4LFCT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfcT00
2UXCT 1N32T 4B3TT 4JV5T 1FJGT 1HNZT 4JI3T 2F4VT 4DUYT 4DV6T 2UU9T 4B3MT 2HHHT 4YHHT 4DR4T 4LFAT 2UXDT 1N33T 4DV7T 4DV5T 4DV4T 3OTOT 1I94T 1HR0T 2ZM6T 4JYAT 4LFBT 2E5LT 4JI1T 4LF6T 4JI2T 1XNQT 1HNXT 4DUZT 4DV0T 4LF8T 1N36T 4DR2T 4LF9T 4DV2T 4DV3T 4DR3T 4DR6T 4X64T 3T1YT 1N34T 4JI4T 4LF5T 4LF4T 3T1HT 4X62T 1HNWT 2UUBT 4LFCT 1XMQT 4GKJT 4YY3T 4GKKT 5LMNT 1IBLT 2UXBT 4DR5T 5BR8T 4JI7T 1IBMT 4NXNT 1J5ET 4DR1T 5IWAT 4K0KT 1IBKT 4AQYT 4JI5T 2VQFT 2UUAT 4KHPT 4X65T 4OX9T 4LF7T 1XNRT 2UUCT 4X66T 4DV1T 1XMOT 4DR7T 4B3ST 4JI0T 4JI8T 5LMUT 4B3RT 2VQET 4JI6T 4NXMT
chains in the Genus database with same CATH superfamily
5H6QB 3UUNA 1R8IA 1N32T 2J62A 2OLTA 3PJAA 1V9DA 2YK0A 3T8OA 2Q9QA 3KV5A 4WYVA 5ABGA 4YJ2E 5CA1E 4IE0A 3E0ZA 2IHR1 3KV6A 2HPLA 5AQJB 2LT3A 4QXHB 2UXXB 3KV9A 4H9RC 4AXPA 1FEWA 1M62A 1GQEA 4IDQA 2CLYB 3RC3A 3UU3A 4F8HA 1HS7A 1FMWA 3ANWA 3B5MA 3KBTA 2X9HA 3JADA 2VKDA 3C98B 3CPZA 3M65A 3ZT6A 3FZHB 1OEDC 4UVBB 4BA9A 4UVAB 3RF1A 2X0HA 4IGUA 2WB5A 3PJAJ 1OEDB 4F6RC 2BBHA 4UEMA 5DQVA 4PK6A 2FBWA 2YEVC 4ILCA 4EYYR 1OWAA 1YXRA 2UXDT 4P0BA 4C90A 1KNZA 4O4LE 1LRZA 5JR9B 4QXCB 4YJ3E 1UX4A 4ADZA 1E1HB 1E2AA 1OEDA 2A72A 2E9XA 4DV5T 2JPFA 5FXZA 2BS4A 2IDOB 3FZLB 3LDQB 4H9NC 3CX8B 4WZXA 4X1KE 4MALA 3ZMVB 3Q5DA 4Z8XA 5AQOB 4YSXA 4LFBT 3DJBA 2WMNA 5CFBA 4QHOA 5LNKA 1BR0A 3AECA 5LG4A 3PU8A 4JI1T 3RKGA 4BJMA 1T7SA 1MMAA 2BVMA 4AKLA 5HEJA 3L09A 3K1SA 3K8PC 3F2EA 4TX5A 3G06A 3GMIA 4IL4A 5FL0A 5HEGA 2BG9A 1JNRA 4ZI2D 4ISTA 2QA7A 5FMNA 4KBMB 2M6IA 2IC9A 3CQGB 3DP7A 3FHNA 4HTEA 4TWHA 1WYCA 4UXNB 5DJQC 3B13A 4DIDB 3N9NA 3ZN1B 1ZKEA 5FY1A 5LGTB 1MMDA 3ZJ1A 4PK5A 4CXWA 3N9PA 4GK5E 3MACA 3UU5A 3RGLA 4AQFC 5JRCA 3EAMA 4DMVA 5AFUL 2XQ5A 1MMNA 3GN5B 2ES0A 2LOSA 1MIWA 2E2AA 4O2AE 3RIUC 4X62T 3T1YT 1HX1B 4LFCT 5F8PA 3UU6A 4KI0F 1XMQT 1EZ3A 2DHRA 1BR1A 3P4RA 4AKHA 4CN6A 4PJNA 3FZFB 3TLWA 3ZMZB 3UU8A 2IC6A 4E7ZA 4GKKT 1U4QA 3AE4A 5HXSA 3MZKB 2A9UA 1IBLT 3NZPA 2BS3A 5HWYA 3I0OA 3N9QA 2X9WA 3AEFA 3AVSA 3UTKA 3VU7H 3FZMB 5KX5E 4JYAT 4HFBA 2Q9QD 3FBZA 1W0AA 3HKEE 5GONE 2LHRA 5JDFA 1HTJF 1LKXA 3AA1B 1UCUA 3AE2A 2LSJA 1J5ET 4NXNT 3ZYMA 4DR1T 5FXXA 1YKEB 2CPTA 4ZZCA 4ZEYA 1BR2A 4IL9A 1G8XA 3AE1A 1VRBA 5EK3A 3JAEA 5EZYE 2V6YA 2YU1A 5AQMB 3ZJ2A 5LHIB 4OYKA 3PUXF 5C8YE 5HXRA 2NTYA 1KNPA 3ANWB 1XDPA 2CMRA 2FJBA 2K24A 2X0YA 3FBLA 3I1AA 3PDYA 2VKJA 4WW0A 4P09A 4CXYA 3VKGA 3ZMTB 2V6YB 2XQ3A 2CWYA 1W9RA 3P8CD 2VASA 2LOPA 4X66T 4DV1T 2WMOA 2CXDA 4ILBA 5DABA 5IUXA 4PJMA 3ZSTA 1HX8A 3V5SA 1LVKA 2YDRA 4NUVA 2PFVA 4ZI7E 1UUSA 5ABEA 5C2TA 4B3ST 2WDRA 2C5KT 2CBJA 1FMVA 2E9XB 4EZ4A 1NAFA 3AVRA 5L4HA 5LMUT 1MNEA 5EK2A 3CX6B 3RRWA 2MPKA 3H37A 4EEBA 2Z6EA 2PG8A 4PJJA 4QX7B 5IHYA 2V5DA 5AQGB 1SHZC 2E9XC 2WWUA 2VQET 3LK42 1IAPA 4NXMT 1XWMA 2YDQA 4O2BE 2XQ9A 4A56A 3ZCIA 2H89A 3RRCA 2XHEB 4IREA 3RQWA 1NENA 1D0YA 2CCQA 2WS3A 2BG9B 3VR8A 3A5XA 2D9DA 3CQCB 2P9BA 2N2NA 4YTNA 4TV8E 2OV9A 4JEHB 4DUYT 3UULA 