2KINB

Kinesin (monomeric) from rattus norvegicus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
AKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLDGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of motor and neck domains from rat brain kinesin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
molecule keywords KINESIN
total genus 29
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1997-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.980 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kinB01
2KINB
chains in the Genus database with same CATH superfamily
4WNKA 5LMNT 4GKKT 3N2OA 2CLYC 4HTEA 3CIRA 5LYJE 2HN2A 4QKNA 3JAFA 3ZPOA 4B6XA 4IGUA 4ILBA 3TLUA 4DMWA 4ISTA 4PW8A 1V9DA 3T8OA 2W62A 4JBWF 2X66A 1UX4A 2VB6A 4AQFA 4ZI2D 4HFIA 2W00A 4DV5T 2KT9A 1D0ZA 4TWHA 3DJBA 4ILAA 3P4RA 3SWHA 3OTOT 1G8XA 3JADA 4QH5A 5LHHB 2D0UA 5EZYE 3RRWA 4H9NC 3HKDE 1FEWA 3Q5DA 4HFHA 3ONXA 5F8PA 3UU3A 4CN6A 2BBJA 1OWAA 3B5MA 3PTRB 2BKNA 2WU5A 3RKGA 1HR0T 1HS7A 2K3WA 4JI7T 3AEEA 4EZHA 4YJ2E 4DV7T 2IDOB 3BQKA 2JMHA 2YN6A 3JCFA 4ZZBA 5HXEA 5L3EB 4LFCT 3UUMA 2J1DG 4TX5A 5LCYA 4YTPA 1L0VA 1JNZA 2BKOA 4DV6T 1N33T 4QX7B 4DIDB 4DO0A 1D0YA 2V5CA 4PNIA 4U72A 3ZJ1A 2L3LA 4DV2T 1W0BA 1XWMA 3IF8B 3H3MA 4EOZB 1UGOA 4XAXB 2XQ7A 3ZYMA 2I6HA 2LJLA 1HFAA 4GK0E 5LB7B 4YSYA 4U74A 4WZXA 3ZN1B 3EDUA 4ZS2A 4O2BE 2X9XA 2KINB 3ZYKA 1VCTA 2K9AA 2XAHB 4I50E 4KHPT 1I6ZA 4COFA 5LGUB 2DL1A 4NXNT 3HKEE 4HFVA 4E7SA 4A98A 2CPTA 4KUMB 5LXTE 2LSJA 3OJAA 2CHNA 2X0YA 2HN1A 1KK7A 4QXBB 4OYJA 3UT5E 5F3JA 4YJ3E 3ZSSA 1NEKA 4TWDA 2W67A 2WMOA 3ZMUB 4QXHB 3NKZA 4YSZA 2XASB 2IHR1 4Z8XA 4UF0A 5LNKA 2IUBA 2BG9E 3TLWA 4BA9A 3C64A 2CMRA 2ZM2A 2SPCA 3AE7A 3BQIA 4L9IA 3SOLA 5AFUL 3AE6A 4GIWA 2QYWA 5JDFA 1T72A 3N9OA 2XM1A 3AE9A 3PJAJ 5FKYA 2NW9A 3ZT7A 4OK0A 5AQNB 4ILUA 4CQIA 1Y01A 2WM9A 3AA6B 2BG9B 2CRBA 3HKCE 3SRZA 4PJLA 1E1HB 2X51A 2WWUA 3OYXA 2BG9C 1J1JA 1LKXA 5AQOB 4LF6T 4EV6A 1SE7A 3ANWA 2UUCT 1YKEB 3JAEA 1OEDC 5FNVE 4YXDA 5J2UE 1MIYA 4HFEA 4C90A 2XY8B 2VKOA 1WRDA 5KDMC 5IHYA 5FY0A 5LGTB 2CCQA 2FBWA 5CJ5A 1E2AA 2I59A 4WYVA 4ANJA 1KNZA 2WP9A 3OBVE 2DNXA 3RQWA 4A5XA 4X1KE 1N34T 2X9HA 5HCMA 3UU4A 5FL1A 2WB5A 4QHOA 3RIUA 3UFGA 1IZNB 5ABHA 5JDGA 1VRBA 4MBQA 4AISA 4MFRA 5GONE 3P7IA 2JQHA 3SS1A 3CK6A 5L2LA 3ZC0A 4ZXLA 5EK2A 1HNZT 3KV4A 4HKAA 1NAFA 4JI6T 1YXRA 3AE3A 4TN7B 4IHJE 2LM9A 2KLQA 3JC6D 2HPJA 4CZZB 2XQ6A 2VURA 4I55E 2DCFA 2BVMA 5HEOA 4HFBA 2BS2A 4IE5A 4F8HA 4IIJE 1ZV4X 2QVAA 3KV9A 4EYUA 4X1IE 4PJMA 2H7VC 4IL9A 4JYAT 4OYKA 3KDSE 2WAUA 4NPPA 2JRKA 2A3DA 4AQFC 4ZI3D 3LBXB 4LF8T 4JEUB 3HR0A 3OVUA 2IC9A 2UU9T 2EHOC 3PUSA 1WFDA 4BAYB 3UTKA 3WAKA 4I4TE 2LRLA 3KVBA 4QXCB 3J7Yq 1VCSA 2QRXA 4P09A 5HEUA 2FJDA 3WI3A 2BVLA 4H63V 3VR8A 3IBPA 2IAKA 3ZEFB 4DV4T 4EIWA 3K3OA 3DTOA 2FJBA 4MHCA 4ADZA 1ZKEA 1MNDA 3P4SA 3RYHE 2NR4A 3VU7H 3O9XA 3NBXX 3MACA 1YQ3A 1UX5A 3B57A 2E9XA 2RP4A 3CQXC 3IEEA 5AQRB 4DUYT 3AE5A 4LMLA 2VVNA 4AKLA 1W9RA 1W0AA 4LF4T 4TNVA 2LSKA 1VOMA 3CPZA 3PUAA 3PU3A 1YD8G 3BK9A 4UV9B 2XHEB 3T1HT 5FXXA 5HEHA 2LKGA 4I0UA 5JR9C 1R8IA 5LG3A 5LHIB 4PFPA 2CM0A 2WBLA 3LSVA 3M65A 3A8YC 2UXBT 3NRYA 2PFVA 3TLVA 5LOVE 1X79A 3UULA 5HXSA 2NTXA 2XQ3A 3TLSA 4IE7A 2V1DB 3QOFA 5HXRA 1KFYA 4L0RA 3HL6A 2XAFB 4UR9A 3PE0A 4JI2T 4LMJA 5JDLA 5AQVB 4H9SE 2CLYB 4JUYA 1OEDB 4CN4A 4CXXA 2JJ9A 2H89A 3P50A 4ZEYA 1JNRA 3N2GE 5AQHB 3T1YT 2LSGA 5L4EA 1M7KA 3QB5A 3NVOA 5H6RB 2ZM0A 3E08A 1KNPA 4ILCA 5JTGA 3LJCA 2UXXB 4DR6T 4Z90A 3U3IA 4YLHA 4B3TT 1HG5A 3L8RA 5ABGA 1YKHB 3OKQA 2VKJA 4YHJA 2X0LB 5JR9A 2MTQA 3ONLC 2B1EA 2WZIA 2Z6EA 4HFCA 2DHRA 5ETWA 5ABFA 2YINA 2W2UA 3C51A 4WW0A 4QX8B 2CEAA 3ZN0B 2LE8A 3QNUA 2BDEA 2D9DA 2KZ7B 2XQ8A 2YKSA 2YDRA 5AQKB 3ZMZB 3V5SA 4X62T 1UCUA 2LRKA 4UV8B 3UUBA 1O3XA 2XUEA 5FVLA 5CGMA 2W66A 4YY3T 3ZC1A 3CX6B 4DV0T 3EI0A 1IBKT 1CHUA 4DVDA 4ZZCA 1M62A 4YHHT 3FZLB 3KV6A 1HX1B 2NW7A 4U7YA 3RYIE 3S4UA 1B7TA 3KFWX 4TV8E 1BR4A 4IT4A 1XNQT 2YK0A 2J62A 4GYRA 4UVCB 3R84B 2DLRA 4EYYR 4LF5T 4UEMA 3ANWB 4EB6E 3HKBE 4E7ZA 3JC6C 3MKDA 2FUPA 2MPKA 1XMQT 4DR5T 2R6GF 1KEYA 1Z0PA 3ZKRA 4EGWA 2BBHA 2WMNA 2E2AA 4DMVA 4HN9A 2M67A 2E5LT 4PJNA 5LHGB 2WY2A 1WR0A 2LSIA 3C4ZA 2LHRA 2XAJB 2YEVC 4KP3C 4IE4A 2X9YA 3A7MA 3M3ZB 4X20E 5HYAA 5L3BB 1HCIA 4K0UA 1UK5A 2L9QA 5HXCA 1HNWT 4BJNA 4OX9T 2D0TA 2J4GA 2W63A 3KINB 2BKPA 2ACZA 3N5LA 2CBJA 5DJQC 4YTNA 2PJQA 3Q9DA 3C50A 2ACXA 2QA7A 4FI5A 2IC6A 4HE8A 4HEAA 4O8SA 4UVBB 2D2SA 2JIWA 2XAGB 2YU2A 3KV5A 4PAGA 3R6NA 4X65T 1ZP0A 1IBMT 2MOZA 3C4XA 1Z8UA 2E8IA 3TLTA 4AI6A 3N9LA 5JR9B 1MMAA 3AXJA 2KWHA 3IA3A 2HHHT 2UXDT 4IDOA 3MJXA 3CVRA 5AQUB 4EEBA 2XPKA 3Q5WA 5FVKA 4EEDA 5JDQA 5KXJA 3LDQB 3UUNA 4TUYE 2XAQB 3KVAA 4DR3T 3LK42 4EXTA 5A1LA 2C0SA 3O1HA 2WQYA 2WDVA 4KBMB 3G06A 3IHRA 3LFMA 4P0BA 4Z91A 4HWCA 3J9X1 3GN5B 4AXPA 4YFSA 4ZI2C 5HAXA 2LOPA 3AE2A 3AVRA 2YDSA 3AEFA 1KF6A 3EDVA 2I0MA 3MXZA 4IREA 1XZYA 2LM2A 5KMGP 5LGNB 4HWFA 4LFBT 5AQGB 3UQ7A 3PV0F 4QH4A 3FZHB 2LKHA 3CKDA 3PUVF 4CXYA 3P4WA 4TZ4C 1FMVA 1T8BA 3NZPA 3AVSA 5LMUT 2WSSV 3RPUA 5LJNA 2FJAA 2CWYA 4JI1T 5L3GB 3RIAA 4U33A 2X67A 4DV1T 2WDQA 4EAHA 1S35A 3ETVA 3Q2MA 3AECA 4KHZF 2VQET 2VL8A 5EK3A 4G63A 5JDHA 1QSDA 4JV5T 3ZLIA 3AEAA 3D0TA 3VRBA 1WLXA 3HI2A 2W0GA 3GWHA 1UURA 3LK3B 3K3NA 4LMKA 1E7PA 3P8CD 5DQVA 5FY7A 4F6RC 5C3JA 4B3ST 2XJ7A 5FY1A 2ZLYA 4ZS3A 3AEBA 1G73A 2ODVA 1LVKA 3PURA 2H3RA 4WBOA 5EK4A 4CI1B 5AQFB 3UU5A 3F2EA 1MMNA 2BS4A 1IJ5A 2VVSA 2UXCT 4TNWA 2KXPB 3PU8A 2IW5B 1NENA 1LVFA 1WR6A 5H6QB 1W09A 1WCRA 2LT3A 2XSAA 3KBTA 1MNEA 3HA4A 3QC9A 2LEHA 4PK6A 2F4VT 2K24A 3AAEB 5L47A 1CUNA 1U4QA 3F31A 2V5DA 4QWNB 1FMWA 3RC8A 3L09A 2WWVA 3P4QA 1J5WA 2WU2A 2KSRA 2Y48B 4JI0T 2JQKA 3FBZA 2W4XA 3N9MA 5JVDE 4ZHQE 5AQLB 3N9QA 3PUGA 4HWDA 5C2TA 3I9YA 2ZM8A 2L8KA 2X0HA 3OYZA 2YU1A 1ZEEA 1EZ3A 5AQIB 4XBFB 3ABVA 1XNRT 1YW0A 3FXDB 5L4HA 2E9XC 2EHOB 3ZCIA 1LRZA 2ODUA 2X9WA 3WAJA 2CXLA 2KWIB 1HX8A 2CA5A 5J2TE 2VKHA 1BR1A 2G0UA 2V6XA 2VKDA 1ZHCA 3F57A 3FXEB 3K3QC 4B3RT 2V7JA 3CQCB 2CXFA 2MBGA 4AKHA 2MYSA 3H3AA 4UXNB 2Q9QB 1FIOA 3NRXA 5DQWA 5E0OA 4U2YA 4X5TA 2DWKA 2LHNA 4AQYT 4C91A 2CE7A 2Y6XA 2WDRA 2WS3A 3LK2B 2V7LA 1US7B 3C4WA 2N9DA 2Q9QA 3EUHA 2K48A 3U78A 4JI4T 2NP9A 3RGLA 5JRCB 2PTFA 2V6YB 4NUVA 5LJMA 3QB5K 1D0XA 5FXVA 2JPFA 4H9PC 4QH1A 2E9XD 4H63H 4CI2B 3C98B 3NZQA 3Q5EA 4X66T 5IYZE 3CWZB 4YSXA 1NWMX 4Q25A 4IDPA 4UF0B 5HEJA 3ZMTB 1X9BA 2E9XB 3RIFA 1J5ET 1OXZA 1YQ4A 2RPAA 1GQEA 2FJEA 3GMIA 3RC3A 4DV3T 3VHLA 1HG2A 5HCJA 4O4LE 4IDNA 5JDMA 3RKOA 2A9UA 1D1AA 3CMLA 4HFDA 3RI5A 2CXDA 1S94A 4DUZT 2UUAT 4K0KT 3AEGA 1MIVA 2M6BA 4DR2T 2LSYA 4PK4A 1SHZC 2GK9A 2NOXA 3ZJ2A 1DU2A 2XQAA 3EAMA 4U2ZA 5KX5E 2ZM6T 2EHOD 2HPLA 3AA1B 2XTLA 3EABA 3L39A 4ASKA 4LF9T 3AAAB 1SUMB 5JRCA 2VWAA 1WYBA 4MALA 2Q9QC 2VK9A 5AQPB 2M6IA 4V1Av 3MZKB 3ESLA 5LBMA 3MA9A 4AQGA 1ZOYA 3QK6A 3CX8B 5FXWA 4KMCA 3RF1A 5LG4A 4O4IE 2H7OA 3Q5XA 4EZ4A 5HWXA 4UELA 4AKIA 2Q9QD 3PUXF 4M1PA 4UIGA 1U5PA 3RYCE 2QGSA 1HF8A 5IWAT 4LF7T 3AEDA 4AKGA 3A5XA 3EHZA 1OEDE 1HNXT 4JEHB 2V7MA 3FB2A 3O1JA 5AQJB 5FXZA 2C5IT 5J0ZA 3FZKB 4PFOA 1MMGA 4WBNE 3AA7B 4O2AE 2KNDA 4ZOLE 5AQSB 4BJMA 5C8YE 3RIUC 4N78D 1MMDA 3I0OA 4NUUA 5ADXL 2WZHA 3SFDA 4H9QC 2C5KT 4IE6A 5AQMB 3ZYLA 4X64T 2XQ5A 2CHOA 1XDPA 3ONJA 4TV9E 3ZMVB 2PG8A 2UUBT 1H7CA 2B76A 2UXNB 1XMOT 4G2AA 3RHWA 2NTYA 3O4XE 2JQ9A 4HGAA 1AJ3A 4YT0A 4IDZA 4UVAB 3BQLA 4DBQA 5M4YA 3LBXA 4OHFA 2BG9A 2MAWA 2E5VA 5JREA 3LG7A 4XZCA 5BR8T 4B3MT 3GN5A 2NWBA 3FBLA 4U3CA 3RH3A 1IAPA 5CA1E 2X68A 4J2CA 4CN1A 3DP7A 3GA8A 3CX7B 4HWIB 3RX6A 4JI3T 4IE0A 1QLBA 3AAIA 5F5WA 5HEGA 1D1CA 4O4HE 2NW8A 3UQ4A 3I0QA 4ZI7E 3VKHA 2N1GA 2YDQA 4P1NA 2EHOA 3FHNA 2XQYA 2DWGA 3N9NA 4PJJA 5DABA 4P0AA 3AE8A 4AKRB 2OLTA 4DNDA 3ZT5A 5CB4E 4JI5T 3N2KE 3CQGB 3VR9A 4IL4A 2DI4A 1IJ6A 2XQ9A 5HWYA 1Y64B 2IIUA 1MIWA 2ES0A 1D1BA 3I9WA 4KX6A 3N9PA 2AE9A 1UUSA 4O4JE 2C5JA 4ERRA 2XM2A 2A2FX 4ISSA 5J1GA 5L3CB 2VASA 1N36T 4AIUA 2AXDS 3H37A 2OA5A 5FP3A 3PDYA 2N2NA 3SFEA 3UFEA 4IDQA 2LOSA 3ZCJA 4A56A 4I43B 4H9OC 2YOEA 3UUXB 2V6YA 2W61A 4NXMT 4MLKA 4X1YE 3FZFB 1SA0E 2XZEA 3K8PC 3X1DA 3K1SA 2HH7A 4OFZA 2ZMAA 5IUXA 2CWOA 5LP6E 3KBUA 4GKJT 1BR0A 4JLEA 1FJGT 4LFAT 3ZMSB 1HTJF 2JMKA 3UU8A 3TKLB 5L3DB 5CFBA 1T98A 3MK7C 3PUYF 4KI0F 5ABEA 5JQGE 1I94T 4ZI3C 4A97A 2VQFT 3W15B 4GOUA 3E22E 3VRAA 1WYCA 2H88A 1KNRA 3O1IA 3PUQA 3ZT6A 5HXHA 4YTMA 3ETUA 3I1AA 4L5GA 5L3FB 1IBLT 2PBIA 5FYMA 1QUUA 4CXWA 4GYSA 5BMVE 3E0ZA 4TWFA 3UU6A 1N32T 1BR2A 4NIQA 3AA0B 2RA1A 3OPCA 2JQQA 3PUWF 3AE1A 2J47A 3B13A 3EVYA 3QUJA 4FJOA 4HWHA 3AE4A 5CA0E 2P9BA 5ABFB 2VL0A 2KMFA 4JI8T 5JDNA 2Y8DA 4DR7T 3PJAA 2OV9A 4GK5E 2D5UA 3RRCA 1T7SA 2IMLA 2K5BB 5FL0A 1XDOA 3L3PA 2BS3A 3P4PA 2XQ4A 3NWIA 3PUZF 3RYFE 4CI3B 1OEDA 3RLFF 4PK5A 5LBQB 3ZSTA 2WCAA 2A72A 2V26A 3FZMB 5LA6E 5TAOA 3V5UA 4DBRA 4DR4T 4U31A 2CBIA 4DR1T 3AB3B 2LLYA 2V7IA 2BZBA 4U7IA 4H9RC 3RQUA 5JH7E 3VKGA 3AXJB 5FMNA 2V8SV 2XSBA 2V7KA 5AQTB 5AQQB
