2KINB

Kinesin (monomeric) from rattus norvegicus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
AKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLDGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KINESIN
publication title X-ray structure of motor and neck domains from rat brain kinesin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 29
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1997-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.980 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kinB01
2KINB
chains in the Genus database with same CATH superfamily
4KMCA 4IE5A 3BQKA 3AEBA 5H6QB 4PK4A 4EEBA 3E22E 5FMNA 3HR0A 4DV2T 1WR6A 2WDQA 4H63H 2JQHA 3NZPA 3OKQA 1MIWA 1W09A 5LHIB 5AFUL 5AQFB 2LKHA 1UK5A 4B3TT 5AQVB 1LRZA 2YINA 4GKKT 2ZMAA 2DWGA 2X9HA 4XZCA 4ISSA 3QOFA 3S4UA 2LSKA 2BS2A 3IA3A 3LK42 5LBMA 4QX7B 3RIFA 1W0BA 4ERRA 4Z90A 5FY0A 1FMWA 2LE8A 4H9SE 3ONJA 5LBQB 3SFEA 4JBWF 2UXBT 1YKEB 3I9WA 2MPKA 3RIUA 3R84B 2XUEA 2XTLA 4OYJA 2H88A 3C4WA 4UVCB 5HCJA 3P7IA 2V26A 1W0AA 3V5UA 4HFBA 2CWOA 3UUBA 4OHFA 3FBZA 3UT5E 3OTOT 4ISTA 5ABFA 2BG9C 4JI5T 3OJAA 5AQGB 1HF8A 4OFZA 2CA5A 1JNZA 5JREA 4AKGA 2HPLA 1H7CA 4GK0E 3U78A 1WRDA 3UU3A 5TAOA 1MMGA 3AE4A 2VVSA 2CEAA 3IBPA 3P4WA 2CPTA 4U7IA 4J2CA 2XASB 3ZEFB 4ZI7E 4JEUB 2FBWA 4O2AE 5ABEA 5LG3A 2CMRA 5AQKB 2KXPB 1N33T 2E9XD 4L9IA 2CLYC 4TZ4C 4JI8T 2UUBT 3ZMUB 4M1PA 2CHOA 1ZHCA 2XQ5A 2EHOB 1SE7A 3AEAA 3ZMSB 2J62A 3L09A 2YK0A 4UIGA 5L3FB 1QUUA 1VRBA 4PNIA 4QH1A 5HXEA 2E2AA 2WU2A 3PURA 2E9XA 4MHCA 1GQEA 3KVBA 2J4GA 3SFDA 4NIQA 2RA1A 3UUNA 4CI3B 4DMVA 3L3PA 2YU1A 4COFA 3C51A 1MIYA 4H9QC 4JI2T 3R6NA 3X1DA 2CLYB 2QYWA 3WAKA 5GONE 2IHR1 3CKDA 3AEEA 3PUSA 4NUUA 4TWHA 4TN7B 3AAEB 5CFBA 5AQHB 3NKZA 2HHHT 2LSIA 2W00A 3PDYA 4IREA 4OK0A 2NP9A 2X9XA 3B5MA 1DU2A 3LK3B 1R8IA 3CQCB 5HYAA 4GK5E 3VKGA 3NWIA 5LG4A 5FYMA 2LSYA 2Z6EA 3UUXB 2JJ9A 2KSRA 1HFAA 1LVKA 3JAFA 4DBQA 4IDNA 4HN9A 4ZS2A 5FY1A 5M4YA 3HKEE 1MIVA 3N9NA 4EGWA 1T8BA 2WDVA 3JCFA 5L3EB 1NAFA 4AQFA 3EDVA 3KFWX 4ZOLE 2WBLA 2V7JA 1NWMX 2XAFB 3PUVF 2NW8A 4E7SA 4X62T 4I43B 3Q9DA 4EYUA 4IL9A 4AQGA 5J2UE 2CBJA 3AXJB 4A98A 1VCTA 3WAJA 2NTYA 4EEDA 3BQIA 2XM2A 3O1JA 4B3MT 3AE3A 4DMWA 4CI1B 3ZN1B 3I9YA 5IYZE 3N2GE 3O1IA 5LYJE 2KZ7B 5CGMA 1IBMT 2LRKA 2VKJA 2J47A 5A1LA 3T1YT 2BS4A 2IC9A 2XJ7A 2V5CA 3EDUA 1BR1A 4NXNT 5LHGB 2H7OA 3KV6A 3J7Yq 4IE6A 1KK7A 2V5DA 2D0UA 3NBXX 3VR9A 4CXXA 4ILUA 4LF9T 4X20E 3KINB 3MK7C 2N9DA 4GYSA 3RYHE 5C2TA 4JUYA 2DWKA 3PJAJ 4ZZBA 1WLXA 3AE9A 3RX6A 1S35A 3VRAA 3N9OA 2VQFT 4ZI2D 5JR9A 4A56A 3N2OA 4C91A 1FJGT 3PV0F 2CM0A 2H7VC 4DBRA 3LBXA 3AE7A 1MMNA 2IC6A 2DHRA 1MMAA 3F2EA 3SOLA 3L8RA 4DR1T 5HCMA 3B57A 3UFGA 4EYYR 4DV1T 2LOPA 3JAEA 5AQNB 4UVBB 2XQ8A 1BR0A 3GN5B 5JDMA 5AQJB 1MMDA 4H9OC 3ZJ1A 2BZBA 1KNRA 3UTKA 3C4ZA 4ILAA 3JADA 2WP9A 4TWDA 1X79A 1KNZA 4DUYT 5CA0E 2V6XA 3CQGB 5L3BB 3N2KE 4I0UA 4IDOA 4PJNA 2ZM6T 2X0HA 2W62A 4AI6A 2V6YA 2LM2A 4AQYT 3FZLB 2OLTA 4PFOA 4YTNA 4K0UA 1XWMA 4BAYB 2XSAA 4HWFA 3FB2A 5ADXL 4YSXA 3TLTA 2X67A 3EAMA 2GK9A 1HG2A 5HEJA 3KBUA 2BVLA 2WB5A 4EB6E 3K8PC 2NOXA 1VOMA 2XQ9A 2X68A 4UV8B 2VL0A 5FXWA 5HWYA 5AQSB 2R6GF 3ZJ2A 4UV9B 3AA6B 1UX4A 3NRYA 3A5XA 4GOUA 5CB4E 1V9DA 3FXEB 2FJDA 2E5VA 2A3DA 2X0YA 2VVNA 3RKGA 4U72A 1NEKA 3UU4A 2ODUA 4IL4A 2WZHA 3Q5EA 3IF8B 3CVRA 1XMOT 5JDGA 4DUZT 2X51A 3RYFE 5CJ5A 3PUQA 4CN1A 5FXZA 3ZKRA 2VURA 3I1AA 5BR8T 3SS1A 1MNDA 3RF1A 4AKRB 5JH7E 3PUGA 5BMVE 1G73A 4EAHA 4V1Av 3C4XA 5AQRB 4KX6A 5L4EA 4DV3T 4GKJT 1XNQT 3ZT7A 3PTRB 2K9AA 3P50A 4TNVA 4LF7T 2ZM8A 4B3ST 2V7LA 4O4LE 2CE7A 3KBTA 2LJLA 4UELA 5ABFB 2EHOC 1OEDC 5HWXA 5L2LA 5L4HA 3N9LA 2PTFA 3NRXA 4U74A 1OEDE 2ACZA 2NR4A 4HWCA 3ETUA 5IWAT 2WDRA 4YT0A 4ZZCA 3TLVA 2DLRA 4YHHT 3AECA 2FJEA 4KI0F 5AQUB 2KLQA 3P4RA 5C8YE 4LF8T 3C98B 4Z8XA 1QSDA 3RH3A 2VKHA 3DTOA 4PJMA 3RYIE 4QX8B 3ZMVB 5DJQC 3MXZA 1US7B 3TLSA 4H63V 4I4TE 1WFDA 2WAUA 4TWFA 4DV7T 5EK3A 5HXRA 3NZQA 4FI5A 3AE1A 1JNRA 3WI3A 1KEYA 5J2TE 2V7IA 4P0BA 4DO0A 2CXLA 4L0RA 2W66A 4HWHA 1OEDB 2YU2A 3RYCE 3ZSSA 5ABHA 2VKOA 3UUMA 3GMIA 5H6RB 3NVOA 3T1HT 2VQET 5FL1A 3RC3A 2C5IT 5DQWA 5F8PA 2I0MA 3H37A 1HX8A 2WCAA 1ZKEA 1G8XA 2XM1A 5JDFA 1N32T 5AQLB 4QXBB 5LXTE 4PJJA 4UXNB 3AE2A 1SHZC 3H3AA 3OBVE 4C90A 