5BR8 T;  3J7Y q;  5LBQ B;  2D5U A;  3PV0 F;  2M6B A;  3TLS A;  1BR2 A;  1NEN A;  3AA7 B;  4U7I A;  3PJA J;  3SFD A;  3TLW A;  4KUM B;  4CXW A;  2W0G A;  3C50 A;  1HX1 B;  4YJ2 E;  5HEO A;  5LOV E;  4ANJ A;  1XZY A;  1M7K A;  1D0Z A;  2WB5 A;  2ZM8 A;  4ILA A;  4XZC A;  4DV7 T;  4ILC A;  4HWF A;  3ZCJ A;  3UU3 A;  4QXH B;  3JAD A;  4IT4 A;  2LE8 A;  2HN1 A;  5JR9 A;  4IDP A;  2WDQ A;  4TWD A;  5FYM A;  2V1D B;  3EAM A;  2WDR A;  4TUY E;  3IHR A;  5HEJ A;  5AQN B;  3TLV A;  4KP3 C;  2BS2 A;  4DUY T;  2H7V C;  4DR6 T;  4H63 V;  4OYJ A;  5H6R B;  5LJM A;  2V8S V;  4PFP A;  4XAX B;  1FEW A;  3ZJ2 A;  4F6R C;  1HX8 A;  4AKI A;  2XSA A;  1LRZ A;  2WWV A;  1J5E T;  2EHO A;  3ZN0 B;  2CHN A;  3O1J A;  1NWM X;  2YU2 A;  2WM9 A;  5AQM B;  2PG8 A;  3AEA A;  1IAP A;  3UU5 A;  4EIW A;  2JPF A;  4JI1 T;  1LVK A;  4X62 T;  4GYR A;  5LP6 E;  3VRA A;  3Q9D A;  3NKZ A;  2W61 A;  5J1G A;  4AI6 A;  3FZM B;  3FBL A;  2BKN A;  2IIU A;  5AQT B;  3K1S A;  2RP4 A;  4AIS A;  2BKO A;  3N2G E;  2MPK A;  1V9D A;  2LM9 A;  3FXD B;  3LJC A;  2QA7 A;  2WMO A;  4PJL A;  2GK9 A;  4HGA A;  5JDL A;  3ZST A;  4CQI A;  4LF4 T;  1OED A;  4P09 A;  2Y48 B;  3AAI A;  5JRE A;  2H88 A;  4IIJ E;  4QXB B;  4GOU A;  3LK3 B;  3M3Z B;  4ZI7 E;  5FVL A;  5LGT B;  3QC9 A;  3FHN A;  2G0U A;  1E1H B;  5AQK B;  4IRE A;  2CWY A;  2XJ7 A;  1HS7 A;  2CHO A;  4B6X A;  2CXD A;  5AQV B;  2KIN B;  4L5G A;  2W63 A;  3F31 A;  2MYS A;  2QYW A;  1Y01 A;  4PW8 A;  2VK9 A;  1WCR A;  4KI0 F;  3DJB A;  3LK2 B;  5HXE A;  4O2A E;  3OPC A;  3OYX A;  1D1B A;  5GON E;  3C4W A;  2XUE A;  4U2Z A;  3PE0 A;  4PK5 A;  4TV9 E;  3CIR A;  3RQU A;  1MND A;  4JBW F;  2FJA A;  4OFZ A;  4ZZB A;  2RA1 A;  4HWH A;  3PUV F;  2X68 A;  5HAX A;  2LKH A;  3O1H A;  4H9S E;  4C91 A;  3CVR A;  2XQ5 A;  2C5I T;  2WCA A;  3F57 A;  3QNU A;  3QK6 A;  3UUL A;  5L3B B;  5LCY A;  3ZYK A;  4EZH A;  3N9M A;  2BVL A;  1YKH B;  1M62 A;  4CN1 A;  3UFE A;  2DL1 A;  3R6N A;  2BS3 A;  4TNW A;  3NZQ A; 
#chains in the Genus database with same CATH homology
 2UU9 T;  1HNW T;  4DV3 T;  4NXN T;  1J5E T;  4B3T T;  4DR2 T;  4JI4 T;  1XMQ T;  4LF8 T;  5LMN T;  1IBK T;  2UXB T;  1N36 T;  4DV6 T;  1IBL T;  2HHH T;  5BR8 T;  4DR4 T;  4DV5 T;  3T1Y T;  4DV2 T;  4JI1 T;  4X62 T;  1N32 T;  1N34 T;  5LMU T;  2VQE T;  4AQY T;  4JI0 T;  1XNR T;  4DR7 T;  2F4V T;  4JI7 T;  4NXM T;  4JV5 T;  4YHH T;  4DV4 T;  1HR0 T;  4DV1 T;  4DR1 T;  4KHP T;  4LFB T;  4YY3 T;  4LF9 T;  2UXD T;  4DV7 T;  4JYA T;  4OX9 T;  1XNQ T;  2VQF T;  2UUC T;  4JI5 T;  4DR5 T;  4B3R T;  4LFA T;  3T1H T;  1FJG T;  4JI8 T;  1I94 T;  2UUA T;  2UXC T;  4JI2 T;  4LF4 T;  4LFC T;  4GKK T;  4LF5 T;  4DUZ T;  5IWA T;  3OTO T;  2E5L T;  4LF7 T;  1HNX T;  1N33 T;  1HNZ T;  4B3M T;  4DUY T;  4K0K T;  4JI6 T;  4DR3 T;  4X65 T;  4X66 T;  4DR6 T;  4JI3 T;  4X64 T;  2UUB T;  4GKJ T;  4DV0 T;  4B3S T;  4LF6 T;  1IBM T;  1XMO T;  2ZM6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...