chains in the Genus database with same CATH topology
4WNKA 3N2OA 2CLYC 4HTEA 5LYJE 4QKNA 3ZPOA 4B6XA 4IGUA 4DMWA 4ISTA 4PW8A 1V9DA 3T8OA 2W62A 2X66A 1UX4A 2VB6A 4AQFA 4ZI2D 2W00A 2KT9A 1D0ZA 3DJBA 3SWHA 1G8XA 5LHHB 2D0UA 5EZYE 3RRWA 4H9NC 3HKDE 1FEWA 5F8PA 3ONXA 1OWAA 3PTRB 1HS7A 4EZHA 4YJ2E 3BQKA 5HXEA 2JMHA 5L3EB 3UUMA 2J1DG 4TX5A 5LCYA 4QX7B 4DO0A 1D0YA 4PNIA 4U72A 3ZJ1A 2L3LA 3IF8B 4EOZB 4XAXB 3ZYMA 2LJLA 4GK0E 1HFAA 4U74A 3ZN1B 3EDUA 4ZS2A 4O2BE 2X9XA 2KINB 3ZYKA 2K9AA 2XAHB 4I50E 5LGUB 3HKEE 4HFVA 4E7SA 5LXTE 4KUMB 2LSJA 3OJAA 1KK7A 4QXBB 4OYJA 3UT5E 5F3JA 4YJ3E 2WMOA 3ZMUB 4QXHB 2XASB 4Z8XA 4UF0A 5LNKA 4BA9A 5AFUL 3C64A 2CMRA 2ZM2A 2SPCA 3BQIA 4L9IA 3SOLA 4GIWA 5JDFA 3N9OA 2NW9A 4CQIA 4OK0A 4ILUA 2WM9A 3AA6B 3HKCE 3SRZA 4PJLA 1E1HB 2X51A 2WWUA 3OYXA 1LKXA 3ANWA 1YKEB 5FNVE 5J2UE 1MIYA 4C90A 2VKOA 1WRDA 5KDMC 5IHYA 5FY0A 5LGTB 2CCQA 2I59A 1KNZA 4ANJA 3OBVE 2DNXA 4X1KE 2X9HA 4QHOA 1IZNB 5JDGA 1VRBA 4MBQA 4MFRA 5GONE 3P7IA 3SS1A 3ZC0A 5L2LA 5EK2A 3KV4A 4HKAA 1NAFA 4TN7B 4IHJE 2LM9A 2KLQA 3JC6D 2HPJA 4CZZB 4I55E 2DCFA 2BVMA 4IE5A 4IIJE 1ZV4X 3KV9A 4EYUA 4X1IE 4PJMA 2H7VC 4OYKA 3KDSE 2WAUA 2JRKA 2A3DA 4AQFC 4ZI3D 3LBXB 4JEUB 3HR0A 2IC9A 2EHOC 3PUSA 4BAYB 3UTKA 3WAKA 4I4TE 4QXCB 3KVBA 3J7Yq 3WI3A 4P09A 2BVLA 4H63V 3ZEFB 3IBPA 2IAKA 4EIWA 3K3OA 3DTOA 4MHCA 4ADZA 1ZKEA 1MNDA 3RYHE 3VU7H 3O9XA 3NBXX 3MACA 1UX5A 3B57A 2E9XA 2RP4A 3CQXC 3IEEA 4AKLA 2LSKA 1VOMA 3CPZA 3PUAA 3PU3A 1YD8G 3BK9A 4UV9B 2XHEB 5FXXA 5JR9C 5LHIB 4PFPA 2CM0A 2WBLA 3M65A 3NRYA 2PFVA 3UULA 5LOVE 1X79A 5HXSA 2NTXA 4IE7A 2V1DB 5LG4A 5HXRA 4L0RA 3HL6A 2XAFB 3PE0A 5JDLA 4H9SE 2CLYB 4JUYA 4CXXA 2JJ9A 3N2GE 2LSGA 5H6RB 2ZM0A 3E08A 3LJCA 2UXXB 3U3IA 4YLHA 1HG5A 1YKHB 3OKQA 2VKJA 4YHJA 2X0LB 5JR9A 2MTQA 2B1EA 2Z6EA 5ETWA 2DHRA 2YINA 4WW0A 3C51A 4QX8B 2CEAA 3ZN0B 2LE8A 2BDEA 2KZ7B 3ZMZB 3VKGA 3V5SA 1UCUA 4UV8B 1O3XA 2XUEA 3ZC1A 3CX6B 4DVDA 3KV6A 3RYIE 2NW7A 3S4UA 1B7TA 3KFWX 4TV8E 1BR4A 2YK0A 4GYRA 4UVCB 3R84B 2DLRA 4EYYR 4UEMA 3ANWB 4EB6E 3HKBE 4E7ZA 3JC6C 3MKDA 1Z0PA 2WMNA 4DMVA 4HN9A 2M67A 4PJNA 5LHGB 3C4ZA 2LSIA 2LHRA 2XAJB 2YEVC 4KP3C 4IE4A 2X9YA 4X20E 5HYAA 5L3BB 1HCIA 4K0UA 2L9QA 5HXCA 4BJNA 2D0TA 2W63A 3KINB 3N5LA 5DJQC 2PJQA 3Q9DA 3C50A 2ACXA 2QA7A 4FI5A 2IC6A 4HE8A 4HEAA 4O8SA 4UVBB 2D2SA 2XAGB 3KV5A 2YU2A 4PAGA 3R6NA 2MOZA 3C4XA 2E8IA 4AI6A 3N9LA 5JR9B 1MMAA 2KWHA 3MJXA 3CVRA 3Q5WA 5JDQA 3UUNA 4TUYE 2XAQB 3KVAA 3LK42 4EXTA 5A1LA 2C0SA 3O1HA 4KBMB 3IHRA 3LFMA 4AXPA 4P0BA 3J9X1 4ZI2C 3GN5B 4YFSA 5HAXA 2LOPA 3AVRA 3EDVA 5LGNB 3MXZA 5KMGP 4CXYA 3CKDA 4TZ4C 1FMVA 3NZPA 3AVSA 2WSSV 3RPUA 5LJNA 2CWYA 5L3GB 2X67A 4EAHA 1S35A 3ETVA 3Q2MA 2VL8A 5EK3A 4G63A 5JDHA 1QSDA 3ZLIA 3D0TA 1WLXA 3HI2A 2W0GA 3GWHA 3LK3B 3K3NA 3P8CD 5DQVA 5FY7A 4F6RC 5FY1A 2ZLYA 4ZS3A 3PURA 1G73A 2ODVA 1LVKA 5EK4A 2H3RA 4WBOA 4CI1B 3F2EA 1MMNA 1IJ5A 2KXPB 3PU8A 2IW5B 1WR6A 1LVFA 5H6QB 3KBTA 5JRCB 2LT3A 3QC9A 1MNEA 3HA4A 4PK6A 2LEHA 2K24A 3AAEB 1CUNA 1U4QA 3F31A 4QWNB 1FMWA 3RC8A 3L09A 2Y48B 3FBZA 3N9MA 5JVDE 4ZHQE 3N9QA 3PUGA 3I9YA 2ZM8A 2L8KA 3OYZA 2YU1A 1ZEEA 1EZ3A 4XBFB 1YW0A 3FXDB 2E9XC 2EHOB 3ZCIA 1LRZA 2ODUA 2X9WA 3WAJA 2CXLA 2KWIB 1HX8A 2CA5A 5J2TE 3FXEB 2VKHA 1BR1A 2G0UA 2VKDA 1ZHCA 3F57A 3K3QC 2V7JA 3CQCB 2CXFA 2MBGA 2MYSA 3H3AA 4UXNB 2Q9QB 1FIOA 3NRXA 5DQWA 5E0OA 2DWKA 2LHNA 4C91A 2CE7A 2Y6XA 3LK2B 2V7LA 1US7B 3C4WA 2N9DA 2Q9QA 3EUHA 2K48A 3U78A 2NP9A 5LJMA 4NUVA 1D0XA 5FXVA 2JPFA 4H9PC 2E9XD 4H63H 4CI2B 3C98B 3NZQA 5IYZE 3CWZB 1NWMX 4UF0B 3ZMTB 2E9XB 1OXZA 3GMIA 3RC3A 3VHLA 1HG2A 4O4LE 5JDMA 3RKOA 3CMLA 1D1AA 2CXDA 1S94A 1MIVA 2LSYA 4PK4A 1SHZC 2GK9A 2NOXA 3ZJ2A 2EHOD 2HPLA 3AA1B 2XTLA 4AKHA 4ASKA 3AAAB 5JRCA 2VWAA 1WYBA 4MALA 2Q9QC 2VK9A 4V1Av 3MZKB 3ESLA 5LBMA 3MA9A 4AQGA 3QK6A 3CX8B 5FXWA 4KMCA 4O4IE 2H7OA 3Q5XA 4EZ4A 5HWXA 4UELA 4AKIA 2Q9QD 4M1PA 4UIGA 1U5PA 3RYCE 2QGSA 1HF8A 