3OVUA 1VCSA 3P4PA 2MAWA 2DCFA 4O4IE 4LMJA 3SWHA 1Z8UA 2Y48B 2MOZA 1IBLT 3RQUA 4TV8E 5HEGA 2BG9A 2VASA 4Z91A 2C5JA 3LSVA 5IHYA 2I59A 3RLFF 4YSZA 2OA5A 3Q5DA 1D0YA 4A5XA 3CPZA 1YQ4A 1WYCA 2IIUA 3PUZF 2UXNB 4UF0B 1J1JA 1NENA 5L47A 3ZMTB 2VWAA 2DNXA 1S94A 4OYKA 4P1NA 2BKOA 4ZS3A 5J1GA 5JTGA 3DJBA 4AKIA 3UU5A 3AAIA 4F6RC 2XQYA 3AE8A 2C5KT 4BJMA 2IDOB 3Q5WA 4JI6T 2QVAA 5LJNA 1YD8G 2BBJA 5JQGE 2LEHA 4U7YA 1E1HB 1SUMB 5AQTB 3UQ4A 4HFCA 4ILBA 1HNZT 4QKNA 1XMQT 4TNWA 1XNRT 4GYRA 2F4VT 2XQ3A 3FXDB 3RGLA 4JI0T 4JYAT 3BK9A 4IGUA 2RP4A 3LFMA 3UU8A 3V5SA 3UQ7A 3PJAA 5L3DB 1M7KA 2YDQA 4ANJA 2QRXA 5JDLA 5LGUB 2LM9A 4HFVA 4ZI2C 4JI4T 3AE6A 2AXDS 4MFRA 2W0GA 2PJQA 2W61A 4LMLA 5HEUA 4I55E 2H3RA 2V7KA 5JRCA 3EHZA 5AQQB 5LHHB 3RI5A 1M62A 2RPAA 4WW0A 2E8IA 4EZ4A 2JMKA 3AXJA 4AKHA 2XPKA 2Y8DA 2PG8A 4JI1T 3BQLA 2OV9A 1EZ3A 3C50A 2W2UA 2PBIA 1U5PA 4JI7T 1IZNB 3PUYF 2N1GA 2LOSA 4ASKA 2BKPA 2G0UA 3HA4A 2JMHA 2WWUA 3G06A 3LBXB 3N9QA 4A97A 3CIRA 5J0ZA 3QB5A 4KUMB 4CXYA 5HEHA 2JPFA 3P4QA 2ZM0A 3CWZB 2Q9QD 1X9BA 3TLUA 1I94T 2WZIA 3P4SA 5JVDE 2I6HA 3OPCA 2XSBA 4HFIA 4EOZB 4YSYA 3VRBA 3FHNA 1FEWA 1WCRA 4DR5T 4DNDA 3EI0A 3ZN0B 3LG7A 3QK6A 3RKOA 4QH4A 3N9MA 4NPPA 3VR8A 2WM9A 5C3JA 2WMOA 2WQYA 3AA1B 4PK6A 2VKDA 2V6YB 3AAAB 3N9PA 3IHRA 3ZC0A 3CK6A 4X1YE 1IJ5A 1I6ZA 3MZKB 2Q9QA 5LMNT 2XQ4A 3ESLA 3RC8A 1XDOA 3E08A 1ZP0A 2L3LA 5AQOB 3I0QA 2JRKA 4PK5A 3QUJA 1E7PA 3Q5XA 1HNXT 2QA7A 4AKLA 1XDPA 3ZT6A 2JQ9A 2K5BB 4WBOA 2CHNA 2ODVA 3ZMZB 3RIUC 4U2ZA 2UXXB 4CI2B 2IMLA 2UUAT 2E5LT 5ETWA 2KWHA 4HGAA 3JC6D 3AA0B 3M3ZB 4YTMA 2JQQA 2XHEB 3W15B 4I50E 3CX7B 4U31A 1HX1B 1YW0A 2A72A 2B76A 4LFAT 3PU8A 4CQIA 3AEFA 2FJBA 4YHJA 1ZEEA 5LOVE 4BA9A 4E7ZA 5DQVA 1XZYA 5FY7A 3J9X1 2L8KA 4MLKA 2XAJB 2D2SA 4B3RT 4QHOA 4QXCB 1UUSA 5FKYA 4U3CA 2C0SA 2HPJA 3HKDE 3ANWA 2V1DB 4HFHA 2XAGB 4NUVA 5DABA 3VHLA 4XAXB 4DR6T 3H3MA 4ZI3D 4WNKA 3ZCJA 4ZHQE 5FXVA 4HFEA 1ZV4X 2VB6A 3PE0A 1J5ET 4AISA 2K3WA 2KT9A 2LRLA 1O3XA 2HN2A 4X66T 1BR2A 5HAXA 2XY8B 3I0OA 4IDQA 4DV0T 1N36T 1IJ6A 2CBIA 2H89A 2IUBA 4DR4T 4EXTA 3HL6A 4P0AA 3A8YC 2XAQB 3SRZA 2VK9A 2LLYA 4MBQA 5AQPB 4EZHA 4IDPA 1J5WA 2E9XC 3AEGA 4TX5A 3EVYA 1Y64B 2UUCT 2XQ7A 5EZYE 5FVLA 3VKHA 4DVDA 2BS3A 4CZZB 2W4XA 4JLEA 2D0TA 4ADZA 5CA1E 2NW9A 3ABVA 5HXHA 3AE5A 2BVMA 4HEAA 3FZHB 2BBHA 4WZXA 5EK2A 4HTEA 4KBMB 4FJOA 2LSJA 1KNPA 3QC9A 2NTXA 1WYBA 2WSSV 2D9DA 3MKDA 5FL0A 3ZCIA 3RHWA 3O4XE 5LCYA 1YQ3A 4JV5T 2BG9E 3KV9A 2YOEA 4H9RC 4DV6T 1ZOYA 2Y6XA 1UCUA 2KINB 4YJ2E 3ZSTA 3ZYLA 3A7MA 2XZEA 2ES0A 5F5WA 2EHOD 3MJXA 5LJMA 4YXDA 4UR9A 4EIWA 1LVFA 3ZYKA 2JQKA 5KMGP 4O2BE 4QWNB 2E9XB 4P09A 4PW8A 2LSGA 3CQXC 1Y01A 5LGTB 1Z0PA 5JDQA 2BKNA 3K3OA 1W9RA 1YXRA 2UU9T 2QGSA 3MACA 2W63A 2YN6A 4AQFC 2WY2A 4YTPA 4IE4A 1D0XA 2CXFA 5AQMB 2BG9B 4LF4T 1OXZA 2ACXA 2EHOA 1OEDA 2D5UA 4L5GA 3AEDA 2A2FX 5JDHA 4HKAA 2WWVA 4LF6T 4CN6A 2X66A 1KFYA 2FUPA 3M65A 4LMKA 3CX6B 4IE0A 4ILCA 3AA7B 4ZXLA 3ONXA 3MA9A 4DR3T 1FIOA 4N78D 4H9NC 4AXPA 2LT3A 3D0TA 3UULA 2DL1A 1CHUA 3P8CD 2XQAA 4DR2T 2B1EA 2HH7A 4LFBT 4QXHB 3K3NA 2CRBA 3PUXF 5L3CB 3EABA 3HKCE 2NWBA 4KHZF 2MTQA 2W67A 1HG5A 3EUHA 2HN1A 5HXSA 4JI3T 1D1CA 5KDMC 1HR0T 2X9YA 4UVAB 2ZLYA 3U3IA 4U2YA 3LK2B 5ABGA 5IUXA 4UF0A 1D1AA 4WBNE 5KX5E 3TKLB 2M67A 4Q25A 3IEEA 3UU6A 1UX5A 5JR9C 5HEOA 1HTJF 5EK4A 2ZM2A 5FP3A 3DP7A 4KHPT 3PUWF 1HS7A 4EV6A 4LF5T 3CX8B 2IW5B 4DR7T 4BJNA 4O4HE 4CXWA 1T98A 5F3JA 3HKBE 1FMVA 1HNWT 4IT4A 3AB3B 2LKGA 3ONLC 1IBKT 5JRCB 5LMUT 1SA0E 4CN4A 4MALA 1MNEA 3ZT5A 4F8HA 4X5TA 4YLHA 3O9XA 2YEVC 5FVKA 3E0ZA 1UURA 3TLWA 2Q9QC 2XAHB 3LJCA 3B13A 3C64A 5L3GB 2P9BA 5LGNB 4ZEYA 4PFPA 1E2AA 2MBGA 4GIWA 5AQIB 4PJLA 5JDNA 3AVRA 3ETVA 5FXXA 3VU7H 4OX9T 4UEMA 2YDRA 4QH5A 5JR9B 1CUNA 2WMNA 1B7TA 4HWIB 4YFSA 3F31A 3ZYMA 4PAGA 4YJ3E 2KWIB 2J1DG 5KXJA 2L9QA 2UXCT 3HI2A 4TV9E 3GA8A 3KV4A 5HXCA 1N34T 4KP3C 1U4QA 4X64T 2VL8A 2CCQA 3QNUA 3RPUA 1WR0A 2CXDA 1IAPA 3FZKB 2SPCA 2CWYA 4HWDA 1T72A 2LHNA 4HE8A 3O1HA 3QB5K 2MYSA 3K1SA 4IHJE 3RIAA 2M6IA 4IE7A 5LP6E 4LFCT 3OYXA 2XQ6A 4O4JE 2N2NA 3OYZA 4TUYE 2PFVA 2Q9QB 5LB7B 4K0KT 3PUAA 3JC6C 1KF6A 3RRCA 3UFEA 2UXDT 2X9WA 2V8SV 5LA6E 3GWHA 3ZLIA 4IIJE 4IDZA 4WYVA 2WS3A 3ZC1A 4DIDB 3ZPOA 2K48A 3N5LA 3AVSA 4U33A 1BR4A 3FZFB 2IAKA 3LDQB 1D0ZA 4X1IE 4O8SA 3RRWA 4XBFB 3PU3A 4HFDA 1YKHB 4AIUA 2K24A 2YKSA 4DV5T 3GN5A 2V7MA 2AE9A 4YY3T 2X0LB 1T7SA 2BDEA 4ZI3C 2YDSA 5E0OA 3KVAA 2DI4A 2JIWA 5LNKA 3F57A 3FBLA 3T8OA 3Q2MA 2A9UA 2NW7A 1OWAA 3L39A 2WU5A 1AJ3A 3FZMB 4G2AA 4JEHB 1LKXA 4X65T 4X1KE 3CMLA 1QLBA 2LHRA 2KNDA 1UGOA 3ANWB 3RQWA 2M6BA 1D1BA 4NXMT 4DV4T 2KMFA 2FJAA 4B6XA 5FNVE 1HCIA 3KV5A 1L0VA 3K3QC 3KDSE 4H9PC 4G63A
