3Q5WA

Structure of proteasome tether
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
198
structure length
198
Chain Sequence
DISKRARQLPVGEQLPLSRLLQYSDKQQLFTILLQCVEKHPDLARDIRGILPAPSMDTCVETLRKLLINLNDSFPYGGDKRGDYAFNRIREKYMAVLHALNDMVPCYLPPYSTCFEKNITFLDAATNVVHELPEFHNPNHNVYKSQAYYELTGAWLVVLRQLEDRPVVPLLPLEELEEHNKTSQNRMEEALNYLKQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein cut8
publication title Structure of Proteasome Tether
rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 57
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08559 Cut8 Cut8, nuclear proteasome tether protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3q5wA00
3Q5WA 3Q5XA
chains in the Genus database with same CATH superfamily
3FBLA 4IGUA 5FXWA 4N78D 2G0UA 3MK7C 2WQYA 3I1AA 3TLSA 2D5UA 4JLEA 3S4UA 4HFVA 2VQFT 5FMNA 3RQUA 5ABFB 1WYCA 3P50A 5AQHB 4JI3T 2X9XA 1LVFA 3AXJA 4DO0A 2VB6A 5EZYE 1XZYA 2XAHB 5AQTB 2CA5A 3CK6A 2GK9A 3EDUA 5EK3A 3VRAA 2XJ7A 5F3JA 2FJBA 4TWFA 4UF0B 2SPCA 4ZS3A 1KNRA 2XASB 1OEDE 2XQYA 1OXZA 2PFVA 1YQ3A 4C91A 5L2LA 2CXDA 3OKQA 3IEEA 2V5DA 5LXTE 3HKEE 2XQ6A 2IMLA 5AQUB 1VOMA 2D2SA 2NR4A 3UT5E 1T7SA 3FZMB 3ZC0A 1XNQT 2Y6XA 3X1DA 3ZYLA 3T8OA 2BG9C 3RKGA 4LF4T 1JNZA 1AJ3A 4E7SA 3RH3A 3Q5WA 3JC6D 2I0MA 2CEAA 1XDPA 2KNDA 1BR0A 1HF8A 1YQ4A 1VRBA 3SOLA 5FVLA 1UX4A 2W4XA 4CXWA 2LSYA 2X0YA 3RIFA 2V7JA 4EZ4A 5LBQB 3TKLB 4KHZF 2BVLA 3LG7A 2K5BB 3RQWA 3UUMA 2EHOB 1Y01A 3LBXB 4IHJE 3UU3A 3L39A 2WM9A 4LFCT 3CQGB 4UEMA 1N33T 3R6NA 3N9PA 3WAJA 1KNPA 3ANWA 4OX9T 3AAEB 2K24A 4CI3B 1UK5A 2K3WA 4ZI2D 3RYFE 5C8YE 2X66A 3JADA 2KXPB 5FXXA 4UIGA 1I94T 2KWIB 4GYSA 4K0KT 4YHJA 3ZT6A 4UVBB 2CPTA 4IE6A 1E2AA 4L5GA 5J2UE 4ZHQE 4X5TA 2XQAA 3ONXA 4O2AE 1B7TA 5E0OA 5IYZE 4AQFC 2DWGA 2LM2A 2H3RA 1E7PA 4JBWF 4NUVA 5LP6E 5L3GB 3ZT7A 3N9LA 4ZI3C 4HE8A 5A1LA 2IDOB 2WP9A 3AECA 3EHZA 1D0ZA 4X65T 5LMNT 2XAGB 4IDOA 4JI8T 3FXDB 5LOVE 1X79A 3AEDA 4I43B 3VRBA 3FZFB 2UUBT 4YY3T 4Q25A 1D0YA 1XMOT 4TNVA 3AE2A 4F6RC 2CHNA 2KSRA 1T72A 2LE8A 2C5KT 3MXZA 3KBTA 3VKGA 4ZZCA 1WR0A 2A9UA 1WYBA 3P8CD 4LFAT 4MALA 2CWOA 3A5XA 3AB3B 2XQ5A 2E9XD 3KV9A 1YD8G 3QK6A 3AVSA 4OHFA 3UFGA 2C5JA 5AQFB 5JDMA 1BR1A 3AE4A 2CLYB 4HWFA 4HGAA 4O4HE 4JYAT 3N9MA 2F4VT 4MBQA 1ZOYA 3B5MA 3QUJA 1IAPA 1QSDA 1CHUA 5AFUL 3QB5K 3CX6B 4QH4A 2DWKA 2YEVC 1ZHCA 3PUQA 5J1GA 4DNDA 5HEOA 2LHRA 2NWBA 2E9XA 3OPCA 2BG9E 4U7IA 4AKIA 3OVUA 3RIAA 3ZC1A 2FJEA 1SUMB 3JCFA 2LKGA 4NPPA 3M3ZB 4EEBA 4M1PA 5LJMA 3LK2B 4EIWA 1Z0PA 2CLYC 4DR2T 2VVNA 5F8PA 2LSKA 3IA3A 3CX8B 4QH1A 1N36T 2BKOA 2WMNA 4Z91A 3WI3A 2W62A 4A97A 2JIWA 2XPKA 2BS4A 3Q2MA 1ZP0A 3ABVA 2C0SA 5JRCB 4IIJE 2KWHA 3TLTA 2BKNA 4KX6A 3AE6A 4X1KE 3NZQA 2YU1A 1IJ5A 2BS3A 3AE1A 3KV4A 2Y8DA 5JTGA 2LEHA 4HFEA 5C2TA 2YINA 3ZN0B 5HXCA 4ILCA 4ZOLE 5ABGA 2BS2A 3PU3A 5CJ5A 2XSAA 5HEUA 4ISSA 2JJ9A 3PUVF 4HFCA 1LVKA 4QXHB 4KHPT 2VQET 3KDSE 2WB5A 3GN5B 4WYVA 4ILAA 1VCTA 3ZEFB 4QWNB 4ADZA 2E5LT 3N2KE 2JMHA 2X0LB 2QGSA 3QNUA 2RPAA 3K1SA 4DR1T 5LMUT 3KBUA 5LBMA 4EOZB 3ZJ2A 3AE7A 1NAFA 3V5UA 1M7KA 3W15B 2NW8A 5KX5E 2WU2A 3DP7A 3C4WA 3J9X1 1G73A 4B3MT 3RPUA 2J1DG 3N5LA 4PK4A 5C3JA 5LYJE 2OV9A 5AQLB 5AQPB 2X9HA 4DV7T 2QYWA 4JI1T 1FEWA 2KZ7B 2MTQA 2L9QA 1YKEB 4QX7B 5BR8T 2ZM6T 4CQIA 1HG2A 2KINB 3D0TA 2DNXA 5JR9A 1HNWT 4G2AA 5JQGE 2OA5A 5FY0A 4CI1B 4JV5T 4JI4T 5HYAA 2A2FX 4CN4A 2V7IA 2X51A 2QVAA 3UUXB 4TZ4C 2IIUA 4EYYR 4E7ZA 3UFEA 3P4SA 3PUZF 4NXNT 2BZBA 2CXFA 2XZEA 3UQ7A 2HPJA 4P09A 2LOSA 3PDYA 4TX5A 2WMOA 3IBPA 3BQKA 4DR5T 1J5WA 2YK0A 3TLUA 3SFDA 3RF1A 2K9AA 4AKLA 2NTYA 5FY7A 4YT0A 3C50A 4AQYT 2BG9B 2W63A 3HL6A 3ZSTA 1HX8A 2Q9QD 2W0GA 4ERRA 1JNRA 5ABHA 4PJJA 4B3RT 1Z8UA 3HKCE 5KMGP 2PJQA 1FMWA 5J2TE 5HAXA 2YDSA 4ILBA 3U78A 4A5XA 1D1BA 3AEGA 4LMLA 4V1Av 4KMCA 1UURA 4U31A 2LSIA 3KVAA 3E08A 4YSYA 4DV5T 2CRBA 4CZZB 3IF8B 4O2BE 2WZHA 3UTKA 2CCQA 2Q9QA 3ZMTB 2YN6A 2JQKA 3NVOA 4TV8E 3O4XE 4HFIA 3N9OA 4U72A 4IE4A 4TWDA 3AA0B 2YKSA 2JMKA 4XZCA 1VCSA 5DQVA 2HN1A 3ZJ1A 3AAAB 4WW0A 2H7VC 4A98A 2QRXA 4H9QC 1MMAA 4X20E 5LGTB 3H37A 3PJAA 4YFSA 1U5PA 2IAKA 2WDRA 1QUUA 3HI2A 4GK5E 2X9YA 1D1CA 4MLKA 4DV6T 2PBIA 3ZMUB 4HWHA 3K3NA 3MJXA 4GKJT 4AXPA 3OYZA 3P4RA 4TNWA 3UU8A 3K8PC 2Y48B 3EDVA 2N2NA 3FZLB 4JI0T 3NRYA 2W00A 2V7KA 2V7MA 4GYRA 4YTNA 5AQIB 3AXJB 4DR4T 