1HR0T

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hr0T00
4DV4T 4B3ST 4OX9T 4YHHT 4JI3T 2HHHT 4LF4T 4JYAT 4LF6T 3T1HT 2UUAT 4GKKT 4LFCT 4LF9T 4LF8T 4DR4T 4B3TT 3OTOT 2UXCT 1HNXT 5LMNT 4DR2T 1N32T 4JI0T 4DV5T 4DV0T 4GKJT 5BR8T 4KHPT 1IBKT 4B3MT 4JI8T 1IBMT 4DR5T 4DR7T 1XMQT 2VQET 4DR6T 2E5LT 4LFBT 1J5ET 4AQYT 4JI6T 4DV3T 4X64T 1HNZT 4JI5T 4LF5T 1XNQT 4X62T 2UXDT 1N33T 1N36T 4K0KT 4DR3T 2UUCT 4DV6T 4JI2T 4X65T 4DV1T 4NXMT 1I94T 4DUZT 4DV2T 2UU9T 5IWAT 1N34T 4JI1T 2UUBT 4B3RT 1FJGT 4DR1T 1XMOT 2F4VT 4X66T 2UXBT 4JV5T 5LMUT 3T1YT 1HNWT 4JI7T 4JI4T 1XNRT 4NXNT 2VQFT 4DUYT 2ZM6T 4LF7T 4DV7T 4LFAT 1IBLT 1HR0T 4YY3T
chains in the Genus database with same CATH superfamily
2CBIA 1ZKEA 2W61A 4Z90A 5JTGA 4CQIA 3J7Yq 3PJAJ 2G0UA 2XQYA 4AKLA 4ZI2D 4PFPA 3WAJA 1I6ZA 2XY8B 4HWDA 1WR6A 4JI0T 2X9WA 4PFOA 3AVSA 5LP6E 4ZI3C 2VQET 1G8XA 3C50A 1U5PA 2XPKA 2CHNA 4EEBA 2DI4A 5C3JA 4UVBB 4X62T 2H7VC 4ANJA 5FP3A 2X0HA 4TV8E 2Q9QD 1I94T 4DUZT 4OYKA 5AQLB 1W09A 3M65A 1MMNA 5HEOA 3RYCE 3RKOA 4KBMB 1MIWA 1HX8A 2V7KA 3ZN0B 3IBPA 4JI7T 4ZHQE 1OEDE 3ZLIA 4AKHA 2XQ7A 4HGAA 2YN6A 4ZS3A 2ZM6T 3SS1A 2LSGA 2WY2A 1BR0A 4GOUA 3K3QC 4DV4T 5LG4A 3MKDA 5JRCB 4O8SA 4P0AA 2ODVA 5AQPB 4EV6A 5AQFB 3I1AA 1UX4A 3ZT7A 5FMNA 5F3JA 3ONJA 3OYZA 5C8YE 4O4JE 5CB4E 2XJ7A 4DV5T 4G63A 3VKHA 4ISTA 2HPJA 4X1IE 3NBXX 2I59A 2W4XA 2VASA 5HXHA 3UFEA 5HYAA 2XAJB 3AEGA 3FXDB 2DWGA 3RIUA 2E5LT 2J1DG 3X1DA 3C4ZA 2H88A 1WYCA 3VR9A 2UUCT 5JDQA 3AEAA 5FNVE 3P4PA 4H9NC 1Y01A 3AEFA 1O3XA 2WQYA 3IF8B 5JREA 2D0UA 3PUGA 2XQ6A 2UXBT 5JDLA 4JV5T 4HFIA 4ZI2C 4BA9A 4MFRA 2RPAA 1W9RA 2LM2A 3G06A 4NXNT 3MA9A 2MBGA 2CA5A 1NWMX 1HG5A 3ETVA 1JNRA 3ZT5A 4LF7T 4YFSA 2CM0A 3MXZA 2DHRA 1HTJF 1VCSA 1Y64B 4DNDA 5ABFA 1ZHCA 5E0OA 5ETWA 1KNRA 4Z91A 4AXPA 1YD8G 2KLQA 3ZPOA 1XWMA 5LBQB 2IMLA 2XASB 3PE0A 1KEYA 4ZEYA 4DR4T 2XM2A 3ZC0A 3OTOT 3RLFF 1E1HB 4HWHA 1OEDB 3L39A 2LEHA 2Q9QC 2V6YB 4V1Av 3LDQB 2VVNA 2WDQA 4EYUA 3AVRA 3TLTA 1ZOYA 2CLYC 