chains in the Genus database with same CATH topology
4KMCA 4AKIA 4IE5A 1UCUA 3RX6A 1S35A 3BQKA 2KINB 4YJ2E 3N9OA 5H6QB 3AAIA 4F6RC 2XQYA 4ZI2D 4PK4A 2C5KT 3E22E 3ZYLA 4BJMA 5FMNA 5JR9A 4A56A 2ES0A 3Q5WA 3HR0A 3N2OA 1WR6A 4C91A 2EHOD 4H63H 3MJXA 5LJNA 1YD8G 2CM0A 2H7VC 3NZPA 4DBRA 3OKQA 5LJMA 3LBXA 1MIWA 1MMNA 4EIWA 5LHIB 5AFUL 5JQGE 2LEHA 1LVFA 3ZYKA 5KMGP 4O2BE 2IC6A 2DHRA 1MMAA 3F2EA 1LRZA 1E1HB 4QWNB 2E9XB 3SOLA 2YINA 3B57A 4P09A 4PW8A 2LSGA 3CQXC 2ZMAA 4EYYR 2DWGA 2LOPA 2X9HA 4XZCA 4QKNA 4GYRA 4ISSA 5LGTB 3S4UA 1Z0PA 4UVBB 2LSKA 3FXDB 5JDQA 3K3OA 1BR0A 3GN5B 5JDMA 2QGSA 1MMDA 4H9OC 3LK42 3BK9A 5LBMA 4QX7B 3MACA 3ZJ1A 4IGUA 2RP4A 3LFMA 4ERRA 2W63A 2BZBA 4AQFC 3UTKA 5FY0A 3V5SA 3C4ZA 1FMWA 4IE4A 2LE8A 4H9SE 1D0XA 2CXFA 1OXZA 1X79A 2ACXA 5LBQB 1KNZA 2EHOA 5L3DB 5CA0E 2D5UA 4L5GA 4ANJA 3CQGB 2A2FX 1YKEB 5JDHA 5L3BB 4HKAA 5JDLA 5LGUB 2X66A 2LM9A 3M65A 3N2KE 3I9WA 4HFVA 4ZI2C 4PJNA 3R84B 2XUEA 2XTLA 3CX6B 2W62A 4IE0A 4OYJA 3AA7B 2W0GA 4MFRA 2PJQA 4AI6A 2W61A 3C4WA 3ONXA 4UVCB 3P7IA 3MA9A 4I55E 2V26A 1FIOA 2H3RA 4N78D 2V7KA 4H9NC 3V5UA 4PFOA 5JRCA 2CWOA 4AXPA 2LT3A 4K0UA 4OHFA 3FBZA 5LHHB 4BAYB 3UT5E 3D0TA 3UULA 4WW0A 3FB2A 2E8IA 4ISTA 4EZ4A 5ADXL 2X67A 3P8CD 2B1EA 2JMKA 2HH7A 2GK9A 1HG2A 3OJAA 4QXHB 4AKHA 3KBUA 1HF8A 3K3NA 4OFZA 2BVLA 2CA5A 4EB6E 3K8PC 5L3CB 2Y8DA 2PG8A 3BQLA 5JREA 4AKGA 2HPLA 2NOXA 1EZ3A 1H7CA 1VOMA 3C50A 3HKCE 2X68A 4UV8B 4GK0E 2NWBA 2PBIA 1U5PA 3U78A 1IZNB 1WRDA 5TAOA 2MTQA 2N1GA 5FXWA 5HWYA 1MMGA 2LOSA 4ASKA 2G0UA 3HA4A 1HG5A 3EUHA 2JMHA 2WWUA 2CEAA 3IBPA 4UV9B 3ZJ2A 5HXSA 3AA6B 3LBXB 3N9QA 1UX4A 3NRYA 1D1CA 4J2CA 2XASB 3A5XA 5KDMC 4GOUA 5CB4E 1V9DA 2X9YA 4UVAB 2ZLYA 3FXEB 3U3IA 3ZEFB 4ZI7E 4JEUB 4O2AE 4KUMB 4CXYA 3LK2B 2CMRA 2A3DA 2JPFA 2ZM0A 2KXPB 3CWZB 2Q9QD 4U72A 5JVDE 4UF0A 2ODUA 2E9XD 1D1AA 4WBNE 5KX5E 4L9IA 2M67A 3TKLB 2CLYC 4TZ4C 3IEEA 3IF8B 4EOZB 3CVRA 1UX5A 5JR9C 1HTJF 5JDGA 3ZMUB 4M1PA 2X51A 3RYFE 1ZHCA 3FHNA 1FEWA 3PUQA 5EK4A 5FXZA 2ZM2A 5FP3A 3DP7A 1HS7A 4DNDA 3I1AA 3CX8B 2IW5B 3ZN0B 3LG7A 4BJNA 2EHOB 3QK6A 4O4HE 3SS1A 3RKOA 4CXWA 1MNDA 3ZMSB 1T98A 5F3JA 4AKRB 3HKBE 1FMVA 3L09A 5JH7E 2YK0A 4UIGA 3PUGA 3N9MA 5L3FB 2WM9A 1QUUA 1G73A 2WMOA 3AA1B 4PK6A 1VRBA 2VKDA 4V1Av 4EAHA 5BMVE 3C4XA 3AAAB 3N9PA 3AB3B 3IHRA 3ZC0A 4X1YE 1IJ5A 3MZKB 4PNIA 5HXEA 5JRCB 2Q9QA 1SA0E 2K9AA 3PTRB 3PURA 3ESLA 3RC8A 4MALA 2E9XA 1MNEA 2ZM8A 3E08A 2L3LA 4YLHA 4MHCA 2V7LA 4O4LE 3O9XA 3I0QA 2CE7A 3KBTA 2LJLA 2JRKA 4PK5A 3QUJA 4UELA 3Q5XA 2YEVC 3KVBA 2EHOC 3E0ZA 5HWXA 2Q9QC 2RA1A 3UUNA 4CI3B 2QA7A 5L2LA 4AKLA 2XAHB 4DMVA 3LJCA 3C64A 3B13A 3L3PA 2YU1A 2K5BB 3N9LA 4WBOA 2ODVA 3ZMZB 3NRXA 3C51A 5L3GB 2UXXB 4U74A 2P9BA 4CI2B 5LGNB 5ETWA 4PFPA 2KWHA 2MBGA 3ETUA 1MIYA 4GIWA 4H9QC 4PJLA 4HGAA 5JDNA 3JC6D 3AA0B 3AVRA 2DLRA 3ETVA 3R6NA 5FXXA 3VU7H 2CLYB 2JQQA 4UEMA 3WAKA 5GONE 2XHEB 3W15B 5JR9B 4I50E 1CUNA 3CX7B 2WMNA 1B7TA 2KLQA 1YW0A 2A72A 3CKDA 5C8YE 4YFSA 3F31A 3PU8A 3C98B 4Z8XA 3ZYMA 4CQIA 4PAGA 1QSDA 3RH3A 4YJ3E 2VKHA 3DTOA 3PUSA 2KWIB 4NUUA 4PJMA 3RYIE 4QX8B 2J1DG 3ZMVB 4YHJA 1ZEEA 2L9QA 5DJQC 5LOVE 4BA9A 4TN7B 3MXZA 3HI2A 4E7ZA 4TV9E 5DQVA 3AAEB 3GA8A 3KV4A 5FY7A 5HXCA 1US7B 4H63V 4I4TE 3J9X1 2L8KA 4KP3C 4MLKA 1U4QA 2LSIA 2XAJB 2D2SA 2VL8A 2CCQA 2WAUA 4QHOA 4QXCB 3RPUA 2W00A 2CXDA 5EK3A 3PDYA 4OK0A 2C0SA 1IAPA 2HPJA 5HXRA 2NP9A 3HKDE 3ANWA 3NZQA 2V1DB 2SPCA 2CWYA 4FI5A 2XAGB 2X9XA 4NUVA 5DABA 3VHLA 3WI3A 4XAXB 3LK3B 5J2TE 3CQCB 2V7IA 2LHNA 4ZI3D 5HYAA 4P0BA 4WNKA 3ZCJA 4DO0A 4HE8A 2CXLA 3O1HA 4ZHQE 4GK5E 3VKGA 5FXVA 4L0RA 5LG4A 5FYMA 2LSYA 2MYSA 4IHJE 2Z6EA 3UUXB 2JJ9A 4IE7A 5LP6E 1HFAA 1LVKA 1ZV4X 3OYXA 2VB6A 4O4JE 4DBQA 3PE0A 2N2NA 3OYZA 4HN9A 2YU2A 4TUYE 4ZS2A 3RYCE 2PFVA 5FY1A 2Q9QB 5M4YA 2KT9A 3HKEE 1MIVA 3PUAA 2VKOA 3JC6C 3RRCA 3UFEA 3UUMA 3GMIA 1O3XA 2X9WA 3N9NA 5H6RB 1BR2A 5LA6E 3GWHA 3ZLIA 5L3EB 1NAFA 4IIJE 