5JREA 3VU7H 3BQIA 4MFRA 1SE7A 4O4IE 1XNRT 4IL9A 4AISA 2YDQA 4QXCB 4CXXA 4DR7T 2HH7A 1IBMT 4U2YA 1W09A 5HCMA 3JAFA 5FVKA 4BJMA 2XAQB 1OEDA 5FL1A 2HN2A 3GA8A 2FBWA 3PURA 1O3XA 5LHGB 3RIUA 4UV8B 3FHNA 2X68A 3ZT5A 3VR8A 2LJLA 5BMVE 2M6IA 1M62A 3IHRA 4QKNA 1HFAA 2IC9A 2XQ9A 1MIYA 4HFBA 3OTOT 3CWZB 2ES0A 1WR6A 2HPLA 4TUYE 2RP4A 5JDNA 3OJAA 5J0ZA 4LF5T 4PJMA 2XHEB 4KI0F 3EVYA 2KLQA 2HHHT 2NW9A 4PFOA 3FZKB 2CBJA 2DHRA 3ZLIA 2V6YA 1BR4A 2CBIA 3ZMZB 4DBQA 5EK2A 2E2AA 4P0BA 3L8RA 3C51A 2M6BA 4YTPA 2BKPA 4GIWA 3A8YC 4TWHA 5LNKA 2V7LA 3PUSA 1HS7A 3NBXX 1SHZC 4AKRB 5LGNB 2CE7A 5M4YA 1W0BA 2V1DB 3ANWB 3VKHA 4HKAA 4H9OC 4IE5A 4U2ZA 3JAEA 1HNXT 3PV0F 5HWXA 1FMVA 2WWUA 4XAXB 2JQ9A 2XM2A 3TLVA 4J2CA 3AE3A 3PUXF 1S35A 4OK0A 2K48A 2UXBT 3ZYKA 3EUHA 3HKDE 4LFBT 4ILUA 5L3DB 2X0HA 4H9RC 4X62T 3JC6C 1J1JA 3O9XA 5KDMC 1IJ6A 4U33A 3H3MA 4H63V 4L9IA 5DABA 2VKHA 4JI6T 2VKDA 2CXLA 4YJ2E 1MIWA 1L0VA 2KMFA 3HKBE 2JPFA 4DV4T 3V5SA 2ZM0A 3LDQB 2V8SV 2A3DA 4K0UA 2M67A 3P4QA 2WZIA 3VHLA 5L4HA 2WSSV 4NUUA 4ZI7E 4X1IE 3UU5A 2WAUA 1MMDA 3QB5A 2W67A 2X9WA 3F2EA 4UVCB 5L4EA 3O1HA 2J62A 1LKXA 3SFEA 1NEKA 3AA1B 3FB2A 4OFZA 2PG8A 2ZM8A 2UUAT 2WU5A 3L3PA 2MBGA 4ZI2C 2ACXA 3LJCA 2BBHA 1D0XA 4B6XA 3ZN1B 2V5CA 1HX1B 5JH7E 3OYXA 3AE5A 2XSBA 1KFYA 3CKDA 5FY1A 3EAMA 3P4PA 3UU4A 4I0UA 3RRWA 4A56A 4NXMT 3Q9DA 3F57A 2V6XA 3H3AA 3AEFA 2WDVA 3PJAJ 2VVSA 2LRLA 4LF8T 3RGLA 2E9XB 4GK0E 4Z90A 4X1YE 1EZ3A 2NOXA 1WLXA 2AXDS 4PJLA 4XBFB 5ABFA 2J4GA 5FNVE 1R8IA 3N9QA 2FJDA 4PK6A 5HXHA 4YXDA 2ZMAA 4WZXA 2JQHA 2E8IA 1X9BA 5F5WA 5LHIB 2D0TA 4JI5T 2FJAA 3RKOA 4EV6A 1KNZA 3CMLA 4EEDA 2PTFA 1SA0E 1QLBA 4PAGA 2JRKA 2C5IT 2XUEA 4EAHA 4ZXLA 4UF0A 3FZHB 4WBNE 5LGUB 2H89A 3AVRA 1W0AA 3M65A 3KFWX 2UU9T 4PK5A 4QX8B 4ZS2A 1MMNA 2I6HA 3KV6A 2E9XC 3OBVE 3L09A 3N9NA 2CHOA 4H9SE 3RI5A 5LJNA 3C64A 2XAJB 3N2OA 5EK4A 5HCJA 3LK42 4IT4A 3AE8A 2EHOD 4X64T 5AQSB 5AQOB 1DU2A 3UUBA 2A72A 3O1JA 4LMKA 4ZI3D 4CI2B 5LG3A 3ZSSA 1UX5A 1WRDA 4DUZT 2ZM2A 1IBKT 4HFHA 3B57A 4GKKT 4C90A 4HTEA 5AQVB 2H7OA 1BR2A 1IZNB 3UU6A 5LCYA 4DIDB 2W61A 3AA7B 4AQFA 3HR0A 4U7YA 2EHOA 3ZKRA 3LBXA 3BK9A 1NWMX 3QOFA 5AQMB 3NZPA 1HR0T 3UULA 2W2UA 5AQRB 3UQ4A 2XQ3A 4PW8A 4EXTA 3Q5XA 2WS3A 4JEUB 2H88A 2XQ4A 2FUPA 4FI5A 4TN7B 1HNZT 3ONJA 3TLWA 4EZHA 3DJBA 3MKDA 4DR3T 4Z8XA 4ISTA 4DBRA 3BQLA 2MAWA 4CN6A 4U74A 4YSXA 4DV0T 4DV2T 2XQ7A 1LRZA 3AA6B 4B3TT 4LMJA 2NTXA 3ZYMA 2OLTA 1YKHB 2XM1A 5JR9B 1UGOA 4UR9A 3ZMVB 3P7IA 5HEJA 4ZZBA 2D9DA 3UUNA 2BDEA 3I9WA 4BAYB 5HEGA 1H7CA 3MACA 1HTJF 1FIOA 3FBZA 5DJQC 1HCIA 4AKHA 5HXRA 5CB4E 2LT3A 3ZCJA 1YW0A 4I55E 5DQWA 5CA0E 3RYIE 5FXZA 3PUYF 2ODUA 4PJNA 3RX6A 4YTMA 1IBLT 1YXRA 4QHOA 5JR9C 5AQKB 3I0QA 3AEAA 4WBOA 3KVBA 2CMRA 3A7MA 1GQEA 1NENA 5FXVA 3J7Yq 5FP3A 2ACZA 3ZMSB 5LG4A 3DTOA 3NKZA 4CN1A 4P0AA 4IE0A 4EGWA 2MOZA 2ODVA 5L47A 3VR9A 5JDGA 4QH5A 1N34T 4AIUA 4PNIA 3GMIA 3HA4A 2LOPA 2Q9QB 4UVAB 4O4LE 4IDQA 4OYKA 4LF6T 4WNKA 5CGMA 3KV5A 2L3LA 3U3IA 2LLYA 4DMWA 2EHOC 3Q5DA 4O8SA 4DUYT 2IHR1 4DR6T 1WCRA 3RC3A 4KBMB 5JDFA 4AI6A 3ETVA 2DCFA 4IREA 3MZKB 1XMQT 4I4TE 1U4QA 4EB6E 2X67A 2J47A 2YOEA 1MNEA 3QC9A 3PUGA 4O4JE 1N32T 5JDHA 1I6ZA 4H63H 3N2GE 2Q9QC 2N9DA 3LSVA 4F8HA 3E0ZA 3NWIA 3SWHA 5HXEA 4IDPA 4DV3T 2VKOA 5JRCA 2NW7A 1ZEEA 1HG5A 4LF9T 3I0OA 2QA7A 2IW5B 3CQCB 3NRXA 1MMGA 2Z6EA 3AEBA 4HEAA 2DLRA 5AQJB 4KUMB 2LRKA 3KINB 5TAOA 4I50E 4CXYA 3PE0A 4FJOA 4JEHB 4AKGA 4UV9B 2RA1A 3K3OA 4IL4A 1FJGT 2P9BA 2R6GF 5CA1E 3LFMA 2LSJA 2D0UA 2YDRA 5KXJA 1OEDB 2VK9A 4DVDA 5GONE 2WDQA 1J5ET 5ABEA 3GN5A 2IUBA 4BA9A 3ETUA 1ZV4X 2XAFB 3RHWA 2CM0A 4U3CA 4ANJA 2E5VA 3RYCE 1KEYA 2YU2A 2WWVA 2VL0A 3RYHE 4TV9E 3MA9A 2VKJA 4COFA 1MIVA 1OWAA 2CWYA 4EYUA 1MNDA 2XY8B 3EI0A 3P4WA 3ONLC 2LM9A 1T98A 2MPKA 2VASA 3FXEB 5CFBA 2XQ8A 4HFDA 4KP3C 3EABA 1ZKEA 4JUYA 1D1AA 5HXSA 4NIQA 3T1HT 5LHHB 2IC6A 4HWCA 1OEDC 2V6YB 2VWAA 4JI2T 3O1IA 1XWMA 3RIUC 3F31A 4IDNA 1UCUA 3AEEA 4UELA 4YHHT 2VURA 2MYSA 1UUSA 5FKYA 5JDQA 2L8KA 4HWDA 2WCAA 4OYJA 3C4ZA 5JVDE 3CPZA 4L0RA 5L3FB 5IUXA 3WAKA 2UXCT 3G06A 3ZPOA 4X66T 2LKHA 5LB7B 4B3ST 5JDLA 3B13A 4IDZA 5IHYA 1G8XA 4YLHA 5HWYA 3PUAA 2UXNB 2BVMA 5L3EB 5FYMA 3LK3B 1E1HB 3AE9A 5H6RB 3C98B 5ADXL 4JI7T 2WBLA 1W9RA 5LA6E 4DV1T 2BBJA 1XDOA 3ZCIA 2V26A 2BG9A 2LSGA 3PTRB 4MHCA 1US7B 3SS1A 3R84B 3Q5EA 4ZEYA 3RRCA 2XTLA 2W66A 2B76A 1T8BA 2KT9A 3CX7B 5HEHA 4IE7A 3AAIA 2UXXB 4AQGA 5AQGB 1CUNA 3PUWF 3PU8A 5L3BB 4G63A 4ASKA 2B1EA 4YJ3E 4H9NC 2DI4A 3I9YA 5L3CB 4DMVA 4H9PC 1KF6A 5ETWA 4GOUA 5AQNB 3T1YT 2N1GA 2WY2A 4BJNA 4LF7T 2I59A 3CIRA 3CVRA 3K3QC 3RC8A 1KK7A 4YSZA 5H6QB 4HN9A 2LHNA 2VL8A 2NP9A 3ESLA 3GWHA 2ZLYA 1S94A 2DL1A 2JQQA 1WFDA 2AE9A 3SRZA 4HWIB 2UXDT 4PFPA 1V9DA 5AQQB 5IWAT 4P1NA 4UXNB 3E22E 3RLFF 3C4XA 3CQXC 5FL0A 1Y64B 2UUCT 4QXBB