5F5WA 2XAGB 4XZCA 3QUJA 2CWOA 1KK7A 2N9DA 4QH4A 2LM9A 2JQQA 3OKQA 2XSAA 3P7IA 4CXXA 3RLFF 2HHHT 5JRCB 4DR4T 4U33A 2K3WA 3AA0B 1KEYA 2NOXA 3N9LA 2FJDA 2IMLA 4HGAA 4OYJA 3NZQA 4AISA 1J1JA 2J4GA 2Y8DA 4AKRB 5JDNA 1N33T 1YD8G 4K0KT 2L8KA 2C5JA 2Y48B 3SFDA 4X64T 4OFZA 1T8BA 4Z90A 4H63V 4DV4T 3I9WA 3ZCJA 3PUAA 2D5UA 3L3PA 3VR9A 1ZOYA 1D1BA 2ODVA 3PUQA 2ZLYA 3EI0A 5FKYA 5FYMA 5LOVE 4CI3B 5KXJA 5L3DB 5LP6E 3M3ZB 2WBLA 1G73A 1MIVA 2V7IA 3CK6A 3RYFE 3V5UA 4ZHQE 2FJAA 2MYSA 2KMFA 4V1Av 5HWXA 2QVAA 4N78D 4JI2T 1XNQT 4UV9B 4KP3C 2YU2A 2CEAA 1KFYA 2EHOD 3HA4A 4LMJA 2E8IA 2NR4A 3AE5A 4BAYB 2V7LA 4DUZT 1N36T 1E7PA 3J7Yq 3WAKA 4LF9T 2BKNA 4O4IE 1W09A 3R84B 5HXHA 4ASKA 2CE7A 4ILAA 5FVKA 4AQGA 3ONJA 4B6XA 4DMWA 5J2UE 2CHOA 2W66A 3HKDE 1OEDE 4IDOA 4IT4A 1NEKA 3P4PA 3N9OA 4IE5A 4KX6A 4YTPA 2BZBA 5ADXL 5AQUB 1CHUA 4EIWA 4LF5T 2FUPA 2HN1A 4LF4T 4HE8A 4ZOLE 2X9YA 3LSVA 3TLTA 4C91A 4PK4A 4UV8B 3T1HT 3N2GE 1HNWT 2UUBT 4YTMA 4A5XA 3PURA 3SRZA 2G0UA 2LKGA 4HFIA 5FY7A 3EVYA 5AQIB 3TLSA 3N2KE 2ACZA 2CLYC 2JQKA 2MTQA 3W15B 3I0QA 3Q5XA 3RH3A 3ZPOA 4AKGA 3AE8A 1ZV4X 3WAJA 5HCMA 4IE6A 4YY3T 4DR6T 3H3AA 3QB5A 2XAJB 3ETVA 5LMNT 1QSDA 2MOZA 1HFAA 5L3EB 5BR8T 2WZIA 4I43B 2VKHA 3ABVA 4DO0A 2FJEA 1IBMT 3IEEA 2JQHA 4GK0E 5ABFA 3UFGA 2VURA 4TNVA 3ZYKA 5LJMA 3ZC0A 4IIJE 4ZS3A 4MFRA 3KINB 5JR9C 2JIWA 2DLRA 3RIUA 3SOLA 4EZHA 5ABFB 2DI4A 4U7IA 1QUUA 3AE3A 4HWIB 2QRXA 2UXNB 3KDSE 1B7TA 3O9XA 4JLEA 2V7KA 5CB4E 2I59A 2UUAT 2MBGA 3P50A 4PFOA 4JUYA 3S4UA 2VWAA 3LK3B 2X0LB 3RYIE 2GK9A 3PTRB 3N9MA 4ZS2A 5AQSB 2IUBA 2XASB 4QH1A 2UUCT 1I6ZA 2R6GF 2V26A 3OYZA 4IE4A 1D1AA 2LRKA 2WU5A 5AQFB 1IJ6A 1BR4A 4TZ4C 3Q9DA 2CBIA 2LJLA 3RKOA 2LSGA 2WSSV 4NIQA 4X5TA 3AEDA 4AKIA 2ZMAA 1VCSA 4JI8T 3KVBA 5TAOA 4CI2B 2K48A 4EV6A 4HWHA 4B3RT 3UUXB 4CQIA 4YXDA 3BQIA 4QXBB 2XUEA 1T98A 2PBIA 4EB6E 3LG7A 1HG5A 4UVCB 4I0UA 4HWFA 2I0MA 2AXDS 2PJQA 1Y01A 3NVOA 2WU2A 2UXCT 2XQ7A 3RIAA 4HWDA 4QKNA 3ZMUB 2XM1A 3Q5WA 3FZKB 4PW8A 5C3JA 3OJAA 5FP3A 5J2TE 4B3TT 2ZM0A 3KV4A 4JV5T 2LM2A 3A7MA 2XQ6A 3JC6C 1H7CA 4XBFB 2XAFB 2F4VT 3JAFA 4L5GA 2VL8A 3NWIA 4CI1B 2DWKA 1UURA 5HEOA 2E5VA 2HN2A 3AE6A 4X1IE 5AQVB 2LSYA 2X68A 5AQNB 4EAHA 4DV6T 1O3XA 1ZHCA 3BK9A 2LSKA 4YHHT 1MMGA 2HH7A 3BQLA 4M1PA 3E22E 4LFAT 1WFDA 2L3LA 4DVDA 2IIUA 3P4WA 3FXDB 2XM2A 3AEAA 3C4XA 3C64A 3QK6A 1CUNA 4PNIA 2WZHA 2YN6A 4UIGA 5AQTB 5LA6E 3ZEFB 5M4YA 4ANJA 4DV7T 3K3OA 2X66A 3OTOT 4ILUA 2XZEA 1ZP0A 1I94T 1M7KA 2YDSA 4U2YA 2LKHA 1HR0T 2CRBA 2ZM6T 2WP9A 2KXPB 5FXVA 2WCAA 1HF8A 4IDNA 4O8SA 3U3IA 4DNDA 4ZZBA 2XQ4A 1VOMA 2JQ9A 4A98A 3AAAB 4EGWA 3OYXA 3OPCA 3RYCE 2E5LT 4U2ZA 3O1HA 2W00A 1D1CA 5L3BB 3EDUA 1DU2A 3PUGA 1WYBA 5AQQB 5L4EA 1HNXT 3C51A 4TN7B 1UGOA 1YQ3A 4P1NA 3HKCE 2EHOA 2XQ8A 3J9X1 5L3FB 4O4HE 4LF8T 1WR0A 4IDZA 4DR2T 4MBQA 3L8RA 5CA0E 4DV2T 5HEHA 2OA5A 4FJOA 4CN4A 4DV3T 2LEHA 2JJ9A 3EHZA 2RPAA 2XSBA 3HR0A 4IDPA 5JH7E 4A97A 2WDQA 5LBMA 5JQGE 5JTGA 4L0RA 5JREA 1XZYA 4DR3T 1WCRA 3UQ4A 1N34T 2KLQA 4H9PC 2C0SA 2CA5A 2LRLA 