5HAXA 4AQFA 3I0OA 3EDVA 4IDZA 3KFWX 4ZOLE 2WBLA 3RC3A 2C5IT 1IJ6A 2V7JA 1NWMX 2XAFB 4EXTA 3HL6A 3ZC1A 3ZPOA 2K48A 4P0AA 3N5LA 2NW8A 2XAQB 5DQWA 5F8PA 4E7SA 3AVSA 3SRZA 3H37A 1HX8A 1ZKEA 1BR4A 4I43B 2IAKA 3Q9DA 2VK9A 1D0ZA 4X1IE 4O8SA 4EYUA 1G8XA 4MBQA 3RRWA 4AQGA 5JDFA 4XBFB 3PU3A 4QXBB 4EZHA 5J2UE 5LXTE 1YKHB 4PJJA 4UXNB 2K24A 1SHZC 3H3AA 3OBVE 3WAJA 2NTYA 4C90A 3GN5A 3BQIA 2V7MA 3O1JA 2E9XC 2X0LB 4TX5A 3EVYA 2DCFA 4DMWA 1Y64B 2BDEA 4O4IE 4CI1B 3ZN1B 3I9YA 5IYZE 4ZI3C 5EZYE 3N2GE 3O1IA 3SWHA 2Y48B 2MOZA 3VKHA 5LYJE 4DVDA 4TV8E 2KZ7B 4CZZB 5E0OA 2VASA 3KVAA 4JLEA 2D0TA 4ADZA 2DI4A 2VKJA 2C5JA 5CA1E 5IHYA 3F57A 2I59A 3FBLA 3T8OA 5A1LA 5LNKA 2IC9A 2NW9A 3EDUA 3Q2MA 1BR1A 2NW7A 5HXHA 2OA5A 1OWAA 1D0YA 5LHGB 1AJ3A 4G2AA 4JEHB 1LKXA 2BVMA 4HEAA 3CPZA 2H7OA 3KV6A 3J7Yq 1WYCA 1KK7A 4IE6A 5EK2A 4HTEA 4X1KE 2D0UA 3CMLA 4KBMB 4FJOA 2LSJA 3NBXX 3QC9A 2NTXA 2UXNB 4CXXA 1WYBA 2WSSV 4ILUA 2LHRA 3MKDA 2KNDA 4UF0B 4X20E 3ANWB 3ZCIA 3KINB 1D1BA 3O4XE 3MK7C 5LCYA 2N9DA 2KMFA 4GYSA 4B6XA 3RYHE 5FNVE 1HCIA 3ZMTB 2VWAA 2DNXA 4JUYA 2DWKA 1S94A 4OYKA 3KV5A 3K3QC 4ZS3A 3KV9A 4H9RC 5J1GA 3KDSE 1WLXA 4H9PC 4G63A 3DJBA 2Y6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIN B; 
#chains in the Genus database with same CATH topology
 4KMC A;  4IE5 A;  3BQK A;  3AEB A;  5H6Q B;  4PK4 A;  4EEB A;  3E22 E;  5FMN A;  3HR0 A;  4DV2 T;  1WR6 A;  2WDQ A;  4H63 H;  2JQH A;  3NZP A;  3OKQ A;  1MIW A;  1W09 A;  5LHI B;  5AFU L;  5AQF B;  2LKH A;  1UK5 A;  4B3T T;  5AQV B;  1LRZ A;  2YIN A;  4GKK T;  2ZMA A;  2DWG A;  2X9H A;  4XZC A;  4ISS A;  3QOF A;  3S4U A;  2LSK A;  2BS2 A;  3IA3 A;  3LK4 2;  5LBM A;  4QX7 B;  3RIF A;  1W0B A;  4ERR A;  4Z90 A;  5FY0 A;  1FMW A;  2LE8 A;  4H9S E;  3ONJ A;  5LBQ B;  3SFE A;  4JBW F;  2UXB T;  1YKE B;  3I9W A;  2MPK A;  3RIU A;  3R84 B;  2XUE A;  2XTL A;  4OYJ A;  2H88 A;  3C4W A;  4UVC B;  5HCJ A;  3P7I A;  2V26 A;  1W0A A;  3V5U A;  4HFB A;  2CWO A;  3UUB A;  4OHF A;  3FBZ A;  3UT5 E;  3OTO T;  4IST A;  5ABF A;  2BG9 C;  4JI5 T;  3OJA A;  5AQG B;  1HF8 A;  4OFZ A;  2CA5 A;  1JNZ A;  5JRE A;  4AKG A;  2HPL A;  1H7C A;  4GK0 E;  3U78 A;  1WRD A;  3UU3 A;  5TAO A;  1MMG A;  3AE4 A;  2VVS A;  2CEA A;  3IBP A;  3P4W A;  2CPT A;  4U7I A;  4J2C A;  2XAS B;  3ZEF B;  4ZI7 E;  4JEU B;  2FBW A;  4O2A E;  5ABE A;  5LG3 A;  2CMR A;  5AQK B;  2KXP B;  1N33 T;  2E9X D;  4L9I A;  2CLY C;  4TZ4 C;  4JI8 T;  2UUB T;  3ZMU B;  4M1P A;  2CHO A;  1ZHC A;  2XQ5 A;  2EHO B;  1SE7 A;  3AEA A;  3ZMS B;  2J62 A;  3L09 A;  2YK0 A;  4UIG A;  5L3F B;  1QUU A;  1VRB A;  4PNI A;  4QH1 A;  5HXE A;  2E2A A;  2WU2 A;  3PUR A;  2E9X A;  4MHC A;  1GQE A;  3KVB A;  2J4G A;  3SFD A;  4NIQ A;  2RA1 A;  3UUN A;  4CI3 B;  4DMV A;  3L3P A;  2YU1 A;  4COF A;  3C51 A;  1MIY A;  4H9Q C;  4JI2 T;  3R6N A;  3X1D A;  2CLY B;  2QYW A;  3WAK A;  5GON E;  2IHR 1;  3CKD A;  3AEE A;  3PUS A;  4NUU A;  4TWH A;  4TN7 B;  3AAE B;  5CFB A;  5AQH B;  3NKZ A;  2HHH T;  2LSI A;  2W00 A;  3PDY A;  4IRE A;  4OK0 A;  2NP9 A;  2X9X A;  3B5M A;  1DU2 A;  3LK3 B;  1R8I A;  3CQC B;  5HYA A;  4GK5 E;  3VKG A;  3NWI A;  5LG4 A;  5FYM A;  2LSY A;  2Z6E A;  3UUX B;  2JJ9 A;  2KSR A;  1HFA A;  1LVK A;  3JAF A;  4DBQ A;  4IDN A;  4HN9 A;  4ZS2 A;  5FY1 A;  5M4Y A;  3HKE E;  1MIV A;  3N9N A;  4EGW A;  1T8B A;  2WDV A;  3JCF A;  5L3E B;  1NAF A;  4AQF A;  3EDV A;  3KFW X;  4ZOL E;  2WBL A;  2V7J A;  1NWM X;  2XAF B;  3PUV F;  2NW8 A;  4E7S A;  4X62 T;  4I43 B;  3Q9D A;  4EYU A;  4IL9 A;  4AQG A;  5J2U E;  2CBJ A;  3AXJ B;  4A98 A;  1VCT A;  3WAJ A;  2NTY A;  4EED A;  3BQI A;  2XM2 A;  3O1J A;  4B3M T;  3AE3 A;  4DMW A;  4CI1 B;  3ZN1 B;  3I9Y A;  5IYZ E;  3N2G E;  3O1I A;  5LYJ E;  2KZ7 B;  5CGM A;  1IBM T;  2LRK A;  2VKJ A;  2J47 A;  5A1L A;  3T1Y T;  2BS4 A;  2IC9 A;  2XJ7 A;  2V5C A;  3EDU A;  1BR1 A;  4NXN T;  5LHG B;  2H7O A;  3KV6 A;  3J7Y q;  4IE6 A;  1KK7 A;  2V5D A;  2D0U A;  3NBX X;  3VR9 A;  4CXX A;  4ILU A;  4LF9 T;  4X20 E;  3KIN B;  3MK7 C;  2N9D A;  4GYS A;  3RYH E;  5C2T A;  4JUY A;  2DWK A;  3PJA J;  4ZZB A;  1WLX A;  3AE9 A;  3RX6 A;  1S35 A;  3VRA A;  3N9O A;  2VQF T;  4ZI2 D;  5JR9 A;  4A56 A;  3N2O A;  4C91 A;  1FJG T;  