chains in the Genus database with same CATH topology
2V1DB 3ANWB 3VKHA 4HKAA 2YINA 3FBLA 3ZN0B 4IGUA 4QHOA 5FXWA 5HXCA 4ZOLE 4N78D 5JR9C 4H9OC 4IE5A 2G0UA 3MK7C 3PU3A 3I0QA 3I1AA 4ISSA 2D5UA 4WBOA 4JLEA 2JJ9A 3KVBA 5HWXA 2CMRA 1LVKA 4QXHB 1FMVA 2WWUA 4XAXB 4HFVA 3S4UA 5FMNA 5FXVA 3KDSE 3J7Yq 1WYCA 5FP3A 3GN5B 4J2CA 4OK0A 1S35A 3ZMSB 5LG4A 3DTOA 2K48A 3ZEFB 4P0AA 4QWNB 4ADZA 3ZYKA 2X9XA 1LVFA 2JMHA 3N2KE 4IE0A 4DO0A 2VB6A 3EUHA 3HKDE 2X0LB 2MOZA 2QGSA 5EZYE 4ILUA 5L3DB 2XAHB 2ODVA 4H9RC 5JDGA 3JC6C 2CA5A 3O9XA 5KDMC 1IJ6A 2GK9A 3KBUA 5LBMA 4EOZB 3ZJ2A 3EDUA 5EK3A 1NAFA 4PNIA 3V5UA 3GMIA 4H63V 3HA4A 3W15B 2NW8A 5KX5E 5F3JA 4L9IA 5DABA 2LOPA 2VKHA 4UF0B 2VKDA 2Q9QB 4UVAB 2CXLA 2SPCA 4YJ2E 1MIWA 3DP7A 4ZS3A 2KMFA 3C4WA 3J9X1 4O4LE 2XASB 3HKBE 2XQYA 4OYKA 1OXZA 2PFVA 4WNKA 2JPFA 4C91A 1G73A 3KV5A 2L3LA 3U3IA 4DMWA 2EHOC 2CXDA 3OKQA 5L2LA 3IEEA 3RPUA 4O8SA 2J1DG 3N5LA 3V5SA 2ZM0A 5LXTE 3HKEE 2A3DA 4K0UA 4PK4A 1VOMA 3RC3A 2D2SA 5LYJE 2M67A 3UT5E 4KBMB 5JDFA 3ZC0A 4AI6A 3VHLA 2Y6XA 3ZYLA 2WSSV 3ETVA 4NUUA 3T8OA 2DCFA 4ZI7E 4X1IE 2X9HA 1AJ3A 3MZKB 4E7SA 4I4TE 1FEWA 3RH3A 2WAUA 1MMDA 1U4QA 3Q5WA 4EB6E 3JC6D 2KZ7B 2X9WA 2MTQA 3F2EA 4UVCB 2L9QA 1YKEB 2X67A 4QX7B 2CEAA 2KNDA 1MNEA 4CQIA 3QC9A 3O1HA 1HG2A 3PUGA 1LKXA 4O4JE 3AA1B 2KINB 1BR0A 3D0TA 2DNXA 3FB2A 5JR9A 1HF8A 4OFZA 2PG8A 4G2AA 5JDHA 5JQGE 2OA5A 2ZM8A 5FY0A 4CI1B 1VRBA 4H63H 3N2GE 5HYAA 2A2FX 3SOLA 2V7IA 2Q9QC 2N9DA 1UX4A 2X51A 3UUXB 4CXWA 4TZ4C 2LSYA 4EYYR 3L3PA 2MBGA 4ZI2C 2V7JA 4EZ4A 4E7ZA 5LBQB 3TKLB 3E0ZA 2ACXA 3UFEA 3LJCA 1D0XA 3SWHA 5HXEA 4B6XA 3ZN1B 2BZBA 2CXFA 2VKOA 5JRCA 2BVLA 2HPJA 4P09A 5JH7E 3OYXA 2LOSA 3LG7A 2K5BB 3PDYA 2NW7A 1ZEEA 1HG5A 3UUMA 4TX5A 3I0OA 2QA7A 2WMOA 2IW5B 2EHOB 3CQCB 3BQKA 3IBPA 3CKDA 1MMGA 3LBXB 2Z6EA 3NRXA 5FY1A 4IHJE 2WM9A 3CQGB 2YK0A 4HEAA 2DLRA 4UEMA 4KUMB 3KINB 5TAOA 4I50E 3R6NA 3N9PA 3PE0A 4CXYA 3RRWA 2K9AA 4AKLA 2NTYA 4FJOA 4JEHB 5FY7A 4A56A 4AKGA 3WAJA 3C50A 3ANWA 4UV9B 3Q9DA 2RA1A 2W63A 3AAEB 3HL6A 2K24A 3F57A 3K3OA 3H3AA 4CI3B 1HX8A 2P9BA 5CA1E 2Q9QD 2W0GA 4ERRA 3LFMA 2LSJA 2D0UA 2E9XB 4GK0E 4ZI2D 4X1YE 3RYFE 5C8YE 2X66A 4PJJA 1EZ3A 2KXPB 5FXXA 2NOXA 2VK9A 1WLXA 5M4YA 4DVDA 4UIGA 4PJLA 2KWIB 3HKCE 4GYSA 5GONE 5KMGP 4XBFB 4YHJA 5FNVE 2PJQA 3GN5A 1FMWA 4BA9A 3ETUA 3N9QA 5J2TE 5HAXA 4PK6A 1ZV4X 2XAFB 4UVBB 3U78A 2CM0A 5HXHA 2ZMAA 2E8IA 4IE6A 1D1BA 4L5GA 5J2UE 4ANJA 4ZHQE 3ONXA 4V1Av 4O2AE 3RYCE 4KMCA 2YU2A 1B7TA 5E0OA 5IYZE 3RYHE 5LHIB 2D0TA 4TV9E 4AQFC 3MA9A 2VKJA 2LSIA 1MIVA 1OWAA 2CWYA 2DWGA 4EYUA 3RKOA 1MNDA 3KVAA 2H3RA 3E08A 1KNZA 3CMLA 4CZZB 1SA0E 4PAGA 4NUVA 2JRKA 2C5IT 3IF8B 4O2BE 2XUEA 5L3GB 4EAHA 5LP6E 2LM9A 1T98A 3N9LA 3UTKA 4ZI3C 4UF0A 2CCQA 2VASA 2Q9QA 3FXEB 4WBNE 5LGUB 3ZMTB 4HE8A 5A1LA 4KP3C 1ZKEA 3AVRA 3M65A 4TV8E 3O4XE 3KFWX 3N9OA 4U72A 4IE4A 4JUYA 4PK5A 4QX8B 1D1AA 3AA0B 1D0ZA 5HXSA 4ZS2A 1MMNA 2JMKA 3KV6A 2E9XC 2XAGB 3OBVE 3L09A 5LHHB 2IC6A 3N9NA 4XZCA 5DQVA 2VWAA 4H9SE 3ZJ1A 3FXDB 5LOVE 1X79A 4I43B 3AAAB 4WW0A 5LJNA 2H7VC 3O1IA 3C64A 1D0YA 2XAJB 3F31A 1UCUA 3N2OA 5EK4A 3LK42 4H9QC 2EHOD 1MMAA 4X20E 4F6RC 4UELA 5LGTB 2MYSA 3H37A 2A72A 3O1JA 4YFSA 1U5PA 2IAKA 1QUUA 4ZI3D 2LE8A 2C5KT 3MXZA 3HI2A 4CI2B 5JDQA 3KBTA 4GK5E 2L8KA 2X9YA 4OYJA 1D1CA 4MLKA 3C4ZA 5JVDE 3CPZA 4L0RA 1UX5A 5L3FB 1WRDA 3VKGA 2PBIA 2ZM2A 3WAKA 3ZPOA 3ZMUB 3K3NA 3MJXA 3B57A 4AXPA 5JDLA 1WYBA 3P8CD 3OYZA 4MALA 4C90A 2CWOA 3A5XA 3B13A 3AB3B 3K8PC 4IDZA 4HTEA 2E9XD 2H7OA 2Y48B 1BR2A 1IZNB 2N2NA 3EDVA 3KV9A 1YD8G 5LCYA 3QK6A 3AVSA 4OHFA 5IHYA 1G8XA 2C5JA 3NRYA 5JDMA 2W00A 1BR1A 2V7KA 4YLHA 5HWYA 3PUAA 2V7MA 4GYRA 2UXNB 2BVMA 2W61A 3AA7B 4AQFA 3HR0A 5L3EB 2CLYB 4HGAA 5JREA 2EHOA 4O4HE 3VU7H 3LBXA 5FYMA 3BQIA 4MFRA 3LK3B 3BK9A 1NWMX 1E1HB 5H6RB 3C98B 3N9MA 4MBQA 5ADXL 2WBLA 4O4IE 