3Q5WA

Structure of proteasome tether
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
198
structure length
198
Chain Sequence
DISKRARQLPVGEQLPLSRLLQYSDKQQLFTILLQCVEKHPDLARDIRGILPAPSMDTCVETLRKLLINLNDSFPYGGDKRGDYAFNRIREKYMAVLHALNDMVPCYLPPYSTCFEKNITFLDAATNVVHELPEFHNPNHNVYKSQAYYELTGAWLVVLRQLEDRPVVPLLPLEELEEHNKTSQNRMEEALNYLKQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Protein cut8
publication title Structure of Proteasome Tether
rcsb
source organism Schizosaccharomyces pombe
total genus 57
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08559 Cut8 Cut8, nuclear proteasome tether protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3q5wA00
3Q5XA 3Q5WA
chains in the Genus database with same CATH superfamily
1AJ3A 1T8BA 4GYSA 2V5DA 1HF8A 3GN5A 4DBRA 4HFCA 5CB4E 2XSAA 4KHZF 5FXVA 3AB3B 1HFAA 5L47A 2YEVC 3AA0B 5ABEA 3AE8A 2CRBA 5HXHA 4JI5T 3OYZA 4E7ZA 1YKEB 2RPAA 4EB6E 2BS3A 2DWGA 3F57A 2YDRA 3A7MA 3M3ZB 2R6GF 3LBXB 5L4HA 4UEMA 1S94A 5LYJE 4C91A 2YKSA 4IE4A 5ABFB 1H7CA 5HCJA 4DR5T 4X1YE 1T72A 4UVBB 2ZM8A 4ASKA 2XM2A 3EABA 3UUNA 1IBLT 2YU2A 2LLYA 3MJXA 5FYMA 4HWCA 4IIJE 4TUYE 2F4VT 5F8PA 3AEBA 2BS4A 3N2GE 5L3FB 4MBQA 4QHOA 4TWDA 3K3QC 5LP6E 2CWOA 3GA8A 4X1IE 4IE5A 2WY2A 3PU3A 3AA6B 3AVRA 3QUJA 2WZIA 3PV0F 4UF0B 2CA5A 4PJMA 3RI5A 4YHHT 3KV6A 3L39A 4QH1A 1E7PA 4A98A 1QLBA 3AXJA 2IHR1 3N9QA 2I59A 2H3RA 3E08A 5LMNT 2CXFA 3AE7A 2OA5A 3B5MA 2XSBA 3ZLIA 2AXDS 4I50E 4ILUA 2XJ7A 4X1KE 4BJNA 3NWIA 3VHLA 4JV5T 3LFMA 4EZ4A 3PJAJ 1M62A 4GYRA 4N78D 5FL0A 2YU1A 4H9RC 4UXNB 4CXXA 5LA6E 4P1NA 1VRBA 4K0UA 5FY7A 4JI6T 3RRWA 2KWHA 4IL4A 2HN1A 3S4UA 1FJGT 5FL1A 3FXDB 3B13A 3AEAA 3TLSA 3C4ZA 1S35A 4DR1T 4B6XA 2NP9A 3ETVA 3LK3B 3ANWA 4J2CA 2ZM0A 3ONJA 3UULA 2HH7A 2NW8A 3ZCIA 5HWYA 3ZYMA 3GN5B 3Q9DA 1OEDE 4GKKT 1HX8A 1MIYA 2UXBT 5LJNA 3UU3A 2BVMA 3RC3A 3BQIA 3UUMA 1MNEA 3PUSA 1W0BA 4UVAB 5FY1A 2KINB 4DR3T 2BBHA 4ILAA 2WWUA 3U78A 4L5GA 5F3JA 3R84B 2W67A 2DWKA 2X0YA 1QUUA 3P4SA 2ZLYA 4KI0F 3EAMA 1QSDA 5F5WA 3ZJ1A 2LRLA 4DVDA 3KVAA 5ETWA 4A5XA 5JTGA 4NIQA 2DNXA 3UU6A 2XPKA 1J5ET 5HEOA 2B1EA 5FY0A 3VKGA 3LG7A 2IMLA 1HS7A 4E7SA 3I0OA 3AAEB 4QH5A 1SE7A 2N2NA 1X79A 1HG2A 1T98A 2PBIA 4C90A 1XNRT 2CM0A 4IDZA 1SUMB 4A97A 4PNIA 4U72A 2HPLA 5JDMA 3NRYA 4JUYA 2E5VA 4UVCB 1YQ4A 4X20E 4ZI7E 2DHRA 3O1HA 2WMNA 5HCMA 4JYAT 4AKIA 3AXJB 1MIVA 3UT5E 3UQ4A 2Q9QB 2XAGB 2EHOB 4WNKA 4YTPA 2WDRA 3U3IA 4AKHA 3PUZF 3RRCA 2CXDA 2L3LA 2LSJA 3AEGA 4P09A 2Q9QC 1US7B 4ZS2A 2EHOC 2VVSA 2VVNA 1L0VA 4Z90A 1NEKA 3FBZA 3K3NA 2V6YA 4QX8B 4O4JE 1ZOYA 2I6HA 1VCSA 3E22E 2B76A 3OYXA 1HTJF 2WWVA 5J0ZA 3OVUA 3IEEA 3CKDA 2X0LB 5L3DB 3LK2B 3OKQA 4QXCB 1N32T 3IF8B 2JMHA 4OFZA 4COFA 2PTFA 2FBWA 4WBNE 2IDOB 3ANWB 4AQYT 4ISTA 1OEDB 2UXXB 4FJOA 2D0TA 3VKHA 1N33T 3SRZA 2LSGA 5EK4A 4AKLA 4DV1T 2WAUA 3AA1B 5AQKB 4CZZB 1E1HB 2VKOA 4IHJE 1OEDC 4JI3T 3C4XA 4O2BE 2JMKA 5HYAA 1IZNB 3WAKA 1UX4A 3RLFF 3RC8A 4GKJT 4EGWA 3PUGA 5M4YA 3NVOA 2LSIA 3R6NA 4AIUA 5C3JA 4G63A 4EXTA 3RF1A 3HKCE 2XTLA 2BG9E 3FZKB 2WU2A 4AI6A 5LJMA 5FP3A 4CQIA 4DV7T 5LG3A 4LF8T 4DMVA 1D0ZA 2A2FX 1U5PA 5LHGB 3AAIA 1G73A 4ZI2C 4HKAA 3UUXB 3UUBA 2RA1A 2YK0A 5HEGA 2WBLA 1DU2A 4B3TT 3J7Yq 3ZT7A 3G06A 4TWFA 5FXXA 4F6RC 3JADA 2X9XA 3UU4A 1XMQT 2UUCT 4JLEA 2XAFB 3P4QA 4U3CA 3QK6A 5LHHB 4CXYA 4YJ3E 5AQNB 1KF6A 2X68A 3GWHA 5JDFA 3B57A 2DL1A 2M6BA 2UXCT 3HA4A 1HX1B 4QH4A 3RIAA 2VQFT 4CN6A 5A1LA 4EOZB 2KWIB 2ES0A 4HWFA 3HKEE 1XNQT 5AFUL 4LF5T 4MALA 5IWAT 3MACA 4LF7T 2PJQA 2MBGA 4P0AA 4DR2T 2WMOA 1FEWA 4YXDA 3ABVA 4DMWA 3JAEA 1N36T 2BKNA 4X62T 5LGUB 2V6YB 2FJAA 2RP4A 3EHZA 1T7SA 4QXHB 5ADXL 2VWAA 2X67A 2Y8DA 3AVSA 5LOVE 3IHRA 4YLHA 1BR2A 2A3DA 5AQHB 4DO0A 1UURA 2Q9QD 2EHOD 5JREA 4YT0A 4U31A 1SA0E 4KP3C 2CBIA 1KNPA 1IBMT 4P0BA 5BMVE 1UX5A 3KV5A 4EAHA 2KZ7B 4PJLA 1W9RA 3QNUA 2JJ9A 3PUAA 2UUAT 3C98B 3JAFA 4HWIB 5C2TA 3WAJA 3ZKRA 2V7JA 2BVLA 3P50A 2BG9B 5H6RB 2BKOA 5DQVA 1M7KA 4PFOA 2CHNA 5L2LA 2NTYA 4AISA 4XBFB 4U7IA 5AQUB 4B3ST 4KX6A 2BG9C 3AE4A 4UV9B 3N9NA 1WYBA 2GK9A 1IBKT 2V7LA 2XASB 2XQ9A 2K3WA 3ZN0B 2E9XD 2DCFA 2L8KA 5AQGB 3N9PA 3PUWF 3RQUA 3UU5A 4AXPA 2VL0A 2XM1A 3N9LA 4PFPA 1OWAA 1I94T 2WQYA 5FKYA 4YSXA 2E8IA 3N9OA 1W09A 3RPUA 3EDVA 3RKOA 4ZI2D 1ZV4X 4JI4T 2Q9QA 4LFCT 3TKLB 2OV9A 4IE7A 2EHOA 1JNZA 