3PV0 F;  2CM0 A;  2H7V C;  4DBR A;  3LBX A;  3AE7 A;  1MMN A;  2IC6 A;  2DHR A;  1MMA A;  3F2E A;  3SOL A;  3L8R A;  4DR1 T;  5HCM A;  3B57 A;  3UFG A;  4EYY R;  4DV1 T;  2LOP A;  3JAE A;  5AQN B;  4UVB B;  2XQ8 A;  1BR0 A;  3GN5 B;  5JDM A;  5AQJ B;  1MMD A;  4H9O C;  3ZJ1 A;  2BZB A;  1KNR A;  3UTK A;  3C4Z A;  4ILA A;  3JAD A;  2WP9 A;  4TWD A;  1X79 A;  1KNZ A;  4DUY T;  5CA0 E;  2V6X A;  3CQG B;  5L3B B;  3N2K E;  4I0U A;  4IDO A;  4PJN A;  2ZM6 T;  2X0H A;  2W62 A;  4AI6 A;  2V6Y A;  2LM2 A;  4AQY T;  3FZL B;  2OLT A;  4PFO A;  4YTN A;  4K0U A;  1XWM A;  4BAY B;  2XSA A;  4HWF A;  3FB2 A;  5ADX L;  4YSX A;  3TLT A;  2X67 A;  3EAM A;  2GK9 A;  1HG2 A;  5HEJ A;  3KBU A;  2BVL A;  2WB5 A;  4EB6 E;  3K8P C;  2NOX A;  1VOM A;  2XQ9 A;  2X68 A;  4UV8 B;  2VL0 A;  5FXW A;  5HWY A;  5AQS B;  2R6G F;  3ZJ2 A;  4UV9 B;  3AA6 B;  1UX4 A;  3NRY A;  3A5X A;  4GOU A;  5CB4 E;  1V9D A;  3FXE B;  2FJD A;  2E5V A;  2A3D A;  2X0Y A;  2VVN A;  3RKG A;  4U72 A;  1NEK A;  3UU4 A;  2ODU A;  4IL4 A;  2WZH A;  3Q5E A;  3IF8 B;  3CVR A;  1XMO T;  5JDG A;  4DUZ T;  2X51 A;  3RYF E;  5CJ5 A;  3PUQ A;  4CN1 A;  5FXZ A;  3ZKR A;  2VUR A;  3I1A A;  5BR8 T;  3SS1 A;  1MND A;  3RF1 A;  4AKR B;  5JH7 E;  3PUG A;  5BMV E;  1G73 A;  4EAH A;  4V1A v;  3C4X A;  5AQR B;  4KX6 A;  5L4E A;  4DV3 T;  4GKJ T;  1XNQ T;  3ZT7 A;  3PTR B;  2K9A A;  3P50 A;  4TNV A;  4LF7 T;  2ZM8 A;  4B3S T;  2V7L A;  4O4L E;  2CE7 A;  3KBT A;  2LJL A;  4UEL A;  5ABF B;  2EHO C;  1OED C;  5HWX A;  5L2L A;  5L4H A;  3N9L A;  2PTF A;  3NRX A;  4U74 A;  1OED E;  2ACZ A;  2NR4 A;  4HWC A;  3ETU A;  5IWA T;  2WDR A;  4YT0 A;  4ZZC A;  3TLV A;  2DLR A;  4YHH T;  3AEC A;  2FJE A;  4KI0 F;  5AQU B;  2KLQ A;  3P4R A;  5C8Y E;  4LF8 T;  3C98 B;  4Z8X A;  1QSD A;  3RH3 A;  2VKH A;  3DTO A;  4PJM A;  3RYI E;  4QX8 B;  3ZMV B;  5DJQ C;  3MXZ A;  1US7 B;  3TLS A;  4H63 V;  4I4T E;  1WFD A;  2WAU A;  4TWF A;  4DV7 T;  5EK3 A;  5HXR A;  3NZQ A;  4FI5 A;  3AE1 A;  1JNR A;  3WI3 A;  1KEY A;  5J2T E;  2V7I A;  4P0B A;  4DO0 A;  2CXL A;  4L0R A;  2W66 A;  4HWH A;  1OED B;  2YU2 A;  3RYC E;  3ZSS A;  5ABH A;  2VKO A;  3UUM A;  3GMI A;  5H6R B;  3NVO A;  3T1H T;  2VQE T;  5FL1 A;  3RC3 A;  2C5I T;  5DQW A;  5F8P A;  2I0M A;  3H37 A;  1HX8 A;  2WCA A;  1ZKE A;  1G8X A;  2XM1 A;  5JDF A;  1N32 T;  5AQL B;  4QXB B;  5LXT E;  4PJJ A;  4UXN B;  3AE2 A;  1SHZ C;  3H3A A;  3OBV E;  4C90 A;  3OVU A;  1VCS A;  3P4P A;  2MAW A;  2DCF A;  4O4I E;  4LMJ A;  3SWH A;  1Z8U A;  2Y48 B;  2MOZ A;  1IBL T;  3RQU A;  4TV8 E;  5HEG A;  2BG9 A;  2VAS A;  4Z91 A;  2C5J A;  3LSV A;  5IHY A;  2I59 A;  3RLF F;  4YSZ A;  2OA5 A;  3Q5D A;  1D0Y A;  4A5X A;  3CPZ A;  1YQ4 A;  1WYC A;  2IIU A;  3PUZ F;  2UXN B;  4UF0 B;  1J1J A;  1NEN A;  5L47 A;  3ZMT B;  2VWA A;  2DNX A;  1S94 A;  4OYK A;  4P1N A;  2BKO A;  4ZS3 A;  5J1G A;  5JTG A;  3DJB A;  4AKI A;  3UU5 A;  3AAI A;  4F6R C;  2XQY A;  3AE8 A;  2C5K T;  4BJM A;  2IDO B;  3Q5W A;  4JI6 T;  2QVA A;  5LJN A;  1YD8 G;  2BBJ A;  5JQG E;  2LEH A;  4U7Y A;  1E1H B;  1SUM B;  5AQT B;  3UQ4 A;  4HFC A;  4ILB A;  1HNZ T;  4QKN A;  1XMQ T;  4TNW A;  1XNR T;  4GYR A;  2F4V T;  2XQ3 A;  3FXD B;  3RGL A;  4JI0 T;  4JYA T;  3BK9 A;  4IGU A;  2RP4 A;  3LFM A;  3UU8 A;  3V5S A;  3UQ7 A;  3PJA A;  5L3D B;  1M7K A;  2YDQ A;  4ANJ A;  2QRX A;  5JDL A;  5LGU B;  2LM9 A;  4HFV A;  4ZI2 C;  4JI4 T;  3AE6 A;  2AXD S;  4MFR A;  2W0G A;  2PJQ A;  2W61 A;  4LML A;  5HEU A;  4I55 E;  2H3R A;  2V7K A;  5JRC A;  3EHZ A;  5AQQ B;  5LHH B;  3RI5 A;  1M62 A;  2RPA A;  4WW0 A;  2E8I A;  4EZ4 A;  2JMK A;  3AXJ A;  4AKH A;  2XPK A;  2Y8D A;  2PG8 A;  4JI1 T;  3BQL A;  2OV9 A;  1EZ3 A;  3C50 A;  2W2U A;  2PBI A;  1U5P A;  4JI7 T;  1IZN B;  3PUY F;  2N1G A;  2LOS A;  4ASK A;  2BKP A;  2G0U A;  3HA4 A;  2JMH A;  2WWU A;  3G06 A;  3LBX B;  3N9Q A;  4A97 A;  3CIR A;  5J0Z A;  3QB5 A;  4KUM B;  4CXY A;  5HEH A;  2JPF A;  3P4Q A;  2ZM0 A;  3CWZ B;  2Q9Q D;  1X9B A;  3TLU A;  1I94 T;  2WZI A;  3P4S A;  5JVD E;  2I6H A;  3OPC A;  2XSB A;  4HFI A;  4EOZ B;  4YSY A;  3VRB A;  3FHN A;  1FEW A;  1WCR A;  4DR5 T;  4DND A;  3EI0 A;  3ZN0 B;  3LG7 A;  3QK6 A;  3RKO A;  4QH4 