4LFCT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfcT00
1XMQT 2UXBT 4LFAT 4JV5T 4OX9T 4DV4T 1I94T 4JI6T 1HNWT 4DR1T 1HR0T 4DV2T 4B3ST 4JI8T 2HHHT 4JI5T 4X66T 4DV6T 4KHPT 4YHHT 5IWAT 1N33T 1N34T 2VQET 2F4VT 4DUZT 1XNRT 4JI1T 4DR4T 1IBKT 2UUBT 4JI7T 1IBMT 5BR8T 3T1YT 4LF5T 4JI3T 5LMUT 4DUYT 4LF6T 4X62T 2UU9T 4AQYT 2UUAT 3OTOT 4DV0T 4GKJT 4YY3T 4JI2T 4DV5T 4K0KT 4JYAT 4X64T 1N36T 1XNQT 4DR5T 4DV3T 4NXNT 2UXCT 1IBLT 4B3TT 1HNXT 2VQFT 4LF9T 4X65T 4DR2T 2UUCT 1XMOT 2E5LT 4B3MT 4LF7T 4LFCT 3T1HT 4GKKT 4DR3T 1J5ET 1FJGT 4DR6T 4JI0T 4LFBT 5LMNT 4DV7T 4DR7T 2UXDT 4LF8T 2ZM6T 4DV1T 4JI4T 4NXMT 1HNZT 1N32T 4B3RT 4LF4T
chains in the Genus database with same CATH superfamily
2K48A 3AEEA 1W0BA 3UU5A 4AI6A 2A9UA 3N2GE 2ZM0A 2VB6A 4IHJE 2CBIA 5HXHA 5LHGB 1HS7A 2CRBA 4OFZA 3E08A 2YEVC 1KNPA 3RYHE 5L47A 3OBVE 2KT9A 4HFHA 3UUXB 3IBPA 4OK0A 3K3NA 2DLRA 4ILAA 1FMWA 5JTGA 3P50A 4JI3T 1U4QA 4X62T 3EDUA 2X9XA 5JRCB 2YN6A 2KZ7B 2AXDS 2EHOA 2CXLA 4A98A 1CUNA 1KNRA 4QH1A 2WBLA 4XBFB 2DNXA 3K3OA 3CX7B 2Z6EA 3CPZA 2IAKA 3P4QA 2E5LT 1YD8G 4YT0A 3R84B 5C3JA 3PUGA 2WS3A 2E2AA 5AQPB 3CQCB 4IT4A 1HCIA 4QX8B 4MBQA 5HEJA 2UXDT 5J0ZA 2YOEA 3I9WA 3PUAA 2ZM6T 3FZMB 1HNZT 2HN2A 3CMLA 1O3XA 4ADZA 2LHNA 2KSRA 2BKOA 5L4HA 3ZT7A 5LHIB 3NRYA 1X79A 2N2NA 2N9DA 4O4JE 2JRKA 3IF8B 3AA1B 5C2TA 2WWVA 4JI5T 5LJMA 2BKNA 3LBXB 3KV5A 2C5JA 2EHOD 3DJBA 1N33T 5LG4A 5JDGA 3C64A 4EZ4A 3L8RA 2XZEA 2FJEA 5LMUT 3Q9DA 1YKEB 3ONXA 2K3WA 3TLWA 4H9OC 5HWXA 1ZHCA 3KV6A 2LKHA 4AQFC 5FP3A 4UV9B 1OEDB 2NOXA 4ZI2D 3JAEA 1AJ3A 3EUHA 2BBJA 4TZ4C 2B76A 4CN6A 3LK42 3PUVF 3BQLA 1FJGT 1DU2A 4A56A 3K3QC 4TWFA 3N2OA 4H9PC 5JDQA 2W63A 4F6RC 2A2FX 5F8PA 5JDMA 4YFSA 4ZI7E 1MIWA 4BAYB 4ZOLE 5CJ5A 4GOUA 4L0RA 2XAFB 3ZMUB 4AKLA 1G73A 5DJQC 4QWNB 2KMFA 3PUXF 2XQ8A 3JC6D 4KP3C 2AE9A 2V7MA 1E7PA 2P9BA 2DWGA 3S4UA 3RH3A 3P4PA 2KWHA 3UU6A 2DWKA 3WAKA 4EXTA 3JADA 2V6YA 5JREA 3ZSTA 4ZZCA 3LK3B 3FZLB 1T98A 2IW5B 3RKGA 3AXJA 3LFMA 3SS1A 4YJ3E 3QK6A 4X65T 1MMNA 2BG9E 4G63A 3BQIA 3CWZB 2UXXB 1SE7A 4ZI3D 5JQGE 1JNZA 4EYYR 2VKDA 1YW0A 4QKNA 2X9WA 2E9XA 3M3ZB 3O1HA 4NXMT 3AE5A 4CI2B 4GIWA 4U7YA 4OHFA 3ZLIA 2X9HA 3AECA 2PBIA 2OV9A 4DIDB 2NP9A 5KX5E 3I1AA 3HA4A 1ZKEA 3ZYMA 2KXPB 1UCUA 5HXRA 3SFEA 1WYBA 3LK2B 2OLTA 3AA0B 4BA9A 4YTMA 3PDYA 4U74A 3PE0A 3CX6B 2KNDA 4EGWA 4YTPA 4O8SA 1G8XA 2H88A 2EHOB 2D0TA 1T8BA 3FBZA 2XASB 3UQ4A 3FZFB 3TLUA 3VKHA 1H7CA 2YKSA 1WR0A 2LSIA 2E9XD 2A3DA 3RQUA 4PFPA 3RI5A 3C4WA 3EHZA 4WYVA 3ZJ2A 5LGNB 4KI0F 3ZT6A 2BS4A 2MYSA 4GKKT 2XQ5A 2BKPA 4DR3T 1YXRA 3OVUA 2W62A 3RIUA 4ASKA 3PUSA 2X0HA 4PK4A 3ZEFB 4DV1T 1FEWA 2WM9A 3LSVA 3DTOA 4NIQA 2VKJA 3TLSA 3AEBA 3ANWB 3CX8B 2WP9A 2Y6XA 4UF0A 5HEOA 1UK5A 2KLQA 5AQKB 2LHRA 4Z91A 3LJCA 1IJ5A 3VR8A 3L39A 4UV8B 4PJNA 4X20E 3NWIA 4U2ZA 3H3MA 4HWCA 4FI5A 4IGUA 3UUNA 2QVAA 2WU5A 2LSKA 3AEGA 2YINA 2ES0A 3AVSA 1SUMB 3MACA 3PV0F 3UQ7A 3N9PA 1KEYA 5FL0A 5EK3A 4X1KE 3CIRA 2J4GA 4M1PA 2HH7A 2HPJA 5AQTB 2NR4A 4HEAA 3UUBA 3QNUA 4H9NC 2VL0A 