1MNDA 3F31A 3AEDA 5KX5E 3NRXA 3MK7C 4QXBB 3PUQA 5LHIB 4LF9T 2XZEA 4HFDA 5FVKA 3P4RA 2W0GA 2VL8A 4X66T 3VRBA 3AE5A 4TNWA 4NXNT 3LDQB 2LT3A 5LG4A 4JI7T 1JNRA 3VR9A 3ZT6A 2P9BA 4NXMT 5AQQB 2W62A 2NTXA 3L8RA 4ADZA 4AKRB 1D1BA 3ONXA 2BS2A 2H7VC 3ZC1A 1OEDA 2E9XA 4AKGA 4QWNB 4U2YA 3CQCB 5AQOB 2LSKA 4OHFA 4F8HA 3CPZA 4ZOLE 1I6ZA 3MA9A 2CPTA 2HN2A 2V6XA 2BDEA 4HFHA 2C5IT 1ZHCA 3E0ZA 2C0SA 3C51A 4DUZT 3O9XA 4GK0E 3A5XA 3BK9A 3AE3A 3AE1A 1D0XA 3O1IA 5FXZA 4TNVA 3AE2A 2VKJA 4ANJA 5DJQC 3SFEA 3PU8A 2XQ8A 1KK7A 1GQEA 2N1GA 4HTEA 3ONLC 1MMDA 4CN4A 2IAKA 3AE6A 3I9YA 3RIUC 4DV3T 3ZYKA 1HNWT 5GONE 5AQTB 3LSVA 3SWHA 2E2AA 2NW7A 3MKDA 2X9YA 2JQKA 3RH3A 4IDPA 3OBVE 4H9OC 3GMIA 4GIWA 2D2SA 4LMJA 5CJ5A 5J2UE 3N5LA 4I55E 1WCRA 3DJBA 3I0QA 1NAFA 2XQ6A 3NZPA 2MAWA 2C5JA 1UUSA 2D9DA 1FMVA 2KT9A 4PW8A 2WU5A 1E2AA 1YD8G 1J1JA 3C64A 1MMAA 3ZMZB 5L3EB 3FZLB 4TV8E 1OXZA 3F2EA 3ZT5A 2QRXA 4HFBA 5JQGE 5JDQA 1WYCA 5HWXA 4IGUA 3LJCA 4XZCA 1BR0A 4G2AA 5HXRA 4IDQA 3LK42 3T1HT 1WR0A 1G8XA 2DI4A 4B3MT 4WYVA 4EIWA 4YHJA 3DTOA 3PUXF 4L0RA 2HPJA 2W2UA 2AE9A 2H7OA 3CVRA 1WLXA 4UELA 4ZXLA 3H3AA 4PAGA 5AQMB 2JIWA 4B3RT 4MFRA 5HAXA 1J5WA 1VOMA 2CE7A 5LBMA 1WR6A 4MHCA 4AQFA 3OTOT 3ZSTA 2WP9A 3O1JA 2OLTA 1MMNA 2E9XB 4DV4T 3ZN1B 2X9WA 5HXCA 3J9X1 2JQ9A 5HXEA 3ESLA 1D0YA 5DABA 3KINB 1YXRA 1Z0PA 2E9XC 4XAXB 3UQ7A 1IJ6A 5KDMC 3CK6A 2BG9A 5JVDE 4OK0A 4OYJA 1MMGA 4I4TE 3W15B 4DR4T 3ZEFB 5C8YE 3CX6B 2CLYB 4HWHA 2K5BB 2ZM6T 3H3MA 2X51A 2IW5B 1LVFA 2ACZA 3QB5A 2CLYC 3QC9A 1EZ3A 4UV8B 2MPKA 2SPCA 2CCQA 2Y48B 5JDLA 1YQ3A 2FJDA 4L9IA 3ZPOA 1YKHB 2UXNB 2WCAA 3T1YT 3SS1A 1XZYA 3Q5XA 5IYZE 4HWDA 2KMFA 2M67A 4TN7B 2ACXA 1IAPA 3P4PA 4OYKA 4HEAA 4DR6T 2BZBA 2V1DB 5AQVB 3AA7B 3RX6A 5AQRB 3BQLA 3T8OA 5L3CB 3PTRB 3AAAB 4HE8A 3RYHE 2NOXA 2VURA 1LRZA 3Q2MA 4EV6A 4NUVA 3VU7H 3FB2A 2LOSA 3PUYF 1XDOA 3SFDA 2KLQA 4CN1A 2H88A 5JRCA 2NWBA 3K8PC 4KBMB 4EZHA 3RIFA 2W00A 1MIWA 2ZM2A 1R8IA 5EZYE 3DP7A 2IC9A 2J4GA 3NZQA 2M6IA 4JI2T 4O2AE 4LFBT 3D0TA 4CI1B 4X65T 2V7MA 2LE8A 1O3XA 1NENA 5LMUT 5TAOA 4DUYT 5LNKA 3EDUA 2CWYA 1KNRA 3PUVF 2KSRA 3N2KE 1KEYA 5CGMA 5AQPB 2LHNA 2XAQB 5JDGA 3EUHA 4H63H 4ZZBA 4YTMA 5KMGP 4YTNA 2WB5A 5L3BB 4AQFC 3IBPA 2XHEB 5FXWA 1HR0T 3RIUA 3I9WA 2H89A 4BAYB 1LKXA 5HEHA 3FZHB 3UTKA 4YJ2E 2YDSA 2W66A 1V9DA 4GOUA 4NUUA 2D0UA 2D5UA 1ZP0A 4ILBA 2K48A 4I0UA 4U7YA 3ZMVB 4JEUB 2UXDT 5LBQB 2Y6XA 3FHNA 2CXLA 2L9QA 3ZCJA 4BA9A 3TLTA 2YDQA 4CI3B 1X9BA 2WSSV 3MZKB 5LXTE 4O4HE 2CBJA 4H9QC 3KBUA 3NKZA 4X5TA 3N2OA 2QA7A 5CA1E 3PJAA 2PFVA 5JH7E 3L3PA 1UGOA 3P4WA 3PURA 2NR4A 2LSYA 2I0MA 2WDVA 4WZXA 4IT4A 2X9HA 4PJJA 4O4LE 3PE0A 5LGNB 2J62A 3RKGA 3ZSSA 4K0KT 2FJEA 1YW0A 4LMLA 4DV2T 2XAHB 2A9UA 4UIGA 1KFYA 4U2ZA 4ISSA 1Z8UA 4ERRA 2YOEA 1B7TA 2ODVA 2V7KA 2VB6A 4ZS3A 5H6QB 4DV6T 3MXZA 3KV4A 2XQ7A 5DQWA 2W63A 3KDSE 2VK9A 2LOPA 3A8YC 2LEHA 5AQSB 5JRCB 3VRAA 4DR7T 5AQJB 2VKHA 5L4EA 2XQAA 1WFDA 4BJMA 3EVYA 2W4XA 5J2TE 3SOLA 4H9SE 5KXJA 3P7IA 4U74A 4X64T 4JEHB 3CQGB 4I43B 4EEBA 3OJAA 2JQQA 3CMLA 5CFBA 3HKBE 4H9NC 1ZKEA 3KVBA 3QOFA 3C50A 2MYSA 3M65A 1D1AA 3RGLA 2X66A 4ZHQE 4Q25A 3FBLA 5IUXA 2WS3A 3O4XE 4UR9A 2XUEA 1HNXT 3K3OA 4PK4A 3AEEA 4IDOA 4TX5A 3JC6C 2XQYA 1Y64B 4HFIA 2LJLA 3K1SA 2LM9A 2E5LT 4CI2B 4M1PA 5LCYA 3TLVA 3V5SA 2ZMAA 3H37A 2BKPA 2XQ5A 3UFGA 2UU9T 1HG5A 3RYIE 5J1GA 5HEJA 2WM9A 4DV0T 2UUBT 3ZMSB 3WI3A 2PG8A 1XMOT 3ZJ2A 4ILCA 3IA3A 1HCIA 4PK6A 2XAJB 4DV5T 2YN6A 4O4IE 1UK5A 3KBTA 4EYYR 4AQGA 4JBWF 5JR9A 1BR1A 3KV9A 4Z8XA 5ABHA 1U4QA 3X1DA 1D1CA 2J47A 4IE6A 2HHHT 3TLWA 4KHPT 2LHRA 4KUMB 4GK5E 3ZYLA 4V1Av 4HFEA 2Z6EA 3CX8B 4ZI3C 5FVLA 3RYCE 5AQFB 5ABGA 2IUBA 1IJ5A 2LKHA 4DIDB 4EYUA 3ZMTB 2QYWA 2YINA 4LFAT 3FZFB 3N9MA 2X0HA 2MTQA 4DBQA 4DNDA 4NPPA 2QGSA 3ZC0A 2BBJA 2ODUA 2XY8B 3Q5DA 3ETUA 3HKDE 5FNVE 2KNDA 5EK2A 5JDHA 5LB7B 3CX7B 2VASA 1UCUA 1SHZC 3VR8A 1N34T 4H9PC 2JPFA 2CEAA 1KNZA 4IREA 2FJBA 2DLRA 3NBXX 4LF4T 3RQWA 5BR8T 5L3GB 3FZMB 4U33A 3UFEA 1HNZT 3QB5K 3ZMUB 4OX9T 4WBOA 3L09A 2VQET 2XQ4A 4Z91A 4YSZA 4LF6T 2A72A 2LKGA 4IE0A 2KXPB 3LBXA 2FUPA 5IHYA 2VKDA 5FMNA 5ABFA 4CXWA 2MOZA 1FIOA 2LM2A 2IC6A 3Q5EA 2XQ3A 2V5CA 3EI0A 4PJNA 2QVAA 1BR4A 4WW0A 4LMKA 4A56A 3AE9A 4JI0T 2CHOA 1NWMX 3KFWX 4YY3T 2V26A 4EEDA 1ZEEA 1CHUA 1Y01A 4YFSA 4FI5A 3RYFE 4QX7B 3TLUA 3CQXC 1VCTA 2JQHA 4ZZCA 3JC6D 2K9AA 3JCFA 4TZ4C 4PK5A 4UF0A 5HEUA 4KMCA 2V7IA 5JR9B 3AEFA 4HFVA 1FMWA 4TV9E 4YSYA 4QKNA 2K24A 3V5UA 3RHWA 5JR9C 3HI2A 4MLKA 3C4WA 5AQIB 2G0UA 3Q5WA 3PDYA 3UU8A 3CWZB 5JDNA 4HGAA 2C5KT 2CMRA 5HXSA 5EK3A 3OPCA 3I1AA 2IIUA 4IDNA 2WDQA 2J1DG 3FXEB 4TWHA 5CA0E 3CIRA 2V8SV 4HN9A 4IL9A 3P8CD 1CUNA 2JRKA 3HL6A 1W0AA 1LVKA 5LGTB 5E0OA 2W61A 4JI1T 3AECA 3BQKA 5AQLB 4ZEYA 1XWMA 2N9DA 4O8SA 3HR0A 1WRDA 4JI8T 4H63V 2NW9A 2LRKA 1XDPA 4ZI3D 2WZHA
