2KINB

Kinesin (monomeric) from rattus norvegicus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
b'AKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLDGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KINESIN
publication title X-ray structure of motor and neck domains from rat brain kinesin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 29
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1997-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.980 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kinB01
2KINB
chains in the Genus database with same CATH superfamily
3C98B 3CVRA 3VHLA 5HCJA 5IYZE 3EDUA 2LOPA 4HFCA 3J7Yq 3SOLA 2XZEA 1BR2A 4YXDA 4LMLA 4I55E 5JR9C 5LGUB 4IIJE 5HCMA 4EYUA 3M3ZB 5ABFB 3VKGA 2ZM6T 5HXSA 4C90A 2PFVA 1AJ3A 2CXFA 3UUNA 4LFBT 1DU2A 3N9MA 2NOXA 1M7KA 4EAHA 3ZLIA 1EZ3A 2V7KA 3HKDE 4IDNA 4IL9A 1YW0A 4ILBA 2BKOA 3RKOA 4JV5T 3NRYA 4A97A 4HWHA 4LMJA 1NENA 4JI3T 4IL4A 2YDRA 2EHOB 2RA1A 3HR0A 2UUAT 3MKDA 3RLFF 3PJAJ 2YN6A 5L4EA 2YKSA 1MIVA 2UUBT 3AAAB 2N1GA 2WQYA 3Q9DA 2YINA 4C91A 5J2TE 4TV8E 5AQKB 1HNWT 4DV0T 4XAXB 1QUUA 1HNZT 4U7IA 2X0LB 5AQTB 3UU3A 2Y6XA 2KZ7B 3WI3A 5AQJB 3CMLA 1ZKEA 2I6HA 1WR0A 5L47A 4BAYB 4KMCA 5F5WA 1T8BA 4DIDB 1NEKA 4OHFA 1M62A 4ZI3C 4GK0E 3ZMZB 4TWDA 4H63H 3ZPOA 4B6XA 2LHRA 4X64T 2Q9QA 4Z8XA 4NUUA 3F31A 5FKYA 1MMAA 3EVYA 4PAGA 3RIAA 2FUPA 4O4IE 3HKCE 5JH7E 4FI5A 5C2TA 4LFAT 3ZYLA 2LRLA 4ZEYA 4L9IA 1SUMB 5FVLA 3H37A 2GK9A 3RYHE 3S4UA 2B1EA 3FHNA 2XAGB 1LVKA 4TUYE 3Q2MA 2DL1A 4ISSA 3P8CD 3ZMSB 4G63A 3TLSA 5FMNA 2YDSA 3ZKRA 4E7SA 3T1YT 1UUSA 2Q9QD 2CA5A 2YK0A 3RQUA 4GIWA 3TLWA 5AQFB 3UUBA 3H3AA 2LKGA 4HFIA 2WDRA 5IWAT 3TLVA 2X0YA 4V1Av 2XHEB 4PFOA 5LOVE 3CIRA 2YEVC 2Q9QB 4AQFC 1KFYA 1VCSA 3ZEFB 2V7JA 5LHGB 2UUCT 2UXDT 3RI5A 4F8HA 2W4XA 3HL6A 4PFPA 4P0BA 2LHNA 3UU5A 2WU5A 3I0QA 4KHZF 5KX5E 2KXPB 3G06A 4EOZB 4GK5E 2XQYA 3EDVA 5AQNB 4QXBB 3ZC1A 2CCQA 4PK5A 4NXNT 4HE8A 2CBIA 3AAEB 4YHJA 2JQKA 4ILAA 2NW9A 4AQYT 1W0BA 4KX6A 5LXTE 1OEDA 4IE7A 1ZHCA 1MMNA 4IREA 5CFBA 3DP7A 2FJAA 3RKGA 2E8IA 2BBHA 2QGSA 4HWCA 4OX9T 4TN7B 3RH3A 4H9QC 3P50A 5JRCB 3AE5A 2CLYC 2I59A 4DBQA 3KBUA 4DR4T 2IC9A 2CWOA 1WFDA 5LJMA 4IT4A 3UFEA 2ES0A 2WBLA 3PU3A 1XNRT 2KT9A 4H9NC 3K3NA 3HA4A 2DI4A 3PUWF 3NBXX 3AE8A 1XDPA 3X1DA 4QX8B 3UT5E 2UXBT 2E9XA 1OEDE 2VL0A 3A7MA 4DBRA 4UEMA 2LRKA 3ZMUB 3UQ4A 5L3EB 1OEDB 3AEBA 3VR9A 5J0ZA 4NUVA 3NZQA 3C4ZA 1ZV4X 3R6NA 4CN6A 5JR9B 1KK7A 1IBKT 2JJ9A 4ANJA 3ONXA 3ANWA 3AA7B 2CHOA 3K1SA 4EZHA 5LBQB 4LMKA 3Q5XA 1ZOYA 3OYXA 5JDMA 3L09A 3R84B 5HEJA 3H3MA 2E9XD 4TZ4C 2BDEA 4U72A 2Q9QC 1S94A 2WMOA 4ADZA 2HN1A 1YKHB 2W2UA 3ETUA 2V26A 3U3IA 3O1HA 3JC6D 2JQ9A 3JADA 3AECA 3UTKA 4HFDA 2D2SA 4KUMB 2X66A 2SPCA 3N9OA 2E9XB 4HWDA 1FJGT 3OVUA 2BVLA 4O2AE 3N2OA 3IEEA 4UVCB 5JDGA 3P4SA 5EZYE 2N9DA 2CEAA 4YSXA 4UVBB 3RYFE 3K8PC 4O8SA 4IE5A 3NZPA 1Z8UA 5LG3A 2K24A 2ACXA 1UURA 2XQ9A 5DQVA 4UVAB 2VK9A 2CWYA 2CRBA 2XUEA 2W00A 3ANWB 4IDZA 2PBIA 4JI1T 3FXDB 3N9PA 4AXPA 4K0UA 4H9PC 1ZP0A 5L3GB 2NWBA 2OLTA 3EHZA 3AB3B 4CXYA 4F6RC 2XQ7A 2E5VA 5LBMA 4WYVA 4JI2T 1T98A 4HGAA 4WZXA 5E0OA 1J5ET 4QH1A 4QHOA 2XQAA 1VCTA 1Y64B 2CPTA 4YSZA 2ODUA 2MPKA 2UXCT 4U3CA 4CI2B 3LK2B 3WAJA 5AQSB 2K48A 2LSKA 1I94T 4JI5T 1IZNB 1H7CA 2MAWA 2WY2A 5ABHA 4OK0A 3ZN0B 3RIFA 4N78D 4JI0T 4EV6A 3FZMB 5CB4E 2E2AA 2LM2A 5FY7A 4DV5T 3L39A 4UELA 1N34T 4LF8T 1OEDC 2LLYA 4O4LE 4HFHA 3LBXA 3FZFB 2XQ4A 3ZCJA 4EIWA 3WAKA 5LB7B 2X68A 1SE7A 3OBVE 3AEAA 3RX6A 2BKNA 2VKJA 2I0MA 2XTLA 3CPZA 5CA1E 2NTYA 2XQ8A 3ONJA 1XNQT 4AQGA 3PUYF 5HXEA 3Q5DA 2XAQB 4NPPA 3EAMA 3LK3B 2VVNA 3HKBE 3N9NA 3KVAA 4ASKA 2V7LA 4PK4A 5EK3A 4JI6T 5AQHB 1HX1B 2LSJA 2ODVA 3PUAA 5L3BB 2E9XC 4QXHB 4I0UA 4B3MT 2JQHA 1ZEEA 5FXWA 2A3DA 4P0AA 2KSRA 4DV2T 2DHRA 4LF6T 1UX5A 2V6YA 2MTQA 3ZSTA 4L5GA 3JC6C 3LBXB 3PV0F 4TNWA 3KV5A 2CLYB 4DR7T 3SRZA 3LK42 3C4XA 4MBQA 3ETVA 5JVDE 4DV4T 1QLBA 1G73A 2JMHA 1B7TA 3AVSA 3KBTA 1XWMA 4U74A 2XQ6A 4AKIA 1KNPA 4AISA 1XDOA 1IBMT 4PNIA 1MIYA 2YOEA 4BJMA 4GYSA 4DV1T 3OKQA 3B13A 2ZM0A 1OXZA 2W0GA 2L3LA 2HH7A 4OYKA 5LGNB 2MBGA 3SFDA 4TX5A 3W15B 3PUGA 3OPCA 4ISTA 3IF8B 1KF6A 3BQLA 1E2AA 3E08A 3P7IA 4U31A 2LJLA 1JNZA 2BG9A 4X20E 3RRCA 4GKKT 3K3OA 3IA3A 3PUXF 5HWXA 3UULA 2Z6EA 3AE6A 4A98A 