5LA6E 1W09A 2BVMA 2XTLA 5AQOB 5ETWA 2CXFA 2RA1A 3O1JA 3OKQA 2NTYA 2W00A 1JNRA 1VOMA 2LSGA 4N78D 2WY2A 2V7IA 3FB2A 4DR7T 4C91A 4QH5A 1I6ZA 5L3EB 1UX4A 3DP7A 2WWUA 2W67A 5IHYA 5LP6E 3PUWF 2XM2A 1D0YA 2JQHA 3PUQA 1S35A 4JV5T 3ZC1A 3A8YC 4DBRA 1T7SA 3MJXA 1YQ3A 2IIUA 5JR9A 3ZSSA 3ZYKA 2XAHB 2JJ9A 2E8IA 2IDOB 4QXHB 2DL1A 4WNKA 1XDOA 3GWHA 4KUMB 3VHLA 5FXVA 2BS3A 4K0KT 2DHRA 3KFWX 3O1IA 4HFCA 3AXJB 4QXCB 2CLYC 2M6IA 2K5BB 5ABFA 4NXNT 3H37A 4IDZA 3AEDA 1ZV4X 4BJNA 4WZXA 4X5TA 3FHNA 3T8OA 2R6GF 3U3IA 1J5ET 4AISA 1WLXA 2CPTA 5AQNB 2E9XB 3R6NA 2W4XA 3JCFA 2WB5A 3TKLB 4EB6E 1IJ6A 3F2EA 4OYJA 2XSAA 1IZNB 5HXEA 1XMQT 1VRBA 2LLYA 2Q9QC 3AE8A 1HTJF 3NRXA 4IE5A 4ILUA 1ZP0A 2XJ7A 3C98B 4IIJE 3ZC0A 2HN1A 5JVDE 2XQ9A 4KHPT 2CWYA 3FZHB 1Z0PA 5F5WA 3RIAA 4HFIA 4JEHB 5IWAT 5DQVA 3L3PA 1XZYA 4UVAB 1BR4A 5LCYA 4TWHA 3ZMZB 2BG9C 3AE6A 2I0MA 1IBMT 5FY0A 3KBUA 4G2AA 4EZHA 2A72A 3AEFA 2BG9A 1J1JA 5KDMC 2L3LA 4ILBA 5FY7A 4NPPA 3MZKB 3GN5A 3IA3A 4IL9A 5DABA 2W61A 3UFGA 2Y8DA 3NZQA 2D0UA 4EAHA 2PFVA 2XAGB 2GK9A 4LF9T 3WAJA 1YQ4A 4IE4A 4LFCT 4BJMA 4AIUA 4WBNE 3LG7A 2HPLA 3KINB 2KINB 2LRKA 3QB5A 4J2CA 4LF8T 2WCAA 3J7Yq 3MA9A 5LGTB 3L09A 4IDQA 3VRBA 4AQFA 2WMOA 4UF0B 2IC6A 4ZS3A 4JI6T 4IL4A 1HNWT 2MBGA 3NVOA 1SHZC 3ZMSB 4B3ST 3ZKRA 2HHHT 4H63H 2VURA 3ETVA 2RPAA 3Q5WA 2CEAA 2F4VT 1E2AA 2WU2A 2JPFA 3AA7B 2RP4A 4EYUA 5LB7B 3MXZA 2MTQA 4ERRA 4HWFA 2UUBT 4JI7T 2D9DA 5AQLB 5LHHB 3FZKB 2UU9T 5IUXA 2J47A 5L3FB 4DV0T 5AQMB 4U3CA 5JDHA 3VKGA 4AKRB 1VCSA 5FYMA 1FMVA 3J9X1 5JDFA 2X68A 2D5UA 4HFEA 3AE2A 4KX6A 1LVKA 2V5CA 2BBHA 1SA0E 2M6BA 3HKDE 2H89A 5L4EA 4HWHA 2VKHA 1LRZA 1NEKA 4YSYA 2OA5A 4PAGA 3AEAA 4UR9A 1Z8UA 4HGAA 4H9SE 3ZN0B 2XAJB 5L3CB 3C4XA 2KWIB 4LFAT 2FJDA 2M67A 4OX9T 1I94T 5JR9B 3WI3A 2XY8B 4IDPA 3AE9A 4IE6A 5HCMA 2LM9A 5M4YA 1WYCA 5CGMA 3EVYA 1VCTA 3X1DA 2CE7A 5JRCA 3F57A 4UELA 3P4SA 1XNRT 1EZ3A 4QH4A 4H63V 2C0SA 3ETUA 4PK5A 4EEDA 3AE3A 5L3GB 3KV4A 5AQQB 4PJMA 2NWBA 3ONJA 2QA7A 3QUJA 1HX8A 4X64T 4HKAA 3SOLA 5ABFB 3VR9A 3QB5K 4EEBA 2CA5A 3A5XA 4HN9A 5CFBA 2J62A 2UXCT 5AQRB 4LMJA 1MIVA 2QRXA 2WDVA 2V8SV 2V7KA 1XMOT 3O4XE 4LF7T 1OXZA 5HCJA 1HX1B 4A5XA 4QX7B 5LGUB 4CZZB 3RC3A 2I59A 4WBOA 5EZYE 4EIWA 3AE7A 2NTXA 2H3RA 2V7JA 4QXBB 4DV7T 2DCFA 4UIGA 4ZS2A 1D1BA 3NZPA 3Q5XA 4LF4T 5LJNA 3N9LA 4E7ZA 1W9RA 2DI4A 1D1AA 3CQXC 3UUMA 1KFYA 2I6HA 3RYCE 5ABGA 5HEGA 3ZJ1A 1D0XA 3I0QA 4V1Av 2LOPA 4X66T 3EABA 1HG5A 4JBWF 3RPUA 1QUUA 3EDVA 1BR1A 3HL6A 4PW8A 1CHUA 4HFBA 4Z8XA 1OEDC 4U2YA 4TUYE 2X66A 4JUYA 2X51A 5BR8T 5LBQB 1US7B 4LMLA 5F3JA 4DUYT 2X0YA 4AQYT 3GN5B 4TX5A 4AXPA 1OWAA 3CKDA 4E7SA 4DV5T 2VL8A 4CQIA 2SPCA 2W66A 5BMVE 4X1IE 3HKBE 2XPKA 4O4HE 2XQ6A 2FUPA 2L9QA 3AB3B 2YDSA 4P09A 4YTNA 4TNWA 5AQHB 3ONLC 4GK5E 5J2TE 4IDOA 2C5KT 5EK4A 5ABHA 1GQEA 3PU8A 4JI4T 3RYIE 4U7IA 1N32T 5FY1A 3RQWA 3EI0A 4DV4T 2X67A 2MPKA 2V26A 3UTKA 2ACXA 3NKZA 2FBWA 3ZCIA 1UUSA 4GYRA 1HF8A 5ADXL 2YDQA 2XQ7A 1N34T 3PJAA 2N1GA 2VVSA 4DUZT 4ZEYA 1IBKT 4CI3B 3KVAA 3HR0A 3GA8A 