4KHZF 5CJ5A 1X79A 4TWDA 4DBQA 3RYHE 2DWGA 1D0XA 3F57A 5IYZE 3CIRA 1UK5A 3AA7B 2WY2A 2LSIA 3ZN0B 3AB3B 5ABHA 4HFDA 4WBOA 3ZLIA 2J47A 4JEUB 3EDVA 5HEUA 5LJNA 2Y6XA 2M6BA 3LK2B 3AAIA 3AE9A 5LB7B 5AQHB 2CM0A 3MXZA 2E9XD 2X9XA 1KNRA 2SPCA 2XTLA 5JDHA 4JI7T 4LMKA 1Y64B 4H9QC 5EK4A 2CHNA 2BG9C 2BKOA 2NTXA 3PUYF 5FL1A 2XAQB 3QOFA 4YHJA 5J0ZA 2L9QA 2WQYA 4I55E 3UFEA 3RQUA 5LHHB 4LMLA 5DQWA 3BQKA 1HG2A 5HXEA 2BS2A 4H63H 2V8SV 3C50A 2CXLA 4AQYT 2NW7A 4GYSA 3PV0F 3U78A 3UT5E 2VQFT 2H7VC 2KWIB 2W63A 5AQPB 5A1LA 3KBUA 2K5BB 2VB6A 4ZXLA 4ZI3C 4K0UA 3VHLA 5ETWA 4YSYA 1JNZA 3C4ZA 5FVLA 2NW9A 4X65T 2KWHA 1D0ZA 4ISSA 4U7YA 2DNXA 5F3JA 5JDMA 4OX9T 2WAUA 4EOZB 2LHNA 4LF7T 5L3GB 4XAXB 3NBXX 3A8YC 1VCTA 3RC8A 4YSZA 1WRDA 1X9BA 5KMGP 5HYAA 2DCFA 1SA0E 3L39A 2YINA 3GWHA 5FXWA 3FXEB 4WNKA 2VK9A 3B57A 2CXFA 3O1JA 4KUMB 2HPJA 5HAXA 3AEBA 4KMCA 2LLYA 3LBXA 1L0VA 4JI0T 3N5LA 3HL6A 4G2AA 4NUUA 2W61A 3C4WA 5LYJE 3IHRA 2J1DG 1MNDA 2XQYA 4FI5A 5JDQA 3ESLA 2NWBA 3SS1A 4JI6T 4J2CA 2W4XA 1YKHB 2Q9QC 2XPKA 4HFHA 1SE7A 4E7SA 3Q5EA 2JMKA 2UXBT 2ZM8A 3AE7A 3EUHA 3IF8B 3VKHA 2EHOC 5HXCA 5L2LA 4UF0B 3ZKRA 2JRKA 2EHOB 3TLVA 3MKDA 5FY0A 3ZMSB 1FJGT 1HNZT 5AQLB 4JI3T 2W2UA 4JBWF 2KNDA 1KF6A 4UF0A 4DBRA 3TKLB 2VKOA 4U72A 4HFCA 1WLXA 3AEGA 2UU9T 2N1GA 2ACXA 4B3MT 4GOUA 3KFWX 5LCYA 3TLUA 3ZT5A 3ONLC 5LGUB 1XDOA 3CKDA 1Z8UA 4WBNE 2H3RA 4H9OC 2KSRA 2W0GA 3K3QC 3NKZA 3RX6A 4YT0A 5BMVE 2WDVA 3SFEA 4OHFA 5CGMA 2V7MA 3GA8A 4H9SE 3OBVE 5AQKB 1NWMX 3N2OA 4HFVA 3ZSSA 3JC6D 5L3CB 3PE0A 2LE8A 2RP4A 3K3NA 4ERRA 3ONXA 2D0UA 2ZM2A 2IAKA 4QWNB 2BG9E 4PJLA 3MJXA 4COFA 4LF6T 3VRAA 3AEEA 3FB2A 3ETUA 3QNUA 2V5CA 4Z91A 2VVSA 5H6RB 2H88A 2VVNA 2WM9A 2YOEA 1T72A 2B1EA 3AA6B 5JDLA 4DV0T 5L47A 3KVAA 2BKPA 3ZT7A 4GYRA 3CVRA 5JVDE 1LVFA 1AJ3A 2QGSA 1IJ5A 2QYWA 1SUMB 2XY8B 2X51A 3HKBE 1OXZA 4HEAA 2PTFA 5HCJA 2V6XA 2ODUA 4ZI3D 1UX5A 2VL0A 2W62A 2H7OA 1J5WA 5J1GA 3Q2MA 4JI4T 3AAEB 4HFEA 4PFPA 2KINB 3IA3A 3F31A 1YW0A 3LFMA 3NRXA 3IBPA 3QB5K 3UUMA 3PU3A 4YLHA 4P0AA 5JR9A 3UU4A 2WWVA 3UUBA 4IHJE 1FIOA 3MA9A 3RIFA 3NRYA 4O4JE 4QH5A 1ZEEA 3CMLA 1MIYA 1U5PA 3QC9A 4L9IA 4GKJT 4NPPA 4UELA 2V7JA 3LBXB 2YKSA 2V1DB 3EABA 3HI2A 3P4QA 3PUZF 4AI6A 3MK7C 3RPUA 5LHGB 4DR5T 3ZYLA 4UR9A 5JDGA 1W0BA 4GIWA 4HKAA 5LXTE 4TWFA 4EXTA 2BVLA 2BDEA 1IZNB 2B76A 1S35A 2NW8A 2X67A 5IWAT 5FNVE 3WI3A 3X1DA 3UQ7A 4CZZB 4I4TE 4JI5T 4I50E 3LJCA 3RHWA 5LG3A 3ZC1A 2XQAA 2C5IT 4X20E 2A2FX 3O1IA 1QLBA 4Q25A 2IW5B 1US7B 4KHPT 2D0TA 4X1YE 2KT9A 2D2SA 4QX8B 4OK0A 4U31A 3OVUA 4G63A 4U3CA 2XJ7A 4PAGA 4AIUA 4MHCA 2RA1A 3PUSA 2KZ7B 3CWZB 3PUWF 2A3DA 4TNWA 1XNRT 5E0OA 3GN5A 4CN1A 2AE9A 3VRBA 2DL1A 2MAWA 4U74A 4TV9E 1WR6A 4BJNA 4HN9A 3D0TA 2M67A 3CQXC 3P4SA 5LBQB 1XMOT 1IBKT 4AQFA 4MLKA 4IE7A 5KDMC 4TUYE 4EEDA 4DR7T 2BBJA 4EYUA 3AXJA 3H3MA 2XAHB 3PUVF 2NP9A 4HWCA 3SWHA 3O4XE 3E08A 2I6HA 2W67A 3JCFA 5AQRB 3I9YA 1HCIA 3RI5A 1YQ4A 2Q9QB 1Z0PA 3AXJB 3CX7B 2JMHA 1S94A 3DTOA 5LGNB 2K9AA 4YFSA 3R6NA 4ZI2C