5LA6E 3QUJA 3NZPA 1IAPA 3UULA 4QXCB 1QSDA 5AFUL 3ZCIA 2V26A 4CXXA 2HH7A 3CX6B 2LSGA 2DWKA 2YEVC 3PTRB 1ZHCA 4MHCA 1US7B 3SS1A 4PW8A 3R84B 4EXTA 3PUQA 3Q5XA 3RRCA 5J1GA 4DNDA 4JEUB 2XTLA 2LHRA 2NWBA 2E9XA 4BJMA 2XAQB 4FI5A 4TN7B 2KT9A 4AKIA 3CX7B 4EZHA 3ZC1A 4IE7A 3DJBA 3GA8A 3AAIA 2UXXB 4AQGA 3PURA 3MKDA 4Z8XA 1O3XA 5LHGB 1CUNA 4UV8B 3FHNA 4ISTA 4DBRA 2X68A 3BQLA 4M1PA 2LJLA 3PU8A 5LJMA 4U74A 5BMVE 5L3BB 3LK2B 4G63A 4ASKA 4EIWA 1Z0PA 2CLYC 2B1EA 4YJ3E 3IHRA 4QKNA 1HFAA 4H9NC 1LRZA 2IC9A 5F8PA 3AA6B 2DI4A 3I9YA 2LSKA 1MIYA 2NTXA 5L3CB 3ZYMA 4DMVA 4H9PC 3CWZB 1YKHB 2ES0A 5ETWA 1WR6A 2HPLA 4GOUA 5JR9B 4TUYE 2RP4A 5JDNA 3OJAA 2N1GA 3CX8B 4BJNA 2I59A 2WMNA 3WI3A 4PJMA 3ZMVB 2XHEB 3P7IA 2W62A 3EVYA 2KLQA 3CVRA 3K3QC 5LGNB 3UUNA 1KK7A 3RC8A 2NW9A 5H6QB 4PFOA 2BDEA 4HN9A 3Q2MA 3I9WA 2DHRA 2LHNA 3ZLIA 2C0SA 4BAYB 4IIJE 5JRCB 2VL8A 2NP9A 1BR4A 3ESLA 2KWHA 3GWHA 2ZLYA 1S94A 1H7CA 3MACA 1HTJF 1FIOA 3ZMZB 4DBQA 5EK2A 3FBZA 4X1KE 1HCIA 5DJQC 3NZQA 4AKHA 4P0BA 5HXRA 2JQQA 3SRZA 5CB4E 2LT3A 2YU1A 3ZCJA 1YW0A 4I55E 1IJ5A 5DQWA 5CA0E 4PFPA 3C51A 1V9DA 3RYIE 4UXNB 3E22E 4GIWA 5FXZA 5LNKA 3C4XA 2V7LA 3CQXC 3KV4A 3PUSA 2ODUA 1HS7A 2Y8DA 3NBXX 1Y64B 2LEHA 4PJNA 3RX6A 1SHZC 4AKRB 2CE7A 4QXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5W A;  3Q5X A; 
#chains in the Genus database with same CATH topology
 3FBL A;  4IGU A;  5FXW A;  4N78 D;  2G0U A;  3MK7 C;  2WQY A;  3I1A A;  3TLS A;  2D5U A;  4JLE A;  3S4U A;  4HFV A;  2VQF T;  5FMN A;  3RQU A;  5ABF B;  1WYC A;  3P50 A;  5AQH B;  4JI3 T;  2X9X A;  1LVF A;  3AXJ A;  4DO0 A;  2VB6 A;  5EZY E;  1XZY A;  2XAH B;  5AQT B;  2CA5 A;  3CK6 A;  2GK9 A;  3EDU A;  5EK3 A;  3VRA A;  2XJ7 A;  5F3J A;  2FJB A;  4TWF A;  4UF0 B;  2SPC A;  4ZS3 A;  1KNR A;  2XAS B;  1OED E;  2XQY A;  1OXZ A;  2PFV A;  1YQ3 A;  4C91 A;  5L2L A;  2CXD A;  3OKQ A;  3IEE A;  2V5D A;  5LXT E;  3HKE E;  2XQ6 A;  2IML A;  5AQU B;  1VOM A;  2D2S A;  2NR4 A;  3UT5 E;  1T7S A;  3FZM B;  3ZC0 A;  1XNQ T;  2Y6X A;  3X1D A;  3ZYL A;  3T8O A;  2BG9 C;  3RKG A;  4LF4 T;  1JNZ A;  1AJ3 A;  4E7S A;  3RH3 A;  3Q5W A;  3JC6 D;  2I0M A;  2CEA A;  1XDP A;  2KND A;  1BR0 A;  1HF8 A;  1YQ4 A;  1VRB A;  3SOL A;  5FVL A;  1UX4 A;  2W4X A;  4CXW A;  2LSY A;  2X0Y A;  3RIF A;  2V7J A;  4EZ4 A;  5LBQ B;  3TKL B;  4KHZ F;  2BVL A;  3LG7 A;  2K5B B;  3RQW A;  3UUM A;  2EHO B;  1Y01 A;  3LBX B;  4IHJ E;  3UU3 A;  3L39 A;  2WM9 A;  4LFC T;  3CQG B;  4UEM A;  1N33 T;  3R6N A;  3N9P A;  3WAJ A;  1KNP A;  3ANW A;  4OX9 T;  3AAE B;  2K24 A;  4CI3 B;  1UK5 A;  2K3W A;  4ZI2 D;  3RYF E;  5C8Y E;  2X66 A;  3JAD A;  2KXP B;  5FXX A;  4UIG A;  1I94 T;  2KWI B;  4GYS A;  4K0K T;  4YHJ A;  3ZT6 A;  4UVB B;  2CPT A;  4IE6 A;  1E2A A;  4L5G A;  5J2U E;  4ZHQ E;  4X5T A;  2XQA A;  3ONX A;  4O2A E;  1B7T A;  5E0O A;  5IYZ E;  4AQF C;  2DWG A;  2LM2 A;  2H3R A;  1E7P A;  4JBW F;  4NUV A;  5LP6 E;  5L3G B;  3ZT7 A;  3N9L A;  4ZI3 C;  4HE8 A;  5A1L A;  2IDO B;  2WP9 A;  3AEC A;  3EHZ A;  1D0Z A;  4X65 T;  5LMN T;  2XAG B;  4IDO A;  4JI8 T;  3FXD B;  5LOV E;  1X79 A;  3AED A;  4I43 B;  3VRB A;  3FZF B;  2UUB T;  4YY3 T;  4Q25 A;  1D0Y A;  1XMO T;  4TNV A;  3AE2 A;  4F6R C;  2CHN A;  2KSR A;  1T72 A;  2LE8 A;  2C5K T;  3MXZ A;  3KBT A;  3VKG A;  4ZZC A;  1WR0 A;  2A9U A;  1WYB A;  3P8C D;  4LFA T;  4MAL A;  2CWO A;  3A5X A;  3AB3 B;  2XQ5 A;  2E9X D;  3KV9 A;  1YD8 G;  3QK6 A;  3AVS A;  4OHF A;  3UFG A;  2C5J A;  5AQF B;  5JDM A;  1BR1 A;  3AE4 A;  2CLY B;  4HWF A;  4HGA A;  4O4H E;  4JYA T;  3N9M A;  2F4V T;  4MBQ A;  1ZOY A;  3B5M A;  3QUJ A;  1IAP A;  1QSD A;  1CHU A;  5AFU L;  3QB5 K;  3CX6 B;  4QH4 A;  2DWK A;  2YEV C;  1ZHC A;  3PUQ A;  5J1G A;  4DND A;  5HEO A;  2LHR A;  2NWB A;  2E9X A;  3OPC A;  2BG9 E;  4U7I A;  4AKI A;  3OVU A;  3RIA A;  3ZC1 A;  2FJE A;  1SUM B;  3JCF A;  2LKG A;  4NPP A;  3M3Z B;  4EEB A;  4M1P A;  5LJM A;  3LK2 B;  4EIW A;  1Z0P A;  2CLY C;  4DR2 T;  2VVN A;  5F8P A;  2LSK A;  3IA3 A;  3CX8 B;  4QH1 A;  1N36 T;  2BKO A;  2WMN A;  4Z91 A;  3WI3 A;  2W62 A;  4A97 A;  2JIW A;  2XPK A;  2BS4 A;  3Q2M A;  1ZP0 A;  3ABV A;  2C0S A;  5JRC B;  4IIJ E;  2KWH A;  3TLT A;  2BKN A;  4KX6 A;  3AE6 A;  4X1K E;  3NZQ A;  2YU1 A;  1IJ5 A;  2BS3 A;  3AE1 A;  3KV4 A;  2Y8D A;  5JTG A;  2LEH A;  4HFE A;  5C2T A;  2YIN A;  3ZN0 B;  5HXC A;  4ILC A;  4ZOL E;  5ABG A;  2BS2 A;  3PU3 A;  5CJ5 A;  2XSA A;  5HEU A;  4ISS A;  2JJ9 A;  3PUV F;  4HFC A;  1LVK A;  4QXH B;  4KHP T;  2VQE T;  3KDS E;  2WB5 A;  3GN5 B;  4WYV A;  4ILA A;  1VCT A;  3ZEF B;  4QWN B;  4ADZ A;  2E5L T;  3N2K E;  2JMH A;  2X0L B;  2QGS A;  3QNU A;  2RPA A;  3K1S A;  4DR1 T;  5LMU T;  3KBU A;  5LBM A;  4EOZ B;  3ZJ2 A;  3AE7 A;  1NAF A;  3V5U A;  1M7K A;  3W15 B;  2NW8 A;  5KX5 E;  2WU2 A;  3DP7 A;  3C4W A;  3J9X 1;  1G73 A;  4B3M T;  3RPU A;  2J1D G;  3N5L A;  4PK4 A;  5C3J A;  5LYJ E;  2OV9 A;  5AQL B;  5AQP B;  2X9H A;  4DV7 T;  2QYW A;  4JI1 T;  1FEW A;  2KZ7 B;  2MTQ A;  2L9Q A;  1YKE B;  4QX7 B;  5BR8 T;  2ZM6 T;  4CQI A;  1HG2 A;  2KIN B;  3D0T A;  2DNX A;  5JR9 A;  1HNW T;  4G2A A;  5JQG E;  2OA5 A;  5FY0 A;  4CI1 B;  4JV5 T;  4JI4 T;  5HYA A;  2A2F X;  4CN4 A;  2V7I A;  2X51 A;  2QVA A;  3UUX B;  4TZ4 C;  2IIU A;  4EYY R;  4E7Z A;  3UFE A;  3P4S A;  3PUZ F;  4NXN T;  2BZB A;  2CXF A;  2XZE A;  3UQ7 A;  2HPJ A;  4P09 A;  2LOS A;  3PDY A;  4TX5 A;  2WMO A;  3IBP A;  3BQK A;  4DR5 T;  1J5W A;  2YK0 A;  3TLU A;  3SFD A;  3RF1 A;  2K9A A;  4AKL A;  2NTY A;  5FY7 A;  4YT0 A;  3C50 A;  4AQY T;  2BG9 B;  2W63 A;  3HL6 A;  3ZST A;  1HX8 A;  2Q9Q D;  2W0G A;  4ERR A;  1JNR A;  5ABH A;  4PJJ A;  4B3R T;  1Z8U A;  3HKC E;  5KMG P;  2PJQ A;  1FMW A;  5J2T E;  5HAX A;  2YDS A;  4ILB A;  3U78 A;  4A5X A;  1D1B A;  3AEG A;  4LML A;  4V1A v;  4KMC A;  1UUR A;  4U31 A;  2LSI A;  3KVA A;  3E08 A;  4YSY A;  4DV5 T;  2CRB A;  4CZZ B;  3IF8 B;  4O2B E;  2WZH A;  3UTK A;  2CCQ A;  2Q9Q A;  3ZMT B;  2YN6 A;  2JQK A;  3NVO A;  4TV8 E;  3O4X E;  4HFI A;  3N9O A;  4U72 A;  4IE4 A;  4TWD A;  3AA0 B;  2YKS A;  2JMK A;  4XZC A;  1VCS A;  5DQV A;  2HN1 A;  3ZJ1 A;  3AAA B;  4WW0 A;  2H7V C;  4A98 A;  2QRX A;  4H9Q C;  1MMA A;  4X20 E;  5LGT B;  3H37 A;  3PJA A;  4YFS A;  1U5P A;  2IAK A;  2WDR A;  1QUU A;  3HI2 A;  4GK5 E;  2X9Y A;  1D1C A;  4MLK A;  4DV6 T;  2PBI A;  3ZMU B;  4HWH A;  3K3N A;  3MJX A;  4GKJ T;  4AXP A;  3OYZ A;  3P4R A;  4TNW A;  3UU8 A;  3K8P C;  2Y48 B;  3EDV A;  2N2N A;  3FZL B;  4JI0 T;  3NRY A;  2W00 A;  2V7K A;  2V7M A;  4GYR A;  4YTN A;  5AQI B;  3AXJ B;  4DR4 T;  5JRE A;  3VU7 H;  3BQI A;  4MFR A;  1SE7 A;  4O4I E;  1XNR T;  4IL9 A;  4AIS A;  2YDQ A;  4QXC B;  4CXX A;  4DR7 T;  2HH7 A;  1IBM T;  4U2Y A;  1W09 A;  5HCM A;  3JAF A;  5FVK A;  4BJM A;  2XAQ B;  1OED A;  5FL1 A;  2HN2 A;  3GA8 A;  2FBW A;  3PUR A;  1O3X A;  5LHG B;  3RIU A;  4UV8 B;  3FHN A;  2X68 A;  3ZT5 A;  3VR8 A;  2LJL A;  5BMV E;  2M6I A;  1M62 A;  3IHR A;  4QKN A;  1HFA A;  2IC9 A;  2XQ9 A;  1MIY A;  4HFB A;  3OTO T;  3CWZ B;  2ES0 A;  1WR6 A;  2HPL A;  4TUY E;  2RP4 A;  5JDN A;  3OJA A;  5J0Z A;  4LF5 T;  4PJM A;  2XHE B;  4KI0 F;  3EVY A;  2KLQ A;  2HHH T;  2NW9 A;  4PFO A;  3FZK B;  2CBJ A;  2DHR A;  3ZLI A;  2V6Y A;  1BR4 A;  2CBI A;  3ZMZ B;  4DBQ A;  5EK2 A;  2E2A A;  4P0B A;  3L8R A;  3C51 A;  2M6B A;  4YTP A;  2BKP A;  4GIW A;  3A8Y C;  4TWH A;  5LNK A;  2V7L A;  3PUS A;  1HS7 A;  3NBX X;  1SHZ C;  4AKR B;  5LGN B;  2CE7 A;  5M4Y A;  1W0B A;  2V1D B;  3ANW B;  3VKH A;  4HKA A;  4H9O C;  4IE5 A;  4U2Z A;  3JAE A;  1HNX T;  3PV0 F;  5HWX A;  1FMV A;  2WWU A;  4XAX B;  2JQ9 A;  2XM2 A;  3TLV A;  4J2C A;  3AE3 A;  3PUX F;  1S35 A;  4OK0 A;  2K48 A;  2UXB T;  3ZYK A;  3EUH A;  3HKD E;  4LFB T;  4ILU A;  5L3D B;  2X0H A;  4H9R C;  4X62 T;  3JC6 C;  1J1J A;  3O9X A;  5KDM C;  1IJ6 A;  4U33 A;  3H3M A;  4H63 V;  4L9I A;  5DAB A;  2VKH A;  4JI6 T;  2VKD A;  2CXL A;  4YJ2 E;  1MIW A;  1L0V A;  2KMF A;  3HKB E;  2JPF A;  4DV4 T;  3V5S A;  2ZM0 A;  3LDQ B;  2V8S V;  2A3D A;  4K0U A;  2M67 A;  3P4Q A;  2WZI A;  3VHL A;  5L4H A;  2WSS V;  4NUU A;  4ZI7 E;  4X1I E;  3UU5 A;  2WAU A;  1MMD A;  3QB5 A;  2W67 A;  2X9W A;  3F2E A;  4UVC B;  5L4E A;  3O1H A;  2J62 A;  1LKX A;  3SFE A;  1NEK A;  3AA1 B;  3FB2 A;  4OFZ A;  2PG8 A;  2ZM8 A;  2UUA T;  2WU5 A;  3L3P A;  2MBG A;  4ZI2 C;  2ACX A;  3LJC A;  2BBH A;  1D0X A;  4B6X A;  3ZN1 B;  2V5C A;  1HX1 B;  5JH7 E;  3OYX A;  3AE5 A;  