chains in the Genus database with same CATH topology
4G63A 4ERRA 5J2UE 4EXTA 1AJ3A 3HKCE 1B7TA 2XTLA 4AI6A 5LJMA 2ODVA 3N5LA 4GYSA 4I55E 2V7KA 2VB6A 3DJBA 1HF8A 3GN5A 3I0QA 4ZS3A 5H6QB 4CQIA 4DBRA 1NAFA 3MXZA 3NZPA 5CB4E 3KV4A 5FXVA 5DQWA 2C5JA 2W63A 3AB3B 1HFAA 3KDSE 2VK9A 4DMVA 1D0ZA 2LOPA 2YEVC 2A2FX 3AA0B 2LEHA 5JRCB 5HXHA 1FMVA 1U5PA 2KT9A 5LHGB 2VKHA 4PW8A 3AAIA 1G73A 4ZI2C 1YD8G 3OYZA 3C64A 1MMAA 4HKAA 3ZMZB 4E7ZA 3UUXB 1YKEB 4EB6E 4BJMA 3EVYA 5J2TE 5L3EB 2DWGA 3F57A 4DVDA 2RA1A 2YK0A 4TV8E 1OXZA 3SOLA 3F2EA 4H9SE 2WBLA 3P7IA 3J7Yq 4U74A 5JQGE 5JDQA 3LBXB 5FXXA 4UEMA 1S94A 1WYCA 5HWXA 5LYJE 4JEHB 4C91A 4IGUA 3LJCA 3CQGB 4IE4A 4XZCA 4I43B 4F6RC 1BR0A 3OJAA 4G2AA 2JQQA 5HXRA 3CMLA 1H7CA 3HKBE 2X9XA 3LK42 4X1YE 4H9NC 1ZKEA 1G8XA 4UVBB 2DI4A 2ZM8A 4ASKA 4JLEA 2XAFB 3KVBA 3UUNA 3C50A 4EIWA 2YU2A 4YHJA 3MJXA 2MYSA 5FYMA 3DTOA 4IIJE 4L0RA 2HPJA 4TUYE 3M65A 1D1AA 3QK6A 5F8PA 2X66A 5LHHB 4ZHQE 2H7OA 4CXYA 3FBLA 4YJ3E 3CVRA 1WLXA 3O4XE 3N2GE 2XUEA 4UELA 5L3FB 2X68A 4MBQA 3GWHA 3H3AA 4QHOA 5JDFA 3B57A 3K3QC 4PAGA 3K3OA 4PK4A 4MFRA 3HA4A 4TX5A 5HAXA 1VOMA 5LP6E 3JC6C 2XQYA 2CWOA 1Y64B 3GA8A 4X1IE 2LJLA 4IE5A 5A1LA 2CE7A 4EOZB 2KWIB 2ES0A 5LBMA 3PU3A 2LM9A 1WR6A 3HKEE 3AA6B 4MHCA 4AQFA 4CI2B 3AVRA 4M1PA 5LCYA 3O1JA 3QUJA 3V5SA 1MMNA 5FP3A 2E9XB 5AFUL 3ZN1B 2X9WA 4MALA 2ZMAA 3H37A 5HXCA 4UF0B 3J9X1 3MACA 2PJQA 2CA5A 2MBGA 4PJMA 3ESLA 5HXEA 4P0AA 1HG5A 3KV6A 3RYIE 1D0YA 5DABA 5J1GA 3KINB 2WMOA 1FEWA 2WM9A 1Z0PA 2E9XC 4XAXB 3ZMSB 4DMWA 1IJ6A 2PG8A 3WI3A 5KDMC 3N9QA 2I59A 2H3RA 3ZMUB 3E08A 3ZJ2A 2CXFA 5JVDE 5LGUB 4OK0A 4OYJA 1MMGA 4I4TE 2RP4A 2OA5A 3W15B 1HCIA 3ZEFB 5C8YE 4PK6A 2XAJB 4QXHB 3CX6B 3ZLIA 4O4IE 5ADXL 4I50E 2VWAA 2CLYB 2X67A 3KBTA 4ILUA 2Y8DA 3AVSA 2K5BB 5LOVE 3IHRA 4YLHA 4X1KE 4BJNA 4EYYR 4AQGA 1BR2A 2A3DA 2X51A 5JR9A 1BR1A 2IW5B 4DO0A 1LVFA 2Q9QD 2EHOD 3VHLA 3KV9A 4Z8XA 5JREA 1U4QA 3LFMA 4EZ4A 2CLYC 3QC9A 1EZ3A 4UV8B 1SA0E 4KP3C 4GYRA 4N78D 2SPCA 2YU1A 4H9RC 4UXNB 4CXXA 1D1CA 4P0BA 5LA6E 5BMVE 2CCQA 1VRBA 4IE6A 2Y48B 1UX5A 4K0UA 5FY7A 3KV5A 3RRWA 4EAHA 5JDLA 4L9IA 2KWHA 2KZ7B 4PJLA 3ZPOA 1YKHB 3S4UA 2LHRA 2JJ9A 3PUAA 2UXNB 3C98B 3FXDB 3SS1A 3B13A 3WAJA 3C4ZA 4KUMB 1S35A 2V7JA 4GK5E 3ZYLA 4B6XA 4V1Av 2BVLA 2NP9A 3Q5XA 3ETVA 5IYZE 5H6RB 3LK3B 3ANWA 2Z6EA 3CX8B 5DQVA 4ZI3C 4J2CA 2KMFA 2ZM0A 3RYCE 3UULA 2M67A 4PFOA 4TN7B 5L2LA 2NTYA 1IJ5A 2HH7A 2NW8A 4XBFB 3ZCIA 4EYUA 3ZMTB 5HWYA 3ZYMA 2YINA 3GN5B 3Q9DA 4UV9B 3N9MA 2ACXA 1IAPA 1HX8A 1MIYA 4OYKA 3N9NA 2MTQA 4DBQA 1WYBA 2GK9A 4HEAA 5LJNA 4DNDA 2V7LA 2QGSA 2XASB 2BZBA 3ZC0A 3ZN0B 2E9XD 2ODUA 2V1DB 2BVMA 2DCFA 3AA7B 2L8KA 3RX6A 3ETUA 3HKDE 3N9PA 3BQLA 3RC3A 3BQIA 3T8OA 5L3CB 4AXPA 5FNVE 3PTRB 3AAAB 4HE8A 3UUMA 1MNEA 2KNDA 5EK2A 3N9LA 4PFPA 5JDHA 3PUSA 1OWAA 4UVAB 3RYHE 2NOXA 3CX7B 2VASA 5FY1A 1LRZA 1UCUA 3Q2MA 1SHZC 2KINB 4NUVA 3VU7H 4H9PC 2JPFA 2WWUA 2CEAA 2LOSA 3FB2A 1KNZA 2KLQA 3U78A 2E8IA 4L5GA 5F3JA 3R84B 3N9OA 2DWKA 2DLRA 5JRCA 3NBXX 3RPUA 1QUUA 3EDVA 2NWBA 2ZLYA 3K8PC 1QSDA 3RKOA 4KBMB 5L3GB 4EZHA 3UFEA 1ZV4X 4ZI2D 2Q9QA 3ZJ1A 3KVAA 2W00A 1MIWA 2ZM2A 4WBOA 4IE7A 2EHOA 3L09A 5ETWA 3TKLB 5EZYE 3DP7A 1MNDA 2IC9A 3NZQA 2DNXA 3F31A 4O2AE 3D0TA 2A72A 4CI1B 4IE0A 2KXPB 3LBXA 5KX5E 2B1EA 2V7MA 3NRXA 2LE8A 5FY0A 3VKGA 3MK7C 5IHYA 2VKDA 3LG7A 4QXBB 1O3XA 5FMNA 1HS7A 3PUQA 5LHIB 5TAOA 4E7SA 4CXWA 2MOZA 3I0OA 1FIOA 5LNKA 2IC6A 3AAEB 3EDUA 2N2NA 2W0GA 2VL8A 2CWYA 1X79A 4PJNA 1HG2A 1BR4A 4WW0A 4A56A 1T98A 2PBIA 4C90A 1NWMX 3N2KE 3KFWX 2CM0A 2LHNA 2V26A 2XAQB 4IDZA 5JDGA 2LT3A 5LG4A 1ZEEA 3EUHA 4H63H 4PNIA 4U72A 2HPLA 4YFSA 4FI5A 5JDMA 5KMGP 3RYFE 3NRYA 5L3BB 4JUYA 4QX7B 4AQFC 3IBPA 2P9BA 2XHEB 4UVCB 4X20E 5FXWA 4ZI7E 2DHRA 3O1HA 2WMNA 2W62A 3CQXC 3I9WA 2NTXA 4ADZA 4AKIA 3JC6D 4BAYB 1LKXA 4AKRB 1MIVA 