chains in the Genus database with same CATH topology
2UXCT 1N32T 4B3TT 4JV5T 1FJGT 1HNZT 4JI3T 2F4VT 4DUYT 4DV6T 2UU9T 4B3MT 2HHHT 4YHHT 4DR4T 4LFAT 2UXDT 1N33T 4DV7T 4DV5T 4DV4T 3OTOT 1I94T 1HR0T 2ZM6T 4JYAT 4LFBT 2E5LT 4JI1T 4LF6T 4JI2T 1XNQT 1HNXT 4DUZT 4DV0T 4LF8T 1N36T 4DR2T 4LF9T 4DV2T 4DV3T 4DR3T 4DR6T 4X64T 3T1YT 1N34T 4JI4T 4LF5T 4LF4T 3T1HT 4X62T 1HNWT 2UUBT 4LFCT 1XMQT 4GKJT 4YY3T 4GKKT 5LMNT 1IBLT 2UXBT 4DR5T 5BR8T 4JI7T 1IBMT 4NXNT 1J5ET 4DR1T 5IWAT 4K0KT 1IBKT 4AQYT 4JI5T 2VQFT 2UUAT 4KHPT 4X65T 4OX9T 4LF7T 1XNRT 2UUCT 4X66T 4DV1T 1XMOT 4DR7T 4B3ST 4JI0T 4JI8T 5LMUT 4B3RT 2VQET 4JI6T 4NXMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC T;  1N32 T;  4B3T T;  4JV5 T;  1FJG T;  1HNZ T;  4JI3 T;  2F4V T;  4DUY T;  4DV6 T;  2UU9 T;  4B3M T;  2HHH T;  4YHH T;  4DR4 T;  4LFA T;  2UXD T;  1N33 T;  4DV7 T;  4DV5 T;  4DV4 T;  3OTO T;  1I94 T;  1HR0 T;  2ZM6 T;  4JYA T;  4LFB T;  2E5L T;  4JI1 T;  4LF6 T;  4JI2 T;  1XNQ T;  1HNX T;  4DUZ T;  4DV0 T;  4LF8 T;  1N36 T;  4DR2 T;  4LF9 T;  4DV2 T;  4DV3 T;  4DR3 T;  4DR6 T;  4X64 T;  3T1Y T;  1N34 T;  4JI4 T;  4LF5 T;  4LF4 T;  3T1H T;  4X62 T;  1HNW T;  2UUB T;  4LFC T;  1XMQ T;  4GKJ T;  4YY3 T;  4GKK T;  5LMN T;  1IBL T;  2UXB T;  4DR5 T;  5BR8 T;  4JI7 T;  1IBM T;  4NXN T;  1J5E T;  4DR1 T;  5IWA T;  4K0K T;  1IBK T;  4AQY T;  4JI5 T;  2VQF T;  2UUA T;  4KHP T;  4X65 T;  4OX9 T;  4LF7 T;  1XNR T;  2UUC T;  4X66 T;  4DV1 T;  1XMO T;  4DR7 T;  4B3S T;  4JI0 T;  4JI8 T;  5LMU T;  4B3R T;  2VQE T;  4JI6 T;  4NXM T; 
#chains in the Genus database with same CATH topology
 5H6Q B;  3UUN A;  1R8I A;  1N32 T;  2J62 A;  2OLT A;  3PJA A;  1V9D A;  2YK0 A;  3T8O A;  2Q9Q A;  3KV5 A;  4WYV A;  5ABG A;  4YJ2 E;  5CA1 E;  4IE0 A;  3E0Z A;  2IHR 1;  3KV6 A;  2HPL A;  5AQJ B;  2LT3 A;  4QXH B;  2UXX B;  3KV9 A;  4H9R C;  4AXP A;  1FEW A;  1M62 A;  1GQE A;  4IDQ A;  2CLY B;  3RC3 A;  3UU3 A;  4F8H A;  1HS7 A;  1FMW A;  3ANW A;  3B5M A;  3KBT A;  2X9H A;  3JAD A;  2VKD A;  3C98 B;  3CPZ A;  3M65 A;  3ZT6 A;  3FZH B;  1OED C;  4UVB B;  4BA9 A;  4UVA B;  3RF1 A;  2X0H A;  4IGU A;  2WB5 A;  3PJA J;  1OED B;  4F6R C;  2BBH A;  4UEM A;  5DQV A;  4PK6 A;  2FBW A;  2YEV C;  4ILC A;  4EYY R;  1OWA A;  1YXR A;  2UXD T;  4P0B A;  4C90 A;  1KNZ A;  4O4L E;  1LRZ A;  5JR9 B;  4QXC B;  4YJ3 E;  1UX4 A;  4ADZ A;  1E1H B;  1E2A A;  1OED A;  2A72 A;  2E9X A;  4DV5 T;  2JPF A;  5FXZ A;  2BS4 A;  2IDO B;  3FZL B;  3LDQ B;  4H9N C;  3CX8 B;  4WZX A;  4X1K E;  4MAL A;  3ZMV B;  3Q5D A;  4Z8X A;  5AQO B;  4YSX A;  4LFB T;  3DJB A;  2WMN A;  5CFB A;  4QHO A;  5LNK A;  1BR0 A;  3AEC A;  5LG4 A;  3PU8 A;  4JI1 T;  3RKG A;  4BJM A;  1T7S A;  1MMA A;  2BVM A;  4AKL A;  5HEJ A;  3L09 A;  3K1S A;  3K8P C;  3F2E A;  4TX5 A;  3G06 A;  3GMI A;  4IL4 A;  5FL0 A;  5HEG A;  2BG9 A;  1JNR A;  4ZI2 D;  4IST A;  2QA7 A;  5FMN A;  4KBM B;  2M6I A;  2IC9 A;  3CQG B;  3DP7 A;  3FHN A;  4HTE A;  4TWH A;  1WYC A;  4UXN