3O4XE 4QH5A 4H9SE 3NRXA 2UXXB 4X5TA 4WW0A 3HI2A 3AEFA 4I4TE 3AEEA 2BBJA 1FIOA 4X1YE 2UU9T 3RPUA 2D5UA 2WS3A 3KINB 2WZIA 4CXXA 3GN5A 4MALA 2LM9A 2LSGA 2VKOA 2D0UA 3ZMTB 1T72A 2XAFB 1HCIA 3ZSSA 4YTMA 2HN2A 2V1DB 5J2UE 1HG5A 3ZJ1A 3KV9A 1MNEA 3ZC0A 2QVAA 4CI3B 1KNRA 5AQGB 5CJ5A 4YT0A 1IAPA 3FZLB 4DR6T 2X9YA 2BG9E 3N5LA 3ESLA 3KVBA 3CQXC 3FXEB 1HG2A 4BA9A 2KWHA 3N9LA 1HS7A 5JDNA 4PW8A 2K5BB 4MLKA 2FJBA 3PUZF 4AKRB 3F57A 2ZM2A 3CQCB 5J1GA 1V9DA 2A2FX 4UXNB 3J9X1 1BR4A 4KBMB 4HFEA 4AKHA 3QB5A 1Y01A 4P1NA 4EB6E 4CZZB 2CXDA 3A5XA 4AKLA 1YKEB 3GMIA 3ZMVB 4DVDA 5KDMC 4IGUA 4LF7T 2PTFA 3HKEE 3BK9A 4ERRA 1VRBA 3QUJA 2KMFA 4PJJA 2H88A 4A56A 3UQ7A 4JUYA 3RC8A 4JI4T 3DTOA 5HYAA 2W63A 2DWKA 4O4JE 4IHJE 2FJEA 2BS2A 3A8YC 3AEGA 1US7B 2AXDS 3CX8B 2C0SA 4TWHA 2CMRA 3T1HT 3FBLA 2WWUA 4IE4A 4LF9T 3BQIA 4O4HE 2KINB 2ACZA 2V7IA 3MXZA 2R6GF 2YU1A 3MA9A 2IW5B 4TV9E 3TLUA 4Q25A 4EZ4A 2D9DA 2K9AA 4U33A 2VKHA 4H63V 1FMVA 2W67A 1R8IA 3QNUA 4QX7B 2JRKA 3KV4A 1LVFA 2W61A 2W66A 3E0ZA 1YD8G 5LHHB 1U4QA 2X9HA 4A5XA 4DV6T 2WU2A 2CBJA 5ETWA 3AVRA 5GONE 4U2YA 4Z91A 3SS1A 2X51A 5IUXA 4PJNA 3RYIE 2OV9A 2LOSA 4MHCA 4OFZA 5L3FB 4B3TT 3UUXB 2M6IA 2HPJA 3LJCA 1SA0E 2XASB 4LF5T 5BMVE 3B57A 3Q5EA 3ZN1B 2X0HA 5FL0A 3AEDA 3ZT5A 1UX4A 2AE9A 4M1PA 2BG9C 1N36T 2C5KT 4DNDA 2WZHA 2IIUA 3UU8A 5FVKA 2XAHB 5AFUL 4CI1B 2IDOB 2BVMA 2BS3A 2K3WA 4CN1A 2XM2A 1KEYA 3PJAA 3T8OA 1YQ3A 3AE1A 2NR4A 5LMUT 3RIUA 2VKDA 3QB5K 4U7YA 3L8RA 4B3ST 2XM1A 2UXNB 2PG8A 2YU2A 2XJ7A 3C50A 5FP3A 3ZT7A 5ABFA 2WWVA 4QXCB 3MZKB 3RC3A 1D1BA 4G2AA 3DJBA 5LJNA 4AI6A 5AQQB 3I1AA 3JCFA 1FEWA 5AQOB 5FNVE 4J2CA 2V5CA 2VB6A 5FXZA 5ABGA 3V5UA 2X9XA 4IE6A 3QC9A 3AXJA 2OA5A 1J5WA 5KXJA 1XMQT 2XSAA 4DR1T 2EHOA 4EXTA 1MNDA 4JI7T 2ZM8A 4YTPA 3K3QC 4QKNA 1L0VA 2F4VT 5HEGA 2V6XA 5HEOA 4UIGA 3EI0A 3I0OA 5FXXA 3RYCE 3I9WA 3PU8A 4HWIB 3PUQA 5HXRA 3EUHA 2DCFA 1I6ZA 5F3JA 1WYBA 2XPKA 3ZYKA 3CX7B 3AA1B 4XZCA 5KMGP 2VWAA 3AA0B 2VQFT 4I50E 3ZT6A 1D0ZA 1MIWA 2LE8A 5EK2A 4AIUA 4ZOLE 2WM9A 3Q5WA 2EHOD 4DR3T 4KHPT 3TLTA 3ZJ2A 4H9OC 1UK5A 1N33T 4I43B 5TAOA 5JTGA 2WDQA 1NWMX 5DJQC 2IMLA 2MYSA 2QYWA 3JAFA 3LFMA 5H6QB 4HWFA 3AXJB 4H9RC 2DNXA 3AE9A 4NIQA 3SWHA 4GOUA 1YQ4A 1S35A 4OYJA 2X67A 1HF8A 1T7SA 2KLQA 4PK6A 2BKPA 5L2LA 2VQET 2RP4A 4X1KE 3C64A 5AQIB 5H6RB 5DQWA 2X9WA 3BQKA 5FY1A 3AE4A 1KNZA 5LNKA 1E7PA 3UU6A 4YJ3E 4ILCA 2CXLA 3CK6A 3VU7H 1IJ6A 1SHZC 1IJ5A 3RQWA 3JAEA 4GKJT 4TNVA 3ZCIA 1X9BA 2KWIB 4X66T 4HFBA 3PDYA 2Y48B 3IHRA 1WLXA 2XSBA 2QRXA 2LSYA 1UCUA 5C3JA 3OTOT 3UU4A 2JQQA 2WAUA 3PE0A 2NW8A 1BR1A 2W62A 5JDHA 2NP9A 2H89A 2MOZA 2V6YB 3UFGA 2P9BA 4YLHA 4E7ZA 3P4QA 4QWNB 3NVOA 3O1IA 2XAJB 3MJXA 5ADXL 1WR6A 3UUMA 2KNDA 4DV3T 3RIUC 4ZZCA 3CKDA 5DABA 5AQVB 3P4WA 3N2GE 4HKAA 4X62T 4LFCT 1N32T 5F8PA 2FJDA 2VL8A 2D0TA 2RPAA 4EYYR 4EEDA 4CXWA 3RRWA 1E1HB 4DUYT 1W09A 2WP9A 5AQUB 1LRZA 5JRCA 2IC6A 4HN9A 1U5PA 4IDPA 2M6BA 5FYMA 3E22E 5HXCA 5C8YE 2CE7A 4TWFA 1Z0PA 3TKLB 2BG9B 4HTEA 3AE3A 5LGTB 2IUBA 4YY3T 5HXHA 3O9XA 1D0YA 3VKHA 2E5LT 4IDOA 1BR0A 4JYAT 4ZS3A 2YDQA 4DR2T 2LEHA 4LF4T 2LSIA 3PUSA 1G8XA 4X65T 2EHOC 2JPFA 3MK7C 3MACA 3GN5B 4L0RA 2V8SV 5LG4A 2NW7A 4U2ZA 3VRBA 2XQ3A 3KV6A 5M4YA 3FZHB 4YJ2E 2M67A 2IAKA 1WYCA 4ILUA 2A72A 1D1AA 4UF0A 4WBNE 4DUZT 5AQMB 2QA7A 3D0TA 5JREA 5JR9A 2J62A 3NWIA 4ZS2A 3V5SA 3VR8A 4UV8B 3EABA 2H7OA 3PTRB 2PJQA 4XBFB 3VRAA 2C5JA 2JIWA 3U78A 2LT3A 1QSDA 2DWGA 3FZKB 3IBPA 4CQIA 4ZI7E 2BS4A 1HR0T 4FJOA 2J1DG 2CHNA 4ZI2D 4IDQA 4DMWA 4EGWA 1CUNA 2VVSA 3KDSE 3M65A 3RHWA 1MMDA 2FBWA 3SFEA 1UGOA 1IBLT 3I9YA 4UV9B 1W0AA 1HX8A 4YTNA 3AE2A 4DO0A 4PJLA 4DMVA 3PURA 3O1JA 3OYZA 3AAIA 4ZHQE 3L3PA 4JI8T 2J47A 3ZYMA 3AE7A 2A9UA 5FL1A 1JNRA 2G0UA 4HFVA 4COFA 5LMNT 2BZBA 5LHIB 3FBZA 1WCRA 2WDVA 3GA8A 2NTXA 4X1IE 5L3DB 4BJNA 4UF0B 1NAFA 4WBOA 1XZYA 5EK4A 2C5IT 5LA6E 5JDLA 1CHUA 5JDQA 3QOFA 1W9RA 2V7MA 3LSVA 3CQGB 5LYJE 2WSSV 4HEAA 5L4HA 4Z90A 4NXMT 4ZZBA 1J1JA 3C4WA 5AQPB 4GYRA 4JLEA 2H3RA 5FXVA 3RGLA 1YXRA 5ABEA 1O3XA 3FB2A 5AQRB 5HEUA 2Y8DA 3P4PA 4O2BE 5A1LA 3KFWX 2DLRA 2L8KA 4IE0A 5JDFA 2ZMAA 3C51A 5AQLB 2XQ5A 5FY0A 5IHYA 2VURA 2HHHT 4KI0F 1WRDA 4JEUB 3N2KE 5LCYA 1HTJF 3RF1A 3P4RA 4KP3C 2WMNA 4ZI3D 3B5MA 4MFRA 2H7VC 2ZLYA 2WCAA 3CWZB 4K0KT 1D1CA 2B76A 3NKZA 1XMOT 1OWAA 3F2EA 4EEBA 2IHR1 3PUVF 4UR9A 3QK6A 1D0XA 5L3CB 2WB5A 4DR5T 4WNKA 5JQGE 3OJAA 2N2NA 5BR8T 4ZXLA 5CA0E 4AQFA 1GQEA 4YSYA 2CM0A 1X79A 1MMGA 3LG7A 4QH4A 2L9QA 4DV7T 1LKXA 3GWHA 5HWYA 3ABVA 4AKGA 2VASA 1HFAA 2J4GA 4YFSA 2LKHA 2V5DA 4PJMA 5CGMA 3ONLC 1FMWA 3CX6B 3LDQB 4JEHB 4B3RT 5LP6E 4ZI2C 5HAXA 2HPLA 5HEHA 4CN4A 2XY8B 3AA6B 1VOMA 4JBWF 2JMKA 4YHHT 3N9QA 1HNXT 4P09A