4AKGA 3A5XA 4JEHB 2V7MA 3FB2A 3O1JA 5FXZA 2C5IT 4PFOA 1MMGA 4WBNE 3AA7B 4O2AE 2KNDA 4ZOLE 4BJMA 5C8YE 5KX5E 4N78D 1MMDA 3I0OA 4NUUA 5ADXL 4H9QC 2C5KT 4IE6A 3ZYLA 4TV9E 3ZMVB 2PG8A 1H7CA 2UXNB 4G2AA 2NTYA 3O4XE 1AJ3A 4HGAA 4IDZA 4UVAB 3BQLA 4DBQA 5M4YA 3LBXA 4OHFA 5JREA 3LG7A 4XZCA 3GN5A 2NWBA 3FBLA 3RH3A 5CA1E 1IAPA 2X68A 4J2CA 3DP7A 3GA8A 3CX7B 3RX6A 4IE0A 3AAIA 1D1CA 4O4HE 2NW8A 4ZI7E 3I0QA 3VKHA 2N1GA 2EHOA 3FHNA 2XQYA 2DWGA 3N9NA 4PJJA 5DABA 4P0AA 4AKRB 4DNDA 5CB4E 3N2KE 3CQGB 2DI4A 1IJ6A 5HWYA 1Y64B 1MIWA 2ES0A 1D1BA 3I9WA 3N9PA 4O4JE 2C5JA 4ERRA 4ISSA 2A2FX 5J1GA 5L3CB 2VASA 3H37A 2OA5A 5FP3A 3PDYA 2N2NA 3ZCJA 3UFEA 2LOSA 4A56A 4I43B 4H9OC 3UUXB 2W61A 4MLKA 4X1YE 1SA0E 3K8PC 2HH7A 4OFZA 2ZMAA 2CWOA 5LP6E 3KBUA 1BR0A 4JLEA 3ZMSB 1HTJF 2JMKA 3TKLB 5L3DB 1T98A 3MK7C 5JQGE 4ZI3C 3W15B 4GOUA 3E22E 1WYCA 3PUQA 3O1IA 5HXHA 5L3FB 3ETUA 3I1AA 4L5GA 2PBIA 5FYMA 1QUUA 4CXWA 4GYSA 5BMVE 3E0ZA 1BR2A 3AA0B 2RA1A 3QUJA 2JQQA 5CA0E 3B13A 3EVYA 4FJOA 2P9BA 2KMFA 5JDNA 2Y8DA 4GK5E 2D5UA 3RRCA 2K5BB 3L3PA 3RYFE 4CI3B 4PK5A 5LBQB 2A72A 2V26A 5LA6E 5TAOA 3V5UA 4DBRA 3AB3B 5JH7E 2V7IA 2BZBA 4H9RC 5FMNA 2V7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIN B; 
#chains in the Genus database with same CATH topology
 4WNK A;  5LMN T;  4GKK T;  3N2O A;  2CLY C;  4HTE A;  3CIR A;  5LYJ E;  2HN2 A;  4QKN A;  3JAF A;  3ZPO A;  4B6X A;  4IGU A;  4ILB A;  3TLU A;  4DMW A;  4IST A;  4PW8 A;  1V9D A;  3T8O A;  2W62 A;  4JBW F;  2X66 A;  1UX4 A;  2VB6 A;  4AQF A;  4ZI2 D;  4HFI A;  2W00 A;  4DV5 T;  2KT9 A;  1D0Z A;  4TWH A;  3DJB A;  4ILA A;  3P4R A;  3SWH A;  3OTO T;  1G8X A;  3JAD A;  4QH5 A;  5LHH B;  2D0U A;  5EZY E;  3RRW A;  4H9N C;  3HKD E;  1FEW A;  3Q5D A;  4HFH A;  3ONX A;  5F8P A;  3UU3 A;  4CN6 A;  2BBJ A;  1OWA A;  3B5M A;  3PTR B;  2BKN A;  2WU5 A;  3RKG A;  1HR0 T;  1HS7 A;  2K3W A;  4JI7 T;  3AEE A;  4EZH A;  4YJ2 E;  4DV7 T;  2IDO B;  3BQK A;  2JMH A;  2YN6 A;  3JCF A;  4ZZB A;  5HXE A;  5L3E B;  4LFC T;  3UUM A;  2J1D G;  4TX5 A;  5LCY A;  4YTP A;  1L0V A;  1JNZ A;  2BKO A;  4DV6 T;  1N33 T;  4QX7 B;  4DID B;  4DO0 A;  1D0Y A;  2V5C A;  4PNI A;  4U72 A;  3ZJ1 A;  2L3L A;  4DV2 T;  1W0B A;  1XWM A;  3IF8 B;  3H3M A;  4EOZ B;  1UGO A;  4XAX B;  2XQ7 A;  3ZYM A;  2I6H A;  2LJL A;  1HFA A;  4GK0 E;  5LB7 B;  4YSY A;  4U74 A;  4WZX A;  3ZN1 B;  3EDU A;  4ZS2 A;  4O2B E;  2X9X A;  2KIN B;  3ZYK A;  1VCT A;  2K9A A;  2XAH B;  4I50 E;  4KHP T;  1I6Z A;  4COF A;  5LGU B;  2DL1 A;  4NXN T;  3HKE E;  4HFV A;  4E7S A;  4A98 A;  2CPT A;  4KUM B;  5LXT E;  2LSJ A;  3OJA A;  2CHN A;  2X0Y A;  2HN1 A;  1KK7 A;  4QXB B;  4OYJ A;  3UT5 E;  5F3J A;  4YJ3 E;  3ZSS A;  1NEK A;  4TWD A;  2W67 A;  2WMO A;  3ZMU B;  4QXH B;  3NKZ A;  4YSZ A;  2XAS B;  2IHR 1;  4Z8X A;  4UF0 A;  5LNK A;  2IUB A;  2BG9 E;  3TLW A;  4BA9 A;  3C64 A;  2CMR A;  2ZM2 A;  2SPC A;  3AE7 A;  3BQI A;  4L9I A;  3SOL A;  5AFU L;  3AE6 A;  4GIW A;  2QYW A;  5JDF A;  1T72 A;  3N9O A;  2XM1 A;  3AE9 A;  3PJA J;  5FKY A;  2NW9 A;  3ZT7 A;  4OK0 A;  5AQN B;  4ILU A;  4CQI A;  1Y01 A;  2WM9 A;  3AA6 B;  2BG9 B;  2CRB A;  3HKC E;  3SRZ A;  4PJL A;  1E1H B;  2X51 A;  2WWU A;  3OYX A;  2BG9 C;  1J1J A;  1LKX A;  5AQO B;  4LF6 T;  4EV6 A;  1SE7 A;  3ANW A;  2UUC T;  1YKE B;  3JAE A;  1OED C;  5FNV E;  4YXD A;  5J2U E;  1MIY A;  4HFE A;  4C90 A;  2XY8 B;  2VKO A;  1WRD A;  5KDM C;  5IHY A;  5FY0 A;  5LGT B;  2CCQ A;  2FBW A;  5CJ5 A;  1E2A A;  2I59 A;  4WYV A;  4ANJ A;  1KNZ A;  2WP9 A;  3OBV E;  2DNX A;  3RQW A;  4A5X A;  4X1K E;  1N34 T;  2X9H A;  5HCM A;  3UU4 A;  5FL1 A;  2WB5 A;  4QHO A;  3RIU A;  3UFG A;  1IZN B;  5ABH A;  5JDG A;  1VRB A;  4MBQ A;  4AIS A;  4MFR A;  5GON E;  3P7I A;  2JQH A;  3SS1 A;  3CK6 A;  5L2L A;  3ZC0 A;  4ZXL A;  5EK2 A;  1HNZ T;  3KV4 A;  4HKA A;  1NAF A;  4JI6 T;  1YXR A;  3AE3 A;  4TN7 B;  4IHJ E;  2LM9 A;  2KLQ A;  3JC6 D;  2HPJ A;  4CZZ B;  2XQ6 A;  2VUR A;  4I55 E;  2DCF A;  2BVM A;  5HEO A;  4HFB A;  2BS2 A;  4IE5 A;  4F8H A;  4IIJ E;  1ZV4 X;  2QVA A;  3KV9 A;  4EYU A;  4X1I E;  4PJM A;  2H7V C;  4IL9 A;  4JYA T;  4OYK A;  3KDS E;  2WAU A;  4NPP A;  2JRK A;  2A3D A;  4AQF C;  4ZI3 D;  3LBX B;  4LF8 