3UT5E 2K9AA 2Q9QB 2XAGB 1D1BA 2EHOB 3ONXA 4WNKA 3UTKA 4YJ2E 2H7VC 3ZC1A 3U3IA 4AKHA 2E9XA 4AKGA 4QWNB 4TZ4C 4PK5A 3RRCA 2CXDA 2L3LA 1V9DA 4UF0A 4GOUA 2LSJA 4P09A 2Q9QC 1US7B 4KMCA 3CQCB 2V7IA 4ZS2A 2EHOC 5JR9B 4NUUA 2D0UA 2LSKA 2D5UA 4OHFA 3CPZA 4HFVA 4ZOLE 2K48A 3MA9A 1FMWA 3ZMVB 4TV9E 4JEUB 4QKNA 2K24A 2BDEA 3FBZA 2C5IT 1ZHCA 3K3NA 3E0ZA 2C0SA 4QX8B 3V5UA 3C51A 4O4JE 5LBQB 5JR9C 3HI2A 3O9XA 2Y6XA 4GK0E 3FHNA 4MLKA 3C4WA 3A5XA 3BK9A 2CXLA 3E22E 2L9QA 3ZCJA 2G0UA 1D0XA 3O1IA 3OYXA 3Q5WA 5FXZA 1HTJF 3PDYA 4BA9A 3CWZB 2VKJA 4ANJA 4CI3B 4HGAA 5JDNA 2C5KT 5DJQC 2CMRA 2WSSV 3MZKB 5LXTE 5HXSA 4O4HE 3IEEA 3CKDA 3PU8A 2X0LB 5EK3A 5L3DB 4H9QC 3LK2B 3OKQA 4QXCB 3IF8B 3KBUA 2JMHA 3I1AA 1KK7A 2N1GA 3N2OA 4OFZA 2J1DG 3FXEB 2QA7A 5CA0E 4HTEA 4HN9A 1MMDA 4WBNE 3ANWB 2IAKA 4ISTA 3I9YA 3P8CD 1CUNA 2PFVA 5CA1E 5JH7E 3L3PA 2JRKA 2UXXB 3ZYKA 3HL6A 4FJOA 2D0TA 3PURA 3VKHA 1LVKA 3SRZA 5GONE 3SWHA 2LSGA 2LSYA 5LGTB 5EK4A 5E0OA 2W61A 4AKLA 2X9HA 4PJJA 4O4LE 2WAUA 3AA1B 2NW7A 3MKDA 3PE0A 5LGNB 4CZZB 1E1HB 2VKOA 2X9YA 4IHJE 3C4XA 4O2BE 2JMKA 5HYAA 3RH3A 1IZNB 1YW0A 3BQKA 3WAKA 1UX4A 3OBVE 3RC8A 2XAHB 4H9OC 3GMIA 2N9DA 4GIWA 3PUGA 5M4YA 4O8SA 3HR0A 1WRDA 2D2SA 4UIGA 2LSIA 4H63V 2NW9A 3R6NA 4ISSA 4ZI3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5X A;  3Q5W A; 
#chains in the Genus database with same CATH topology
 1AJ3 A;  1T8B A;  4GYS A;  2V5D A;  1HF8 A;  3GN5 A;  4DBR A;  4HFC A;  5CB4 E;  2XSA A;  4KHZ F;  5FXV A;  3AB3 B;  1HFA A;  5L47 A;  2YEV C;  3AA0 B;  5ABE A;  3AE8 A;  2CRB A;  5HXH A;  4JI5 T;  3OYZ A;  4E7Z A;  1YKE B;  2RPA A;  4EB6 E;  2BS3 A;  2DWG A;  3F57 A;  2YDR A;  3A7M A;  3M3Z B;  2R6G F;  3LBX B;  5L4H A;  4UEM A;  1S94 A;  5LYJ E;  4C91 A;  2YKS A;  4IE4 A;  5ABF B;  1H7C A;  5HCJ A;  4DR5 T;  4X1Y E;  1T72 A;  4UVB B;  2ZM8 A;  4ASK A;  2XM2 A;  3EAB A;  3UUN A;  1IBL T;  2YU2 A;  2LLY A;  3MJX A;  5FYM A;  4HWC A;  4IIJ E;  4TUY E;  2F4V T;  5F8P A;  3AEB A;  2BS4 A;  3N2G E;  5L3F B;  4MBQ A;  4QHO A;  4TWD A;  3K3Q C;  5LP6 E;  2CWO A;  3GA8 A;  4X1I E;  4IE5 A;  2WY2 A;  3PU3 A;  3AA6 B;  3AVR A;  3QUJ A;  2WZI A;  3PV0 F;  4UF0 B;  2CA5 A;  4PJM A;  3RI5 A;  4YHH T;  3KV6 A;  3L39 A;  4QH1 A;  1E7P A;  4A98 A;  1QLB A;  3AXJ A;  2IHR 1;  3N9Q A;  2I59 A;  2H3R A;  3E08 A;  5LMN T;  2CXF A;  3AE7 A;  2OA5 A;  3B5M A;  2XSB A;  3ZLI A;  2AXD S;  4I50 E;  4ILU A;  2XJ7 A;  4X1K E;  4BJN A;  3NWI A;  3VHL A;  4JV5 T;  3LFM A;  4EZ4 A;  3PJA J;  1M62 A;  4GYR A;  4N78 D;  5FL0 A;  2YU1 A;  4H9R C;  4UXN B;  4CXX A;  5LA6 E;  4P1N A;  1VRB A;  4K0U A;  5FY7 A;  4JI6 T;  3RRW A;  2KWH A;  4IL4 A;  2HN1 A;  3S4U A;  1FJG T;  5FL1 A;  3FXD B;  3B13 A;  3AEA A;  3TLS A;  3C4Z A;  1S35 A;  4DR1 T;  4B6X A;  2NP9 A;  3ETV A;  3LK3 B;  3ANW A;  4J2C A;  2ZM0 A;  3ONJ A;  3UUL A;  2HH7 A;  2NW8 A;  3ZCI A;  5HWY A;  3ZYM A;  3GN5 B;  3Q9D A;  1OED E;  4GKK T;  1HX8 A;  1MIY A;  2UXB T;  5LJN A;  3UU3 A;  2BVM A;  3RC3 A;  3BQI A;  3UUM A;  1MNE A;  3PUS A;  1W0B A;  4UVA B;  5FY1 A;  2KIN B;  4DR3 T;  2BBH A;  4ILA A;  2WWU A;  3U78 A;  4L5G A;  5F3J A;  3R84 B;  2W67 A;  2DWK A;  2X0Y A;  1QUU A;  3P4S A;  2ZLY A;  4KI0 F;  3EAM A;  1QSD A;  5F5W A;  3ZJ1 A;  2LRL A;  4DVD A;  3KVA A;  5ETW A;  4A5X A;  5JTG A;  4NIQ A;  2DNX A;  3UU6 A;  2XPK A;  1J5E T;  5HEO A;  2B1E A;  5FY0 A;  3VKG A;  3LG7 A;  2IML A;  1HS7 A;  4E7S A;  3I0O A;  3AAE B;  4QH5 A;  1SE7 A;  2N2N A;  1X79 A;  1HG2 A;  1T98 A;  2PBI A;  4C90 A;  1XNR T;  2CM0 A;  4IDZ A;  1SUM B;  4A97 A;  4PNI A;  4U72 A;  2HPL A;  5JDM A;  3NRY A;  4JUY A;  2E5V A;  4UVC B;  1YQ4 A;  4X20 E;  4ZI7 E;  2DHR A;  3O1H A;  2WMN A;  5HCM A;  4JYA T;  4AKI A;  3AXJ B;  1MIV A;  3UT5 E;  3UQ4 A;  2Q9Q B;  2XAG B;  2EHO B;  4WNK A;  4YTP A;  2WDR A;  3U3I A;  4AKH A;  3PUZ F;  3RRC A;  2CXD A;  2L3L A;  2LSJ A;  3AEG A;  4P09 A;  2Q9Q C;  1US7 B;  4ZS2 A;  2EHO C;  2VVS A;  2VVN A;  1L0V A;  4Z90 A;  1NEK A;  3FBZ A;  3K3N A;  2V6Y A;  4QX8 B;  4O4J E;  1ZOY A;  2I6H A;  1VCS A;  3E22 E;  2B76 A;  3OYX A;  1HTJ F;  2WWV A;  5J0Z A;  3OVU A;  3IEE A;  3CKD A;  2X0L B;  5L3D B;  3LK2 B;  3OKQ A;  4QXC B;  1N32 T;  3IF8 B;  2JMH A;  4OFZ A;  