3FXDB 4ZHQE 4CXYA 1W0AA 5AFUL 4JYAT 2BDEA 4DR5T 3UU4A 4K0UA 2L8KA 3N9MA 4MHCA 3U78A 3E22E 3IEEA 1FIOA 2V6YB 5AQJB 2QYWA 4JLEA 1YKHB 3RKOA 5E0OA 2XQ4A 2WZIA 5HXCA 4DNDA 2JQKA 4I0UA 5FNVE 1ZOYA 1KNZA 1V9DA 4KMCA 3ZCJA 4CI1B 4A97A 2IHR1 4I4TE 3Q5DA 2JQQA 4TN7B 4YHJA 3ZN1B 4B3RT 1OEDE 4HWIB 4UVCB 1XWMA 2UXBT 1Y64B 4CN1A 1MNEA 1U5PA 5FVLA 4DR1T 2YDRA 2MOZA 5EK2A 5HWYA 2K24A 2XHEB 5FVKA 3B57A 4HE8A 3UULA 5CB4E 2EHOC 2LE8A 1HG2A 4DMWA 2XSBA 3AAEB 3HKEE 3SWHA 1HFAA 3P4WA 5AQVB 4FJOA 2Q9QA 3KBTA 1LVFA 5J1GA 2UUAT 5AQUB 3RHWA 3RGLA 4GKJT 4C90A 1S94A 3PUYF 5GONE 1N36T 3ZMVB 3C51A 3ABVA 4DV3T 2LOSA 4ZI2C 2XQAA 3RRWA 1IBLT 2VQFT 5CA0E 1M62A 2CM0A 4DR2T 4PJLA 4AKIA 2LKGA 1ZEEA 4OYKA 3I0OA 3B5MA 5DQWA 4TV8E 5LNKA 4DR6T 3V5UA 3ANWA 4IE7A 3VU7H 3W15B 2W2UA 3I9YA 3M65A 4EOZB 1BR0A 2LEHA 3UFEA 2XAQB 4HFDA 4XZCA 1UGOA 5HXSA 3HI2A 4U72A 3H3AA 3Q2MA 2Q9QD 2PG8A 4UEMA 1HR0T 2IMLA 1MMAA 1R8IA 4CN4A 4DV6T 3JC6C 3AE1A 2VQET 2VWAA 2JIWA 3PJAJ 3V5SA 4YSZA 5ABEA 4DR4T 2ODUA 4KHZF 2W0GA 2YU2A 3CQGB 2ACZA 1XDPA 1QSDA 3HKCE 3UU8A 2NW8A 1KK7A 3C4ZA 2H7VC 4B6XA 3ZYLA 2XQ3A 1B7TA 5L3DB 4MFRA 2XQYA 4TV9E 5KXJA 4PFOA 2IUBA 4UXNB 4PK6A 3RRCA 2LT3A 4YLHA 3SRZA 1KF6A 3LDQB 4ZI3C 4DO0A 4ILCA 1MIYA 2B1EA 4LFBT 1X9BA 5LMNT 2ZM2A 2XM1A 3RIFA 2VKOA 2CWOA 3PTRB 1MMGA 4NUUA 3ZPOA 5CA1E 3Q5EA 4XAXB 5AQSB 2WAUA 2XUEA 5A1LA 1MMDA 4YSXA 5AQIB 2H7OA 3N9NA 3PU3A 4JI8T 4P1NA 3RC8A 3C50A 5L2LA 4O2AE 1D0ZA 2VASA 5FXXA 2JMKA 2K9AA 3P4RA 2WDQA 2LM2A 4DVDA 1WRDA 2CCQA 3QOFA 1MNDA 3N9QA 5LOVE 3T1YT 4LF5T 4KBMB 4ISTA 3AAIA 2V5DA 3QC9A 2YU1A 5AQFB 4JI2T 5H6QB 1XNQT 2E9XC 1WR6A 2ZMAA 3D0TA 3G06A 4B3TT 5FMNA 4PNIA 5LG3A 2E5VA 3AE4A 2JQ9A 3RYFE 4MLKA 4MALA 4HWDA 4B3MT 3FXEB 3VRAA 4DBQA 4COFA 4L5GA 3MK7C 4HFVA 4JI0T 1BR2A 2PJQA 5FXWA 3KDSE 2CLYB 2Y48B 5LYJE 3JAFA 4Q25A 5FXZA 2V1DB 3K1SA 2YK0A 4P0AA 2QGSA 2VK9A 1IAPA 1WCRA 4O4LE 4I50E 3SFDA 4TNVA 4DV2T 3O9XA 4I55E 3RX6A 1NAFA 3B13A 3OYXA 5AQGB 2X9YA 4H9RC 3UU3A 2WSSV 4CXWA 4YHHT 3LBXA 4PJJA 2J1DG 4X1YE 1NWMX 2Q9QB 4IREA 5LXTE 4HTEA 3A7MA 4GYSA 1NENA 3AA6B 2ODVA 2BZBA 3RIUC 3P7IA 4ANJA 3OTOT 2JMHA 5J2UE 4YY3T 2C5IT 4EV6A 3BK9A 1Y01A 4ISSA 2VVNA 1T72A 3KVBA 3OYZA 4AKGA 4I43B 1HNXT 2BG9B 2V6XA 4F8HA 2LSYA 5FKYA 1OEDA 3PUZF 2MAWA 2FJBA 5JDLA 3T1HT 4GK0E 4DMVA 1E1HB 3E0ZA 1QLBA 4AKHA 2CMRA 2WQYA 4L9IA 2PTFA 4IDNA 4UVBB 5LBMA 3CVRA 2WDRA 3BQKA 2ZLYA 3ESLA 2V7LA 2NW9A 2IC9A 2WMNA 3K8PC 5JDNA 4O4IE 4YJ2E 2LSJA 1L0VA 5HEUA 3EAMA 3AAAB 5C8YE 4JEUB 4ZXLA 3RLFF 4YXDA 2LJLA 3CK6A 2D2SA 1WFDA 3N5LA 3AVRA 4H9QC 2CHOA 4U31A 2WZHA 2CXDA 5IYZE 2BVLA 1D1CA 5FL1A 3UT5E 3IHRA 3N9OA 4Z90A 4JI1T 4QHOA 2X0LB 3GMIA 3NBXX 2G0UA 1J5WA 1UURA 3FBLA 4TWDA 4LF6T 5JH7E 1M7KA 5H6RB 2BS2A 3F31A 5HEHA 3P8CD 3KV9A 5L3BB 3RF1A 3ZMTB 5HYAA 1LKXA 3OJAA 5KMGP 4U33A 4WW0A 2CBJA 4CXXA 2CHNA 2UUCT 3N2KE 4P0BA 3PURA 2ZM8A 4NUVA 4O2BE 5TAOA 4ZZBA 2NW7A 3ZT5A 5HAXA 5JR9C 4LMKA 3TLTA 2FJAA 1UX5A 3MKDA 4AQGA 3OPCA 2UXNB 4IE0A 3TLVA 2LRLA