A;  3N9M A;  4NPP A;  3VR8 A;  2WM9 A;  5C3J A;  2WMO A;  2WQY A;  3AA1 B;  4PK6 A;  2VKD A;  2V6Y B;  3AAA B;  3N9P A;  3IHR A;  3ZC0 A;  3CK6 A;  4X1Y E;  1IJ5 A;  1I6Z A;  3MZK B;  2Q9Q A;  5LMN T;  2XQ4 A;  3ESL A;  3RC8 A;  1XDO A;  3E08 A;  1ZP0 A;  2L3L A;  5AQO B;  3I0Q A;  2JRK A;  4PK5 A;  3QUJ A;  1E7P A;  3Q5X A;  1HNX T;  2QA7 A;  4AKL A;  1XDP A;  3ZT6 A;  2JQ9 A;  2K5B B;  4WBO A;  2CHN A;  2ODV A;  3ZMZ B;  3RIU C;  4U2Z A;  2UXX B;  4CI2 B;  2IML A;  2UUA T;  2E5L T;  5ETW A;  2KWH A;  4HGA A;  3JC6 D;  3AA0 B;  3M3Z B;  4YTM A;  2JQQ A;  2XHE B;  3W15 B;  4I50 E;  3CX7 B;  4U31 A;  1HX1 B;  1YW0 A;  2A72 A;  2B76 A;  4LFA T;  3PU8 A;  4CQI A;  3AEF A;  2FJB A;  4YHJ A;  1ZEE A;  5LOV E;  4BA9 A;  4E7Z A;  5DQV A;  1XZY A;  5FY7 A;  3J9X 1;  2L8K A;  4MLK A;  2XAJ B;  2D2S A;  4B3R T;  4QHO A;  4QXC B;  1UUS A;  5FKY A;  4U3C A;  2C0S A;  2HPJ A;  3HKD E;  3ANW A;  2V1D B;  4HFH A;  2XAG B;  4NUV A;  5DAB A;  3VHL A;  4XAX B;  4DR6 T;  3H3M A;  4ZI3 D;  4WNK A;  3ZCJ A;  4ZHQ E;  5FXV A;  4HFE A;  1ZV4 X;  2VB6 A;  3PE0 A;  1J5E T;  4AIS A;  2K3W A;  2KT9 A;  2LRL A;  1O3X A;  2HN2 A;  4X66 T;  1BR2 A;  5HAX A;  2XY8 B;  3I0O A;  4IDQ A;  4DV0 T;  1N36 T;  1IJ6 A;  2CBI A;  2H89 A;  2IUB A;  4DR4 T;  4EXT A;  3HL6 A;  4P0A A;  3A8Y C;  2XAQ B;  3SRZ A;  2VK9 A;  2LLY A;  4MBQ A;  5AQP B;  4EZH A;  4IDP A;  1J5W A;  2E9X C;  3AEG A;  4TX5 A;  3EVY A;  1Y64 B;  2UUC T;  2XQ7 A;  5EZY E;  5FVL A;  3VKH A;  4DVD A;  2BS3 A;  4CZZ B;  2W4X A;  4JLE A;  2D0T A;  4ADZ A;  5CA1 E;  2NW9 A;  3ABV A;  5HXH A;  3AE5 A;  2BVM A;  4HEA A;  3FZH B;  2BBH A;  4WZX A;  5EK2 A;  4HTE A;  4KBM B;  4FJO A;  2LSJ A;  1KNP A;  3QC9 A;  2NTX A;  1WYB A;  2WSS V;  2D9D A;  3MKD A;  5FL0 A;  3ZCI A;  3RHW A;  3O4X E;  5LCY A;  1YQ3 A;  4JV5 T;  2BG9 E;  3KV9 A;  2YOE A;  4H9R C;  4DV6 T;  1ZOY A;  2Y6X A;  1UCU A;  2KIN B;  4YJ2 E;  3ZST A;  3ZYL A;  3A7M A;  2XZE A;  2ES0 A;  5F5W A;  2EHO D;  3MJX A;  5LJM A;  4YXD A;  4UR9 A;  4EIW A;  1LVF A;  3ZYK A;  2JQK A;  5KMG P;  4O2B E;  4QWN B;  2E9X B;  4P09 A;  4PW8 A;  2LSG A;  3CQX C;  1Y01 A;  5LGT B;  1Z0P A;  5JDQ A;  2BKN A;  3K3O A;  1W9R A;  1YXR A;  2UU9 T;  2QGS A;  3MAC A;  2W63 A;  2YN6 A;  4AQF C;  2WY2 A;  4YTP A;  4IE4 A;  1D0X A;  2CXF A;  5AQM B;  2BG9 B;  4LF4 T;  1OXZ A;  2ACX A;  2EHO A;  1OED A;  2D5U A;  4L5G A;  3AED A;  2A2F X;  5JDH A;  4HKA A;  2WWV A;  4LF6 T;  4CN6 A;  2X66 A;  1KFY A;  2FUP A;  3M65 A;  4LMK A;  3CX6 B;  4IE0 A;  4ILC A;  3AA7 B;  4ZXL A;  3ONX A;  3MA9 A;  4DR3 T;  1FIO A;  4N78 D;  4H9N C;  4AXP A;  2LT3 A;  3D0T A;  3UUL A;  2DL1 A;  1CHU A;  3P8C D;  2XQA A;  4DR2 T;  2B1E A;  2HH7 A;  4LFB T;  4QXH B;  3K3N A;  2CRB A;  3PUX F;  5L3C B;  3EAB A;  3HKC E;  2NWB A;  4KHZ F;  2MTQ A;  2W67 A;  1HG5 A;  3EUH A;  2HN1 A;  5HXS A;  4JI3 T;  1D1C A;  5KDM C;  1HR0 T;  2X9Y A;  4UVA B;  2ZLY A;  3U3I A;  4U2Y A;  3LK2 B;  5ABG A;  5IUX A;  4UF0 A;  1D1A A;  4WBN E;  5KX5 E;  3TKL B;  2M67 A;  4Q25 A;  3IEE A;  3UU6 A;  1UX5 A;  5JR9 C;  5HEO A;  1HTJ F;  5EK4 A;  2ZM2 A;  5FP3 A;  3DP7 A;  4KHP T;  3PUW F;  1HS7 A;  4EV6 A;  4LF5 T;  3CX8 B;  2IW5 B;  4DR7 T;  4BJN A;  4O4H E;  4CXW A;  1T98 A;  5F3J A;  3HKB E;  1FMV A;  1HNW T;  4IT4 A;  3AB3 B;  2LKG A;  3ONL C;  1IBK T;  5JRC B;  5LMU T;  1SA0 E;  4CN4 A;  4MAL A;  1MNE A;  3ZT5 A;  4F8H A;  4X5T A;  4YLH A;  3O9X A;  2YEV C;  5FVK A;  3E0Z A;  1UUR A;  3TLW A;  2Q9Q C;  2XAH B;  3LJC A;  3B13 A;  3C64 A;  5L3G B;  2P9B A;  5LGN B;  4ZEY A;  4PFP A;  1E2A A;  2MBG A;  4GIW A;  5AQI B;  4PJL A;  5JDN A;  3AVR A;  3ETV A;  5FXX A;  3VU7 H;  4OX9 T;  4UEM A;  2YDR A;  4QH5 A;  5JR9 B;  1CUN A;  2WMN A;  1B7T A;  4HWI B;  4YFS A;  3F31 A;  3ZYM A;  4PAG A;  4YJ3 E;  2KWI B;  2J1D G;  5KXJ A;  2L9Q A;  2UXC T;  3HI2 A;  4TV9 E;  3GA8 A;  3KV4 A;  5HXC A;  1N34 T;  4KP3 C;  1U4Q A;  4X64 T;  2VL8 A;  2CCQ A;  3QNU A;  3RPU A;  1WR0 A;  2CXD A;  1IAP A;  3FZK B;  2SPC A;  2CWY A;  4HWD A;  1T72 A;  2LHN A;  4HE8 A;  3O1H A;  3QB5 K;  2MYS A;  3K1S A;  4IHJ E;  3RIA A;  2M6I A;  4IE7 A;  5LP6 E;  4LFC T;  3OYX A;  2XQ6 A;  4O4J E;  2N2N A;  