4COF A;  2PTF A;  2FBW A;  4WBN E;  2IDO B;  3ANW B;  4AQY T;  4IST A;  1OED B;  2UXX B;  4FJO A;  2D0T A;  3VKH A;  1N33 T;  3SRZ A;  2LSG A;  5EK4 A;  4AKL A;  4DV1 T;  2WAU A;  3AA1 B;  5AQK B;  4CZZ B;  1E1H B;  2VKO A;  4IHJ E;  1OED C;  4JI3 T;  3C4X A;  4O2B E;  2JMK A;  5HYA A;  1IZN B;  3WAK A;  1UX4 A;  3RLF F;  3RC8 A;  4GKJ T;  4EGW A;  3PUG A;  5M4Y A;  3NVO A;  2LSI A;  3R6N A;  4AIU A;  5C3J A;  4G63 A;  4EXT A;  3RF1 A;  3HKC E;  2XTL A;  2BG9 E;  3FZK B;  2WU2 A;  4AI6 A;  5LJM A;  5FP3 A;  4CQI A;  4DV7 T;  5LG3 A;  4LF8 T;  4DMV A;  1D0Z A;  2A2F X;  1U5P A;  5LHG B;  3AAI A;  1G73 A;  4ZI2 C;  4HKA A;  3UUX B;  3UUB A;  2RA1 A;  2YK0 A;  5HEG A;  2WBL A;  1DU2 A;  4B3T T;  3J7Y q;  3ZT7 A;  3G06 A;  4TWF A;  5FXX A;  4F6R C;  3JAD A;  2X9X A;  3UU4 A;  1XMQ T;  2UUC T;  4JLE A;  2XAF B;  3P4Q A;  4U3C A;  3QK6 A;  5LHH B;  4CXY A;  4YJ3 E;  5AQN B;  1KF6 A;  2X68 A;  3GWH A;  5JDF A;  3B57 A;  2DL1 A;  2M6B A;  2UXC T;  3HA4 A;  1HX1 B;  4QH4 A;  3RIA A;  2VQF T;  4CN6 A;  5A1L A;  4EOZ B;  2KWI B;  2ES0 A;  4HWF A;  3HKE E;  1XNQ T;  5AFU L;  4LF5 T;  4MAL A;  5IWA T;  3MAC A;  4LF7 T;  2PJQ A;  2MBG A;  4P0A A;  4DR2 T;  2WMO A;  1FEW A;  4YXD A;  3ABV A;  4DMW A;  3JAE A;  1N36 T;  2BKN A;  4X62 T;  5LGU B;  2V6Y B;  2FJA A;  2RP4 A;  3EHZ A;  1T7S A;  4QXH B;  5ADX L;  2VWA A;  2X67 A;  2Y8D A;  3AVS A;  5LOV E;  3IHR A;  4YLH A;  1BR2 A;  2A3D A;  5AQH B;  4DO0 A;  1UUR A;  2Q9Q D;  2EHO D;  5JRE A;  4YT0 A;  4U31 A;  1SA0 E;  4KP3 C;  2CBI A;  1KNP A;  1IBM T;  4P0B A;  5BMV E;  1UX5 A;  3KV5 A;  4EAH A;  2KZ7 B;  4PJL A;  1W9R A;  3QNU A;  2JJ9 A;  3PUA A;  2UUA T;  3C98 B;  3JAF A;  4HWI B;  5C2T A;  3WAJ A;  3ZKR A;  2V7J A;  2BVL A;  3P50 A;  2BG9 B;  5H6R B;  2BKO A;  5DQV A;  1M7K A;  4PFO A;  2CHN A;  5L2L A;  2NTY A;  4AIS A;  4XBF B;  4U7I A;  5AQU B;  4B3S T;  4KX6 A;  2BG9 C;  3AE4 A;  4UV9 B;  3N9N A;  1WYB A;  2GK9 A;  1IBK T;  2V7L A;  2XAS B;  2XQ9 A;  2K3W A;  3ZN0 B;  2E9X D;  2DCF A;  2L8K A;  5AQG B;  3N9P A;  3PUW F;  3RQU A;  3UU5 A;  4AXP A;  2VL0 A;  2XM1 A;  3N9L A;  4PFP A;  1OWA A;  1I94 T;  2WQY A;  5FKY A;  4YSX A;  2E8I A;  3N9O A;  1W09 A;  3RPU A;  3EDV A;  3RKO A;  4ZI2 D;  1ZV4 X;  4JI4 T;  2Q9Q A;  4LFC T;  3TKL B;  2OV9 A;  4IE7 A;  2EHO A;  1JNZ A;  1MND A;  3F31 A;  3AED A;  5KX5 E;  3NRX A;  3MK7 C;  4QXB B;  3PUQ A;  5LHI B;  4LF9 T;  2XZE A;  4HFD A;  5FVK A;  3P4R A;  2W0G A;  2VL8 A;  4X66 T;  3VRB A;  3AE5 A;  4TNW A;  4NXN T;  3LDQ B;  2LT3 A;  5LG4 A;  4JI7 T;  1JNR A;  3VR9 A;  3ZT6 A;  2P9B A;  4NXM T;  5AQQ B;  2W62 A;  2NTX A;  3L8R A;  4ADZ A;  4AKR B;  1D1B A;  3ONX A;  2BS2 A;  2H7V C;  3ZC1 A;  1OED A;  2E9X A;  4AKG A;  4QWN B;  4U2Y A;  3CQC B;  5AQO B;  2LSK A;  4OHF A;  4F8H A;  3CPZ A;  4ZOL E;  1I6Z A;  3MA9 A;  2CPT A;  2HN2 A;  2V6X A;  2BDE A;  4HFH A;  2C5I T;  1ZHC A;  3E0Z A;  2C0S A;  3C51 A;  4DUZ T;  3O9X A;  4GK0 E;  3A5X A;  3BK9 A;  3AE3 A;  3AE1 A;  1D0X A;  3O1I A;  5FXZ A;  4TNV A;  3AE2 A;  2VKJ A;  4ANJ A;  5DJQ C;  3SFE A;  3PU8 A;  2XQ8 A;  1KK7 A;  1GQE A;  2N1G A;  4HTE A;  3ONL C;  1MMD A;  4CN4 A;  2IAK A;  3AE6 A;  3I9Y A;  3RIU C;  4DV3 T;  3ZYK A;  1HNW T;  5GON E;  5AQT B;  3LSV A;  3SWH A;  2E2A A;  2NW7 A;  3MKD A;  2X9Y A;  2JQK A;  3RH3 A;  4IDP A;  3OBV E;  4H9O C;  3GMI A;  4GIW A;  2D2S A;  4LMJ A;  5CJ5 A;  5J2U E;  3N5L A;  4I55 E;  1WCR A;  3DJB A;  3I0Q A;  1NAF A;  2XQ6 A;  3NZP A;  2MAW A;  2C5J A;  1UUS A;  2D9D A;  1FMV A;  2KT9 A;  4PW8 A;  2WU5 A;  1E2A A;  1YD8 G;  1J1J A;  3C64 A;  1MMA A;  3ZMZ B;  5L3E B;  3FZL B;  4TV8 E;  1OXZ A;  3F2E A;  3ZT5 A;  2QRX A;  4HFB A;  5JQG E;  5JDQ A;  1WYC A;  5HWX A;  4IGU A;  3LJC A;  4XZC A;  1BR0 A;  4G2A A;  5HXR A;  4IDQ A;  3LK4 2;  3T1H T;  1WR0 A;  1G8X A;  2DI4 A;  4B3M T;  4WYV A;  4EIW A;  4YHJ A;  3DTO A;  3PUX F;  4L0R A;  2HPJ A;  2W2U A;  2AE9 A;  2H7O A;  3CVR A;  1WLX A;  4UEL A;  4ZXL A;  3H3A A;  4PAG A;  5AQM B;  2JIW A;  4B3R T;  4MFR A;  5HAX A;  1J5W A;  1VOM A;  2CE7 A;  5LBM A;  1WR6 A;  4MHC A;  4AQF A;  3OTO T;  3ZST A;  2WP9 A;  3O1J A;  2OLT A;  1MMN A;  2E9X B;  4DV4 T;  3ZN1 B;  2X9W A;  5HXC