chains in the Genus database with same CATH topology
1XMQT 2UXBT 4LFAT 4JV5T 4OX9T 4DV4T 1I94T 4JI6T 1HNWT 4DR1T 1HR0T 4DV2T 4B3ST 4JI8T 2HHHT 4JI5T 4X66T 4DV6T 4KHPT 4YHHT 5IWAT 1N33T 1N34T 2VQET 2F4VT 4DUZT 1XNRT 4JI1T 4DR4T 1IBKT 2UUBT 4JI7T 1IBMT 5BR8T 3T1YT 4LF5T 4JI3T 5LMUT 4DUYT 4LF6T 4X62T 2UU9T 4AQYT 2UUAT 3OTOT 4DV0T 4GKJT 4YY3T 4JI2T 4DV5T 4K0KT 4JYAT 4X64T 1N36T 1XNQT 4DR5T 4DV3T 4NXNT 2UXCT 1IBLT 4B3TT 1HNXT 2VQFT 4LF9T 4X65T 4DR2T 2UUCT 1XMOT 2E5LT 4B3MT 4LF7T 4LFCT 3T1HT 4GKKT 4DR3T 1J5ET 1FJGT 4DR6T 4JI0T 4LFBT 5LMNT 4DV7T 4DR7T 2UXDT 4LF8T 2ZM6T 4DV1T 4JI4T 4NXMT 1HNZT 1N32T 4B3RT 4LF4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ T;  2UXB T;  4LFA T;  4JV5 T;  4OX9 T;  4DV4 T;  1I94 T;  4JI6 T;  1HNW T;  4DR1 T;  1HR0 T;  4DV2 T;  4B3S T;  4JI8 T;  2HHH T;  4JI5 T;  4X66 T;  4DV6 T;  4KHP T;  4YHH T;  5IWA T;  1N33 T;  1N34 T;  2VQE T;  2F4V T;  4DUZ T;  1XNR T;  4JI1 T;  4DR4 T;  1IBK T;  2UUB T;  4JI7 T;  1IBM T;  5BR8 T;  3T1Y T;  4LF5 T;  4JI3 T;  5LMU T;  4DUY T;  4LF6 T;  4X62 T;  2UU9 T;  4AQY T;  2UUA T;  3OTO T;  4DV0 T;  4GKJ T;  4YY3 T;  4JI2 T;  4DV5 T;  4K0K T;  4JYA T;  4X64 T;  1N36 T;  1XNQ T;  4DR5 T;  4DV3 T;  4NXN T;  2UXC T;  1IBL T;  4B3T T;  1HNX T;  2VQF T;  4LF9 T;  4X65 T;  4DR2 T;  2UUC T;  1XMO T;  2E5L T;  4B3M T;  4LF7 T;  4LFC T;  3T1H T;  4GKK T;  4DR3 T;  1J5E T;  1FJG T;  4DR6 T;  4JI0 T;  4LFB T;  5LMN T;  4DV7 T;  4DR7 T;  2UXD T;  4LF8 T;  2ZM6 T;  4DV1 T;  4JI4 T;  4NXM T;  1HNZ T;  1N32 T;  4B3R T;  4LF4 T; 
#chains in the Genus database with same CATH topology
 2K48 A;  3AEE A;  1W0B A;  3UU5 A;  4AI6 A;  2A9U A;  3N2G E;  2ZM0 A;  2VB6 A;  4IHJ E;  2CBI A;  5HXH A;  5LHG B;  1HS7 A;  2CRB A;  4OFZ A;  3E08 A;  2YEV C;  1KNP A;  3RYH E;  5L47 A;  3OBV E;  2KT9 A;  4HFH A;  3UUX B;  3IBP A;  4OK0 A;  3K3N A;  2DLR A;  4ILA A;  1FMW A;  5JTG A;  3P50 A;  4JI3 T;  1U4Q A;  4X62 T;  3EDU A;  2X9X A;  5JRC B;  2YN6 A;  2KZ7 B;  2AXD S;  2EHO A;  2CXL A;  4A98 A;  1CUN A;  1KNR A;  4QH1 A;  2WBL A;  4XBF B;  2DNX A;  3K3O A;  3CX7 B;  2Z6E A;  3CPZ A;  2IAK A;  3P4Q A;  2E5L T;  1YD8 G;  4YT0 A;  3R84 B;  5C3J A;  3PUG A;  2WS3 A;  2E2A A;  5AQP B;  3CQC B;  4IT4 A;  1HCI A;  4QX8 B;  4MBQ A;  5HEJ A;  2UXD T;  5J0Z A;  2YOE A;  3I9W A;  3PUA A;  2ZM6 T;  3FZM B;  1HNZ T;  2HN2 A;  3CML A;  1O3X A;  4ADZ A;  2LHN A;  2KSR A;  2BKO A;  5L4H A;  3ZT7 A;  5LHI B;  3NRY A;  1X79 A;  2N2N A;  2N9D A;  4O4J E;  2JRK A;  3IF8 B;  3AA1 B;  5C2T A;  2WWV A;  4JI5 T;  5LJM A;  2BKN A;  3LBX B;  3KV5 A;  2C5J A;  2EHO D;  3DJB A;  1N33 T;  5LG4 A;  5JDG A;  3C64 A;  4EZ4 A;  3L8R A;  2XZE A;  2FJE A;  5LMU T;  3Q9D A;  1YKE B;  3ONX A;  2K3W A;  3TLW A;  4H9O C;  5HWX A;  1ZHC A;  3KV6 A;  2LKH A;  4AQF C;  5FP3 A;  4UV9 B;  1OED B;  2NOX A;  4ZI2 D;  3JAE A;  1AJ3 A;  3EUH A;  2BBJ A;  4TZ4 C;  2B76 A;  4CN6 A;  3LK4 2;  3PUV F;  3BQL A;  1FJG T;  1DU2 A;  4A56 A;  3K3Q