T;  4JEU B;  3HR0 A;  3OVU A;  2IC9 A;  2UU9 T;  2EHO C;  3PUS A;  1WFD A;  4BAY B;  3UTK A;  3WAK A;  4I4T E;  2LRL A;  3KVB A;  4QXC B;  3J7Y q;  1VCS A;  2QRX A;  4P09 A;  5HEU A;  2FJD A;  3WI3 A;  2BVL A;  4H63 V;  3VR8 A;  3IBP A;  2IAK A;  3ZEF B;  4DV4 T;  4EIW A;  3K3O A;  3DTO A;  2FJB A;  4MHC A;  4ADZ A;  1ZKE A;  1MND A;  3P4S A;  3RYH E;  2NR4 A;  3VU7 H;  3O9X A;  3NBX X;  3MAC A;  1YQ3 A;  1UX5 A;  3B57 A;  2E9X A;  2RP4 A;  3CQX C;  3IEE A;  5AQR B;  4DUY T;  3AE5 A;  4LML A;  2VVN A;  4AKL A;  1W9R A;  1W0A A;  4LF4 T;  4TNV A;  2LSK A;  1VOM A;  3CPZ A;  3PUA A;  3PU3 A;  1YD8 G;  3BK9 A;  4UV9 B;  2XHE B;  3T1H T;  5FXX A;  5HEH A;  2LKG A;  4I0U A;  5JR9 C;  1R8I A;  5LG3 A;  5LHI B;  4PFP A;  2CM0 A;  2WBL A;  3LSV A;  3M65 A;  3A8Y C;  2UXB T;  3NRY A;  2PFV A;  3TLV A;  5LOV E;  1X79 A;  3UUL A;  5HXS A;  2NTX A;  2XQ3 A;  3TLS A;  4IE7 A;  2V1D B;  3QOF A;  5HXR A;  1KFY A;  4L0R A;  3HL6 A;  2XAF B;  4UR9 A;  3PE0 A;  4JI2 T;  4LMJ A;  5JDL A;  5AQV B;  4H9S E;  2CLY B;  4JUY A;  1OED B;  4CN4 A;  4CXX A;  2JJ9 A;  2H89 A;  3P50 A;  4ZEY A;  1JNR A;  3N2G E;  5AQH B;  3T1Y T;  2LSG A;  5L4E A;  1M7K A;  3QB5 A;  3NVO A;  5H6R B;  2ZM0 A;  3E08 A;  1KNP A;  4ILC A;  5JTG A;  3LJC A;  2UXX B;  4DR6 T;  4Z90 A;  3U3I A;  4YLH A;  4B3T T;  1HG5 A;  3L8R A;  5ABG A;  1YKH B;  3OKQ A;  2VKJ A;  4YHJ A;  2X0L B;  5JR9 A;  2MTQ A;  3ONL C;  2B1E A;  2WZI A;  2Z6E A;  4HFC A;  2DHR A;  5ETW A;  5ABF A;  2YIN A;  2W2U A;  3C51 A;  4WW0 A;  4QX8 B;  2CEA A;  3ZN0 B;  2LE8 A;  3QNU A;  2BDE A;  2D9D A;  2KZ7 B;  2XQ8 A;  2YKS A;  2YDR A;  5AQK B;  3ZMZ B;  3V5S A;  4X62 T;  1UCU A;  2LRK A;  4UV8 B;  3UUB A;  1O3X A;  2XUE A;  5FVL A;  5CGM A;  2W66 A;  4YY3 T;  3ZC1 A;  3CX6 B;  4DV0 T;  3EI0 A;  1IBK T;  1CHU A;  4DVD A;  4ZZC A;  1M62 A;  4YHH T;  3FZL B;  3KV6 A;  1HX1 B;  2NW7 A;  4U7Y A;  3RYI E;  3S4U A;  1B7T A;  3KFW X;  4TV8 E;  1BR4 A;  4IT4 A;  1XNQ T;  2YK0 A;  2J62 A;  4GYR A;  4UVC B;  3R84 B;  2DLR A;  4EYY R;  4LF5 T;  4UEM A;  3ANW B;  4EB6 E;  3HKB E;  4E7Z A;  3JC6 C;  3MKD A;  2FUP A;  2MPK A;  1XMQ T;  4DR5 T;  2R6G F;  1KEY A;  1Z0P A;  3ZKR A;  4EGW A;  2BBH A;  2WMN A;  2E2A A;  4DMV A;  4HN9 A;  2M67 A;  2E5L T;  4PJN A;  5LHG B;  2WY2 A;  1WR0 A;  2LSI A;  3C4Z A;  2LHR A;  2XAJ B;  2YEV C;  4KP3 C;  4IE4 A;  2X9Y A;  3A7M A;  3M3Z B;  4X20 E;  5HYA A;  5L3B B;  1HCI A;  4K0U A;  1UK5 A;  2L9Q A;  5HXC A;  1HNW T;  4BJN A;  4OX9 T;  2D0T A;  2J4G A;  2W63 A;  3KIN B;  2BKP A;  2ACZ A;  3N5L A;  2CBJ A;  5DJQ C;  4YTN A;  2PJQ A;  3Q9D A;  3C50 A;  2ACX A;  2QA7 A;  4FI5 A;  2IC6 A;  4HE8 A;  4HEA A;  4O8S A;  4UVB B;  2D2S A;  2JIW A;  2XAG B;  2YU2 A;  3KV5 A;  4PAG A;  3R6N A;  4X65 T;  1ZP0 A;  1IBM T;  2MOZ A;  3C4X A;  1Z8U A;  2E8I A;  3TLT A;  4AI6 A;  3N9L A;  5JR9 B;  1MMA A;  3AXJ A;  2KWH A;  3IA3 A;  2HHH T;  2UXD T;  4IDO A;  3MJX A;  3CVR A;  5AQU B;  4EEB A;  2XPK A;  3Q5W A;  5FVK A;  4EED A;  5JDQ A;  5KXJ A;  3LDQ B;  3UUN A;  4TUY E;  2XAQ B;  3KVA A;  4DR3 T;  3LK4 2;  4EXT A;  5A1L A;  2C0S A;  3O1H A;  2WQY A;  2WDV A;  4KBM B;  3G06 A;  3IHR A;  3LFM A;  4P0B A;  4Z91 A;  4HWC A;  3J9X 1;  3GN5 B;  4AXP A;  4YFS A;  4ZI2 C;  5HAX A;  2LOP A;  3AE2 A;  3AVR A;  2YDS A;  3AEF A;  1KF6 A;  3EDV A;  2I0M A;  3MXZ A;  4IRE A;  1XZY A;  2LM2 A;  5KMG P;  5LGN B;  4HWF A;  4LFB T;  5AQG B;  3UQ7 A;  3PV0 F;  4QH4 A;  3FZH B;  2LKH A;  3CKD A;  3PUV F;  4CXY A;  3P4W A;  4TZ4 C;  1FMV A;  1T8B A;  3NZP A;  3AVS A;  5LMU T;  2WSS V;  3RPU A;  5LJN A;  2FJA A;  2CWY A;  4JI1 T;  5L3G B;  3RIA A;  4U33 A;  2X67 A;  4DV1 T;  2WDQ A;  4EAH A;  1S35 A;  3ETV A;  3Q2M A;  3AEC A;  4KHZ F;  2VQE T;  2VL8 A;  5EK3 A;  4G63 A;  5JDH A;  1QSD A;  4JV5 T;  3ZLI A;  3AEA A;  3D0T A;  3VRB A;  1WLX A;  3HI2 A;  2W0G A;  3GWH A;  1UUR A;  3LK3 B;  3K3N A;  4LMK A;  1E7P A;  3P8C D;  5DQV A;  5FY7 A;  4F6R C;  5C3J A;  4B3S T;  2XJ7 A;  5FY1 A;  2ZLY A;  4ZS3 A;  3AEB A;  1G73 A;  2ODV A;  1LVK A;  3PUR A;  2H3R A;  4WBO A;  5EK4 A;  4CI1 B;  5AQF B;  3UU5 A;  3F2E A;  1MMN A;  2BS4 A;  1IJ5 A;  2VVS A;  2UXC T;  4TNW A;  2KXP