2XSB A;  1KFY A;  3CKD A;  5FY1 A;  3EAM A;  3P4P A;  3UU4 A;  4I0U A;  3RRW A;  4A56 A;  4NXM T;  3Q9D A;  3F57 A;  2V6X A;  3H3A A;  3AEF A;  2WDV A;  3PJA J;  2VVS A;  2LRL A;  4LF8 T;  3RGL A;  2E9X B;  4GK0 E;  4Z90 A;  4X1Y E;  1EZ3 A;  2NOX A;  1WLX A;  2AXD S;  4PJL A;  4XBF B;  5ABF A;  2J4G A;  5FNV E;  1R8I A;  3N9Q A;  2FJD A;  4PK6 A;  5HXH A;  4YXD A;  2ZMA A;  4WZX A;  2JQH A;  2E8I A;  1X9B A;  5F5W A;  5LHI B;  2D0T A;  4JI5 T;  2FJA A;  3RKO A;  4EV6 A;  1KNZ A;  3CML A;  4EED A;  2PTF A;  1SA0 E;  1QLB A;  4PAG A;  2JRK A;  2C5I T;  2XUE A;  4EAH A;  4ZXL A;  4UF0 A;  3FZH B;  4WBN E;  5LGU B;  2H89 A;  3AVR A;  1W0A A;  3M65 A;  3KFW X;  2UU9 T;  4PK5 A;  4QX8 B;  4ZS2 A;  1MMN A;  2I6H A;  3KV6 A;  2E9X C;  3OBV E;  3L09 A;  3N9N A;  2CHO A;  4H9S E;  3RI5 A;  5LJN A;  3C64 A;  2XAJ B;  3N2O A;  5EK4 A;  5HCJ A;  3LK4 2;  4IT4 A;  3AE8 A;  2EHO D;  4X64 T;  5AQS B;  5AQO B;  1DU2 A;  3UUB A;  2A72 A;  3O1J A;  4LMK A;  4ZI3 D;  4CI2 B;  5LG3 A;  3ZSS A;  1UX5 A;  1WRD A;  4DUZ T;  2ZM2 A;  1IBK T;  4HFH A;  3B57 A;  4GKK T;  4C90 A;  4HTE A;  5AQV B;  2H7O A;  1BR2 A;  1IZN B;  3UU6 A;  5LCY A;  4DID B;  2W61 A;  3AA7 B;  4AQF A;  3HR0 A;  4U7Y A;  2EHO A;  3ZKR A;  3LBX A;  3BK9 A;  1NWM X;  3QOF A;  5AQM B;  3NZP A;  1HR0 T;  3UUL A;  2W2U A;  5AQR B;  3UQ4 A;  2XQ3 A;  4PW8 A;  4EXT A;  3Q5X A;  2WS3 A;  4JEU B;  2H88 A;  2XQ4 A;  2FUP A;  4FI5 A;  4TN7 B;  1HNZ T;  3ONJ A;  3TLW A;  4EZH A;  3DJB A;  3MKD A;  4DR3 T;  4Z8X A;  4IST A;  4DBR A;  3BQL A;  2MAW A;  4CN6 A;  4U74 A;  4YSX A;  4DV0 T;  4DV2 T;  2XQ7 A;  1LRZ A;  3AA6 B;  4B3T T;  4LMJ A;  2NTX A;  3ZYM A;  2OLT A;  1YKH B;  2XM1 A;  5JR9 B;  1UGO A;  4UR9 A;  3ZMV B;  3P7I A;  5HEJ A;  4ZZB A;  2D9D A;  3UUN A;  2BDE A;  3I9W A;  4BAY B;  5HEG A;  1H7C A;  3MAC A;  1HTJ F;  1FIO A;  3FBZ A;  5DJQ C;  1HCI A;  4AKH A;  5HXR A;  5CB4 E;  2LT3 A;  3ZCJ A;  1YW0 A;  4I55 E;  5DQW A;  5CA0 E;  3RYI E;  5FXZ A;  3PUY F;  2ODU A;  4PJN A;  3RX6 A;  4YTM A;  1IBL T;  1YXR A;  4QHO A;  5JR9 C;  5AQK B;  3I0Q A;  3AEA A;  4WBO A;  3KVB A;  2CMR A;  3A7M A;  1GQE A;  1NEN A;  5FXV A;  3J7Y q;  5FP3 A;  2ACZ A;  3ZMS B;  5LG4 A;  3DTO A;  3NKZ A;  4CN1 A;  4P0A A;  4IE0 A;  4EGW A;  2MOZ A;  2ODV A;  5L47 A;  3VR9 A;  5JDG A;  4QH5 A;  1N34 T;  4AIU A;  4PNI A;  3GMI A;  3HA4 A;  2LOP A;  2Q9Q B;  4UVA B;  4O4L E;  4IDQ A;  4OYK A;  4LF6 T;  4WNK A;  5CGM A;  3KV5 A;  2L3L A;  3U3I A;  2LLY A;  4DMW A;  2EHO C;  3Q5D A;  4O8S A;  4DUY T;  2IHR 1;  4DR6 T;  1WCR A;  3RC3 A;  4KBM B;  5JDF A;  4AI6 A;  3ETV A;  2DCF A;  4IRE A;  3MZK B;  1XMQ T;  4I4T E;  1U4Q A;  4EB6 E;  2X67 A;  2J47 A;  2YOE A;  1MNE A;  3QC9 A;  3PUG A;  4O4J E;  1N32 T;  5JDH A;  1I6Z A;  4H63 H;  3N2G E;  2Q9Q C;  2N9D A;  3LSV A;  4F8H A;  3E0Z A;  3NWI A;  3SWH A;  5HXE A;  4IDP A;  4DV3 T;  2VKO A;  5JRC A;  2NW7 A;  1ZEE A;  1HG5 A;  4LF9 T;  3I0O A;  2QA7 A;  2IW5 B;  3CQC B;  3NRX A;  1MMG A;  2Z6E A;  3AEB A;  4HEA A;  2DLR A;  5AQJ B;  4KUM B;  2LRK A;  3KIN B;  5TAO A;  4I50 E;  4CXY A;  3PE0 A;  4FJO A;  4JEH B;  4AKG A;  4UV9 B;  2RA1 A;  3K3O A;  4IL4 A;  1FJG T;  2P9B A;  2R6G F;  5CA1 E;  3LFM A;  2LSJ A;  2D0U A;  2YDR A;  5KXJ A;  1OED B;  2VK9 A;  4DVD A;  5GON E;  2WDQ A;  1J5E T;  5ABE A;  3GN5 A;  2IUB A;  4BA9 A;  3ETU A;  1ZV4 X;  2XAF B;  3RHW A;  2CM0 A;  4U3C A;  4ANJ A;  2E5V A;  3RYC E;  1KEY A;  2YU2 A;  2WWV A;  2VL0 A;  3RYH E;  4TV9 E;  3MA9 A;  2VKJ A;  4COF A;  1MIV A;  1OWA A;  2CWY A;  4EYU A;  1MND A;  2XY8 B;  3EI0 A;  3P4W A;  3ONL C;  2LM9 A;  1T98 A;  2MPK A;  2VAS A;  3FXE B;  5CFB A;  2XQ8 A;  4HFD A;  4KP3 C;  3EAB A;  1ZKE A;  4JUY A;  1D1A A;  5HXS A;  4NIQ A;  3T1H T;  5LHH B;  2IC6 A;  4HWC A;  1OED C;  2V6Y B;  2VWA A;  4JI2 T;  3O1I A;  1XWM A;  3RIU C;  3F31 A;  4IDN A;  1UCU A;  3AEE A;  4UEL A;  4YHH T;  2VUR A;  2MYS A;  1UUS A;  5FKY A;  5JDQ A;  2L8K A;  4HWD A;  2WCA A;  4OYJ A;  3C4Z A;  5JVD E;  3CPZ A;  4L0R A;  5L3F B;  5IUX A;  3WAK A;  2UXC T;  3G06 A;  3ZPO A;  4X66 T;  2LKH A;  5LB7 B;  4B3S T;  5JDL A;  3B13 A;  4IDZ A;  5IHY A;  1G8X A;  4YLH A;  5HWY A;  3PUA A;  2UXN B;  