C;  4TWF A;  3N2O A;  4H9P C;  5JDQ A;  2W63 A;  4F6R C;  2A2F X;  5F8P A;  5JDM A;  4YFS A;  4ZI7 E;  1MIW A;  4BAY B;  4ZOL E;  5CJ5 A;  4GOU A;  4L0R A;  2XAF B;  3ZMU B;  4AKL A;  1G73 A;  5DJQ C;  4QWN B;  2KMF A;  3PUX F;  2XQ8 A;  3JC6 D;  4KP3 C;  2AE9 A;  2V7M A;  1E7P A;  2P9B A;  2DWG A;  3S4U A;  3RH3 A;  3P4P A;  2KWH A;  3UU6 A;  2DWK A;  3WAK A;  4EXT A;  3JAD A;  2V6Y A;  5JRE A;  3ZST A;  4ZZC A;  3LK3 B;  3FZL B;  1T98 A;  2IW5 B;  3RKG A;  3AXJ A;  3LFM A;  3SS1 A;  4YJ3 E;  3QK6 A;  4X65 T;  1MMN A;  2BG9 E;  4G63 A;  3BQI A;  3CWZ B;  2UXX B;  1SE7 A;  4ZI3 D;  5JQG E;  1JNZ A;  4EYY R;  2VKD A;  1YW0 A;  4QKN A;  2X9W A;  2E9X A;  3M3Z B;  3O1H A;  4NXM T;  3AE5 A;  4CI2 B;  4GIW A;  4U7Y A;  4OHF A;  3ZLI A;  2X9H A;  3AEC A;  2PBI A;  2OV9 A;  4DID B;  2NP9 A;  5KX5 E;  3I1A A;  3HA4 A;  1ZKE A;  3ZYM A;  2KXP B;  1UCU A;  5HXR A;  3SFE A;  1WYB A;  3LK2 B;  2OLT A;  3AA0 B;  4BA9 A;  4YTM A;  3PDY A;  4U74 A;  3PE0 A;  3CX6 B;  2KND A;  4EGW A;  4YTP A;  4O8S A;  1G8X A;  2H88 A;  2EHO B;  2D0T A;  1T8B A;  3FBZ A;  2XAS B;  3UQ4 A;  3FZF B;  3TLU A;  3VKH A;  1H7C A;  2YKS A;  1WR0 A;  2LSI A;  2E9X D;  2A3D A;  3RQU A;  4PFP A;  3RI5 A;  3C4W A;  3EHZ A;  4WYV A;  3ZJ2 A;  5LGN B;  4KI0 F;  3ZT6 A;  2BS4 A;  2MYS A;  4GKK T;  2XQ5 A;  2BKP A;  4DR3 T;  1YXR A;  3OVU A;  2W62 A;  3RIU A;  4ASK A;  3PUS A;  2X0H A;  4PK4 A;  3ZEF B;  4DV1 T;  1FEW A;  2WM9 A;  3LSV A;  3DTO A;  4NIQ A;  2VKJ A;  3TLS A;  3AEB A;  3ANW B;  3CX8 B;  2WP9 A;  2Y6X A;  4UF0 A;  5HEO A;  1UK5 A;  2KLQ A;  5AQK B;  2LHR A;  4Z91 A;  3LJC A;  1IJ5 A;  3VR8 A;  3L39 A;  4UV8 B;  4PJN A;  4X20 E;  3NWI A;  4U2Z A;  3H3M A;  4HWC A;  4FI5 A;  4IGU A;  3UUN A;  2QVA A;  2WU5 A;  2LSK A;  3AEG A;  2YIN A;  2ES0 A;  3AVS A;  1SUM B;  3MAC A;  3PV0 F;  3UQ7 A;  3N9P A;  1KEY A;  5FL0 A;  5EK3 A;  4X1K E;  3CIR A;  2J4G A;  4M1P A;  2HH7 A;  2HPJ A;  5AQT B;  2NR4 A;  4HEA A;  3UUB A;  3QNU A;  4H9N C;  2VL0 A;  5LA6 E;  1W09 A;  2BVM A;  2XTL A;  5AQO B;  5ETW A;  2CXF A;  2RA1 A;  3O1J A;  3OKQ A;  2NTY A;  2W00 A;  1JNR A;  1VOM A;  2LSG A;  4N78 D;  2WY2 A;  2V7I A;  3FB2 A;  4DR7 T;  4C91 A;  4QH5 A;  1I6Z A;  5L3E B;  1UX4 A;  3DP7 A;  2WWU A;  2W67 A;  5IHY A;  5LP6 E;  3PUW F;  2XM2 A;  1D0Y A;  2JQH A;  3PUQ A;  1S35 A;  4JV5 T;  3ZC1 A;  3A8Y C;  4DBR A;  1T7S A;  3MJX A;  1YQ3 A;  2IIU A;  5JR9 A;  3ZSS A;  3ZYK A;  2XAH B;  2JJ9 A;  2E8I A;  2IDO B;  4QXH B;  2DL1 A;  4WNK A;  1XDO A;  3GWH A;  4KUM B;  3VHL A;  5FXV A;  2BS3 A;  4K0K T;  2DHR A;  3KFW X;  3O1I A;  4HFC A;  3AXJ B;  4QXC B;  2CLY C;  2M6I A;  2K5B B;  5ABF A;  4NXN T;  3H37 A;  4IDZ A;  3AED A;  1ZV4 X;  4BJN A;  4WZX A;  4X5T A;  3FHN A;  3T8O A;  2R6G F;  3U3I A;  1J5E T;  4AIS A;  1WLX A;  2CPT A;  5AQN B;  2E9X B;  3R6N A;  2W4X A;  3JCF A;  2WB5 A;  3TKL B;  4EB6 E;  1IJ6 A;  3F2E A;  4OYJ A;  2XSA A;  1IZN B;  5HXE A;  