2QVAA 4QKNA 5LG3A 2XHEB 4MHCA 3ZMTB 5AQNB 2XQ5A 3J9X1 2JQKA 2V8SV 2DCFA 2LRLA 1LVFA 2V7MA 3QB5A 3S4UA 3LFMA 3JADA 3HR0A 4J2CA 1N34T 4MBQA 2PTFA 2XUEA 2CRBA 1J1JA 5AFUL 2W67A 3EABA 2JIWA 2GK9A 3CIRA 4DVDA 4HWIB 2N9DA 4N78D 4JLEA 4CI1B 3Q2MA 4ILBA 3N5LA 4JI4T 2SPCA 2L3LA 3RC3A 3Q5DA 4AKRB 5LJMA 4DUYT 2XAGB 4AKIA 4LFAT 1IBLT 2VK9A 5JR9A 2B76A 3AAEB 2IC6A 2KMFA 4OX9T 5A1LA 2QYWA 3FHNA 3ZCIA 2NW7A 1SA0E 4O4HE 2EHOB 3UU3A 3U78A 2Y48B 1V9DA 2CE7A 4EGWA 2NW9A 4CXWA 2CXLA 3UT5E 4NIQA 2X0LB 2V6XA 5HEGA 3UUMA 4ZZCA 2BG9C 1T8BA 4L5GA 2HN2A 4IE5A 3SFEA 1B7TA 1MMAA 5AQUB 2ACXA 3RGLA 4AQYT 3MZKB 4PNIA 3JAEA 5DQWA 5HWYA 3EHZA 3KVAA 5J2TE 4DV6T 4FJOA 2WU2A 4YLHA 3SFDA 5KMGP 2E9XB 4GK0E 2V26A 4BJNA 3KVBA 4IGUA 5LHHB 3PV0F 2WDRA 2WZIA 3K3NA 5LMUT 2X68A 1W0BA 1IJ5A 1WFDA 4COFA 3WAKA 2IAKA 1XDOA 3EAMA 3ONXA 1US7B 1NAFA 3VKGA 5L3CB 2HH7A 3D0TA 5LNKA 2FUPA 5LCYA 3T8OA 2LKGA 2UUAT 2YOEA 4CN6A 3AECA 3B13A 3JCFA 1T98A 2E5VA 2PG8A 3PUAA 2UXCT 2V7JA 4U72A 4GKJT 2WMOA 2A2FX 4BJMA 5J2UE 2RA1A 1VCTA 1X79A 4DR5T 4KMCA 2LSYA 2LSKA 2X0YA 2V7LA 3ONLC 3CQCB 2X9XA 4DV3T 4X64T 3PUXF 2VL8A 1N36T 3CWZB 4UF0A 3QNUA 2NTXA 2IHR1 4NXMT 5CGMA 5JQGE 2BS2A 2W2UA 1UK5A 4PK6A 4U7YA 4XAXB 4F6RC 4Z8XA 3N9MA 2CWOA 3IA3A 1KNPA 3RHWA 1WCRA 4KX6A 4PJMA 3AA1B 4HFVA 1XNRT 2EHOD 3FZMB 2NR4A 2P9BA 1D0ZA 4U31A 4YSZA 3RI5A 2N1GA 5AQHB 5DQVA 4WBOA 2VURA 2D9DA 5JH7E 4B3ST 2XAFB 1UCUA 4YHHT 3ZJ1A 2HHHT 3KDSE 3CKDA 4LF6T 3T1HT 5LYJE 3E0ZA 4LFCT 2Y8DA 4UR9A 5LMNT 4AIUA 1HCIA 2FBWA 1KFYA 3TLVA 4GIWA 5JDNA 5J0ZA 3TLSA 4ILAA 4UVCB 5AQIB 4WBNE 4QH1A 4CN1A 2Q9QA 2WWVA 2BVLA 4QX7B 5FY0A 4YT0A 4DBRA 4KHZF 3ZMZB 5LGUB 3TLUA 3AAAB 4JI6T 3ESLA 2FJAA 2YEVC 4ADZA 2KT9A 3CX8B 3W15B 2CMRA 2NP9A 3ZT6A 3AE1A 5HEJA 4NPPA 4YTNA 3PUSA 3CPZA 2V7IA 5HXCA 4F8HA 1HF8A 2QRXA 5IYZE 3UQ4A 3P7IA 5L3GB 3NRXA 3HKCE 2LE8A 3EDUA 4IDPA 1KNZA 4E7ZA 1KF6A 3LJCA 4GYSA 1QSDA 1QUUA 2BS4A 4QHOA 5EK3A 4UXNB 4HKAA 5F8PA 4WZXA 4YY3T 3CVRA 4JI3T 4B6XA 4LF4T 2D5UA 