B;  5DJQ C;  3B13 A;  4DID B;  3N9N A;  3ZN1 B;  1ZKE A;  5FY1 A;  5LGT B;  1MMD A;  3ZJ1 A;  4PK5 A;  4CXW A;  3N9P A;  4GK5 E;  3MAC A;  3UU5 A;  3RGL A;  4AQF C;  5JRC A;  3EAM A;  4DMV A;  5AFU L;  2XQ5 A;  1MMN A;  3GN5 B;  2ES0 A;  2LOS A;  1MIW A;  2E2A A;  4O2A E;  3RIU C;  4X62 T;  3T1Y T;  1HX1 B;  4LFC T;  5F8P A;  3UU6 A;  4KI0 F;  1XMQ T;  1EZ3 A;  2DHR A;  1BR1 A;  3P4R A;  4AKH A;  4CN6 A;  4PJN A;  3FZF B;  3TLW A;  3ZMZ B;  3UU8 A;  2IC6 A;  4E7Z A;  4GKK T;  1U4Q A;  3AE4 A;  5HXS A;  3MZK B;  2A9U A;  1IBL T;  3NZP A;  2BS3 A;  5HWY A;  3I0O A;  3N9Q A;  2X9W A;  3AEF A;  3AVS A;  3UTK A;  3VU7 H;  3FZM B;  5KX5 E;  4JYA T;  4HFB A;  2Q9Q D;  3FBZ A;  1W0A A;  3HKE E;  5GON E;  2LHR A;  5JDF A;  1HTJ F;  1LKX A;  3AA1 B;  1UCU A;  3AE2 A;  2LSJ A;  1J5E T;  4NXN T;  3ZYM A;  4DR1 T;  5FXX A;  1YKE B;  2CPT A;  4ZZC A;  4ZEY A;  1BR2 A;  4IL9 A;  1G8X A;  3AE1 A;  1VRB A;  5EK3 A;  3JAE A;  5EZY E;  2V6Y A;  2YU1 A;  5AQM B;  3ZJ2 A;  5LHI B;  4OYK A;  3PUX F;  5C8Y E;  5HXR A;  2NTY A;  1KNP A;  3ANW B;  1XDP A;  2CMR A;  2FJB A;  2K24 A;  2X0Y A;  3FBL A;  3I1A A;  3PDY A;  2VKJ A;  4WW0 A;  4P09 A;  4CXY A;  3VKG A;  3ZMT B;  2V6Y B;  2XQ3 A;  2CWY A;  1W9R A;  3P8C D;  2VAS A;  2LOP A;  4X66 T;  4DV1 T;  2WMO A;  2CXD A;  4ILB A;  5DAB A;  5IUX A;  4PJM A;  3ZST A;  1HX8 A;  3V5S A;  1LVK A;  2YDR A;  4NUV A;  2PFV A;  4ZI7 E;  1UUS A;  5ABE A;  5C2T A;  4B3S T;  2WDR A;  2C5K T;  2CBJ A;  1FMV A;  2E9X B;  4EZ4 A;  1NAF A;  3AVR A;  5L4H A;  5LMU T;  1MNE A;  5EK2 A;  3CX6 B;  3RRW A;  2MPK A;  3H37 A;  4EEB A;  2Z6E A;  2PG8 A;  4PJJ A;  4QX7 B;  5IHY A;  2V5D A;  5AQG B;  1SHZ C;  2E9X C;  2WWU A;  2VQE T;  3LK4 2;  1IAP A;  4NXM T;  1XWM A;  2YDQ A;  4O2B E;  2XQ9 A;  4A56 A;  3ZCI A;  2H89 A;  3RRC A;  2XHE B;  4IRE A;  3RQW A;  1NEN A;  1D0Y A;  2CCQ A;  2WS3 A;  2BG9 B;  3VR8 A;  3A5X A;  2D9D A;  3CQC B;  2P9B A;  2N2N A;  4YTN A;  4TV8 E;  2OV9 A;  4JEH B;  4DUY T;  3UUL A;  5F5W A;  2XAG B;  4XZC A;  3QUJ A;  2CWO A;  1KK7 A;  2N9D A;  4QH4 A;  2LM9 A;  2JQQ A;  3OKQ A;  2XSA A;  3P7I A;  4CXX A;  3RLF F;  2HHH T;  5JRC B;  4DR4 T;  4U33 A;  2K3W A;  3AA0 B;  1KEY A;  2NOX A;  3N9L A;  2FJD A;  2IML A;  4HGA A;  4OYJ A;  3NZQ A;  4AIS A;  1J1J A;  2J4G A;  2Y8D A;  4AKR B;  5JDN A;  1N33 T;  1YD8 G;  4K0K T;  2L8K A;  2C5J A;  2Y48 B;  3SFD A;  4X64 T;  4OFZ A;  1T8B A;  4Z90 A;  4H63 V;  4DV4 T;  3I9W A;  3ZCJ A;  3PUA A;  2D5U A;  3L3P A;  3VR9 A;  1ZOY A;  1D1B A;  2ODV A;  3PUQ A;  2ZLY A;  3EI0 A;  5FKY A;  5FYM A;  5LOV E;  4CI3 B;  5KXJ A;  5L3D B;  5LP6 E;  3M3Z B;  2WBL A;  1G73 A;  1MIV A;  2V7I A;  3CK6 A;  3RYF E;  3V5U A;  4ZHQ E;  2FJA A;  2MYS A;  2KMF A;  4V1A v;  5HWX A;  2QVA A;  4N78 D;  4JI2 T;  1XNQ T;  4UV9 B;  4KP3 C;  2YU2 A;  2CEA A;  1KFY A;  2EHO D;  3HA4 A;  4LMJ A;  2E8I A;  2NR4 A;  3AE5 A;  4BAY B;  2V7L A;  4DUZ T;  1N36 T;  1E7P A;  