1XMQ T;  1VRB A;  2LLY A;  2Q9Q C;  3AE8 A;  1HTJ F;  3NRX A;  4IE5 A;  4ILU A;  1ZP0 A;  2XJ7 A;  3C98 B;  4IIJ E;  3ZC0 A;  2HN1 A;  5JVD E;  2XQ9 A;  4KHP T;  2CWY A;  3FZH B;  1Z0P A;  5F5W A;  3RIA A;  4HFI A;  4JEH B;  5IWA T;  5DQV A;  3L3P A;  1XZY A;  4UVA B;  1BR4 A;  5LCY A;  4TWH A;  3ZMZ B;  2BG9 C;  3AE6 A;  2I0M A;  1IBM T;  5FY0 A;  3KBU A;  4G2A A;  4EZH A;  2A72 A;  3AEF A;  2BG9 A;  1J1J A;  5KDM C;  2L3L A;  4ILB A;  5FY7 A;  4NPP A;  3MZK B;  3GN5 A;  3IA3 A;  4IL9 A;  5DAB A;  2W61 A;  3UFG A;  2Y8D A;  3NZQ A;  2D0U A;  4EAH A;  2PFV A;  2XAG B;  2GK9 A;  4LF9 T;  3WAJ A;  1YQ4 A;  4IE4 A;  4LFC T;  4BJM A;  4AIU A;  4WBN E;  3LG7 A;  2HPL A;  3KIN B;  2KIN B;  2LRK A;  3QB5 A;  4J2C A;  4LF8 T;  2WCA A;  3J7Y q;  3MA9 A;  5LGT B;  3L09 A;  4IDQ A;  3VRB A;  4AQF A;  2WMO A;  4UF0 B;  2IC6 A;  4ZS3 A;  4JI6 T;  4IL4 A;  1HNW T;  2MBG A;  3NVO A;  1SHZ C;  3ZMS B;  4B3S T;  3ZKR A;  2HHH T;  4H63 H;  2VUR A;  3ETV A;  2RPA A;  3Q5W A;  2CEA A;  2F4V T;  1E2A A;  2WU2 A;  2JPF A;  3AA7 B;  2RP4 A;  4EYU A;  5LB7 B;  3MXZ A;  2MTQ A;  4ERR A;  4HWF A;  2UUB T;  4JI7 T;  2D9D A;  5AQL B;  5LHH B;  3FZK B;  2UU9 T;  5IUX A;  2J47 A;  5L3F B;  4DV0 T;  5AQM B;  4U3C A;  5JDH A;  3VKG A;  4AKR B;  1VCS A;  5FYM A;  1FMV A;  3J9X 1;  5JDF A;  2X68 A;  2D5U A;  4HFE A;  3AE2 A;  4KX6 A;  1LVK A;  2V5C A;  2BBH A;  1SA0 E;  2M6B A;  3HKD E;  2H89 A;  5L4E A;  4HWH A;  2VKH A;  1LRZ A;  1NEK A;  4YSY A;  2OA5 A;  4PAG A;  3AEA A;  4UR9 A;  1Z8U A;  4HGA A;  4H9S E;  3ZN0 B;  2XAJ B;  5L3C B;  3C4X A;  2KWI B;  4LFA T;  2FJD A;  2M67 A;  4OX9 T;  1I94 T;  5JR9 B;  3WI3 A;  2XY8 B;  4IDP A;  3AE9 A;  4IE6 A;  5HCM A;  2LM9 A;  5M4Y A;  1WYC A;  5CGM A;  3EVY A;  1VCT A;  3X1D A;  2CE7 A;  5JRC A;  3F57 A;  4UEL A;  3P4S A;  1XNR T;  1EZ3 A;  4QH4 A;  4H63 V;  2C0S A;  3ETU A;  4PK5 A;  4EED A;  3AE3 A;  5L3G B;  3KV4 A;  5AQQ B;  4PJM A;  2NWB A;  3ONJ A;  2QA7 A;  3QUJ A;  1HX8 A;  4X64 T;  4HKA A;  3SOL A;  5ABF B;  3VR9 A;  3QB5 K;  4EEB A;  2CA5 A;  3A5X A;  4HN9 A;  5CFB A;  2J62 A;  2UXC T;  5AQR B;  4LMJ A;  1MIV A;  2QRX A;  2WDV A;  2V8S V;  2V7K A;  1XMO T;  3O4X E;  4LF7 T;  1OXZ A;  5HCJ A;  1HX1 B;  4A5X A;  4QX7 B;  5LGU B;  4CZZ B;  3RC3 A;  2I59 A;  4WBO A;  5EZY E;  4EIW A;  3AE7 A;  2NTX A;  2H3R A;  2V7J A;  4QXB B;  4DV7 T;  2DCF A;  4UIG A;  4ZS2 A;  1D1B A;  3NZP A;  3Q5X A;  4LF4 T;  5LJN A;  3N9L A;  4E7Z A;  1W9R A;  2DI4 A;  1D1A A;  3CQX C;  3UUM A;  1KFY A;  2I6H A;  3RYC E;  5ABG A;  5HEG A;  3ZJ1 A;  1D0X A;  3I0Q A;  4V1A v;  2LOP A;  4X66 T;  3EAB A;  1HG5 A;  4JBW F;  3RPU A;  1QUU A;  3EDV A;  1BR1 A;  3HL6 A;  4PW8 A;  1CHU A;  4HFB A;  4Z8X A;  1OED C;  4U2Y A;  4TUY E;  2X66 A;  4JUY A;  2X51 A;  5BR8 T;  5LBQ B;  1US7 B;  4LML A;  5F3J A;  4DUY T;  2X0Y A;  4AQY T;  3GN5 B;  4TX5 A;  4AXP A;  1OWA A;  3CKD A;  4E7S A;  4DV5 T;  2VL8 A;  4CQI A;  2SPC