B;  3PU8 A;  2IW5 B;  1NEN A;  1LVF A;  1WR6 A;  5H6Q B;  1W09 A;  1WCR A;  2LT3 A;  2XSA A;  3KBT A;  1MNE A;  3HA4 A;  3QC9 A;  2LEH A;  4PK6 A;  2F4V T;  2K24 A;  3AAE B;  5L47 A;  1CUN A;  1U4Q A;  3F31 A;  2V5D A;  4QWN B;  1FMW A;  3RC8 A;  3L09 A;  2WWV A;  3P4Q A;  1J5W A;  2WU2 A;  2KSR A;  2Y48 B;  4JI0 T;  2JQK A;  3FBZ A;  2W4X A;  3N9M A;  5JVD E;  4ZHQ E;  5AQL B;  3N9Q A;  3PUG A;  4HWD A;  5C2T A;  3I9Y A;  2ZM8 A;  2L8K A;  2X0H A;  3OYZ A;  2YU1 A;  1ZEE A;  1EZ3 A;  5AQI B;  4XBF B;  3ABV A;  1XNR T;  1YW0 A;  3FXD B;  5L4H A;  2E9X C;  2EHO B;  3ZCI A;  1LRZ A;  2ODU A;  2X9W A;  3WAJ A;  2CXL A;  2KWI B;  1HX8 A;  2CA5 A;  5J2T E;  2VKH A;  1BR1 A;  2G0U A;  2V6X A;  2VKD A;  1ZHC A;  3F57 A;  3FXE B;  3K3Q C;  4B3R T;  2V7J A;  3CQC B;  2CXF A;  2MBG A;  4AKH A;  2MYS A;  3H3A A;  4UXN B;  2Q9Q B;  1FIO A;  3NRX A;  5DQW A;  5E0O A;  4U2Y A;  4X5T A;  2DWK A;  2LHN A;  4AQY T;  4C91 A;  2CE7 A;  2Y6X A;  2WDR A;  2WS3 A;  3LK2 B;  2V7L A;  1US7 B;  3C4W A;  2N9D A;  2Q9Q A;  3EUH A;  2K48 A;  3U78 A;  4JI4 T;  2NP9 A;  3RGL A;  5JRC B;  2PTF A;  2V6Y B;  4NUV A;  5LJM A;  3QB5 K;  1D0X A;  5FXV A;  2JPF A;  4H9P C;  4QH1 A;  2E9X D;  4H63 H;  4CI2 B;  3C98 B;  3NZQ A;  3Q5E A;  4X66 T;  5IYZ E;  3CWZ B;  4YSX A;  1NWM X;  4Q25 A;  4IDP A;  4UF0 B;  5HEJ A;  3ZMT B;  1X9B A;  2E9X B;  3RIF A;  1J5E T;  1OXZ A;  1YQ4 A;  2RPA A;  1GQE A;  2FJE A;  3GMI A;  3RC3 A;  4DV3 T;  3VHL A;  1HG2 A;  5HCJ A;  4O4L E;  4IDN A;  5JDM A;  3RKO A;  2A9U A;  1D1A A;  3CML A;  4HFD A;  3RI5 A;  2CXD A;  1S94 A;  4DUZ T;  2UUA T;  4K0K T;  3AEG A;  1MIV A;  2M6B A;  4DR2 T;  2LSY A;  4PK4 A;  1SHZ C;  2GK9 A;  2NOX A;  3ZJ2 A;  1DU2 A;  2XQA A;  3EAM A;  4U2Z A;  5KX5 E;  2ZM6 T;  2EHO D;  2HPL A;  3AA1 B;  2XTL A;  3EAB A;  3L39 A;  4ASK A;  4LF9 T;  3AAA B;  1SUM B;  5JRC A;  2VWA A;  1WYB A;  4MAL A;  2Q9Q C;  2VK9 A;  5AQP B;  2M6I A;  4V1A v;  3MZK B;  3ESL A;  5LBM A;  3MA9 A;  4AQG A;  1ZOY A;  3QK6 A;  3CX8 B;  5FXW A;  4KMC A;  3RF1 A;  5LG4 A;  4O4I E;  2H7O A;  3Q5X A;  4EZ4 A;  5HWX A;  4UEL A;  4AKI A;  2Q9Q D;  3PUX F;  4M1P A;  4UIG A;  1U5P A;  3RYC E;  2QGS A;  1HF8 A;  5IWA T;  4LF7 T;  3AED A;  4AKG A;  3A5X A;  3EHZ A;  1OED E;  1HNX T;  4JEH B;  2V7M A;  3FB2 A;  3O1J A;  5AQJ B;  5FXZ A;  2C5I T;  5J0Z A;  3FZK B;  4PFO A;  1MMG A;  4WBN E;  3AA7 B;  4O2A E;  2KND A;  4ZOL E;  5AQS B;  4BJM A;  5C8Y E;  3RIU C;  4N78 D;  1MMD A;  3I0O A;  4NUU A;  5ADX L;  2WZH A;  3SFD A;  4H9Q C;  2C5K T;  4IE6 A;  5AQM B;  3ZYL A;  4X64 T;  2XQ5 A;  2CHO A;  1XDP A;  3ONJ A;  4TV9 E;  3ZMV B;  2PG8 A;  2UUB T;  1H7C A;  2B76 A;  2UXN B;  1XMO T;  4G2A A;  3RHW A;  2NTY A;  3O4X E;  2JQ9 A;  4HGA A;  1AJ3 A;  4YT0 A;  4IDZ A;  4UVA B;  3BQL A;  4DBQ A;  5M4Y A;  3LBX A;  4OHF A;  2BG9 A;  2MAW A;  2E5V A;  5JRE A;  3LG7 A;  4XZC A;  5BR8 T;  4B3M T;  3GN5 A;  2NWB A;  3FBL A;  4U3C A;  3RH3 A;  1IAP A;  5CA1 E;  2X68 A;  4J2C A;  4CN1 A;  3DP7 A;  3GA8 A;  3CX7 B;  4HWI B;  3RX6 A;  4JI3 T;  4IE0 A;  1QLB A;  3AAI A;  5F5W A;  5HEG A;  1D1C A;  4O4H E;  2NW8 A;  3UQ4 A;  3I0Q A;  4ZI7 E;  3VKH A;  2N1G A;  2YDQ A;  4P1N A;  2EHO A;  3FHN A;  2XQY A;  2DWG A;  3N9N A;  4PJJ A;  5DAB A;  4P0A A;  3AE8 A;  4AKR B;  2OLT A;  4DND A;  3ZT5 A;  5CB4 E;  4JI5 T;  3N2K E;  3CQG B;  3VR9 A;  4IL4 A;  2DI4 A;  1IJ6 A;  2XQ9 A;  5HWY A;  1Y64 B;  2IIU A;  1MIW A;  2ES0 A;  1D1B A;  3I9W A;  4KX6 A;  3N9P A;  2AE9 A;  1UUS A;  4O4J E;  2C5J A;  4ERR A;  2XM2 A;  2A2F X;  4ISS A;  5J1G A;  5L3C B;  2VAS A;  1N36 T;  4AIU A;  2AXD S;  3H37 A;  2OA5 A;  5FP3 A;  3PDY A;  2N2N A;  3SFE A;  3UFE A;  4IDQ A;  2LOS A;  3ZCJ A;  4A56 A;  4I43 B;  4H9O C;  2YOE A;  3UUX B;  2V6Y A;  2W61 A;  4NXM T;  4MLK A;  4X1Y E;  3FZF B;  1SA0 E;  2XZE A;  3K8P C;  3X1D A;  3K1S A;  2HH7 A;  4OFZ A;  2ZMA A;  5IUX A;  2CWO A;  5LP6 E;  3KBU A;  4GKJ T;  1BR0 A;  4JLE A;  1FJG T;  4LFA T;  3ZMS B;  1HTJ F;  2JMK A;  3UU8 A;  3TKL B;  5L3D B;  5CFB A;  1T98 A;  3MK7 C;  3PUY F;  4KI0 F;  5ABE A;  5JQG E;  1I94 T;  4ZI3 C;  4A97 A;  2VQF T;  3W15 B;  4GOU A;  3E22 E;  3VRA A;  1WYC A;  2H88 A;  