3J7Y q;  3WAK A;  4LF9 T;  2BKN A;  4O4I E;  1W09 A;  3R84 B;  5HXH A;  4ASK A;  2CE7 A;  4ILA A;  5FVK A;  4AQG A;  3ONJ A;  4B6X A;  4DMW A;  5J2U E;  2CHO A;  2W66 A;  3HKD E;  1OED E;  4IDO A;  4IT4 A;  1NEK A;  3P4P A;  3N9O A;  4IE5 A;  4KX6 A;  4YTP A;  2BZB A;  5ADX L;  5AQU B;  1CHU A;  4EIW A;  4LF5 T;  2FUP A;  2HN1 A;  4LF4 T;  4HE8 A;  4ZOL E;  2X9Y A;  3LSV A;  3TLT A;  4C91 A;  4PK4 A;  4UV8 B;  3T1H T;  3N2G E;  1HNW T;  2UUB T;  4YTM A;  4A5X A;  3PUR A;  3SRZ A;  2G0U A;  2LKG A;  4HFI A;  5FY7 A;  3EVY A;  5AQI B;  3TLS A;  3N2K E;  2ACZ A;  2CLY C;  2JQK A;  2MTQ A;  3W15 B;  3I0Q A;  3Q5X A;  3RH3 A;  3ZPO A;  4AKG A;  3AE8 A;  1ZV4 X;  3WAJ A;  5HCM A;  4IE6 A;  4YY3 T;  4DR6 T;  3H3A A;  3QB5 A;  2XAJ B;  3ETV A;  5LMN T;  1QSD A;  2MOZ A;  1HFA A;  5L3E B;  5BR8 T;  2WZI A;  4I43 B;  2VKH A;  3ABV A;  4DO0 A;  2FJE A;  1IBM T;  3IEE A;  2JQH A;  4GK0 E;  5ABF A;  3UFG A;  2VUR A;  4TNV A;  3ZYK A;  5LJM A;  3ZC0 A;  4IIJ E;  4ZS3 A;  4MFR A;  3KIN B;  5JR9 C;  2JIW A;  2DLR A;  3RIU A;  3SOL A;  4EZH A;  5ABF B;  2DI4 A;  4U7I A;  1QUU A;  3AE3 A;  4HWI B;  2QRX A;  2UXN B;  3KDS E;  1B7T A;  3O9X A;  4JLE A;  2V7K A;  5CB4 E;  2I59 A;  2UUA T;  2MBG A;  3P50 A;  4PFO A;  4JUY A;  3S4U A;  2VWA A;  3LK3 B;  2X0L B;  3RYI E;  2GK9 A;  3PTR B;  3N9M A;  4ZS2 A;  5AQS B;  2IUB A;  2XAS B;  4QH1 A;  2UUC T;  1I6Z A;  2R6G F;  2V26 A;  3OYZ A;  4IE4 A;  1D1A A;  2LRK A;  2WU5 A;  5AQF B;  1IJ6 A;  1BR4 A;  4TZ4 C;  3Q9D A;  2CBI A;  2LJL A;  3RKO A;  2LSG A;  2WSS V;  4NIQ A;  4X5T A;  3AED A;  4AKI A;  2ZMA A;  1VCS A;  4JI8 T;  3KVB A;  5TAO A;  4CI2 B;  2K48 A;  4EV6 A;  4HWH A;  4B3R T;  3UUX B;  4CQI A;  4YXD A;  3BQI A;  4QXB B;  2XUE A;  1T98 A;  2PBI A;  4EB6 E;  3LG7 A;  1HG5 A;  4UVC B;  4I0U A;  4HWF A;  2I0M A;  2AXD S;  2PJQ A;  1Y01 A;  3NVO A;  2WU2 A;  2UXC T;  2XQ7 A;  3RIA A;  4HWD A;  4QKN A;  3ZMU B;  2XM1 A;  3Q5W A;  3FZK B;  4PW8 A;  5C3J A;  3OJA A;  5FP3 A;  5J2T E;  4B3T T;  2ZM0 A;  3KV4 A;  4JV5 T;  2LM2 A;  3A7M A;  2XQ6 A;  3JC6 C;  1H7C A;  4XBF B;  2XAF B;  2F4V T;  3JAF A;  4L5G A;  2VL8 A;  3NWI A;  4CI1 B;  2DWK A;  1UUR A;  5HEO A;  2E5V A;  2HN2 A;  3AE6 A;  4X1I E;  5AQV B;  2LSY A;  2X68 A;  5AQN B;  4EAH A;  4DV6 T;  1O3X A;  1ZHC A;  3BK9 A;  2LSK A;  4YHH T;  1MMG A;  2HH7 A;  3BQL A;  4M1P A;  3E22 E;  4LFA T;  1WFD A;  2L3L A;  4DVD A;  2IIU A;  3P4W A;  3FXD B;  2XM2 A;  3AEA A;  3C4X A;  3C64 A;  3QK6 A;  1CUN A;  4PNI A;  2WZH A;  2YN6 A;  4UIG A;  5AQT B;  5LA6 E;  3ZEF B;  5M4Y A;  4ANJ A;  4DV7 T;  3K3O A;  2X66 A;  3OTO T;  4ILU A;  2XZE A;  1ZP0 A;  1I94 T;  1M7K A;  2YDS A;  4U2Y A;  2LKH A;  1HR0 T;  2CRB A;  2ZM6 T;  2WP9 A;  2KXP B;  5FXV A;  2WCA A;  1HF8 A;  4IDN A;  4O8S A;  3U3I A;  4DND A;  4ZZB A;  2XQ4 A;  1VOM A;  2JQ9 A;  4A98 A;  3AAA B;  4EGW A;  3OYX A;  3OPC A;  3RYC E;  2E5L T;  4U2Z A;  3O1H A;  2W00 A;  1D1C