A;  3J9X 1;  2JQ9 A;  5HXE A;  3ESL A;  1D0Y A;  5DAB A;  3KIN B;  1YXR A;  1Z0P A;  2E9X C;  4XAX B;  3UQ7 A;  1IJ6 A;  5KDM C;  3CK6 A;  2BG9 A;  5JVD E;  4OK0 A;  4OYJ A;  1MMG A;  4I4T E;  3W15 B;  4DR4 T;  3ZEF B;  5C8Y E;  3CX6 B;  2CLY B;  4HWH A;  2K5B B;  2ZM6 T;  3H3M A;  2X51 A;  2IW5 B;  1LVF A;  2ACZ A;  3QB5 A;  2CLY C;  3QC9 A;  1EZ3 A;  4UV8 B;  2MPK A;  2SPC A;  2CCQ A;  2Y48 B;  5JDL A;  1YQ3 A;  2FJD A;  4L9I A;  3ZPO A;  1YKH B;  2UXN B;  2WCA A;  3T1Y T;  3SS1 A;  1XZY A;  3Q5X A;  5IYZ E;  4HWD A;  2KMF A;  2M67 A;  4TN7 B;  2ACX A;  1IAP A;  3P4P A;  4OYK A;  4HEA A;  4DR6 T;  2BZB A;  2V1D B;  5AQV B;  3AA7 B;  3RX6 A;  5AQR B;  3BQL A;  3T8O A;  5L3C B;  3PTR B;  3AAA B;  4HE8 A;  3RYH E;  2NOX A;  2VUR A;  1LRZ A;  3Q2M A;  4EV6 A;  4NUV A;  3VU7 H;  3FB2 A;  2LOS A;  3PUY F;  1XDO A;  3SFD A;  2KLQ A;  4CN1 A;  2H88 A;  5JRC A;  2NWB A;  3K8P C;  4KBM B;  4EZH A;  3RIF A;  2W00 A;  1MIW A;  2ZM2 A;  1R8I A;  5EZY E;  3DP7 A;  2IC9 A;  2J4G A;  3NZQ A;  2M6I A;  4JI2 T;  4O2A E;  4LFB T;  3D0T A;  4CI1 B;  4X65 T;  2V7M A;  2LE8 A;  1O3X A;  1NEN A;  5LMU T;  5TAO A;  4DUY T;  5LNK A;  3EDU A;  2CWY A;  1KNR A;  3PUV F;  2KSR A;  3N2K E;  1KEY A;  5CGM A;  5AQP B;  2LHN A;  2XAQ B;  5JDG A;  3EUH A;  4H63 H;  4ZZB A;  4YTM A;  5KMG P;  4YTN A;  2WB5 A;  5L3B B;  4AQF C;  3IBP A;  2XHE B;  5FXW A;  1HR0 T;  3RIU A;  3I9W A;  2H89 A;  4BAY B;  1LKX A;  5HEH A;  3FZH B;  3UTK A;  4YJ2 E;  2YDS A;  2W66 A;  1V9D A;  4GOU A;  4NUU A;  2D0U A;  2D5U A;  1ZP0 A;  4ILB A;  2K48 A;  4I0U A;  4U7Y A;  3ZMV B;  4JEU B;  2UXD T;  5LBQ B;  2Y6X A;  3FHN A;  2CXL A;  2L9Q A;  3ZCJ A;  4BA9 A;  3TLT A;  2YDQ A;  4CI3 B;  1X9B A;  2WSS V;  3MZK B;  5LXT E;  4O4H E;  2CBJ A;  4H9Q C;  3KBU A;  3NKZ A;  4X5T A;  3N2O A;  2QA7 A;  5CA1 E;  3PJA A;  2PFV A;  5JH7 E;  3L3P A;  1UGO A;  3P4W A;  3PUR A;  2NR4 A;  2LSY A;  2I0M A;  2WDV A;  4WZX A;  4IT4 A;  2X9H A;  4PJJ A;  4O4L E;  3PE0 A;  5LGN B;  2J62 A;  3RKG A;  3ZSS A;  4K0K T;  2FJE A;  1YW0 A;  4LML A;  4DV2 T;  2XAH B;  2A9U A;  4UIG A;  1KFY A;  4U2Z A;  4ISS A;  1Z8U A;  4ERR A;  2YOE A;  1B7T A;  2ODV A;  2V7K A;  2VB6 A;  4ZS3 A;  5H6Q B;  4DV6 T;  3MXZ A;  3KV4 A;  2XQ7 A;  5DQW A;  2W63 A;  3KDS E;  2VK9 A;  2LOP A;  3A8Y C;  2LEH A;  5AQS B;  5JRC B;  3VRA A;  4DR7 T;  5AQJ B;  2VKH A;  5L4E A;  2XQA A;  1WFD A;  4BJM A;  3EVY A;  2W4X A;  5J2T E;  3SOL A;  4H9S E;  5KXJ A;  3P7I A;  4U74 A;  4X64 T;  4JEH B;  3CQG B;  4I43 B;  4EEB A;  3OJA A;  2JQQ A;  3CML A;  5CFB A;  3HKB E;  4H9N C;  1ZKE A;  3KVB A;  3QOF A;  3C50 A;  2MYS A;  3M65 A;  1D1A A;  3RGL A;  2X66 A;  4ZHQ E;  4Q25 A;  3FBL A;  5IUX A;  2WS3 A;  3O4X E;  4UR9 A;  2XUE A;  1HNX T;  3K3O A;  4PK4 A;  3AEE A;  4IDO A;  4TX5 A;  3JC6 C;  2XQY A;  1Y64 B;  4HFI A;  2LJL A;  3K1S A;  2LM9 A;  2E5L T;  4CI2 B;  4M1P A;  5LCY A;  3TLV A;  3V5S A;  2ZMA A;  3H37 A;  2BKP A;  2XQ5 A;  3UFG A;  2UU9 T;  1HG5 A;  3RYI E;  5J1G A;  5HEJ A;  2WM9 A;  4DV0 T;  2UUB T;  3ZMS B;  3WI3 A;  2PG8 A;  1XMO T;  3ZJ2 A;  4ILC A;  3IA3 A;  1HCI A;  4PK6 A;  2XAJ B;  4DV5 T;  2YN6 A;  4O4I E;  1UK5 A;  3KBT A;  4EYY R;  4AQG A;  4JBW F;  5JR9 A;  1BR1 A;  3KV9 A;  4Z8X A;  5ABH A;  1U4Q A;  3X1D A;  1D1C A;  2J47 A;  4IE6 A;  2HHH T;  3TLW A;  4KHP T;  2LHR A;  4KUM B;  4GK5 E;  3ZYL A;  4V1A v;  4HFE A;  2Z6E A;  3CX8 B;  4ZI3 C;  5FVL A;  3RYC E;  5AQF B;  5ABG A;  2IUB A;  1IJ5 A;  2LKH A;  4DID B;  4EYU A;  3ZMT B;  2QYW A;  2YIN A;  4LFA T;  3FZF B;  3N9M A;  2X0H A;  2MTQ A;  4DBQ A;  4DND A;  4NPP A;  2QGS A;  3ZC0 A;  2BBJ A;  2ODU A;  2XY8 B;  3Q5D A;  3ETU A;  3HKD E;  5FNV E;  2KND A;  5EK2 A;  5JDH A;  5LB7 B;  3CX7 B;  2VAS A;  1UCU A;  1SHZ C;  3VR8 A;  1N34 T;  4H9P C;  2JPF A;  2CEA A;  1KNZ A;  4IRE A;  2FJB A;  2DLR A;  3NBX X;  4LF4 T;  3RQW A;  5BR8 T;  5L3G B;  3FZM B;  4U33 A;  3UFE A;  1HNZ T;  3QB5 K;  3ZMU B;  4OX9 T;  4WBO A;  3L09 A;  2VQE T;  2XQ4 A;  4Z91 A;  4YSZ A;  4LF6 T;  2A72 A;  2LKG A;  4IE0 A;  2KXP B;  3LBX A;  2FUP A;  5IHY A;  2VKD A;  5FMN A;  5ABF A;  4CXW A;  2MOZ A;  1FIO A;  2LM2 A;  2IC6 A;  3Q5E A;  2XQ3 A;  2V5C A;  3EI0 A;  