1M7KA 2V5CA 4I4TE 4EB6E 5EZYE 4YSYA 1LVKA 1YQ4A 4LF9T 2XQ8A 3O9XA 4A56A 1QLBA 1HNXT 4DR2T 2W66A 5ABFB 2C5IT 3NRYA 3SWHA 2BBJA 3AEDA 3K3OA 2BG9A 4A5XA 2RP4A 3FXEB 2JRKA 5CFBA 2MTQA 4GYRA 3VRAA 4I43B 1UUSA 3RYHE 4IT4A 4YTMA 1WRDA 3I9WA 4JI5T 2I6HA 2WMNA 2D0TA 5AQJB 3F31A 1LRZA 3UFGA 3PUYF 4IL9A 3ZKRA 4QX8B 4JI1T 4XZCA 3EDVA 3AXJA 5KDMC 4H9QC 2UXXB 4AISA 2XAHB 3JC6D 3A5XA 3PJAA 2UXNB 4ILUA 5AQVB 4I50E 4JEHB 3OYXA 3RX6A 5LA6E 5LXTE 1FEWA 2W63A 2VWAA 4TNWA 4U2YA 4DIDB 1OXZA 4IIJE 4O2BE 4X20E 1MNEA 3UU8A 2K24A 4TV9E 3ZMUB 2JPFA 5L2LA 5JR9B 3Q5EA 2CWYA 4QH5A 3A7MA 3BK9A 1Z0PA 4H9PC 3AA0B 3AEBA 4KP3C 2YINA 3N9QA 4P1NA 3H3AA 4DO0A 1MNDA 4OFZA 1UURA 3M3ZB 4CXYA 3HL6A 4HWFA 2MYSA 3ABVA 1XNQT 2XQ4A 1YKHB 3FZKB 1WYBA 5FY7A 2J47A 2VB6A 2X51A 4IDQA 3AA6B 2MOZA 2BBHA 1T7SA 4X66T 1ZP0A 2NOXA 3VR8A 5F5WA 5ABHA 1HNWT 3RKGA 2H7OA 2ZMAA 2YU1A 5AQKB 1J5WA 3L3PA 3UUXB 4BAYB 3O1JA 2LHRA 5FVKA 5FYMA 2LLYA 4EYYR 2H3RA 4ZZBA 4JYAT 2VL0A 1SHZC 2X9YA 4E7SA 4GKKT 2CHOA 3AA7B 4IE0A 4C91A 2C5KT 4PW8A 4QXCB 1AJ3A 4B3TT 2AE9A 4PJLA 3VRBA 4EAHA 3AAIA 4IREA 2FJDA 2W62A 2J62A 2A9UA 4CXXA 1WLXA 4KI0F 2DWKA 3ZC1A 3E08A 4U33A 2A72A 2YKSA 2IUBA 3N9OA 3PU8A 5KXJA 4H9RC 3JC6C 2IDOB 5AQGB 1NENA 3F57A 2MPKA 3PDYA 4IE7A 3AE4A 3R84B 3DP7A 2LSJA 4JUYA 2CBJA 3HA4A 2WDVA 3V5SA 2Y6XA 4QH4A 3RPUA 4P09A 5FXVA 3PTRB 1X9BA 3ZEFB 4UF0B 3VHLA 5HXRA 4QXBB 2BKOA 5FVLA 1XDPA 4YXDA 3ANWA 4PK4A 4TNVA 4U7IA 3E22E 4JEUB 4G2AA 3BQKA 3CX6B 2VKOA 4DMVA 5FXZA 2X9HA 2XSAA 4U74A 4LMJA 2BG9E 2CPTA 3KV6A 5C2TA 2YK0A 4LF8T 2YDSA 3OVUA 3OBVE 5FL0A 2BKNA 2E2AA 2Z6EA 3EVYA 5ADXL 3KBTA 3ZYLA 5HXEA 2N2NA 5AQQB 5LB7B 4WYVA 2B1EA 4LFBT 4O2AE 3HKDE 3CQXC 5HEHA 3N9LA 4K0KT 3LK2B 2Q9QB 3C98B 4TUYE 4QWNB 3HKEE 2AXDS 1R8IA 5IWAT 2CLYB 3DJBA 3CQGB 3QC9A 3UUNA 2HPLA 2NTYA 1MMDA 1OWAA 1XMOT 2XQ3A 5HEUA 3P8CD 1MIYA 2F4VT 3RQUA 3CMLA 3VU7H 1HX1B 4M1PA 1LKXA 4TWDA 4Q25A 3RQWA 4MALA 5HCJA 2ZM2A 3F2EA 4WW0A 4HEAA 3FBZA 5L47A 2IC9A 2WP9A 3I9YA 