chains in the Genus database with same CATH topology
2A2FX 4UXNB 3C98B 3CVRA 3J9X1 4ADZA 1YKHB 3VHLA 2Y48B 3ETUA 2V26A 1BR4A 3U3IA 3O1HA 4KBMB 5IYZE 3IHRA 3EDUA 1WLXA 2LOPA 4AKHA 4EB6E 3J7Yq 3SOLA 2LSYA 4CZZB 2CXDA 3JC6D 3A5XA 1UCUA 1BR2A 4AKLA 3UTKA 1YKEB 3GMIA 3ZMVB 2D2SA 4KUMB 4DVDA 2X66A 5KDMC 2SPCA 3N9OA 4IGUA 4I55E 2JQQA 2WAUA 3HKEE 3BK9A 2E9XB 4IIJE 5JR9C 4ERRA 1VRBA 3QUJA 2KMFA 4PJJA 3PE0A 4A56A 4EYUA 2NW8A 1BR1A 4JUYA 3VKGA 2W62A 5JDHA 3RC8A 2BVLA 2NP9A 4O2AE 3DTOA 2MOZA 5HXSA 2W63A 5HYAA 2DWKA 2P9BA 3IEEA 3N2OA 4O4JE 4UVCB 4YLHA 2PFVA 4C90A 5JDGA 4E7ZA 1AJ3A 4QWNB 2CXFA 5EZYE 4IHJE 2N9DA 3O1IA 2CEAA 3UUNA 1US7B 2XAJB 3N9MA 3CX8B 4UVBB 3MJXA 3RYFE 2NOXA 3K8PC 4O8SA 4IE5A 5ADXL 2C0SA 4EAHA 3ZLIA 1WR6A 3UUMA 1EZ3A 2CMRA 2KNDA 3FBLA 2V7KA 2WWUA 3NZPA 4IE4A 3HKDE 2K24A 3CKDA 1YW0A 2ACXA 3BQIA 4O4HE 5DQVA 4UVAB 2KINB 5DABA 2V7IA 2VK9A 2CWYA 3MXZA 3RKOA 2XUEA 3N2GE 4HKAA 2YU1A 2W00A 3ANWB 4IDZA 2PBIA 3NRYA 3FXDB 3N9PA 3MA9A 4AXPA 2IW5B 4K0UA 4TV9E 4H9PC 5F8PA 2VL8A 4EZ4A 5L3GB 2D0TA 4EYYR 2NWBA 4CXWA 3RRWA 1E1HB 2K9AA 2VKHA 2EHOB 3AB3B 2RA1A 4CXYA 4F6RC 4H63V 3HR0A 1FMVA 5LBMA 1LRZA 4QX7B 5JRCA 3MKDA 2JRKA 2IC6A 3KV4A 1T98A 4HGAA 4HN9A 1LVFA 1U5PA 5E0OA 2W61A 4QHOA 5FYMA 3E22E 5HXCA 1MIVA 5C8YE 1Y64B 2CE7A 3AAAB 2N1GA 3E0ZA 1Z0PA 1YD8G 3Q9DA 3TKLB 2YINA 4C91A 2ODUA 5J2TE 4TV8E 4CI2B 4XAXB 3LK2B 4HTEA 1QUUA 5LHHB 3WAJA 1U4QA 2X0LB 2K48A 2X9HA 2LSKA 2Y6XA 5LGTB 1IZNB 2KZ7B 3WI3A 5HXHA 1H7CA 3O9XA 3CMLA 1D0YA 1ZKEA 3VKHA 4OK0A 5ETWA 3ZN0B 4BAYB 3AVRA 1BR0A 5GONE 4N78D 4KMCA 3SS1A 2X51A 4ZS3A 5CB4E 4PJNA 4OHFA 2LEHA 3RYIE 2LSIA 4ZI3C 4GK0E 3ZMZB 3PUSA 2LOSA 4H63H 4MHCA 3ZPOA 4OFZA 5L3FB 4B6XA 5FY7A 1G8XA 2LHRA 2EHOC 3UUXB 4UELA 2JPFA 2Q9QA 3MK7C 4Z8XA 3MACA 3GN5B 4NUUA 4L0RA 3F31A 5LG4A 2HPJA 3LJCA 1MMAA 4O4LE 2NW7A 3EVYA 1SA0E 2XASB 3KV6A 4PAGA 3LBXA 5M4YA 4YJ2E 2M67A 2IAKA 1WYCA 5BMVE 3B57A 2A72A 4ILUA 3ZN1B 1D1AA 4UF0A 4WBNE 4O4IE 2QA7A 3HKCE 3D0TA 1UX4A 5JH7E 3ZCJA 4M1PA 5JREA 5JR9A 4FI5A 4EIWA 4ZS2A 2C5KT 3V5SA 3WAKA 4DNDA 4UV8B 2H7OA 3PTRB 2X68A 2PJQA 4XBFB 2C5JA 3ZYLA 3U78A 2LT3A 4L9IA 2XAHB 5AFUL 4CI1B 1QSDA 2DWGA 3IBPA 4CQIA 2BVMA 3H37A 3OBVE 4ZI7E 2GK9A 3RYHE 4FJOA 3RX6A 2J1DG 4ZI2D 3S4UA 3T8OA 2B1EA 2VKJA 3FHNA 2XAGB 2XTLA 3CPZA 4DMWA 1LVKA 5CA1E 2NTYA 4TUYE 3Q2MA 4ISSA 1CUNA 3P8CD 3KDSE 3M65A 4G63A 3ZMSB 3PDYA 5FMNA 2VKDA 4AQGA 4E7SA 1MMDA 2Q9QD 5HXEA 2CA5A 2XAQB 3LK3B 2YK0A 3I9YA 3HKBE 3N9NA 4UV9B 4GIWA 3KVAA 4ASKA 1HX8A 2V7LA 4DO0A 4PJLA 4PK4A 4DMVA 3H3AA 3O1JA 3OYZA 3PURA 5EK3A 2UXNB 2LSJA 2ODVA 3AAIA 3PUAA 5L3BB 2PG8A 4ZHQE 2YU2A 2E9XC 3L3PA 4QXHB 3C50A 5FP3A 3ZYMA 4V1Av 2XHEB 4PFOA 1ZEEA 5FXWA 2A3DA 5LOVE 2G0UA 4HFVA 2YEVC 2Q9QB 4P0AA 4AQFC 2DHRA 4QXCB 3MZKB 3RC3A 2BZBA 1D1BA 1UX5A 5LHIB 2MTQA 3ZEFB 2V7JA 3FBZA 4G2AA 3DJBA 4L5GA 3GA8A 5LHGB 2NTXA 5LJNA 3JC6C 4X1IE 5L3DB 3LBXB 4BJNA 4AI6A 3KV5A 4UF0B 1NAFA 3I1AA 2CLYB 3SRZA 3LK42 3HL6A 4WBOA 3C4XA 4PFPA 5EK4A 4MBQA 4P0BA 1FEWA 3ETVA 2LHNA 2C5IT 5LA6E 5JVDE 5FNVE 4J2CA 5JDLA 3I0QA 2VB6A 5FXZA 5KX5E 1G73A 2KXPB 2JMHA 1B7TA 3AVSA 3KBTA 3V5UA 5JDQA 2X9XA 2V7MA 4EOZB 4U74A 4GK5E 4IE6A 4AKIA 3CQGB 5LYJE 2WSSV 2XQYA 4HEAA 3EDVA 3QC9A 4QXBB 3ZC1A 2CCQA 2OA5A 4PNIA 1MIYA 4BJMA 4GYSA 4PK5A 3C4WA 4GYRA 4HE8A 4JLEA 3OKQA 2EHOA 3B13A 2ZM0A 1OXZA 2H3RA 2W0GA 3AAEB 4YHJA 2L3LA 2HH7A 5FXVA 4OYKA 5LGNB 4EXTA 1MNDA 2NW9A 2MBGA 2ZM8A 1O3XA 5LXTE 4IE7A 3K3QC 3FB2A 4QKNA 4TX5A 3W15B 1ZHCA 1MMNA 3PUGA 3DP7A 4ISTA 2Y8DA 3IF8B 2E8IA 2QGSA 3BQLA 4O2BE 5A1LA 3KFWX 3E08A 3P7IA 4UIGA 2DLRA 4TN7B 3RH3A 2L8KA 4IE0A 3I0OA 5FXXA 4H9QC 3RYCE 5JDFA 2LJLA 2ZMAA 3I9WA 3PU8A 5JRCB 4X20E 3PUQA 2CLYC 2I59A 3C51A 5HXRA 3RRCA 3EUHA 2DCFA 5F3JA 1WYBA 3ZYKA 4DBQA 3K3OA 3KBUA 2IC9A 5FY0A 5HWXA 2CWOA 3UULA 2Z6EA 5IHYA 3CX7B 3AA1B 4XZCA 5KMGP 5LJMA 1WRDA 2VWAA 4JEUB 3N2KE 5LCYA 3AA0B 3UFEA 2ES0A 