A;  2W66 A;  5BMV E;  4X1I E;  3HKB E;  2XPK A;  4O4H E;  2XQ6 A;  2FUP A;  2L9Q A;  3AB3 B;  2YDS A;  4P09 A;  4YTN A;  4TNW A;  5AQH B;  3ONL C;  4GK5 E;  5J2T E;  4IDO A;  2C5K T;  5EK4 A;  5ABH A;  1GQE A;  3PU8 A;  4JI4 T;  3RYI E;  4U7I A;  1N32 T;  5FY1 A;  3RQW A;  3EI0 A;  4DV4 T;  2X67 A;  2MPK A;  2V26 A;  3UTK A;  2ACX A;  3NKZ A;  2FBW A;  3ZCI A;  1UUS A;  4GYR A;  1HF8 A;  5ADX L;  2YDQ A;  2XQ7 A;  1N34 T;  3PJA A;  2N1G A;  2VVS A;  4DUZ T;  4ZEY A;  1IBK T;  4CI3 B;  3KVA A;  3HR0 A;  3GA8 A;  3FXD B;  4ZHQ E;  4CXY A;  1W0A A;  5AFU L;  4JYA T;  2BDE A;  4DR5 T;  3UU4 A;  4K0U A;  2L8K A;  3N9M A;  4MHC A;  3U78 A;  3E22 E;  3IEE A;  1FIO A;  2V6Y B;  5AQJ B;  2QYW A;  4JLE A;  1YKH B;  3RKO A;  5E0O A;  2XQ4 A;  2WZI A;  5HXC A;  4DND A;  2JQK A;  4I0U A;  5FNV E;  1ZOY A;  1KNZ A;  1V9D A;  4KMC A;  3ZCJ A;  4CI1 B;  4A97 A;  2IHR 1;  4I4T E;  3Q5D A;  2JQQ A;  4TN7 B;  4YHJ A;  3ZN1 B;  4B3R T;  1OED E;  4HWI B;  4UVC B;  1XWM A;  2UXB T;  1Y64 B;  4CN1 A;  1MNE A;  1U5P A;  5FVL A;  4DR1 T;  2YDR A;  2MOZ A;  5EK2 A;  5HWY A;  2K24 A;  2XHE B;  5FVK A;  3B57 A;  4HE8 A;  3UUL A;  5CB4 E;  2EHO C;  2LE8 A;  1HG2 A;  4DMW A;  2XSB A;  3AAE B;  3HKE E;  3SWH A;  1HFA A;  3P4W A;  5AQV B;  4FJO A;  2Q9Q A;  3KBT A;  1LVF A;  5J1G A;  2UUA T;  5AQU B;  3RHW A;  3RGL A;  4GKJ T;  4C90 A;  1S94 A;  3PUY F;  5GON E;  1N36 T;  3ZMV B;  3C51 A;  3ABV A;  4DV3 T;  2LOS A;  4ZI2 C;  2XQA A;  3RRW A;  1IBL T;  2VQF T;  5CA0 E;  1M62 A;  2CM0 A;  4DR2 T;  4PJL A;  4AKI A;  2LKG A;  1ZEE A;  4OYK A;  3I0O A;  3B5M A;  5DQW A;  4TV8 E;  5LNK A;  4DR6 T;  3V5U A;  3ANW A;  4IE7 A;  3VU7 H;  3W15 B;  2W2U A;  3I9Y A;  3M65 A;  4EOZ B;  1BR0 A;  2LEH A;  3UFE A;  2XAQ B;  4HFD A;  4XZC A;  1UGO A;  5HXS A;  3HI2 A;  4U72 A;  3H3A A;  3Q2M A;  2Q9Q D;  2PG8 A;  4UEM A;  1HR0 T;  2IML A;  1MMA A;  1R8I A;  4CN4 A;  4DV6 T;  3JC6 C;  3AE1 A;  2VQE T;  2VWA A;  2JIW A;  3PJA J;  3V5S A;  4YSZ A;  5ABE A;  4DR4 T;  2ODU A;  4KHZ F;  2W0G A;  2YU2 A;  3CQG B;  2ACZ A;  1XDP A;  1QSD A;  3HKC E;  3UU8 A;  2NW8 A;  1KK7 A;  3C4Z A;  2H7V C;  4B6X A;  3ZYL A;  2XQ3 A;  1B7T A;  5L3D B;  4MFR A;  2XQY A;  4TV9 E;  5KXJ A;  4PFO A;  2IUB A;  4UXN B;  4PK6 A;  3RRC A;  2LT3 A;  4YLH A;  3SRZ A;  1KF6 A;  3LDQ B;  4ZI3 C;  4DO0 A;  4ILC A;  1MIY A;  2B1E A;  4LFB T;  1X9B A;  5LMN T;  2ZM2 A;  2XM1 A;  3RIF A;  2VKO A;  2CWO A;  3PTR B;  1MMG A;  4NUU A;  3ZPO A;  5CA1 E;  3Q5E A;  4XAX B;  5AQS B;  2WAU A;  2XUE A;  5A1L A;  1MMD A;  4YSX A;  5AQI B;  2H7O A;  3N9N A;  3PU3 A;  4JI8 T;  4P1N A;  3RC8 A;  3C50 A;  5L2L A;  4O2A E;  1D0Z A;  2VAS A;  5FXX A;  2JMK A;  2K9A A;  3P4R A;  2WDQ A;  2LM2 A;  4DVD A;  1WRD A;  2CCQ A;  3QOF A;  1MND A;  3N9Q A;  5LOV E;  3T1Y T;  4LF5 T;  4KBM B;  4IST A;  3AAI A;  2V5D A;  3QC9 A;  2YU1 A;  5AQF B;  4JI2 T;  5H6Q B;  1XNQ T;  2E9X C;  1WR6 A;  2ZMA A;  3D0T A;  