1YW0A 1BR4A 3C4XA 3NKZA 1G73A 3AE3A 1XZYA 2LM9A 2LJLA 4OHFA 2IW5B 5AQMB 3EUHA 3FZFB 4TWFA 4TWHA 2I0MA 4LMKA 4EOZB 3KV4A 5L4HA 3KV9A 2PJQA 3LSVA 5LOVE 4NUUA 4AQGA 3N2OA 1IJ6A 3FB2A 1N32T 3P4WA 1IBKT 3Q5XA 3UU6A 1HS7A 5AQOB 3MACA 2V1DB 3SRZA 4AQFC 4C90A 2LOSA 4YHJA 1CUNA 1VOMA 4EZ4A 2M6BA 4IE6A 2BG9B 5IHYA 5CJ5A 2JQQA 1FMWA 2L8KA 3IEEA 5JDGA 3GN5B 2CCQA 1VRBA 5L3EB 4YSXA 2OLTA 3OJAA 4YTPA 2E9XD 4OK0A 1NEKA 1H7CA 2YDQA 3ZJ2A 1KK7A 3AE2A 5EK2A 3RH3A 2ODUA 4O4IE 4P0BA 4UIGA 3DTOA 4X1YE 4AI6A 5CA0E 3HI2A 4UELA 3AXJB 1ZV4X 3KINB 3IHRA 5L3DB 4ISSA 5IUXA 1W0AA 3B57A 1OEDC 3PURA 1BR2A 4ILCA 3UQ7A 3HKBE 2OA5A 3RYFE 2H89A 1IZNB 3AE8A 4K0UA 4HFCA 3QUJA 4EZHA 3RRCA 4KHPT 2XQAA 2R6GF 4GK5E 1IBMT 3Q5WA 1S94A 2HN1A 3N2KE 3ZYKA 3PUWF 3LK3B 3FBLA 3P4SA 2BZBA 3RYIE 2ACZA 5LGTB 1FMVA 2LHNA 1GQEA 4X1KE 4TZ4C 5JDHA 1MMGA 1HFAA 4DV2T 3GN5A 3N9NA 4I0UA 3LBXA 1D1BA 3RRWA 2DNXA 2WM9A 2KZ7B 1SE7A 4HE8A 4KUMB 5H6RB 1BR1A 3PUZF 5JVDE 2EHOC 2WSSV 3GA8A 2WAUA 4CI3B 4DV7T 5JDMA 5AQTB 3QB5K 5L3BB 2M67A 1DU2A 1YXRA 3OKQA 5AQSB 3B5MA 3AE7A 5FXWA 3KBUA 2JMKA 3AE9A 4L0RA 2IIUA 3H3MA 2PBIA 1YKEB 3P50A 3I0QA 3N2GE 2E8IA 3FZLB 4L9IA 3ZMSB 2FJBA 2OV9A 1E7PA 4PJNA 3R6NA 3BQIA 4DR7T 1XMQT 5ABEA 2E9XC 4HFHA 5J1GA 2W00A 3FZHB 5KX5E 1J5ET 3LK42 5FL1A 4UV8B 4IL4A 2NW8A 2UXDT 2L9QA 2KWIB 3NWIA 3ETUA 5M4YA 1L0VA 2VVSA 1YQ3A 2XZEA 4H63V 2K9AA 5TAOA 3SOLA 4U3CA 4CN4A 3T1YT 1D1CA 3K8PC 5JRCA 3ZSTA 2KINB 2MAWA 2VQFT 1D0XA 2XAQB 3KFWX 4WNKA 3MJXA 2D2SA 1S35A 2XSBA 4AKGA 4TX5A 4XBFB 4A97A 3CK6A 3JAFA 4FI5A 3ANWB 3ZYMA 5GONE 1E2AA 4H9OC 4ZS2A 2LKHA 3EI0A 2XTLA 4ZOLE 3RIFA 2DL1A 5BR8T 4U2ZA 2LOPA 2CXDA 4B3MT 4YJ2E 5LGNB 2CXFA 3AB3B 4AQFA 2WU5A 3BQLA 3ZN1B 2LT3A 2QA7A 3ZMVB 4DR3T 2ZM8A 5FXXA 1SUMB 1M62A 5BMVE 1IAPA 4TN7B 1D0YA 1CHUA 4B3RT 1FJGT 4ERRA 2CEAA 5HWXA 3C4WA 3U3IA 3AE5A 4UV9B 4DMWA 4LMLA 2VKHA 4ASKA 5FKYA 3UTKA 2WZHA 2NWBA 3H37A 3L09A 3ZCJA 2JMHA 3O1IA 1FIOA 2YDRA 1HR0T 2K3WA 5LHIB 3GWHA 5ABGA 4HTEA 1OEDA 