2BVM A;  5L3E B;  5FYM A;  3LK3 B;  1E1H B;  3AE9 A;  5H6R B;  3C98 B;  5ADX L;  4JI7 T;  2WBL A;  1W9R A;  5LA6 E;  4DV1 T;  2BBJ A;  1XDO A;  3ZCI A;  2V26 A;  2BG9 A;  2LSG A;  3PTR B;  4MHC A;  1US7 B;  3SS1 A;  3R84 B;  3Q5E A;  4ZEY A;  3RRC A;  2XTL A;  2W66 A;  2B76 A;  1T8B A;  2KT9 A;  3CX7 B;  5HEH A;  4IE7 A;  3AAI A;  2UXX B;  4AQG A;  5AQG B;  1CUN A;  3PUW F;  3PU8 A;  5L3B B;  4G63 A;  4ASK A;  2B1E A;  4YJ3 E;  4H9N C;  2DI4 A;  3I9Y A;  5L3C B;  4DMV A;  4H9P C;  1KF6 A;  5ETW A;  4GOU A;  5AQN B;  3T1Y T;  2N1G A;  2WY2 A;  4BJN A;  4LF7 T;  2I59 A;  3CIR A;  3CVR A;  3K3Q C;  3RC8 A;  1KK7 A;  4YSZ A;  5H6Q B;  4HN9 A;  2LHN A;  2VL8 A;  2NP9 A;  3ESL A;  3GWH A;  2ZLY A;  1S94 A;  2DL1 A;  2JQQ A;  1WFD A;  2AE9 A;  3SRZ A;  4HWI B;  2UXD T;  4PFP A;  1V9D A;  5AQQ B;  5IWA T;  4P1N A;  4UXN B;  3E22 E;  3RLF F;  3C4X A;  3CQX C;  5FL0 A;  1Y64 B;  2UUC T;  4QXB B; 
#chains in the Genus database with same CATH homology
 2V1D B;  3ANW B;  3VKH A;  4HKA A;  2YIN A;  3FBL A;  3ZN0 B;  4IGU A;  4QHO A;  5FXW A;  5HXC A;  4ZOL E;  4N78 D;  5JR9 C;  4H9O C;  4IE5 A;  2G0U A;  3MK7 C;  3PU3 A;  3I0Q A;  3I1A A;  4ISS A;  2D5U A;  4WBO A;  4JLE A;  2JJ9 A;  3KVB A;  5HWX A;  2CMR A;  1LVK A;  4QXH B;  1FMV A;  2WWU A;  4XAX B;  4HFV A;  3S4U A;  5FMN A;  5FXV A;  3KDS E;  3J7Y q;  1WYC A;  5FP3 A;  3GN5 B;  4J2C A;  4OK0 A;  1S35 A;  3ZMS B;  5LG4 A;  3DTO A;  2K48 A;  3ZEF B;  4P0A A;  4QWN B;  4ADZ A;  3ZYK A;  2X9X A;  1LVF A;  2JMH A;  3N2K E;  4IE0 A;  4DO0 A;  2VB6 A;  3EUH A;  3HKD E;  2X0L B;  2MOZ A;  2QGS A;  5EZY E;  4ILU A;  5L3D B;  2XAH B;  2ODV A;  4H9R C;  5JDG A;  3JC6 C;  2CA5 A;  3O9X A;  5KDM C;  1IJ6 A;  2GK9 A;  3KBU A;  5LBM A;  4EOZ B;  3ZJ2 A;  3EDU A;  5EK3 A;  1NAF A;  4PNI A;  3V5U A;  3GMI A;  4H63 V;  3HA4 A;  3W15 B;  2NW8 A;  5KX5 E;  5F3J A;  4L9I A;  5DAB A;  2LOP A;  2VKH A;  4UF0 B;  2VKD A;  2Q9Q B;  4UVA B;  2CXL A;  2SPC A;  4YJ2 E;  1MIW A;  3DP7 A;  4ZS3 A;  2KMF A;  3C4W A;  3J9X 1;  4O4L E;  2XAS B;  3HKB E;  2XQY A;  4OYK A;  1OXZ A;  2PFV A;  4WNK A;  2JPF A;  4C91 A;  1G73 A;  3KV5 A;  2L3L A;  3U3I A;  4DMW A;  2EHO C;  2CXD A;  3OKQ A;  5L2L A;  3IEE A;  3RPU A;  4O8S A;  2J1D G;  3N5L A;  3V5S A;  2ZM0 A;  5LXT E;  3HKE E;  2A3D A;  4K0U A;  4PK4 A;  1VOM A;  3RC3 A;  2D2S A;  5LYJ E;  2M67 A;  3UT5 E;  4KBM B;  5JDF A;  3ZC0 A;  4AI6 A;  3VHL A;  2Y6X A;  3ZYL A;  2WSS V;  3ETV A;  4NUU A;  3T8O A;  2DCF A;  4ZI7 E;  4X1I E;  2X9H A;  1AJ3 A;  3MZK B;  4E7S A;  4I4T E;  1FEW A;  3RH3 A;  2WAU A;  1MMD A;  1U4Q A;  3Q5W A;  4EB6 E;  3JC6 D;  2KZ7 B;  2X9W A;  2MTQ A;  3F2E A;  4UVC B;  2L9Q A;  1YKE B;  2X67 A;  4QX7 B;  2CEA A;  2KND A;  1MNE A;  4CQI A;  3QC9 A;  3O1H A;  1HG2 A;  3PUG A;  1LKX A;  4O4J E;  3AA1 B;  2KIN B;  1BR0 A;  3D0T A;  2DNX A;  3FB2 A;  5JR9 A;  1HF8 A;  4OFZ A;  2PG8 A;  4G2A A;  5JDH A;  5JQG E;  2OA5 A;  2ZM8 A;  5FY0 A;  4CI1 B;  1VRB A;  4H63 H;  3N2G E;  5HYA A;  2A2F X;  3SOL A;  2V7I A;  2Q9Q C;  2N9D A;  1UX4 A;  2X51 A;  3UUX B;  4CXW A;  4TZ4 C;  2LSY A;  4EYY R;  3L3P A;  2MBG A;  4ZI2 C;  2V7J A;  4EZ4 A;  4E7Z A;  5LBQ B;  3TKL B;  3E0Z A;  2ACX A;  3UFE A;  3LJC A;  1D0X A;  3SWH A;  5HXE A;  4B6X A;  3ZN1 B;  2BZB A;  2CXF A;  2VKO A;  5JRC A;  2BVL A;  2HPJ A;  4P09 A;  5JH7 E;  3OYX A;  2LOS A;  3LG7 A;  2K5B B;  3PDY A;  2NW7 A;  1ZEE A;  1HG5 A;  3UUM A;  4TX5 A;  3I0O A;  2QA7 A;  2WMO A;  2IW5 B;  2EHO B;  3CQC B;  3BQK A;  3IBP A;  3CKD A;  1MMG A;  3LBX B;  2Z6E A;  3NRX A;  5FY1 A;  4IHJ E;  2WM9 A;  3CQG B;  2YK0 A;  4HEA A;  2DLR A;  4UEM A;  4KUM B;  3KIN B;  5TAO A;  4I50 E;  3R6N A;  3N9P A;  3PE0 A;  4CXY A;  3RRW A;  2K9A A;  4AKL A;  2NTY A;  4FJO A;  4JEH B;  5FY7 A;  4A56 A;  4AKG A;  3WAJ A;  3C50 A;  3ANW A;  4UV9 B;  3Q9D A;  2RA1 A;  2W63 A;  3AAE B;  3HL6 A;  2K24 A;  3F57 A;  3K3O A;  3H3A A;  4CI3 B;  1HX8 A;  2P9B A;  5CA1 E;  2Q9Q D;  2W0G A;  4ERR A;  3LFM A;  2LSJ A;  2D0U A;  2E9X B;  4GK0 E;  4ZI2 D;  4X1Y E;  3RYF E;  5C8Y E;  2X66 A;  4PJJ A;  1EZ3 A;  2KXP B;  5FXX A;  2NOX A;  2VK9 A;  1WLX A;  5M4Y A;  4DVD A;  4UIG A;  4PJL A;  2KWI B;  3HKC E;  4GYS