4PJN A;  2QVA A;  1BR4 A;  4WW0 A;  4LMK A;  4A56 A;  3AE9 A;  4JI0 T;  2CHO A;  1NWM X;  3KFW X;  4YY3 T;  2V26 A;  4EED A;  1ZEE A;  1CHU A;  1Y01 A;  4YFS A;  4FI5 A;  3RYF E;  4QX7 B;  3TLU A;  3CQX C;  1VCT A;  2JQH A;  4ZZC A;  3JC6 D;  2K9A A;  3JCF A;  4TZ4 C;  4PK5 A;  4UF0 A;  5HEU A;  4KMC A;  2V7I A;  5JR9 B;  3AEF A;  4HFV A;  1FMW A;  4TV9 E;  4YSY A;  4QKN A;  2K24 A;  3V5U A;  3RHW A;  5JR9 C;  3HI2 A;  4MLK A;  3C4W A;  5AQI B;  2G0U A;  3Q5W A;  3PDY A;  3UU8 A;  3CWZ B;  5JDN A;  4HGA A;  2C5K T;  2CMR A;  5HXS A;  5EK3 A;  3OPC A;  3I1A A;  2IIU A;  4IDN A;  2WDQ A;  2J1D G;  3FXE B;  4TWH A;  5CA0 E;  3CIR A;  2V8S V;  4HN9 A;  4IL9 A;  3P8C D;  1CUN A;  2JRK A;  3HL6 A;  1W0A A;  1LVK A;  5LGT B;  5E0O A;  2W61 A;  4JI1 T;  3AEC A;  3BQK A;  5AQL B;  4ZEY A;  1XWM A;  2N9D A;  4O8S A;  3HR0 A;  1WRD A;  4JI8 T;  4H63 V;  2NW9 A;  2LRK A;  1XDP A;  4ZI3 D;  2WZH A; 
#chains in the Genus database with same CATH homology
 4G63 A;  4ERR A;  5J2U E;  4EXT A;  1AJ3 A;  3HKC E;  1B7T A;  2XTL A;  4AI6 A;  5LJM A;  2ODV A;  3N5L A;  4GYS A;  4I55 E;  2V7K A;  2VB6 A;  3DJB A;  1HF8 A;  3GN5 A;  3I0Q A;  4ZS3 A;  5H6Q B;  4CQI A;  4DBR A;  1NAF A;  3MXZ A;  3NZP A;  5CB4 E;  3KV4 A;  5FXV A;  5DQW A;  2C5J A;  2W63 A;  3AB3 B;  1HFA A;  3KDS E;  2VK9 A;  4DMV A;  1D0Z A;  2LOP A;  2YEV C;  2A2F X;  3AA0 B;  2LEH A;  5JRC B;  5HXH A;  1FMV A;  1U5P A;  2KT9 A;  5LHG B;  2VKH A;  4PW8 A;  3AAI A;  1G73 A;  4ZI2 C;  1YD8 G;  3OYZ A;  3C64 A;  1MMA A;  4HKA A;  3ZMZ B;  4E7Z A;  3UUX B;  1YKE B;  4EB6 E;  4BJM A;  3EVY A;  5J2T E;  5L3E B;  2DWG A;  3F57 A;  4DVD A;  2RA1 A;  2YK0 A;  4TV8 E;  1OXZ A;  3SOL A;  3F2E A;  4H9S E;  2WBL A;  3P7I A;  3J7Y q;  4U74 A;  5JQG E;  5JDQ A;  3LBX B;  5FXX A;  4UEM A;  1S94 A;  1WYC A;  5HWX A;  5LYJ E;  4JEH B;  4C91 A;  4IGU A;  3LJC A;  3CQG B;  4IE4 A;  4XZC A;  4I43 B;  4F6R C;  1BR0 A;  3OJA A;  4G2A A;  2JQQ A;  5HXR A;  3CML A;  1H7C A;  3HKB E;  2X9X A;  3LK4 2;  4X1Y E;  4H9N C;  1ZKE A;  1G8X A;  4UVB B;  2DI4 A;  2ZM8 A;  4ASK A;  4JLE A;  2XAF B;  3KVB A;  3UUN A;  3C50 A;  4EIW A;  2YU2 A;  4YHJ A;  3MJX A;  2MYS A;  5FYM A;  3DTO A;  4IIJ E;  4L0R A;  2HPJ A;  4TUY E;  3M65 A;  1D1A A;  3QK6 A;  5F8P A;  2X66 A;  5LHH B;  4ZHQ E;  2H7O A;  4CXY A;  3FBL A;  4YJ3 E;  3CVR A;  1WLX A;  3O4X E;  3N2G E;  2XUE A;  4UEL A;  5L3F B;  2X68 A;  4MBQ A;  3GWH A;  3H3A A;  4QHO A;  5JDF A;  3B57 A;  3K3Q C;  4PAG A;  3K3O A;  4PK4 A;  4MFR A;  3HA4 A;  4TX5 A;  5HAX A;  1VOM A;  5LP6 E;  3JC6 C;  2XQY A;  2CWO A;  1Y64 B;  3GA8 A;  4X1I E;  2LJL A;  4IE5 A;  5A1L A;  2CE7 A;  4EOZ B;  2KWI B;  2ES0 A;  5LBM A;  3PU3 A;  2LM9 A;  1WR6 A;  3HKE E;  3AA6 B;  4MHC A;  4AQF A;  4CI2 B;  3AVR A;  4M1P A;  5LCY A;  3O1J A;  3QUJ A;  3V5S A;  1MMN A;  5FP3 A;  2E9X B;  5AFU L;  3ZN1 B;  2X9W A;  4MAL A;  2ZMA A;  3H37 A;  5HXC A;  4UF0 B;  3J9X 1;  3MAC A;  2PJQ A;  2CA5 A;  2MBG A;  4PJM A;  3ESL A;  5HXE A;  4P0A A;  1HG5 A;  3KV6 A;  3RYI E;  1D0Y A;  5DAB A;  5J1G A;  3KIN B;  2WMO A;  1FEW A;  2WM9 A;  1Z0P A;  2E9X C;  4XAX B;  3ZMS B;  4DMW A;  1IJ6 A;  2PG8 A;  3WI3 A;  5KDM C;  3N9Q A;  2I59 A;  2H3R A;  3ZMU B;  3E08 A;  3ZJ2 A;  2CXF A;  5JVD E;  5LGU B;  4OK0 A;  4OYJ A;  1MMG A;  4I4T E;  2RP4 A;  2OA5 A;  3W15 B;  1HCI A;  3ZEF B;  5C8Y E;  4PK6 A;  2XAJ B;  4QXH B;  3CX6 B;  3ZLI A;  4O4I E;  5ADX L;  4I50 E;  2VWA A;  2CLY B;  2X67 A;  3KBT A;  4ILU A;  2Y8D A;  3AVS A;  2K5B B;  5LOV E;  3IHR A;  4YLH A;  4X1K E;  4BJN A;  4EYY R;  4AQG A;  1BR2 A;  2A3D A;  2X51 A;  5JR9 A;  1BR1 A;  2IW5 B;  4DO0 A;  1LVF A;  2Q9Q D;  2EHO D;  3VHL A;  3KV9 A;  4Z8X A;  5JRE A;  1U4Q A;  3LFM A;  4EZ4 A;  2CLY C;  3QC9 A;  1EZ3 A;  4UV8 B;  1SA0 E;  4KP3 C;  4GYR A;  4N78 D;  2SPC A;  2YU1 A;  4H9R C;  4UXN B;  4CXX A;  1D1C A;  4P0B A;  5LA6 E;  5BMV E;  2CCQ A;  1VRB A;  4IE6 A;  2Y48 B;  1UX5 A;  4K0U A;  5FY7 A;  3KV5 A;  3RRW A;  4EAH A;  5JDL A;  4L9I A;  2KWH A;  2KZ7 B;  4PJL A;  3ZPO A;  1YKH B;  3S4U A;  2LHR A;  2JJ9 A;  3PUA A;  2UXN B;  3C98 B;  3FXD B;  3SS1 A;  3B13 A;  3WAJ A;  3C4Z A;  4KUM B;  1S35 A;  2V7J A;  4GK5 E;  