A;  5L3B B;  3EDU A;  1DU2 A;  3PUG A;  1WYB A;  5AQQ B;  5L4E A;  1HNX T;  3C51 A;  4TN7 B;  1UGO A;  1YQ3 A;  4P1N A;  3HKC E;  2EHO A;  2XQ8 A;  3J9X 1;  5L3F B;  4O4H E;  4LF8 T;  1WR0 A;  4IDZ A;  4DR2 T;  4MBQ A;  3L8R A;  5CA0 E;  4DV2 T;  5HEH A;  2OA5 A;  4FJO A;  4CN4 A;  4DV3 T;  2LEH A;  2JJ9 A;  3EHZ A;  2RPA A;  2XSB A;  3HR0 A;  4IDP A;  5JH7 E;  4A97 A;  2WDQ A;  5LBM A;  5JQG E;  5JTG A;  4L0R A;  5JRE A;  1XZY A;  4DR3 T;  1WCR A;  3UQ4 A;  1N34 T;  2KLQ A;  4H9P C;  2C0S A;  2CA5 A;  2LRL A;  4KHZ F;  5CJ5 A;  1X79 A;  4TWD A;  4DBQ A;  3RYH E;  2DWG A;  1D0X A;  3F57 A;  5IYZ E;  3CIR A;  1UK5 A;  3AA7 B;  2WY2 A;  2LSI A;  3ZN0 B;  3AB3 B;  5ABH A;  4HFD A;  4WBO A;  3ZLI A;  2J47 A;  4JEU B;  3EDV A;  5HEU A;  5LJN A;  2Y6X A;  2M6B A;  3LK2 B;  3AAI A;  3AE9 A;  5LB7 B;  5AQH B;  2CM0 A;  3MXZ A;  2E9X D;  2X9X A;  1KNR A;  2SPC A;  2XTL A;  5JDH A;  4JI7 T;  4LMK A;  1Y64 B;  4H9Q C;  5EK4 A;  2CHN A;  2BG9 C;  2BKO A;  2NTX A;  3PUY F;  5FL1 A;  2XAQ B;  3QOF A;  4YHJ A;  5J0Z A;  2L9Q A;  2WQY A;  4I55 E;  3UFE A;  3RQU A;  5LHH B;  4LML A;  5DQW A;  3BQK A;  1HG2 A;  5HXE A;  2BS2 A;  4H63 H;  2V8S V;  3C50 A;  2CXL A;  4AQY T;  2NW7 A;  4GYS A;  3PV0 F;  3U78 A;  3UT5 E;  2VQF T;  2H7V C;  2KWI B;  2W63 A;  5AQP B;  5A1L A;  3KBU A;  2K5B B;  2VB6 A;  4ZXL A;  4ZI3 C;  4K0U A;  3VHL A;  5ETW A;  4YSY A;  1JNZ A;  3C4Z A;  5FVL A;  2NW9 A;  4X65 T;  2KWH A;  1D0Z A;  4ISS A;  4U7Y A;  2DNX A;  5F3J A;  5JDM A;  4OX9 T;  2WAU A;  4EOZ B;  2LHN A;  4LF7 T;  5L3G B;  4XAX B;  3NBX X;  3A8Y C;  1VCT A;  3RC8 A;  4YSZ A;  1WRD A;  1X9B A;  5KMG P;  5HYA A;  2DCF A;  1SA0 E;  3L39 A;  2YIN A;  3GWH A;  5FXW A;  3FXE B;  4WNK A;  2VK9 A;  3B57 A;  2CXF A;  3O1J A;  4KUM B;  2HPJ A;  5HAX A;  3AEB A;  4KMC A;  2LLY A;  3LBX A;  1L0V A;  4JI0 T;  3N5L A;  3HL6 A;  4G2A A;  4NUU A;  2W61 A;  3C4W A;  5LYJ E;  3IHR A;  2J1D G;  1MND A;  2XQY A;  4FI5 A;  5JDQ A;  3ESL A;  2NWB A;  3SS1 A;  4JI6 T;  4J2C A;  2W4X A;  1YKH B;  2Q9Q C;  2XPK A;  4HFH A;  1SE7 A;  4E7S A;  3Q5E A;  2JMK A;  2UXB T;  2ZM8 A;  3AE7 A;  3EUH A;  3IF8 B;  3VKH A;  2EHO C;  5HXC A;  5L2L A;  4UF0 B;  3ZKR A;  2JRK A;  2EHO B;  3TLV A;  3MKD A;  5FY0 A;  3ZMS B;  1FJG T;  1HNZ T;  5AQL B;  4JI3 T;  2W2U A;  4JBW F;  2KND A;  1KF6 A;  4UF0 A;  4DBR A;  3TKL B;  2VKO A;  4U72 A;  4HFC A;  1WLX A;  3AEG A;  2UU9 T;  2N1G A;  2ACX A;  4B3M T;  4GOU A;  3KFW X;  5LCY A;  3TLU A;  3ZT5 A;  3ONL C;  5LGU B;  1XDO A;  3CKD A;  1Z8U A;  4WBN E;  2H3R A;  4H9O C;  2KSR A;  2W0G A;  3K3Q C;  3NKZ A;  3RX6 A;  4YT0 A;  5BMV E;  2WDV A;  3SFE A;  4OHF A;  5CGM A;  2V7M A;  3GA8 A;  4H9S E;  3OBV E;  5AQK B;  1NWM X;  3N2O A;  4HFV A;  3ZSS A;  3JC6 D;  5L3C B;  3PE0 A;  2LE8 A;  2RP4 A;  3K3N A;  4ERR A;  3ONX A;  2D0U A;  2ZM2 A;  2IAK A;  4QWN B;  2BG9 E;  4PJL A;  3MJX A;  4COF A;  4LF6 T;  3VRA A;  3AEE A;  3FB2 A;  