2WBLA 1HTJF 3O4XE 4I50E 4H9SE 4KP3C 3NRXA 3PU3A 2UXXB 2WMNA 4ZI3D 1D0ZA 1MIWA 2KT9A 2LE8A 4WW0A 3HI2A 5EK2A 4H9NC 4I4TE 4ZOLE 2WM9A 3K3NA 3Q5WA 2EHOD 3HA4A 4MFRA 2H7VC 2DI4A 1FIOA 4X1YE 3ZJ2A 2ZLYA 4H9OC 3RPUA 3CWZB 2D5UA 1D1CA 3KINB 4I43B 4CXXA 3GN5A 5TAOA 4MALA 2LM9A 3NBXX 1NWMX 1OWAA 2LSGA 3F2EA 5DJQC 2MYSA 2VKOA 3LFMA 3QK6A 2D0UA 5H6QB 3ZMTB 1D0XA 5L3CB 4QX8B 3UT5E 2XAFB 1HCIA 2V1DB 5J2UE 1HG5A 4H9RC 3ZJ1A 2E9XA 2DNXA 4DBRA 3SWHA 4UEMA 3KV9A 1MNEA 4GOUA 4WNKA 5JQGE 3ZC0A 1S35A 3OJAA 4OYJA 2X67A 2N2NA 4CI3B 5CA0E 3ZMUB 1HF8A 4AQFA 1IAPA 5L3EB 5LGUB 2KLQA 2CM0A 2X9YA 4PK6A 1X79A 5L2LA 4NUVA 2RP4A 3N5LA 3ESLA 1MMGA 3NZQA 3C64A 4X1KE 3LG7A 5H6RB 3C4ZA 1ZV4X 5DQWA 3R6NA 2X9WA 3KVBA 3CQXC 5JR9B 2L9QA 3BQKA 5FY1A 3FXEB 1HG2A 1KK7A 1LKXA 3GWHA 5HWYA 4BA9A 4AKGA 2JJ9A 4ANJA 5LNKA 1KNZA 2VASA 1HFAA 2KWHA 4YFSA 3ONXA 4YJ3E 2CXLA 3ANWA 4PJMA 3AA7B 3N9LA 1HS7A 4EZHA 5LBQB 3VU7H 1FMWA 3CX6B 1IJ6A 1SHZC 5JDNA 1IJ5A 4JEHB 4PW8A 2K5BB 3Q5XA 5LP6E 4MLKA 4ZI2C 5HAXA 2HPLA 3OYXA 5JDMA 3L09A 3R84B 3AA6B 1VOMA 3ZCIA 4AKRB 3F57A 2JMKA 2KWIB 2E9XD 2ZM2A 3CQCB 4TZ4C 2BDEA 3N9QA 5J1GA 4U72A 1V9DA 4P09A 2Q9QC 1S94A 2WMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIN B; 
#chains in the Genus database with same CATH topology
 3C98 B;  3CVR A;  3VHL A;  5HCJ A;  5IYZ E;  3EDU A;  2LOP A;  4HFC A;  3J7Y q;  3SOL A;  2XZE A;  1BR2 A;  4YXD A;  4LML A;  4I55 E;  5JR9 C;  5LGU B;  4IIJ E;  5HCM A;  4EYU A;  3M3Z B;  5ABF B;  3VKG A;  2ZM6 T;  5HXS A;  4C90 A;  2PFV A;  1AJ3 A;  2CXF A;  3UUN A;  4LFB T;  1DU2 A;  3N9M A;  2NOX A;  1M7K A;  4EAH A;  3ZLI A;  1EZ3 A;  2V7K A;  3HKD E;  4IDN A;  4IL9 A;  1YW0 A;  4ILB A;  2BKO A;  3RKO A;  4JV5 T;  3NRY A;  4A97 A;  4HWH A;  4LMJ A;  1NEN A;  4JI3 T;  4IL4 A;  2YDR A;  2EHO B;  2RA1 A;  3HR0 A;  2UUA T;  3MKD A;  3RLF F;  3PJA J;  2YN6 A;  5L4E A;  2YKS A;  1MIV A;  2UUB T;  3AAA B;  2N1G A;  2WQY A;  3Q9D A;  2YIN A;  4C91 A;  5J2T E;  4TV8 E;  5AQK B;  1HNW T;  4DV0 T;  4XAX B;  1QUU A;  1HNZ T;  4U7I A;  2X0L B;  5AQT B;  3UU3 A;  2Y6X A;  2KZ7 B;  3WI3 A;  5AQJ B;  3CML A;  1ZKE A;  2I6H A;  1WR0 A;  5L47 A;  4BAY B;  4KMC A;  5F5W A;  1T8B A;  4DID B;  1NEK A;  4OHF A;  1M62 A;  4ZI3 C;  4GK0 E;  3ZMZ B;  4TWD A;  4H63 H;  3ZPO A;  4B6X A;  2LHR A;  4X64 T;  2Q9Q A;  4Z8X A;  4NUU A;  3F31 A;  5FKY A;  1MMA A;  3EVY A;  4PAG A;  3RIA A;  2FUP A;  4O4I E;  3HKC E;  5JH7 E;  4FI5 A;  5C2T A;  4LFA T;  3ZYL A;  2LRL A;  4ZEY A;  4L9I A;  1SUM B;  5FVL A;  3H37 A;  2GK9 A;  3RYH E;  3S4U A;  2B1E A;  3FHN A;  2XAG B;  1LVK A;  4TUY E;  3Q2M A;  2DL1 A;  4ISS A;  3P8C D;  3ZMS B;  4G63 A;  3TLS A;  5FMN A;  2YDS A;  3ZKR A;  4E7S A;  3T1Y T;  1UUS A;  2Q9Q D;  2CA5 A;  2YK0 A;  3RQU A;  4GIW A;  3TLW A;  5AQF B;  3UUB A;  3H3A A;  2LKG A;  4HFI A;  2WDR A;  5IWA T;  3TLV A;  2X0Y A;  4V1A v;  2XHE B;  4PFO A;  5LOV E;  3CIR A;  2YEV C;  2Q9Q B;  4AQF C;  1KFY A;  1VCS A;  3ZEF B;  2V7J A;  5LHG B;  2UUC T;  2UXD T;  3RI5 A;  4F8H A;  2W4X A;  3HL6 A;  4PFP A;  4P0B A;  2LHN A;  3UU5 A;  2WU5 A;  3I0Q A;  4KHZ F;  5KX5 E;  2KXP B;  3G06 A;  4EOZ B;  4GK5 E;  2XQY A;  3EDV A;  5AQN B;  4QXB B;  3ZC1 A;  2CCQ A;  4PK5 A;  4NXN T;  4HE8 A;  2CBI A;  3AAE B;  4YHJ A;  2JQK A;  4ILA A;  2NW9 A;  4AQY T;  1W0B A;  4KX6 A;  5LXT E;  1OED A;  4IE7 A;  1ZHC A;  1MMN A;  4IRE A;  5CFB A;  3DP7 A;  2FJA A;  3RKG A;  2E8I A;  2BBH A;  2QGS A;  4HWC A;  4OX9 T;  4TN7 B;  3RH3 A;  4H9Q C;  3P50 A;  5JRC B;  3AE5 A;  2CLY C;  2I59 A;  4DBQ A;  3KBU A;  4DR4 T;  2IC9 A;  2CWO A;  1WFD A;  5LJM A;  4IT4 A;  3UFE A;  2ES0 A;  2WBL A;  3PU3 A;  1XNR T;  2KT9 A;  4H9N C;  3K3N A;  3HA4 A;  2DI4 A;  3PUW F;  3NBX X;  3AE8 A;  1XDP A;  3X1D A;  4QX8 B;  3UT5 E;  2UXB T;  2E9X A;  1OED E;  2VL0 A;  3A7M A;  4DBR A;  4UEM A;  2LRK A;  3ZMU B;  3UQ4 A;  5L3E B;  1OED B;  3AEB A;  3VR9 A;  5J0Z A;  4NUV A;  3NZQ A;  3C4Z A;  1ZV4 X;  3R6N A;  4CN6 A;  5JR9 B;  1KK7 A;  1IBK T;  2JJ9 A;  4ANJ A;  3ONX A;  3ANW A;  3AA7 B;  2CHO A;  3K1S A;  4EZH A;  5LBQ B;  4LMK A;  3Q5X A;  1ZOY A;  3OYX A;  5JDM A;  3L09 A;  3R84 B;  5HEJ A;  3H3M A;  2E9X D;  4TZ4 C;  2BDE A;  4U72 A;  