3G06 A;  4B3T T;  5FMN A;  4PNI A;  5LG3 A;  2E5V A;  3AE4 A;  2JQ9 A;  3RYF E;  4MLK A;  4MAL A;  4HWD A;  4B3M T;  3FXE B;  3VRA A;  4DBQ A;  4COF A;  4L5G A;  3MK7 C;  4HFV A;  4JI0 T;  1BR2 A;  2PJQ A;  5FXW A;  3KDS E;  2CLY B;  2Y48 B;  5LYJ E;  3JAF A;  4Q25 A;  5FXZ A;  2V1D B;  3K1S A;  2YK0 A;  4P0A A;  2QGS A;  2VK9 A;  1IAP A;  1WCR A;  4O4L E;  4I50 E;  3SFD A;  4TNV A;  4DV2 T;  3O9X A;  4I55 E;  3RX6 A;  1NAF A;  3B13 A;  3OYX A;  5AQG B;  2X9Y A;  4H9R C;  3UU3 A;  2WSS V;  4CXW A;  4YHH T;  3LBX A;  4PJJ A;  2J1D G;  4X1Y E;  1NWM X;  2Q9Q B;  4IRE A;  5LXT E;  4HTE A;  3A7M A;  4GYS A;  1NEN A;  3AA6 B;  2ODV A;  2BZB A;  3RIU C;  3P7I A;  4ANJ A;  3OTO T;  2JMH A;  5J2U E;  4YY3 T;  2C5I T;  4EV6 A;  3BK9 A;  1Y01 A;  4ISS A;  2VVN A;  1T72 A;  3KVB A;  3OYZ A;  4AKG A;  4I43 B;  1HNX T;  2BG9 B;  2V6X A;  4F8H A;  2LSY A;  5FKY A;  1OED A;  3PUZ F;  2MAW A;  2FJB A;  5JDL A;  3T1H T;  4GK0 E;  4DMV A;  1E1H B;  3E0Z A;  1QLB A;  4AKH A;  2CMR A;  2WQY A;  4L9I A;  2PTF A;  4IDN A;  4UVB B;  5LBM A;  3CVR A;  2WDR A;  3BQK A;  2ZLY A;  3ESL A;  2V7L A;  2NW9 A;  2IC9 A;  2WMN A;  3K8P C;  5JDN A;  4O4I E;  4YJ2 E;  2LSJ A;  1L0V A;  5HEU A;  3EAM A;  3AAA B;  5C8Y E;  4JEU B;  4ZXL A;  3RLF F;  4YXD A;  2LJL A;  3CK6 A;  2D2S A;  1WFD A;  3N5L A;  3AVR A;  4H9Q C;  2CHO A;  4U31 A;  2WZH A;  2CXD A;  5IYZ E;  2BVL A;  1D1C A;  5FL1 A;  3UT5 E;  3IHR A;  3N9O A;  4Z90 A;  4JI1 T;  4QHO A;  2X0L B;  3GMI A;  3NBX X;  2G0U A;  1J5W A;  1UUR A;  3FBL A;  4TWD A;  4LF6 T;  5JH7 E;  1M7K A;  5H6R B;  2BS2 A;  3F31 A;  5HEH A;  3P8C D;  3KV9 A;  5L3B B;  3RF1 A;  3ZMT B;  5HYA A;  1LKX A;  3OJA A;  5KMG P;  4U33 A;  4WW0 A;  2CBJ A;  4CXX A;  2CHN A;  2UUC T;  3N2K E;  4P0B A;  3PUR A;  2ZM8 A;  4NUV A;  4O2B E;  5TAO A;  4ZZB A;  2NW7 A;  3ZT5 A;  5HAX A;  5JR9 C;  4LMK A;  3TLT A;  2FJA A;  1UX5 A;  3MKD A;  4AQG A;  3OPC A;  2UXN B;  4IE0 A;  3TLV A;  2LRL A; 
#chains in the Genus database with same CATH homology
 1XMQ T;  2UXB T;  4LFA T;  4JV5 T;  4OX9 T;  4DV4 T;  1I94 T;  4JI6 T;  1HNW T;  4DR1 T;  1HR0 T;  4DV2 T;  4B3S T;  4JI8 T;  2HHH T;  4JI5 T;  4X66 T;  4DV6 T;  4KHP T;  4YHH T;  5IWA T;  1N33 T;  1N34 T;  2VQE T;  2F4V T;  4DUZ T;  1XNR T;  4JI1 T;  4DR4 T;  1IBK T;  2UUB T;  4JI7 T;  1IBM T;  5BR8 T;  3T1Y T;  4LF5 T;  4JI3 T;  5LMU T;  4DUY T;  4LF6 T;  4X62 T;  2UU9 T;  4AQY T;  2UUA T;  3OTO T;  4DV0 T;  4GKJ T;  4YY3 T;  4JI2 T;  4DV5 T;  4K0K T;  4JYA T;  4X64 T;  1N36 T;  1XNQ T;  4DR5 T;  4DV3 T;  4NXN T;  2UXC T;  1IBL T;  4B3T T;  1HNX T;  2VQF T;  4LF9 T;  4X65 T;  4DR2 T;  2UUC T;  1XMO T;  2E5L T;  4B3M T;  4LF7 T;  4LFC T;  3T1H T;  4GKK T;  4DR3 T;  1J5E T;  1FJG T;  4DR6 T;  4JI0 T;  4LFB T;  5LMN T;  4DV7 T;  4DR7 T;  2UXD T;  4LF8 T;  2ZM6 T;  4DV1 T;  4JI4 T;  4NXM T;  1HNZ T;  1N32 T;  4B3R T;  4LF4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...