A;  5GON E;  5KMG P;  4XBF B;  4YHJ A;  5FNV E;  2PJQ A;  3GN5 A;  1FMW A;  4BA9 A;  3ETU A;  3N9Q A;  5J2T E;  5HAX A;  4PK6 A;  1ZV4 X;  2XAF B;  4UVB B;  3U78 A;  2CM0 A;  5HXH A;  2ZMA A;  2E8I A;  4IE6 A;  1D1B A;  4L5G A;  5J2U E;  4ANJ A;  4ZHQ E;  3ONX A;  4V1A v;  4O2A E;  3RYC E;  4KMC A;  2YU2 A;  1B7T A;  5E0O A;  5IYZ E;  3RYH E;  5LHI B;  2D0T A;  4TV9 E;  4AQF C;  3MA9 A;  2VKJ A;  2LSI A;  1MIV A;  1OWA A;  2CWY A;  2DWG A;  4EYU A;  3RKO A;  1MND A;  3KVA A;  2H3R A;  3E08 A;  1KNZ A;  3CML A;  4CZZ B;  1SA0 E;  4PAG A;  4NUV A;  2JRK A;  2C5I T;  3IF8 B;  4O2B E;  2XUE A;  5L3G B;  4EAH A;  5LP6 E;  2LM9 A;  1T98 A;  3N9L A;  3UTK A;  4ZI3 C;  4UF0 A;  2CCQ A;  2VAS A;  2Q9Q A;  3FXE B;  4WBN E;  5LGU B;  3ZMT B;  4HE8 A;  5A1L A;  4KP3 C;  1ZKE A;  3AVR A;  3M65 A;  4TV8 E;  3O4X E;  3KFW X;  3N9O A;  4U72 A;  4IE4 A;  4JUY A;  4PK5 A;  4QX8 B;  1D1A A;  3AA0 B;  1D0Z A;  5HXS A;  4ZS2 A;  1MMN A;  2JMK A;  3KV6 A;  2E9X C;  2XAG B;  3OBV E;  3L09 A;  5LHH B;  2IC6 A;  3N9N A;  4XZC A;  5DQV A;  2VWA A;  4H9S E;  3ZJ1 A;  3FXD B;  5LOV E;  1X79 A;  4I43 B;  3AAA B;  4WW0 A;  5LJN A;  2H7V C;  3O1I A;  3C64 A;  1D0Y A;  2XAJ B;  3F31 A;  1UCU A;  3N2O A;  5EK4 A;  3LK4 2;  4H9Q C;  2EHO D;  1MMA A;  4X20 E;  4F6R C;  4UEL A;  5LGT B;  2MYS A;  3H37 A;  2A72 A;  3O1J A;  4YFS A;  1U5P A;  2IAK A;  1QUU A;  4ZI3 D;  2LE8 A;  2C5K T;  3MXZ A;  3HI2 A;  4CI2 B;  5JDQ A;  3KBT A;  4GK5 E;  2L8K A;  2X9Y A;  4OYJ A;  1D1C A;  4MLK A;  3C4Z A;  5JVD E;  3CPZ A;  4L0R A;  1UX5 A;  5L3F B;  1WRD A;  3VKG A;  2PBI A;  2ZM2 A;  3WAK A;  3ZPO A;  3ZMU B;  3K3N A;  3MJX A;  3B57 A;  4AXP A;  5JDL A;  1WYB A;  3P8C D;  3OYZ A;  4MAL A;  4C90 A;  2CWO A;  3A5X A;  3B13 A;  3AB3 B;  3K8P C;  4IDZ A;  4HTE A;  2E9X D;  2H7O A;  2Y48 B;  1BR2 A;  1IZN B;  2N2N A;  3EDV A;  3KV9 A;  1YD8 G;  5LCY A;  3QK6 A;  3AVS A;  4OHF A;  5IHY A;  1G8X A;  2C5J A;  3NRY A;  5JDM A;  2W00 A;  1BR1 A;  2V7K A;  4YLH A;  5HWY A;  3PUA A;  2V7M A;  4GYR A;  2UXN B;  2BVM A;  2W61 A;  3AA7 B;  4AQF A;  3HR0 A;  5L3E B;  2CLY B;  4HGA A;  5JRE A;  2EHO A;  4O4H E;  3VU7 H;  3LBX A;  5FYM A;  3BQI A;  4MFR A;  3LK3 B;  3BK9 A;  1NWM X;  1E1H B;  5H6R B;  3C98 B;  3N9M A;  4MBQ A;  5ADX L;  2WBL A;  4O4I E;  5LA6 E;  3QUJ A;  3NZP A;  1IAP A;  3UUL A;  4QXC B;  1QSD A;  5AFU L;  3ZCI A;  2V26 A;  4CXX A;  2HH7 A;  3CX6 B;  2LSG A;  2DWK A;  2YEV C;  3PTR B;  1ZHC A;  4MHC A;  1US7 B;  3SS1 A;  4PW8 A;  3R84 B;  4EXT A;  3PUQ A;  3Q5X A;  3RRC A;  5J1G A;  4DND A;  4JEU B;  2XTL A;  2LHR A;  2NWB A;  2E9X A;  4BJM A;  2XAQ B;  4FI5 A;  4TN7 B;  2KT9 A;  4AKI A;  3CX7 B;  4EZH A;  3ZC1 A;  4IE7 A;  3DJB A;  3GA8 A;  3AAI A;  2UXX B;  4AQG A;  3PUR A;  3MKD A;  4Z8X A;  1O3X A;  5LHG B;  1CUN A;  4UV8 B;  3FHN A;  4IST A;  4DBR A;  2X68 A;  3BQL A;  4M1P A;  2LJL A;  3PU8 A;  5LJM A;  4U74 A;  5BMV E;  5L3B B;  3LK2 B;  4G63 A;  4ASK A;  4EIW A;  1Z0P A;  2CLY C;  2B1E A;  4YJ3 E;  3IHR A;  4QKN A;  1HFA A;  4H9N C;  1LRZ A;  2IC9 A;  5F8P A;  3AA6 B;  2DI4 A;  3I9Y A;  2LSK A;  1MIY A;  2NTX A;  5L3C B;  3ZYM A;  4DMV A;  4H9P C;  3CWZ B;  1YKH B;  2ES0 A;  5ETW A;  1WR6 A;  2HPL A;  4GOU A;  5JR9 B;  4TUY E;  2RP4 A;  5JDN A;  3OJA A;  2N1G A;  3CX8 B;  4BJN A;  2I59 A;  2WMN A;  3WI3 A;  4PJM A;  3ZMV B;  2XHE B;  3P7I A;  2W62 A;  3EVY A;  2KLQ A;  3CVR A;  3K3Q C;  5LGN B;  3UUN A;  1KK7 A;  3RC8 A;  2NW9 A;  5H6Q B;  4PFO A;  2BDE A;  4HN9 A;  3Q2M A;  3I9W A;  2DHR A;  2LHN A;  3ZLI A;  2C0S A;  4BAY B;  4IIJ E;  5JRC B;  2VL8 A;  2NP9 A;  1BR4 A;  3ESL A;  2KWH A;  3GWH A;  2ZLY A;  1S94 A;  1H7C A;  3MAC A;  1HTJ F;  1FIO A;  3ZMZ B;  4DBQ A;  5EK2 A;  3FBZ A;  4X1K E;  1HCI A;  5DJQ C;  3NZQ A;  4AKH A;  4P0B A;  5HXR A;  2JQQ A;  3SRZ A;  5CB4 E;  2LT3 A;  2YU1 A;  3ZCJ A;  1YW0 A;  4I55 E;  1IJ5 A;  5DQW A;  5CA0 E;  4PFP A;  3C51 A;  1V9D A;  3RYI E;  4UXN B;  3E22 E;  4GIW A;  5FXZ A;  5LNK A;  3C4X A;  2V7L A;  3CQX C;  3KV4 A;  3PUS A;  2ODU A;  1HS7 A;  2Y8D A;  3NBX X;  1Y64 B;  2LEH A;  4PJN A;  3RX6 A;  1SHZ C;  4AKR B;  2CE7 A;  4QXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...