2Q9Q C;  1S94 A;  2WMO A;  4ADZ A;  2HN1 A;  1YKH B;  2W2U A;  3ETU A;  2V26 A;  3U3I A;  3O1H A;  3JC6 D;  2JQ9 A;  3JAD A;  3AEC A;  3UTK A;  4HFD A;  2D2S A;  4KUM B;  2X66 A;  2SPC A;  3N9O A;  2E9X B;  4HWD A;  1FJG T;  3OVU A;  2BVL A;  4O2A E;  3N2O A;  3IEE A;  4UVC B;  5JDG A;  3P4S A;  5EZY E;  2N9D A;  2CEA A;  4YSX A;  4UVB B;  3RYF E;  3K8P C;  4O8S A;  4IE5 A;  3NZP A;  1Z8U A;  5LG3 A;  2K24 A;  2ACX A;  1UUR A;  2XQ9 A;  5DQV A;  4UVA B;  2VK9 A;  2CWY A;  2CRB A;  2XUE A;  2W00 A;  3ANW B;  4IDZ A;  2PBI A;  4JI1 T;  3FXD B;  3N9P A;  4AXP A;  4K0U A;  4H9P C;  1ZP0 A;  5L3G B;  2NWB A;  2OLT A;  3EHZ A;  3AB3 B;  4CXY A;  4F6R C;  2XQ7 A;  2E5V A;  5LBM A;  4WYV A;  4JI2 T;  1T98 A;  4HGA A;  4WZX A;  5E0O A;  1J5E T;  4QH1 A;  4QHO A;  2XQA A;  1VCT A;  1Y64 B;  2CPT A;  4YSZ A;  2ODU A;  2MPK A;  2UXC T;  4U3C A;  4CI2 B;  3LK2 B;  3WAJ A;  5AQS B;  2K48 A;  2LSK A;  1I94 T;  4JI5 T;  1IZN B;  1H7C A;  2MAW A;  2WY2 A;  5ABH A;  4OK0 A;  3ZN0 B;  3RIF A;  4N78 D;  4JI0 T;  4EV6 A;  3FZM B;  5CB4 E;  2E2A A;  2LM2 A;  5FY7 A;  4DV5 T;  3L39 A;  4UEL A;  1N34 T;  4LF8 T;  1OED C;  2LLY A;  4O4L E;  4HFH A;  3LBX A;  3FZF B;  2XQ4 A;  3ZCJ A;  4EIW A;  3WAK A;  5LB7 B;  2X68 A;  1SE7 A;  3OBV E;  3AEA A;  3RX6 A;  2BKN A;  2VKJ A;  2I0M A;  2XTL A;  3CPZ A;  5CA1 E;  2NTY A;  2XQ8 A;  3ONJ A;  1XNQ T;  4AQG A;  3PUY F;  5HXE A;  3Q5D A;  2XAQ B;  4NPP A;  3EAM A;  3LK3 B;  2VVN A;  3HKB E;  3N9N A;  3KVA A;  4ASK A;  2V7L A;  4PK4 A;  5EK3 A;  4JI6 T;  5AQH B;  1HX1 B;  2LSJ A;  2ODV A;  3PUA A;  5L3B B;  2E9X C;  4QXH B;  4I0U A;  4B3M T;  2JQH A;  1ZEE A;  5FXW A;  2A3D A;  4P0A A;  2KSR A;  4DV2 T;  2DHR A;  4LF6 T;  1UX5 A;  2V6Y A;  2MTQ A;  3ZST A;  4L5G A;  3JC6 C;  3LBX B;  3PV0 F;  4TNW A;  3KV5 A;  2CLY B;  4DR7 T;  3SRZ A;  3LK4 2;  3C4X A;  4MBQ A;  3ETV A;  5JVD E;  4DV4 T;  1QLB A;  1G73 A;  2JMH A;  1B7T A;  3AVS A;  3KBT A;  1XWM A;  4U74 A;  2XQ6 A;  4AKI A;  1KNP A;  4AIS A;  1XDO A;  1IBM T;  4PNI A;  1MIY A;  2YOE A;  4BJM A;  4GYS A;  4DV1 T;  3OKQ A;  3B13 A;  2ZM0 A;  1OXZ A;  2W0G A;  2L3L A;  2HH7 A;  4OYK A;  5LGN B;  2MBG A;  3SFD A;  4TX5 A;  3W15 B;  3PUG A;  3OPC A;  4IST A;  3IF8 B;  1KF6 A;  3BQL A;  1E2A A;  3E08 A;  3P7I A;  4U31 A;  2LJL A;  1JNZ A;  2BG9 A;  4X20 E;  3RRC A;  4GKK T;  3K3O A;  3IA3 A;  3PUX F;  5HWX A;  3UUL A;  2Z6E A;  3AE6 A;  4A98 A;  3O4X E;  4QH5 A;  4H9S E;  3NRX A;  2UXX B;  4X5T A;  4WW0 A;  3HI2 A;  3AEF A;  4I4T E;  3AEE A;  2BBJ A;  1FIO A;  4X1Y E;  2UU9 T;  3RPU A;  2D5U A;  2WS3 A;  3KIN B;  2WZI A;  4CXX A;  3GN5 A;  4MAL A;  2LM9 A;  2LSG A;  2VKO A;  2D0U A;  3ZMT B;  1T72 A;  2XAF B;  1HCI A;  3ZSS A;  4YTM A;  2HN2 A;  2V1D B;  5J2U E;  1HG5 A;  3ZJ1 A;  3KV9 A;  1MNE A;  3ZC0 A;  2QVA A;  4CI3 B;  1KNR A;  5AQG B;  5CJ5 A;  4YT0 A;  1IAP A;  3FZL B;  4DR6 T;  2X9Y A;  2BG9 E;  3N5L A;  3ESL A;  3KVB A;  3CQX C;  3FXE B;  1HG2 A;  4BA9 A;  2KWH A;  3N9L A;  1HS7 A;  5JDN A;  4PW8 A;  2K5B B;  4MLK A;  2FJB A;  3PUZ F;  4AKR B;  3F57 A;  2ZM2 A;  3CQC B;  5J1G A;  1V9D A;  2A2F X;  4UXN B;  3J9X 1;  1BR4 A;  4KBM B;  4HFE A;  4AKH A;  3QB5 A;  1Y01 A;  4P1N A;  4EB6 E;  4CZZ B;  2CXD A;  3A5X A;  4AKL A;  1YKE B;  3GMI A;  3ZMV B;  4DVD A;  5KDM C;  4IGU A;  4LF7 T;  2PTF A;  3HKE E;  3BK9 A;  4ERR A;  1VRB A;  3QUJ A;  2KMF A;  4PJJ A;  2H88 A;  4A56 A;  3UQ7 A;  4JUY A;  3RC8 A;  4JI4 T;  3DTO A;  5HYA A;  2W63 A;  2DWK A;  4O4J E;  4IHJ E;  2FJE A;  2BS2 A;  3A8Y C;  3AEG A;  1US7 B;  2AXD S;  3CX8 B;  2C0S A;  4TWH A;  2CMR A;  3T1H T;  3FBL A;  2WWU A;  4IE4 A;  4LF9 T;  3BQI A;  4O4H E;  2KIN B;  2ACZ A;  2V7I A;  3MXZ A;  2R6G F;  2YU1 A;  3MA9 A;  2IW5 B;  4TV9 E;  3TLU A;  4Q25 A;  4EZ4 A;  2D9D A;  2K9A A;  4U33 A;  2VKH A;  4H63 V;  1FMV A;  2W67 A;  1R8I A;  3QNU A;  4QX7 B;  2JRK A;  3KV4 A;  1LVF A;  2W61 A;  2W66 A;  3E0Z A;  1YD8 G;  5LHH B;  1U4Q A;  2X9H A;  4A5X A;  4DV6 T;  2WU2 A;  2CBJ A;  5ETW A;  3AVR A;  5GON E;  4U2Y A;  4Z91 A;  3SS1 A;  2X51 A;  5IUX A;  4PJN A;  3RYI E;  2OV9 A;  2LOS A;  4MHC A;  4OFZ A;  5L3F B;  4B3T T;  3UUX B;  2M6I A;  2HPJ A;  3LJC