3OYZ A;  4TUY E;  2PFV A;  2Q9Q B;  5LB7 B;  4K0K T;  3PUA A;  3JC6 C;  1KF6 A;  3RRC A;  3UFE A;  2UXD T;  2X9W A;  2V8S V;  5LA6 E;  3GWH A;  3ZLI A;  4IIJ E;  4IDZ A;  4WYV A;  2WS3 A;  3ZC1 A;  4DID B;  3ZPO A;  2K48 A;  3N5L A;  3AVS A;  4U33 A;  1BR4 A;  3FZF B;  2IAK A;  3LDQ B;  1D0Z A;  4X1I E;  4O8S A;  3RRW A;  4XBF B;  3PU3 A;  4HFD A;  1YKH B;  4AIU A;  2K24 A;  2YKS A;  4DV5 T;  3GN5 A;  2V7M A;  2AE9 A;  4YY3 T;  2X0L B;  1T7S A;  2BDE A;  4ZI3 C;  2YDS A;  5E0O A;  3KVA A;  2DI4 A;  2JIW A;  5LNK A;  3F57 A;  3FBL A;  3T8O A;  3Q2M A;  2A9U A;  2NW7 A;  1OWA A;  3L39 A;  2WU5 A;  1AJ3 A;  3FZM B;  4G2A A;  4JEH B;  1LKX A;  4X65 T;  4X1K E;  3CML A;  1QLB A;  2LHR A;  2KND A;  1UGO A;  3ANW B;  3RQW A;  2M6B A;  1D1B A;  4NXM T;  4DV4 T;  2KMF A;  2FJA A;  4B6X A;  5FNV E;  1HCI A;  3KV5 A;  1L0V A;  3K3Q C;  3KDS E;  4H9P C;  4G63 A; 
#chains in the Genus database with same CATH homology
 4KMC A;  4AKI A;  4IE5 A;  1UCU A;  3RX6 A;  1S35 A;  3BQK A;  2KIN B;  4YJ2 E;  3N9O A;  5H6Q B;  3AAI A;  4F6R C;  2XQY A;  4ZI2 D;  4PK4 A;  2C5K T;  3E22 E;  3ZYL A;  4BJM A;  5FMN A;  5JR9 A;  4A56 A;  2ES0 A;  3Q5W A;  3HR0 A;  3N2O A;  1WR6 A;  4C91 A;  2EHO D;  4H63 H;  3MJX A;  5LJN A;  1YD8 G;  2CM0 A;  2H7V C;  3NZP A;  4DBR A;  3OKQ A;  5LJM A;  3LBX A;  1MIW A;  1MMN A;  4EIW A;  5LHI B;  5AFU L;  5JQG E;  2LEH A;  1LVF A;  3ZYK A;  5KMG P;  4O2B E;  2IC6 A;  2DHR A;  1MMA A;  3F2E A;  1LRZ A;  1E1H B;  4QWN B;  2E9X B;  3SOL A;  2YIN A;  3B57 A;  4P09 A;  4PW8 A;  2LSG A;  3CQX C;  2ZMA A;  4EYY R;  2DWG A;  2LOP A;  2X9H A;  4XZC A;  4QKN A;  4GYR A;  4ISS A;  5LGT B;  3S4U A;  1Z0P A;  4UVB B;  2LSK A;  3FXD B;  5JDQ A;  3K3O A;  1BR0 A;  3GN5 B;  5JDM A;  2QGS A;  1MMD A;  4H9O C;  3LK4 2;  3BK9 A;  5LBM A;  4QX7 B;  3MAC A;  3ZJ1 A;  4IGU A;  2RP4 A;  3LFM A;  4ERR A;  2W63 A;  2BZB A;  4AQF C;  3UTK A;  5FY0 A;  3V5S A;  3C4Z A;  1FMW A;  4IE4 A;  2LE8 A;  4H9S E;  1D0X A;  2CXF A;  1OXZ A;  1X79 A;  2ACX A;  5LBQ B;  1KNZ A;  2EHO A;  5L3D B;  5CA0 E;  2D5U A;  4L5G A;  4ANJ A;  3CQG B;  2A2F X;  1YKE B;  5JDH A;  5L3B B;  4HKA A;  5JDL A;  5LGU B;  2X66 A;  2LM9 A;  3M65 A;  3N2K E;  3I9W A;  4HFV A;  4ZI2 C;  4PJN A;  3R84 B;  2XUE A;  2XTL A;  3CX6 B;  2W62 A;  4IE0 A;  4OYJ A;  3AA7 B;  2W0G A;  4MFR A;  2PJQ A;  4AI6 A;  2W61 A;  3C4W A;  3ONX A;  4UVC B;  3P7I A;  3MA9 A;  4I55 E;  2V26 A;  1FIO A;  2H3R A;  4N78 D;  2V7K A;  4H9N C;  3V5U A;  4PFO A;  5JRC A;  2CWO A;  4AXP A;  2LT3 A;  4K0U A;  4OHF A;  3FBZ A;  5LHH B;  4BAY B;  3UT5 E;  3D0T A;  3UUL A;  4WW0 A;  3FB2 A;  2E8I A;  4IST A;  4EZ4 A;  5ADX L;  2X67 A;  3P8C D;  2B1E A;  2JMK A;  2HH7 A;  2GK9 A;  1HG2 A;  3OJA A;  4QXH B;  4AKH A;  3KBU A;  1HF8 A;  3K3N A;  4OFZ A;  2BVL A;  2CA5 A;  4EB6 E;  3K8P C;  5L3C B;  2Y8D A;  2PG8 A;  3BQL A;  5JRE A;  4AKG A;  2HPL A;  2NOX A;  1EZ3 A;  1H7C A;  1VOM A;  3C50 A;  3HKC E;  2X68 A;  4UV8 B;  4GK0 E;  2NWB A;  2PBI A;  1U5P A;  3U78 A;  1IZN B;  1WRD A;  5TAO A;  2MTQ A;  2N1G A;  5FXW A;  5HWY A;  1MMG A;  2LOS A;  4ASK A;  2G0U A;  3HA4 A;  1HG5 A;  3EUH A;  2JMH A;  2WWU A;  2CEA A;  3IBP A;  4UV9 B;  3ZJ2 A;  5HXS A;  3AA6 B;  3LBX B;  3N9Q A;  1UX4 A;  3NRY A;  1D1C A;  4J2C A;  2XAS B;  3A5X A;  5KDM C;  4GOU A;  5CB4 E;  1V9D A;  2X9Y A;  4UVA B;  2ZLY A;  3FXE B;  3U3I A;  3ZEF B;  4ZI7 E;  4JEU B;  4O2A E;  4KUM B;  4CXY A;  3LK2 B;  2CMR A;  2A3D A;  2JPF A;  2ZM0 A;  2KXP B;  3CWZ B;  2Q9Q D;  4U72 A;  5JVD E;  4UF0 A;  2ODU A;  2E9X D;  1D1A A;  4WBN E;  5KX5 E;  4L9I A;  2M67 A;  3TKL B;  2CLY C;  4TZ4 C;  3IEE A;  3IF8 B;  4EOZ B;  3CVR A;  1UX5 A;  5JR9 C;  1HTJ F;  5JDG A;  3ZMU B;  4M1P A;  2X51 A;  3RYF E;  1ZHC A;  3FHN A;  1FEW A;  3PUQ A;  5EK4 A;  5FXZ A;  2ZM2 A;  5FP3 A;  3DP7 A;  1HS7 A;  4DND A;  3I1A A;  3CX8 B;  2IW5 B;  3ZN0 B;  3LG7 A;  4BJN A;  2EHO B;  3QK6 A;  4O4H E;  3SS1 A;  3RKO A;  4CXW A;  1MND A;  3ZMS B;  1T98 A;  5F3J A;  4AKR B;  3HKB E;  1FMV A;  3L09 A;  5JH7 E;  2YK0 A;  4UIG A;  3PUG A;  3N9M A;  5L3F B;  2WM9 A;  1QUU A;  1G73 A;  2WMO A;  3AA1 B;  4PK6 A;  1VRB A;  2VKD A;  4V1A v;  