1KNR A;  3O1I A;  3PUQ A;  3ZT6 A;  5HXH A;  4YTM A;  3ETU A;  3I1A A;  4L5G A;  5L3F B;  1IBL T;  2PBI A;  5FYM A;  1QUU A;  4CXW A;  4GYS A;  5BMV E;  3E0Z A;  4TWF A;  3UU6 A;  1N32 T;  1BR2 A;  4NIQ A;  3AA0 B;  2RA1 A;  3OPC A;  2JQQ A;  3PUW F;  3AE1 A;  2J47 A;  3B13 A;  3EVY A;  3QUJ A;  4FJO A;  4HWH A;  3AE4 A;  5CA0 E;  2P9B A;  5ABF B;  2VL0 A;  2KMF A;  4JI8 T;  5JDN A;  2Y8D A;  4DR7 T;  3PJA A;  2OV9 A;  4GK5 E;  2D5U A;  3RRC A;  1T7S A;  2IML A;  2K5B B;  5FL0 A;  1XDO A;  3L3P A;  2BS3 A;  3P4P A;  2XQ4 A;  3NWI A;  3PUZ F;  3RYF E;  4CI3 B;  1OED A;  3RLF F;  4PK5 A;  5LBQ B;  3ZST A;  2WCA A;  2A72 A;  2V26 A;  3FZM B;  5LA6 E;  5TAO A;  3V5U A;  4DBR A;  4DR4 T;  4U31 A;  2CBI A;  4DR1 T;  3AB3 B;  2LLY A;  2V7I A;  2BZB A;  4U7I A;  4H9R C;  3RQU A;  5JH7 E;  3VKG A;  3AXJ B;  5FMN A;  2V8S V;  2XSB A;  2V7K A;  5AQT B;  5AQQ B; 
#chains in the Genus database with same CATH homology
 4WNK A;  3N2O A;  2CLY C;  4HTE A;  5LYJ E;  4QKN A;  3ZPO A;  4B6X A;  4IGU A;  4DMW A;  4IST A;  4PW8 A;  1V9D A;  3T8O A;  2W62 A;  2X66 A;  1UX4 A;  2VB6 A;  4AQF A;  4ZI2 D;  2W00 A;  2KT9 A;  1D0Z A;  3DJB A;  3SWH A;  1G8X A;  5LHH B;  2D0U A;  5EZY E;  3RRW A;  4H9N C;  3HKD E;  1FEW A;  5F8P A;  3ONX A;  1OWA A;  3PTR B;  1HS7 A;  4EZH A;  4YJ2 E;  3BQK A;  5HXE A;  2JMH A;  5L3E B;  3UUM A;  2J1D G;  4TX5 A;  5LCY A;  4QX7 B;  4DO0 A;  1D0Y A;  4PNI A;  4U72 A;  3ZJ1 A;  2L3L A;  3IF8 B;  4EOZ B;  4XAX B;  3ZYM A;  2LJL A;  4GK0 E;  1HFA A;  4U74 A;  3ZN1 B;  3EDU A;  4ZS2 A;  4O2B E;  2X9X A;  2KIN B;  3ZYK A;  2K9A A;  2XAH B;  4I50 E;  5LGU B;  3HKE E;  4HFV A;  4E7S A;  5LXT E;  4KUM B;  2LSJ A;  3OJA A;  1KK7 A;  4QXB B;  4OYJ A;  3UT5 E;  5F3J A;  4YJ3 E;  2WMO A;  3ZMU B;  4QXH B;  2XAS B;  4Z8X A;  4UF0 A;  5LNK A;  4BA9 A;  5AFU L;  3C64 A;  2CMR A;  2ZM2 A;  2SPC A;  3BQI A;  4L9I A;  3SOL A;  4GIW A;  5JDF A;  3N9O A;  2NW9 A;  4CQI A;  4OK0 A;  4ILU A;  2WM9 A;  3AA6 B;  3HKC E;  3SRZ A;  4PJL A;  1E1H B;  2X51 A;  2WWU A;  3OYX A;  1LKX A;  3ANW A;  1YKE B;  5FNV E;  5J2U E;  1MIY A;  4C90 A;  2VKO A;  1WRD A;  5KDM C;  5IHY A;  5FY0 A;  5LGT B;  2CCQ A;  2I59 A;  1KNZ A;  4ANJ A;  3OBV E;  2DNX A;  4X1K E;  2X9H A;  4QHO A;  1IZN B;  5JDG A;  1VRB A;  4MBQ A;  4MFR A;  5GON E;  3P7I A;  3SS1 A;  3ZC0 A;  5L2L A;  5EK2 A;  3KV4 A;  4HKA A;  1NAF A;  4TN7 B;  4IHJ E;  2LM9 A;  2KLQ A;  3JC6 D;  2HPJ A;  4CZZ B;  4I55 E;  2DCF A;  2BVM A;  4IE5 A;  4IIJ E;  1ZV4 X;  3KV9 A;  4EYU A;  4X1I E;  4PJM A;  2H7V C;  4OYK A;  3KDS E;  2WAU A;  2JRK A;  2A3D A;  4AQF C;  4ZI3 D;  3LBX B;  4JEU B;  3HR0 A;  2IC9 A;  2EHO C;  3PUS A;  4BAY B;  3UTK A;  3WAK A;  4I4T E;  4QXC B;  3KVB A;  3J7Y q;  3WI3 A;  4P09 A;  2BVL A;  4H63 V;  3ZEF B;  3IBP A;  2IAK A;  4EIW A;  3K3O A;  3DTO A;  4MHC A;  4ADZ A;  1ZKE A;  1MND A;  3RYH E;  3VU7 H;  3O9X A;  3NBX X;  3MAC A;  1UX5 A;  3B57 A;  2E9X A;  2RP4 A;  3CQX C;  3IEE A;  4AKL A;  2LSK A;  1VOM A;  3CPZ A;  3PUA A;  3PU3 A;  1YD8 G;  3BK9 A;  4UV9 B;  2XHE B;  5FXX A;  5JR9 C;  5LHI B;  4PFP A;  2CM0 A;  2WBL A;  3M65 A;  3NRY A;  2PFV A;  3UUL A;  5LOV E;  1X79 A;  5HXS A;  2NTX A;  4IE7 A;  2V1D B;  5LG4 A;  5HXR A;  4L0R A;  3HL6 A;  2XAF B;  3PE0 A;  5JDL A;  4H9S E;  2CLY B;  4JUY A;  4CXX A;  2JJ9 A;  3N2G E;  2LSG A;  5H6R B;  2ZM0 A;  3E08 A;  3LJC A;  2UXX B;  3U3I A;  4YLH A;  1HG5 A;  1YKH B;  3OKQ A;  2VKJ A;  4YHJ A;  2X0L B;  5JR9 A;  2MTQ A;  2B1E A;  2Z6E A;  5ETW A;  2DHR A;  2YIN A;  4WW0 A;  3C51 A;  4QX8 B;  2CEA A;  3ZN0 B;  2LE8 A;  2BDE A;  2KZ7 B;  3ZMZ B;  3VKG A;  3V5S A;  1UCU A;  4UV8 B;  1O3X A;  2XUE A;  3ZC1 A;  3CX6 B;  4DVD A;  3KV6 A;  3RYI E;  2NW7 A;  3S4U A;  1B7T A;  3KFW X;  4TV8 E;  1BR4 A;  2YK0 A;  4GYR A;  4UVC B;  3R84 B;  2DLR A;  4EYY R;  4UEM A;  3ANW B;  4EB6 E;  3HKB E;  4E7Z A;  3JC6 C;  3MKD A;  1Z0P A;  2WMN A;  4DMV A;  4HN9 A;  2M67 A;  4PJN A;  5LHG B;  3C4Z A;  2LSI A;  2LHR A;  2XAJ B;  2YEV C;  4KP3 C;  4IE4 A;  2X9Y A;  4X20 E;  5HYA A;  5L3B B;  1HCI A;  4K0U A;  2L9Q A;  5HXC A;  4BJN A;  2D0T A;  2W63 A;  3KIN B;  3N5L A;  5DJQ C;  2PJQ A;  3Q9D A;  