A;  1SA0 E;  2XAS B;  4LF5 T;  5BMV E;  3B57 A;  3Q5E A;  3ZN1 B;  2X0H A;  5FL0 A;  3AED A;  3ZT5 A;  1UX4 A;  2AE9 A;  4M1P A;  2BG9 C;  1N36 T;  2C5K T;  4DND A;  2WZH A;  2IIU A;  3UU8 A;  5FVK A;  2XAH B;  5AFU L;  4CI1 B;  2IDO B;  2BVM A;  2BS3 A;  2K3W A;  4CN1 A;  2XM2 A;  1KEY A;  3PJA A;  3T8O A;  1YQ3 A;  3AE1 A;  2NR4 A;  5LMU T;  3RIU A;  2VKD A;  3QB5 K;  4U7Y A;  3L8R A;  4B3S T;  2XM1 A;  2UXN B;  2PG8 A;  2YU2 A;  2XJ7 A;  3C50 A;  5FP3 A;  3ZT7 A;  5ABF A;  2WWV A;  4QXC B;  3MZK B;  3RC3 A;  1D1B A;  4G2A A;  3DJB A;  5LJN A;  4AI6 A;  5AQQ B;  3I1A A;  3JCF A;  1FEW A;  5AQO B;  5FNV E;  4J2C A;  2V5C A;  2VB6 A;  5FXZ A;  5ABG A;  3V5U A;  2X9X A;  4IE6 A;  3QC9 A;  3AXJ A;  2OA5 A;  1J5W A;  5KXJ A;  1XMQ T;  2XSA A;  4DR1 T;  2EHO A;  4EXT A;  1MND A;  4JI7 T;  2ZM8 A;  4YTP A;  3K3Q C;  4QKN A;  1L0V A;  2F4V T;  5HEG A;  2V6X A;  5HEO A;  4UIG A;  3EI0 A;  3I0O A;  5FXX A;  3RYC E;  3I9W A;  3PU8 A;  4HWI B;  3PUQ A;  5HXR A;  3EUH A;  2DCF A;  1I6Z A;  5F3J A;  1WYB A;  2XPK A;  3ZYK A;  3CX7 B;  3AA1 B;  4XZC A;  5KMG P;  2VWA A;  3AA0 B;  2VQF T;  4I50 E;  3ZT6 A;  1D0Z A;  1MIW A;  2LE8 A;  5EK2 A;  4AIU A;  4ZOL E;  2WM9 A;  3Q5W A;  2EHO D;  4DR3 T;  4KHP T;  3TLT A;  3ZJ2 A;  4H9O C;  1UK5 A;  1N33 T;  4I43 B;  5TAO A;  5JTG A;  2WDQ A;  1NWM X;  5DJQ C;  2IML A;  2MYS A;  2QYW A;  3JAF A;  3LFM A;  5H6Q B;  4HWF A;  3AXJ B;  4H9R C;  2DNX A;  3AE9 A;  4NIQ A;  3SWH A;  4GOU A;  1YQ4 A;  1S35 A;  4OYJ A;  2X67 A;  1HF8 A;  1T7S A;  2KLQ A;  4PK6 A;  2BKP A;  5L2L A;  2VQE T;  2RP4 A;  4X1K E;  3C64 A;  5AQI B;  5H6R B;  5DQW A;  2X9W A;  3BQK A;  5FY1 A;  3AE4 A;  1KNZ A;  5LNK A;  1E7P A;  3UU6 A;  4YJ3 E;  4ILC A;  2CXL A;  3CK6 A;  3VU7 H;  1IJ6 A;  1SHZ C;  1IJ5 A;  3RQW A;  3JAE A;  4GKJ T;  4TNV A;  3ZCI A;  1X9B A;  2KWI B;  4X66 T;  4HFB A;  3PDY A;  2Y48 B;  3IHR A;  1WLX A;  2XSB A;  2QRX A;  2LSY A;  1UCU A;  5C3J A;  3OTO T;  3UU4 A;  2JQQ A;  2WAU A;  3PE0 A;  2NW8 A;  1BR1 A;  2W62 A;  5JDH A;  2NP9 A;  2H89 A;  2MOZ A;  2V6Y B;  3UFG A;  2P9B A;  4YLH A;  4E7Z A;  3P4Q A;  4QWN B;  3NVO A;  3O1I A;  2XAJ B;  3MJX A;  5ADX L;  1WR6 A;  3UUM A;  2KND A;  4DV3 T;  3RIU C;  4ZZC A;  3CKD A;  5DAB A;  5AQV B;  3P4W A;  3N2G E;  4HKA A;  4X62 T;  4LFC T;  1N32 T;  5F8P A;  2FJD A;  2VL8 A;  2D0T A;  2RPA A;  4EYY R;  4EED A;  4CXW A;  3RRW A;  1E1H B;  4DUY T;  1W09 A;  2WP9 A;  5AQU B;  1LRZ A;  5JRC A;  2IC6 A;  4HN9 A;  1U5P A;  4IDP A;  2M6B A;  5FYM A;  3E22 E;  5HXC A;  5C8Y E;  2CE7 A;  4TWF A;  1Z0P A;  3TKL B;  2BG9 B;  4HTE A;  3AE3 A;  5LGT B;  2IUB A;  4YY3 T;  5HXH A;  3O9X A;  1D0Y A;  3VKH A;  2E5L T;  4IDO A;  1BR0 A;  4JYA T;  4ZS3 A;  2YDQ A;  4DR2 T;  2LEH A;  4LF4 T;  2LSI A;  3PUS A;  1G8X A;  4X65 T;  2EHO C;  2JPF A;  3MK7 C;  3MAC A;  3GN5 B;  4L0R A;  2V8S V;  5LG4 A;  2NW7 A;  4U2Z A;  3VRB A;  2XQ3 A;  3KV6 A;  5M4Y A;  3FZH B;  4YJ2 E;  2M67 A;  2IAK A;  1WYC A;  4ILU A;  2A72 A;  1D1A A;  4UF0 A;  4WBN E;  4DUZ T;  5AQM B;  2QA7 A;  3D0T A;  5JRE A;  5JR9 A;  2J62 A;  3NWI A;  4ZS2 A;  3V5S A;  3VR8 A;  4UV8 B;  3EAB A;  2H7O A;  3PTR B;  2PJQ A;  4XBF B;  3VRA A;  2C5J A;  2JIW A;  3U78 A;  2LT3 A;  1QSD A;  2DWG A;  3FZK B;  3IBP A;  4CQI A;  4ZI7 E;  2BS4 A;  1HR0 T;  4FJO A;  2J1D G;  2CHN A;  4ZI2 D;  4IDQ A;  4DMW A;  4EGW A;  1CUN A;  2VVS A;  3KDS E;  3M65 A;  3RHW A;  1MMD A;  2FBW A;  3SFE A;  1UGO A;  1IBL T;  3I9Y A;  4UV9 B;  1W0A A;  1HX8 A;  4YTN A;  3AE2 A;  4DO0 A;  4PJL A;  4DMV A;  3PUR A;  3O1J A;  3OYZ A;  3AAI A;  4ZHQ E;  3L3P A;  4JI8 T;  2J47 A;  3ZYM A;  3AE7 A;  2A9U A;  5FL1 A;  1JNR A;  2G0U A;  4HFV A;  4COF A;  5LMN T;  2BZB A;  5LHI B;  3FBZ A;  1WCR A;  2WDV A;  3GA8 A;  2NTX A;  4X1I E;  5L3D B;  4BJN A;  4UF0 B;  1NAF A;  4WBO A;  1XZY A;  5EK4 A;  2C5I T;  5LA6 E;  5JDL A;  1CHU A;  5JDQ A;  3QOF A;  1W9R A;  2V7M A;  3LSV A;  3CQG B;  5LYJ E;  2WSS V;  4HEA A;  5L4H A;  4Z90 A;  4NXM T;  4ZZB A;  1J1J A;  3C4W A;  5AQP B;  4GYR A;  4JLE A;  2H3R A;  5FXV A;  3RGL A;  1YXR A;  5ABE A;  1O3X A;  3FB2 A;  5AQR B;  5HEU A;  2Y8D A;  3P4P A;  4O2B E;  5A1L A;  3KFW X;  