3ETU A;  3QNU A;  2V5C A;  4Z91 A;  2VVS A;  5H6R B;  2H88 A;  2VVN A;  2WM9 A;  2YOE A;  1T72 A;  2B1E A;  3AA6 B;  5JDL A;  4DV0 T;  5L47 A;  3KVA A;  2BKP A;  3ZT7 A;  4GYR A;  3CVR A;  5JVD E;  1LVF A;  1AJ3 A;  2QGS A;  1IJ5 A;  2QYW A;  1SUM B;  2XY8 B;  2X51 A;  3HKB E;  1OXZ A;  4HEA A;  2PTF A;  5HCJ A;  2V6X A;  2ODU A;  4ZI3 D;  1UX5 A;  2VL0 A;  2W62 A;  2H7O A;  1J5W A;  5J1G A;  3Q2M A;  4JI4 T;  3AAE B;  4HFE A;  4PFP A;  2KIN B;  3IA3 A;  3F31 A;  1YW0 A;  3LFM A;  3NRX A;  3IBP A;  3QB5 K;  3UUM A;  3PU3 A;  4YLH A;  4P0A A;  5JR9 A;  3UU4 A;  2WWV A;  3UUB A;  4IHJ E;  1FIO A;  3MA9 A;  3RIF A;  3NRY A;  4O4J E;  4QH5 A;  1ZEE A;  3CML A;  1MIY A;  1U5P A;  3QC9 A;  4L9I A;  4GKJ T;  4NPP A;  4UEL A;  2V7J A;  3LBX B;  2YKS A;  2V1D B;  3EAB A;  3HI2 A;  3P4Q A;  3PUZ F;  4AI6 A;  3MK7 C;  3RPU A;  5LHG B;  4DR5 T;  3ZYL A;  4UR9 A;  5JDG A;  1W0B A;  4GIW A;  4HKA A;  5LXT E;  4TWF A;  4EXT A;  2BVL A;  2BDE A;  1IZN B;  2B76 A;  1S35 A;  2NW8 A;  2X67 A;  5IWA T;  5FNV E;  3WI3 A;  3X1D A;  3UQ7 A;  4CZZ B;  4I4T E;  4JI5 T;  4I50 E;  3LJC A;  3RHW A;  5LG3 A;  3ZC1 A;  2XQA A;  2C5I T;  4X20 E;  2A2F X;  3O1I A;  1QLB A;  4Q25 A;  2IW5 B;  1US7 B;  4KHP T;  2D0T A;  4X1Y E;  2KT9 A;  2D2S A;  4QX8 B;  4OK0 A;  4U31 A;  3OVU A;  4G63 A;  4U3C A;  2XJ7 A;  4PAG A;  4AIU A;  4MHC A;  2RA1 A;  3PUS A;  2KZ7 B;  3CWZ B;  3PUW F;  2A3D A;  4TNW A;  1XNR T;  5E0O A;  3GN5 A;  4CN1 A;  2AE9 A;  3VRB A;  2DL1 A;  2MAW A;  4U74 A;  4TV9 E;  1WR6 A;  4BJN A;  4HN9 A;  3D0T A;  2M67 A;  3CQX C;  3P4S A;  5LBQ B;  1XMO T;  1IBK T;  4AQF A;  4MLK A;  4IE7 A;  5KDM C;  4TUY E;  4EED A;  4DR7 T;  2BBJ A;  4EYU A;  3AXJ A;  3H3M A;  2XAH B;  3PUV F;  2NP9 A;  4HWC A;  3SWH A;  3O4X E;  3E08 A;  2I6H A;  2W67 A;  3JCF A;  5AQR B;  3I9Y A;  1HCI A;  3RI5 A;  1YQ4 A;  2Q9Q B;  1Z0P A;  3AXJ B;  3CX7 B;  2JMH A;  1S94 A;  3DTO A;  5LGN B;  2K9A A;  4YFS A;  3R6N A;  4ZI2 C; 
#chains in the Genus database with same CATH homology
 2UXC T;  1N32 T;  4B3T T;  4JV5 T;  1FJG T;  1HNZ T;  4JI3 T;  2F4V T;  4DUY T;  4DV6 T;  2UU9 T;  4B3M T;  2HHH T;  4YHH T;  4DR4 T;  4LFA T;  2UXD T;  1N33 T;  4DV7 T;  4DV5 T;  4DV4 T;  3OTO T;  1I94 T;  1HR0 T;  2ZM6 T;  4JYA T;  4LFB T;  2E5L T;  4JI1 T;  4LF6 T;  4JI2 T;  1XNQ T;  1HNX T;  4DUZ T;  4DV0 T;  4LF8 T;  1N36 T;  4DR2 T;  4LF9 T;  4DV2 T;  4DV3 T;  4DR3 T;  4DR6 T;  4X64 T;  3T1Y T;  1N34 T;  4JI4 T;  4LF5 T;  4LF4 T;  3T1H T;  4X62 T;  1HNW T;  2UUB T;  4LFC T;  1XMQ T;  4GKJ T;  4YY3 T;  4GKK T;  5LMN T;  1IBL T;  2UXB T;  4DR5 T;  5BR8 T;  4JI7 T;  1IBM T;  4NXN T;  1J5E T;  4DR1 T;  5IWA T;  4K0K T;  1IBK T;  4AQY T;  4JI5 T;  2VQF T;  2UUA T;  4KHP T;  4X65 T;  4OX9 T;  4LF7 T;  1XNR T;  2UUC T;  4X66 T;  4DV1 T;  1XMO T;  4DR7 T;  4B3S T;  4JI0 T;  4JI8 T;  5LMU T;  4B3R T;  2VQE T;  4JI6 T;  4NXM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...