4EAH A;  5BMV E;  3C4X A;  3AAA B;  3N9P A;  3AB3 B;  3IHR A;  3ZC0 A;  4X1Y E;  1IJ5 A;  3MZK B;  4PNI A;  5HXE A;  5JRC B;  2Q9Q A;  1SA0 E;  2K9A A;  3PTR B;  3PUR A;  3ESL A;  3RC8 A;  4MAL A;  2E9X A;  1MNE A;  2ZM8 A;  3E08 A;  2L3L A;  4YLH A;  4MHC A;  2V7L A;  4O4L E;  3O9X A;  3I0Q A;  2CE7 A;  3KBT A;  2LJL A;  2JRK A;  4PK5 A;  3QUJ A;  4UEL A;  3Q5X A;  2YEV C;  3KVB A;  2EHO C;  3E0Z A;  5HWX A;  2Q9Q C;  2RA1 A;  3UUN A;  4CI3 B;  2QA7 A;  5L2L A;  4AKL A;  2XAH B;  4DMV A;  3LJC A;  3C64 A;  3B13 A;  3L3P A;  2YU1 A;  2K5B B;  3N9L A;  4WBO A;  2ODV A;  3ZMZ B;  3NRX A;  3C51 A;  5L3G B;  2UXX B;  4U74 A;  2P9B A;  4CI2 B;  5LGN B;  5ETW A;  4PFP A;  2KWH A;  2MBG A;  3ETU A;  1MIY A;  4GIW A;  4H9Q C;  4PJL A;  4HGA A;  5JDN A;  3JC6 D;  3AA0 B;  3AVR A;  2DLR A;  3ETV A;  3R6N A;  5FXX A;  3VU7 H;  2CLY B;  2JQQ A;  4UEM A;  3WAK A;  5GON E;  2XHE B;  3W15 B;  5JR9 B;  4I50 E;  1CUN A;  3CX7 B;  2WMN A;  1B7T A;  2KLQ A;  1YW0 A;  2A72 A;  3CKD A;  5C8Y E;  4YFS A;  3F31 A;  3PU8 A;  3C98 B;  4Z8X A;  3ZYM A;  4CQI A;  4PAG A;  1QSD A;  3RH3 A;  4YJ3 E;  2VKH A;  3DTO A;  3PUS A;  2KWI B;  4NUU A;  4PJM A;  3RYI E;  4QX8 B;  2J1D G;  3ZMV B;  4YHJ A;  1ZEE A;  2L9Q A;  5DJQ C;  5LOV E;  4BA9 A;  4TN7 B;  3MXZ A;  3HI2 A;  4E7Z A;  4TV9 E;  5DQV A;  3AAE B;  3GA8 A;  3KV4 A;  5FY7 A;  5HXC A;  1US7 B;  4H63 V;  4I4T E;  3J9X 1;  2L8K A;  4KP3 C;  4MLK A;  1U4Q A;  2LSI A;  2XAJ B;  2D2S A;  2VL8 A;  2CCQ A;  2WAU A;  4QHO A;  4QXC B;  3RPU A;  2W00 A;  2CXD A;  5EK3 A;  3PDY A;  4OK0 A;  2C0S A;  1IAP A;  2HPJ A;  5HXR A;  2NP9 A;  3HKD E;  3ANW A;  3NZQ A;  2V1D B;  2SPC A;  2CWY A;  4FI5 A;  2XAG B;  2X9X A;  4NUV A;  5DAB A;  3VHL A;  3WI3 A;  4XAX B;  3LK3 B;  5J2T E;  3CQC B;  2V7I A;  2LHN A;  4ZI3 D;  5HYA A;  4P0B A;  4WNK A;  3ZCJ A;  4DO0 A;  4HE8 A;  2CXL A;  3O1H A;  4ZHQ E;  4GK5 E;  3VKG A;  5FXV A;  4L0R A;  5LG4 A;  5FYM A;  2LSY A;  2MYS A;  4IHJ E;  2Z6E A;  3UUX B;  2JJ9 A;  4IE7 A;  5LP6 E;  1HFA A;  1LVK A;  1ZV4 X;  3OYX A;  2VB6 A;  4O4J E;  4DBQ A;  3PE0 A;  2N2N A;  3OYZ A;  4HN9 A;  2YU2 A;  4TUY E;  4ZS2 A;  3RYC E;  2PFV A;  5FY1 A;  2Q9Q B;  5M4Y A;  2KT9 A;  3HKE E;  1MIV A;  3PUA A;  2VKO A;  3JC6 C;  3RRC A;  3UFE A;  3UUM A;  3GMI A;  1O3X A;  2X9W A;  3N9N A;  5H6R B;  1BR2 A;  5LA6 E;  3GWH A;  3ZLI A;  5L3E B;  1NAF A;  4IIJ E;  5HAX A;  4AQF A;  3I0O A;  3EDV A;  4IDZ A;  3KFW X;  4ZOL E;  2WBL A;  3RC3 A;  2C5I T;  1IJ6 A;  2V7J A;  1NWM X;  2XAF B;  4EXT A;  3HL6 A;  3ZC1 A;  3ZPO A;  2K48 A;  4P0A A;  3N5L A;  2NW8 A;  2XAQ B;  5DQW A;  5F8P A;  4E7S A;  3AVS A;  3SRZ A;  3H37 A;  1HX8 A;  1ZKE A;  1BR4 A;  4I43 B;  2IAK A;  3Q9D A;  2VK9 A;  1D0Z A;  4X1I E;  4O8S A;  4EYU A;  1G8X A;  4MBQ A;  3RRW A;  4AQG A;  5JDF A;  4XBF B;  3PU3 A;  4QXB B;  4EZH A;  5J2U E;  5LXT E;  1YKH B;  4PJJ A;  4UXN B;  2K24 A;  1SHZ C;  3H3A A;  3OBV E;  3WAJ A;  2NTY A;  4C90 A;  3GN5 A;  3BQI A;  2V7M A;  3O1J A;  2E9X C;  2X0L B;  4TX5 A;  3EVY A;  2DCF A;  4DMW A;  1Y64 B;  2BDE A;  4O4I E;  4CI1 B;  3ZN1 B;  3I9Y A;  5IYZ E;  4ZI3 C;  5EZY E;  3N2G E;  3O1I A;  3SWH A;  2Y48 B;  2MOZ A;  3VKH A;  5LYJ E;  4DVD A;  4TV8 E;  2KZ7 B;  4CZZ B;  5E0O A;  2VAS A;  3KVA A;  4JLE A;  2D0T A;  4ADZ A;  2DI4 A;  2VKJ A;  2C5J A;  5CA1 E;  5IHY A;  3F57 A;  2I59 A;  3FBL A;  3T8O A;  5A1L A;  5LNK A;  2IC9 A;  2NW9 A;  3EDU A;  3Q2M A;  1BR1 A;  2NW7 A;  5HXH A;  2OA5 A;  1OWA A;  1D0Y A;  5LHG B;  1AJ3 A;  4G2A A;  4JEH B;  1LKX A;  2BVM A;  4HEA A;  3CPZ A;  2H7O A;  3KV6 A;  3J7Y q;  1WYC A;  1KK7 A;  4IE6 A;  5EK2 A;  4HTE A;  4X1K E;  2D0U A;  3CML A;  4KBM B;  4FJO A;  2LSJ A;  3NBX X;  3QC9 A;  2NTX A;  2UXN B;  4CXX A;  1WYB A;  2WSS V;  4ILU A;  2LHR A;  3MKD A;  2KND A;  4UF0 B;  4X20 E;  3ANW B;  3ZCI A;  3KIN B;  1D1B A;  3O4X E;  3MK7 C;  5LCY A;  2N9D A;  2KMF A;  4GYS A;  4B6X A;  3RYH E;  5FNV E;  1HCI A;  3ZMT B;  2VWA A;  2DNX A;  4JUY A;  2DWK A;  1S94 A;  4OYK A;  3KV5 A;  3K3Q C;  4ZS3 A;  3KV9 A;  4H9R C;  5J1G A;  3KDS E;  1WLX A;  4H9P C;  4G63 A;  3DJB A;  2Y6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...