2DLR A;  2L8K A;  4IE0 A;  5JDF A;  2ZMA A;  3C51 A;  5AQL B;  2XQ5 A;  5FY0 A;  5IHY A;  2VUR A;  2HHH T;  4KI0 F;  1WRD A;  4JEU B;  3N2K E;  5LCY A;  1HTJ F;  3RF1 A;  3P4R A;  4KP3 C;  2WMN A;  4ZI3 D;  3B5M A;  4MFR A;  2H7V C;  2ZLY A;  2WCA A;  3CWZ B;  4K0K T;  1D1C A;  2B76 A;  3NKZ A;  1XMO T;  1OWA A;  3F2E A;  4EEB A;  2IHR 1;  3PUV F;  4UR9 A;  3QK6 A;  1D0X A;  5L3C B;  2WB5 A;  4DR5 T;  4WNK A;  5JQG E;  3OJA A;  2N2N A;  5BR8 T;  4ZXL A;  5CA0 E;  4AQF A;  1GQE A;  4YSY A;  2CM0 A;  1X79 A;  1MMG A;  3LG7 A;  4QH4 A;  2L9Q A;  4DV7 T;  1LKX A;  3GWH A;  5HWY A;  3ABV A;  4AKG A;  2VAS A;  1HFA A;  2J4G A;  4YFS A;  2LKH A;  2V5D A;  4PJM A;  5CGM A;  3ONL C;  1FMW A;  3CX6 B;  3LDQ B;  4JEH B;  4B3R T;  5LP6 E;  4ZI2 C;  5HAX A;  2HPL A;  5HEH A;  4CN4 A;  2XY8 B;  3AA6 B;  1VOM A;  4JBW F;  2JMK A;  4YHH T;  3N9Q A;  1HNX T;  4P09 A; 
#chains in the Genus database with same CATH homology
 2A2F X;  4UXN B;  3C98 B;  3CVR A;  3J9X 1;  4ADZ A;  1YKH B;  3VHL A;  2Y48 B;  3ETU A;  2V26 A;  1BR4 A;  3U3I A;  3O1H A;  4KBM B;  5IYZ E;  3IHR A;  3EDU A;  1WLX A;  2LOP A;  4AKH A;  4EB6 E;  3J7Y q;  3SOL A;  2LSY A;  4CZZ B;  2CXD A;  3JC6 D;  3A5X A;  1UCU A;  1BR2 A;  4AKL A;  3UTK A;  1YKE B;  3GMI A;  3ZMV B;  2D2S A;  4KUM B;  4DVD A;  2X66 A;  5KDM C;  2SPC A;  3N9O A;  4IGU A;  4I55 E;  2JQQ A;  2WAU A;  3HKE E;  3BK9 A;  2E9X B;  4IIJ E;  5JR9 C;  4ERR A;  1VRB A;  3QUJ A;  2KMF A;  4PJJ A;  3PE0 A;  4A56 A;  4EYU A;  2NW8 A;  1BR1 A;  4JUY A;  3VKG A;  2W62 A;  5JDH A;  3RC8 A;  2BVL A;  2NP9 A;  4O2A E;  3DTO A;  2MOZ A;  5HXS A;  2W63 A;  5HYA A;  2DWK A;  2P9B A;  3IEE A;  3N2O A;  4O4J E;  4UVC B;  4YLH A;  2PFV A;  4C90 A;  5JDG A;  4E7Z A;  1AJ3 A;  4QWN B;  2CXF A;  5EZY E;  4IHJ E;  2N9D A;  3O1I A;  2CEA A;  3UUN A;  1US7 B;  2XAJ B;  3N9M A;  3CX8 B;  4UVB B;  3MJX A;  3RYF E;  2NOX A;  3K8P C;  4O8S A;  4IE5 A;  5ADX L;  2C0S A;  4EAH A;  3ZLI A;  1WR6 A;  3UUM A;  1EZ3 A;  2CMR A;  2KND A;  3FBL A;  2V7K A;  2WWU A;  3NZP A;  4IE4 A;  3HKD E;  2K24 A;  3CKD A;  1YW0 A;  2ACX A;  3BQI A;  4O4H E;  5DQV A;  4UVA B;  2KIN B;  5DAB A;  2V7I A;  2VK9 A;  2CWY A;  3MXZ A;  3RKO A;  2XUE A;  3N2G E;  4HKA A;  2YU1 A;  2W00 A;  3ANW B;  4IDZ A;  2PBI A;  3NRY A;  3FXD B;  3N9P A;  3MA9 A;  4AXP A;  2IW5 B;  4K0U A;  4TV9 E;  4H9P C;  5F8P A;  2VL8 A;  4EZ4 A;  5L3G B;  2D0T A;  4EYY R;  2NWB A;  4CXW A;  3RRW A;  1E1H B;  2K9A A;  2VKH A;  2EHO B;  3AB3 B;  2RA1 A;  4CXY A;  4F6R C;  4H63 V;  3HR0 A;  1FMV A;  5LBM A;  1LRZ A;  4QX7 B;  5JRC A;  3MKD A;  2JRK A;  2IC6 A;  3KV4 A;  1T98 A;  4HGA A;  4HN9 A;  1LVF A;  1U5P A;  5E0O A;  2W61 A;  4QHO A;  5FYM A;  3E22 E;  5HXC A;  1MIV A;  5C8Y E;  1Y64 B;  2CE7 A;  3AAA B;  2N1G A;  3E0Z A;  1Z0P A;  1YD8 G;  3Q9D A;  3TKL B;  2YIN A;  4C91 A;  2ODU A;  5J2T E;  4TV8 E;  4CI2 B;  4XAX B;  3LK2 B;  4HTE A;  1QUU A;  5LHH B;  3WAJ A;  1U4Q A;  2X0L B;  2K48 A;  2X9H A;  2LSK A;  2Y6X A;  5LGT B;  1IZN B;  2KZ7 B;  3WI3 A;  5HXH A;  1H7C A;  3O9X A;  3CML A;  1D0Y A;  1ZKE A;  3VKH A;  4OK0 A;  5ETW A;  3ZN0 B;  4BAY B;  3AVR A;  1BR0 A;  5GON E;  4N78 D;  4KMC A;  3SS1 A;  2X51 A;  4ZS3 A;  5CB4 E;  4PJN A;  4OHF A;  2LEH A;  3RYI E;  2LSI A;  4ZI3 C;  4GK0 E;  3ZMZ B;  3PUS A;  2LOS A;  4H63 H;  4MHC A;  3ZPO A;  4OFZ A;  5L3F B;  4B6X A;  5FY7 A;  1G8X A;  2LHR A;  2EHO C;  3UUX B;  4UEL A;  2JPF A;  2Q9Q A;  3MK7 C;  4Z8X A;  3MAC A;  3GN5 B;  4NUU A;  4L0R A;  3F31 A;  5LG4 A;  2HPJ A;  3LJC A;  1MMA A;  4O4L E;  2NW7 A;  3EVY A;  1SA0 E;  2XAS B;  3KV6 A;  4PAG A;  3LBX A;  5M4Y A;  4YJ2 E;  2M67 A;  2IAK A;  1WYC A;  5BMV E;  3B57 A;  2A72 A;  4ILU A;  3ZN1 B;  1D1A A;  4UF0 A;  4WBN E;  4O4I E;  2QA7 A;  3HKC E;  3D0T A;  1UX4 A;  5JH7 E;  3ZCJ A;  4M1P A;  5JRE A;  5JR9 A;  4FI5 A;  4EIW A;  4ZS2 A;  2C5K T;  3V5S A;  3WAK A;  4DND A;  4UV8 B;  2H7O A;  3PTR B;  2X68 A;  2PJQ A;  4XBF B;  2C5J A;  3ZYL A;  3U78 A;  2LT3 A;  4L9I A;  2XAH B;  5AFU L;  4CI1 B;  1QSD A;  2DWG A;  3IBP A;  4CQI A;  2BVM A;  3H37 A;  3OBV E;  4ZI7 E;  2GK9 A;  3RYH E;  4FJO A;  3RX6 A;  2J1D G;  4ZI2 D;  3S4U A;  