3ZYL A;  4B6X A;  4V1A v;  2BVL A;  2NP9 A;  3Q5X A;  3ETV A;  5IYZ E;  5H6R B;  3LK3 B;  3ANW A;  2Z6E A;  3CX8 B;  5DQV A;  4ZI3 C;  4J2C A;  2KMF A;  2ZM0 A;  3RYC E;  3UUL A;  2M67 A;  4PFO A;  4TN7 B;  5L2L A;  2NTY A;  1IJ5 A;  2HH7 A;  2NW8 A;  4XBF B;  3ZCI A;  4EYU A;  3ZMT B;  5HWY A;  3ZYM A;  2YIN A;  3GN5 B;  3Q9D A;  4UV9 B;  3N9M A;  2ACX A;  1IAP A;  1HX8 A;  1MIY A;  4OYK A;  3N9N A;  2MTQ A;  4DBQ A;  1WYB A;  2GK9 A;  4HEA A;  5LJN A;  4DND A;  2V7L A;  2QGS A;  2XAS B;  2BZB A;  3ZC0 A;  3ZN0 B;  2E9X D;  2ODU A;  2V1D B;  2BVM A;  2DCF A;  3AA7 B;  2L8K A;  3RX6 A;  3ETU A;  3HKD E;  3N9P A;  3BQL A;  3RC3 A;  3BQI A;  3T8O A;  5L3C B;  4AXP A;  5FNV E;  3PTR B;  3AAA B;  4HE8 A;  3UUM A;  1MNE A;  2KND A;  5EK2 A;  3N9L A;  4PFP A;  5JDH A;  3PUS A;  1OWA A;  4UVA B;  3RYH E;  2NOX A;  3CX7 B;  2VAS A;  5FY1 A;  1LRZ A;  1UCU A;  3Q2M A;  1SHZ C;  2KIN B;  4NUV A;  3VU7 H;  4H9P C;  2JPF A;  2WWU A;  2CEA A;  2LOS A;  3FB2 A;  1KNZ A;  2KLQ A;  3U78 A;  2E8I A;  4L5G A;  5F3J A;  3R84 B;  3N9O A;  2DWK A;  2DLR A;  5JRC A;  3NBX X;  3RPU A;  1QUU A;  3EDV A;  2NWB A;  2ZLY A;  3K8P C;  1QSD A;  3RKO A;  4KBM B;  5L3G B;  4EZH A;  3UFE A;  1ZV4 X;  4ZI2 D;  2Q9Q A;  3ZJ1 A;  3KVA A;  2W00 A;  1MIW A;  2ZM2 A;  4WBO A;  4IE7 A;  2EHO A;  3L09 A;  5ETW A;  3TKL B;  5EZY E;  3DP7 A;  1MND A;  2IC9 A;  3NZQ A;  2DNX A;  3F31 A;  4O2A E;  3D0T A;  2A72 A;  4CI1 B;  4IE0 A;  2KXP B;  3LBX A;  5KX5 E;  2B1E A;  2V7M A;  3NRX A;  2LE8 A;  5FY0 A;  3VKG A;  3MK7 C;  5IHY A;  2VKD A;  3LG7 A;  4QXB B;  1O3X A;  5FMN A;  1HS7 A;  3PUQ A;  5LHI B;  5TAO A;  4E7S A;  4CXW A;  2MOZ A;  3I0O A;  1FIO A;  5LNK A;  2IC6 A;  3AAE B;  3EDU A;  2N2N A;  2W0G A;  2VL8 A;  2CWY A;  1X79 A;  4PJN A;  1HG2 A;  1BR4 A;  4WW0 A;  4A56 A;  1T98 A;  2PBI A;  4C90 A;  1NWM X;  3N2K E;  3KFW X;  2CM0 A;  2LHN A;  2V26 A;  2XAQ B;  4IDZ A;  5JDG A;  2LT3 A;  5LG4 A;  1ZEE A;  3EUH A;  4H63 H;  4PNI A;  4U72 A;  2HPL A;  4YFS A;  4FI5 A;  5JDM A;  5KMG P;  3RYF E;  3NRY A;  5L3B B;  4JUY A;  4QX7 B;  4AQF C;  3IBP A;  2P9B A;  2XHE B;  4UVC B;  4X20 E;  5FXW A;  4ZI7 E;  2DHR A;  3O1H A;  2WMN A;  2W62 A;  3CQX C;  3I9W A;  2NTX A;  4ADZ A;  4AKI A;  3JC6 D;  4BAY B;  1LKX A;  4AKR B;  1MIV A;  3UT5 E;  2K9A A;  2Q9Q B;  2XAG B;  1D1B A;  2EHO B;  3ONX A;  4WNK A;  3UTK A;  4YJ2 E;  2H7V C;  3ZC1 A;  3U3I A;  4AKH A;  2E9X A;  4AKG A;  4QWN B;  4TZ4 C;  4PK5 A;  3RRC A;  2CXD A;  2L3L A;  1V9D A;  4UF0 A;  4GOU A;  2LSJ A;  4P09 A;  2Q9Q C;  1US7 B;  4KMC A;  3CQC B;  2V7I A;  4ZS2 A;  2EHO C;  5JR9 B;  4NUU A;  2D0U A;  2LSK A;  2D5U A;  4OHF A;  3CPZ A;  4HFV A;  4ZOL E;  2K48 A;  3MA9 A;  1FMW A;  3ZMV B;  4TV9 E;  4JEU B;  4QKN A;  2K24 A;  2BDE A;  3FBZ A;  2C5I T;  1ZHC A;  3K3N A;  3E0Z A;  2C0S A;  4QX8 B;  3V5U A;  3C51 A;  4O4J E;  5LBQ B;  5JR9 C;  3HI2 A;  3O9X A;  2Y6X A;  4GK0 E;  3FHN A;  4MLK A;  3C4W A;  3A5X A;  3BK9 A;  2CXL A;  3E22 E;  2L9Q A;  3ZCJ A;  2G0U A;  1D0X A;  3O1I A;  3OYX A;  3Q5W A;  5FXZ A;  1HTJ F;  3PDY A;  4BA9 A;  3CWZ B;  2VKJ A;  4ANJ A;  4CI3 B;  4HGA A;  5JDN A;  2C5K T;  5DJQ C;  2CMR A;  2WSS V;  3MZK B;  5LXT E;  5HXS A;  4O4H E;  3IEE A;  3CKD A;  3PU8 A;  2X0L B;  5EK3 A;  5L3D B;  4H9Q C;  3LK2 B;  3OKQ A;  4QXC B;  3IF8 B;  3KBU A;  2JMH A;  3I1A A;  1KK7 A;  2N1G A;  3N2O A;  4OFZ A;  2J1D G;  3FXE B;  2QA7 A;  5CA0 E;  4HTE A;  4HN9 A;  1MMD A;  4WBN E;  3ANW B;  2IAK A;  4IST A;  3I9Y A;  3P8C D;  1CUN A;  2PFV A;  5CA1 E;  5JH7 E;  3L3P A;  2JRK A;  2UXX B;  3ZYK A;  3HL6 A;  4FJO A;  2D0T A;  3PUR A;  3VKH A;  1LVK A;  3SRZ A;  5GON E;  3SWH A;  2LSG A;  2LSY A;  5LGT B;  5EK4 A;  5E0O A;  2W61 A;  4AKL A;  2X9H A;  4PJJ A;  4O4L E;  2WAU A;  3AA1 B;  2NW7 A;  3MKD A;  3PE0 A;  5LGN B;  4CZZ B;  1E1H B;  2VKO A;  2X9Y A;  4IHJ E;  3C4X A;  4O2B E;  2JMK A;  5HYA A;  3RH3 A;  1IZN B;  1YW0 A;  3BQK A;  3WAK A;  1UX4 A;  3OBV E;  3RC8 A;  2XAH B;  4H9O C;  3GMI A;  2N9D A;  4GIW A;  3PUG A;  5M4Y A;  4O8S A;  3HR0 A;  1WRD A;  2D2S A;  4UIG A;  2LSI A;  4H63 V;  2NW9 A;  3R6N A;  4ISS A;  4ZI3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...