3C50 A;  2ACX A;  2QA7 A;  4FI5 A;  2IC6 A;  4HE8 A;  4HEA A;  4O8S A;  4UVB B;  2D2S A;  2XAG B;  3KV5 A;  2YU2 A;  4PAG A;  3R6N A;  2MOZ A;  3C4X A;  2E8I A;  4AI6 A;  3N9L A;  5JR9 B;  1MMA A;  2KWH A;  3MJX A;  3CVR A;  3Q5W A;  5JDQ A;  3UUN A;  4TUY E;  2XAQ B;  3KVA A;  3LK4 2;  4EXT A;  5A1L A;  2C0S A;  3O1H A;  4KBM B;  3IHR A;  3LFM A;  4AXP A;  4P0B A;  3J9X 1;  4ZI2 C;  3GN5 B;  4YFS A;  5HAX A;  2LOP A;  3AVR A;  3EDV A;  5LGN B;  3MXZ A;  5KMG P;  4CXY A;  3CKD A;  4TZ4 C;  1FMV A;  3NZP A;  3AVS A;  2WSS V;  3RPU A;  5LJN A;  2CWY A;  5L3G B;  2X67 A;  4EAH A;  1S35 A;  3ETV A;  3Q2M A;  2VL8 A;  5EK3 A;  4G63 A;  5JDH A;  1QSD A;  3ZLI A;  3D0T A;  1WLX A;  3HI2 A;  2W0G A;  3GWH A;  3LK3 B;  3K3N A;  3P8C D;  5DQV A;  5FY7 A;  4F6R C;  5FY1 A;  2ZLY A;  4ZS3 A;  3PUR A;  1G73 A;  2ODV A;  1LVK A;  5EK4 A;  2H3R A;  4WBO A;  4CI1 B;  3F2E A;  1MMN A;  1IJ5 A;  2KXP B;  3PU8 A;  2IW5 B;  1WR6 A;  1LVF A;  5H6Q B;  3KBT A;  5JRC B;  2LT3 A;  3QC9 A;  1MNE A;  3HA4 A;  4PK6 A;  2LEH A;  2K24 A;  3AAE B;  1CUN A;  1U4Q A;  3F31 A;  4QWN B;  1FMW A;  3RC8 A;  3L09 A;  2Y48 B;  3FBZ A;  3N9M A;  5JVD E;  4ZHQ E;  3N9Q A;  3PUG A;  3I9Y A;  2ZM8 A;  2L8K A;  3OYZ A;  2YU1 A;  1ZEE A;  1EZ3 A;  4XBF B;  1YW0 A;  3FXD B;  2E9X C;  2EHO B;  3ZCI A;  1LRZ A;  2ODU A;  2X9W A;  3WAJ A;  2CXL A;  2KWI B;  1HX8 A;  2CA5 A;  5J2T E;  3FXE B;  2VKH A;  1BR1 A;  2G0U A;  2VKD A;  1ZHC A;  3F57 A;  3K3Q C;  2V7J A;  3CQC B;  2CXF A;  2MBG A;  2MYS A;  3H3A A;  4UXN B;  2Q9Q B;  1FIO A;  3NRX A;  5DQW A;  5E0O A;  2DWK A;  2LHN A;  4C91 A;  2CE7 A;  2Y6X A;  3LK2 B;  2V7L A;  1US7 B;  3C4W A;  2N9D A;  2Q9Q A;  3EUH A;  2K48 A;  3U78 A;  2NP9 A;  5LJM A;  4NUV A;  1D0X A;  5FXV A;  2JPF A;  4H9P C;  2E9X D;  4H63 H;  4CI2 B;  3C98 B;  3NZQ A;  5IYZ E;  3CWZ B;  1NWM X;  4UF0 B;  3ZMT B;  2E9X B;  1OXZ A;  3GMI A;  3RC3 A;  3VHL A;  1HG2 A;  4O4L E;  5JDM A;  3RKO A;  3CML A;  1D1A A;  2CXD A;  1S94 A;  1MIV A;  2LSY A;  4PK4 A;  1SHZ C;  2GK9 A;  2NOX A;  3ZJ2 A;  2EHO D;  2HPL A;  3AA1 B;  2XTL A;  4AKH A;  4ASK A;  3AAA B;  5JRC A;  2VWA A;  1WYB A;  4MAL A;  2Q9Q C;  2VK9 A;  4V1A v;  3MZK B;  3ESL A;  5LBM A;  3MA9 A;  4AQG A;  3QK6 A;  3CX8 B;  5FXW A;  4KMC A;  4O4I E;  2H7O A;  3Q5X A;  4EZ4 A;  5HWX A;  4UEL A;  4AKI A;  2Q9Q D;  4M1P A;  4UIG A;  1U5P A;  3RYC E;  2QGS A;  1HF8 A;  4AKG A;  3A5X A;  4JEH B;  2V7M A;  3FB2 A;  3O1J A;  5FXZ A;  2C5I T;  4PFO A;  1MMG A;  4WBN E;  3AA7 B;  4O2A E;  2KND A;  4ZOL E;  4BJM A;  5C8Y E;  5KX5 E;  4N78 D;  1MMD A;  3I0O A;  4NUU A;  5ADX L;  4H9Q C;  2C5K T;  4IE6 A;  3ZYL A;  4TV9 E;  3ZMV B;  2PG8 A;  1H7C A;  2UXN B;  4G2A A;  2NTY A;  3O4X E;  1AJ3 A;  4HGA A;  4IDZ A;  4UVA B;  3BQL A;  4DBQ A;  5M4Y A;  3LBX A;  4OHF A;  5JRE A;  3LG7 A;  4XZC A;  3GN5 A;  2NWB A;  3FBL A;  3RH3 A;  5CA1 E;  1IAP A;  2X68 A;  4J2C A;  3DP7 A;  3GA8 A;  3CX7 B;  3RX6 A;  4IE0 A;  3AAI A;  1D1C A;  4O4H E;  2NW8 A;  4ZI7 E;  3I0Q A;  3VKH A;  2N1G A;  2EHO A;  3FHN A;  2XQY A;  2DWG A;  3N9N A;  4PJJ A;  5DAB A;  4P0A A;  4AKR B;  4DND A;  5CB4 E;  3N2K E;  3CQG B;  2DI4 A;  1IJ6 A;  5HWY A;  1Y64 B;  1MIW A;  2ES0 A;  1D1B A;  3I9W A;  3N9P A;  4O4J E;  2C5J A;  4ERR A;  4ISS A;  2A2F X;  5J1G A;  5L3C B;  2VAS A;  3H37 A;  2OA5 A;  5FP3 A;  3PDY A;  2N2N A;  3ZCJ A;  3UFE A;  2LOS A;  4A56 A;  4I43 B;  4H9O C;  3UUX B;  2W61 A;  4MLK A;  4X1Y E;  1SA0 E;  3K8P C;  2HH7 A;  4OFZ A;  2ZMA A;  2CWO A;  5LP6 E;  3KBU A;  1BR0 A;  4JLE A;  3ZMS B;  1HTJ F;  2JMK A;  3TKL B;  5L3D B;  1T98 A;  3MK7 C;  5JQG E;  4ZI3 C;  3W15 B;  4GOU A;  3E22 E;  1WYC A;  3PUQ A;  3O1I A;  5HXH A;  5L3F B;  3ETU A;  3I1A A;  4L5G A;  2PBI A;  5FYM A;  1QUU A;  4CXW A;  4GYS A;  5BMV E;  3E0Z A;  1BR2 A;  3AA0 B;  2RA1 A;  3QUJ A;  2JQQ A;  5CA0 E;  3B13 A;  3EVY A;  4FJO A;  2P9B A;  2KMF A;  5JDN A;  2Y8D A;  4GK5 E;  2D5U A;  3RRC A;  2K5B B;  3L3P A;  3RYF E;  4CI3 B;  4PK5 A;  5LBQ B;  2A72 A;  2V26 A;  5LA6 E;  5TAO A;  3V5U A;  4DBR A;  3AB3 B;  5JH7 E;  2V7I A;  2BZB A;  4H9R C;  5FMN A;  2V7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...