3T8O A;  2B1E A;  2VKJ A;  3FHN A;  2XAG B;  2XTL A;  3CPZ A;  4DMW A;  1LVK A;  5CA1 E;  2NTY A;  4TUY E;  3Q2M A;  4ISS A;  1CUN A;  3P8C D;  3KDS E;  3M65 A;  4G63 A;  3ZMS B;  3PDY A;  5FMN A;  2VKD A;  4AQG A;  4E7S A;  1MMD A;  2Q9Q D;  5HXE A;  2CA5 A;  2XAQ B;  3LK3 B;  2YK0 A;  3I9Y A;  3HKB E;  3N9N A;  4UV9 B;  4GIW A;  3KVA A;  4ASK A;  1HX8 A;  2V7L A;  4DO0 A;  4PJL A;  4PK4 A;  4DMV A;  3H3A A;  3O1J A;  3OYZ A;  3PUR A;  5EK3 A;  2UXN B;  2LSJ A;  2ODV A;  3AAI A;  3PUA A;  5L3B B;  2PG8 A;  4ZHQ E;  2YU2 A;  2E9X C;  3L3P A;  4QXH B;  3C50 A;  5FP3 A;  3ZYM A;  4V1A v;  2XHE B;  4PFO A;  1ZEE A;  5FXW A;  2A3D A;  5LOV E;  2G0U A;  4HFV A;  2YEV C;  2Q9Q B;  4P0A A;  4AQF C;  2DHR A;  4QXC B;  3MZK B;  3RC3 A;  2BZB A;  1D1B A;  1UX5 A;  5LHI B;  2MTQ A;  3ZEF B;  2V7J A;  3FBZ A;  4G2A A;  3DJB A;  4L5G A;  3GA8 A;  5LHG B;  2NTX A;  5LJN A;  3JC6 C;  4X1I E;  5L3D B;  3LBX B;  4BJN A;  4AI6 A;  3KV5 A;  4UF0 B;  1NAF A;  3I1A A;  2CLY B;  3SRZ A;  3LK4 2;  3HL6 A;  4WBO A;  3C4X A;  4PFP A;  5EK4 A;  4MBQ A;  4P0B A;  1FEW A;  3ETV A;  2LHN A;  2C5I T;  5LA6 E;  5JVD E;  5FNV E;  4J2C A;  5JDL A;  3I0Q A;  2VB6 A;  5FXZ A;  5KX5 E;  1G73 A;  2KXP B;  2JMH A;  1B7T A;  3AVS A;  3KBT A;  3V5U A;  5JDQ A;  2X9X A;  2V7M A;  4EOZ B;  4U74 A;  4GK5 E;  4IE6 A;  4AKI A;  3CQG B;  5LYJ E;  2WSS V;  2XQY A;  4HEA A;  3EDV A;  3QC9 A;  4QXB B;  3ZC1 A;  2CCQ A;  2OA5 A;  4PNI A;  1MIY A;  4BJM A;  4GYS A;  4PK5 A;  3C4W A;  4GYR A;  4HE8 A;  4JLE A;  3OKQ A;  2EHO A;  3B13 A;  2ZM0 A;  1OXZ A;  2H3R A;  2W0G A;  3AAE B;  4YHJ A;  2L3L A;  2HH7 A;  5FXV A;  4OYK A;  5LGN B;  4EXT A;  1MND A;  2NW9 A;  2MBG A;  2ZM8 A;  1O3X A;  5LXT E;  4IE7 A;  3K3Q C;  3FB2 A;  4QKN A;  4TX5 A;  3W15 B;  1ZHC A;  1MMN A;  3PUG A;  3DP7 A;  4IST A;  2Y8D A;  3IF8 B;  2E8I A;  2QGS A;  3BQL A;  4O2B E;  5A1L A;  3KFW X;  3E08 A;  3P7I A;  4UIG A;  2DLR A;  4TN7 B;  3RH3 A;  2L8K A;  4IE0 A;  3I0O A;  5FXX A;  4H9Q C;  3RYC E;  5JDF A;  2LJL A;  2ZMA A;  3I9W A;  3PU8 A;  5JRC B;  4X20 E;  3PUQ A;  2CLY C;  2I59 A;  3C51 A;  5HXR A;  3RRC A;  3EUH A;  2DCF A;  5F3J A;  1WYB A;  3ZYK A;  4DBQ A;  3K3O A;  3KBU A;  2IC9 A;  5FY0 A;  5HWX A;  2CWO A;  3UUL A;  2Z6E A;  5IHY A;  3CX7 B;  3AA1 B;  4XZC A;  5KMG P;  5LJM A;  1WRD A;  2VWA A;  4JEU B;  3N2K E;  5LCY A;  3AA0 B;  3UFE A;  2ES0 A;  2WBL A;  1HTJ F;  3O4X E;  4I50 E;  4H9S E;  4KP3 C;  3NRX A;  3PU3 A;  2UXX B;  2WMN A;  4ZI3 D;  1D0Z A;  1MIW A;  2KT9 A;  2LE8 A;  4WW0 A;  3HI2 A;  5EK2 A;  4H9N C;  4I4T E;  4ZOL E;  2WM9 A;  3K3N A;  3Q5W A;  2EHO D;  3HA4 A;  4MFR A;  2H7V C;  2DI4 A;  1FIO A;  4X1Y E;  3ZJ2 A;  2ZLY A;  4H9O C;  3RPU A;  3CWZ B;  2D5U A;  1D1C A;  3KIN B;  4I43 B;  4CXX A;  3GN5 A;  5TAO A;  4MAL A;  2LM9 A;  3NBX X;  1NWM X;  1OWA A;  2LSG A;  3F2E A;  5DJQ C;  2MYS A;  2VKO A;  3LFM A;  3QK6 A;  2D0U A;  5H6Q B;  3ZMT B;  1D0X A;  5L3C B;  4QX8 B;  3UT5 E;  2XAF B;  1HCI A;  2V1D B;  5J2U E;  1HG5 A;  4H9R C;  3ZJ1 A;  2E9X A;  2DNX A;  4DBR A;  3SWH A;  4UEM A;  3KV9 A;  1MNE A;  4GOU A;  4WNK A;  5JQG E;  3ZC0 A;  1S35 A;  3OJA A;  4OYJ A;  2X67 A;  2N2N A;  4CI3 B;  5CA0 E;  3ZMU B;  1HF8 A;  4AQF A;  1IAP A;  5L3E B;  5LGU B;  2KLQ A;  2CM0 A;  2X9Y A;  4PK6 A;  1X79 A;  5L2L A;  4NUV A;  2RP4 A;  3N5L A;  3ESL A;  1MMG A;  3NZQ A;  3C64 A;  4X1K E;  3LG7 A;  5H6R B;  3C4Z A;  1ZV4 X;  5DQW A;  3R6N A;  2X9W A;  3KVB A;  3CQX C;  5JR9 B;  2L9Q A;  3BQK A;  5FY1 A;  3FXE B;  1HG2 A;  1KK7 A;  1LKX A;  3GWH A;  5HWY A;  4BA9 A;  4AKG A;  2JJ9 A;  4ANJ A;  5LNK A;  1KNZ A;  2VAS A;  1HFA A;  2KWH A;  4YFS A;  3ONX A;  4YJ3 E;  2CXL A;  3ANW A;  4PJM A;  3AA7 B;  3N9L A;  1HS7 A;  4EZH A;  5LBQ B;  3VU7 H;  1FMW A;  3CX6 B;  1IJ6 A;  1SHZ C;  5JDN A;  1IJ5 A;  4JEH B;  4PW8 A;  2K5B B;  3Q5X A;  5LP6 E;  4MLK A;  4ZI2 C;  5HAX A;  2HPL A;  3OYX A;  5JDM A;  3L09 A;  3R84 B;  3AA6 B;  1VOM A;  3ZCI A;  4AKR B;  3F57 A;  2JMK A;  2KWI B;  2E9X D;  2ZM2 A;  3CQC B;  4TZ4 C;  2BDE A;  3N9Q A;  5J1G A;  4U72 A;  1V9D A;  4P09 A;  2Q9Q C;  1S94 A;  2WMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...