2V5DA 5LJNA 3KV5A 3UU5A 2V6YA 2BVMA 3TLWA 4HFDA 2M6IA 2C0SA 4EXTA 3AE6A 2WWUA 1U4QA 4EIWA 2KXPB 2VKDA 1HG2A 2LSIA 1UGOA 2J4GA 4DV0T 2K5BB 4DBQA 3O4XE 3P4RA 3O1HA 2C5JA 4ZI7E 3CX7B 4JBWF 3ZSSA 3TKLB 5HXSA 3Q9DA 1WR0A 5DJQC 3RIUC 4DR6T 3C51A 2X66A 2A3DA 5LBMA 5HAXA 3RF1A 2W0GA 3V5UA 2QGSA 4PJJA 2DLRA 2XQ9A 3PU3A 4X65T 3QK6A 2KNDA 4DV1T 4HN9A 4ZI3D 3LG7A 4YJ3E 2UU9T 4X5TA 1UX5A 4IDNA 5L4EA 3I0OA 2BDEA 2YU2A 4QXHB 4HWCA 3N9PA 3WI3A 2JQHA 2BS3A 2EHOA 2WCAA 5DABA 4UEMA 2KSRA 4HFEA 2FJEA 3QOFA 1D1AA 4ZXLA 2JJ9A 5LHGB 2PFVA 1EZ3A 2K48A 4UVAB 4HFBA 5H6QB 5FY1A 5JDFA 3PUVF 3NVOA 2LRKA 3C64A 3GMIA 4IDOA 4A98A 2JQ9A 3RIAA 4JI8T 1T72A 3RC8A 4CI2B 4PK5A 3A8YC 2WS3A 3UU4A 4IDZA 2X67A 4H9SE 2E9XA 3P4QA 3PUQA 4NUVA 5CA1E 2XM1A 1HNZT 3UUBA 4LF5T 2BKPA 1N33T 5AQRB 5L3FB 3NZQA 4JI2T 3OPCA 4O4LE 4OYJA 2WBLA 2WB5A 5EK4A 3UULA 3K1SA 5HCMA 4PAGA 3L8RA 3NZPA 2ES0A 2ZLYA 2UUBT 4IHJE 4DR1T 3AEEA 4I55E 1JNZA 4CZZB 4IE4A 2KWHA 4H63H 4EEDA 1ZEEA 3LBXB 3MK7C 1MIVA 2ZM0A 4MLKA 1Z8UA 5JR9C 2VKJA
chains in the Genus database with same CATH topology
4DV4T 4B3ST 4OX9T 4YHHT 4JI3T 2HHHT 4LF4T 4JYAT 4LF6T 3T1HT 2UUAT 4GKKT 4LFCT 4LF9T 4LF8T 4DR4T 4B3TT 3OTOT 2UXCT 1HNXT 5LMNT 4DR2T 1N32T 4JI0T 4DV5T 4DV0T 4GKJT 5BR8T 4KHPT 1IBKT 4B3MT 4JI8T 1IBMT 4DR5T 4DR7T 1XMQT 2VQET 4DR6T 2E5LT 4LFBT 1J5ET 4AQYT 4JI6T 4DV3T 4X64T 1HNZT 4JI5T 4LF5T 1XNQT 4X62T 2UXDT 1N33T 1N36T 4K0KT 4DR3T 2UUCT 4DV6T 4JI2T 4X65T 4DV1T 4NXMT 1I94T 4DUZT 4DV2T 2UU9T 5IWAT 1N34T 4JI1T 2UUBT 4B3RT 1FJGT 4DR1T 1XMOT 2F4VT 4X66T 2UXBT 4JV5T 5LMUT 3T1YT 1HNWT 4JI7T 4JI4T 1XNRT 4NXNT 2VQFT 4DUYT 2ZM6T 4LF7T 4DV7T 4LFAT 1IBLT 1HR0T 4YY3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 T;  4B3S T;  4OX9 T;  4YHH T;  4JI3 T;  2HHH T;  4LF4 T;  4JYA T;  4LF6 T;  3T1H T;  2UUA T;  4GKK T;  4LFC T;  4LF9 T;  4LF8 T;  4DR4 T;  4B3T T;  3OTO T;  2UXC T;  1HNX T;  5LMN T;  4DR2 T;  1N32 T;  4JI0 T;  4DV5 T;  4DV0 T;  4GKJ T;  5BR8 T;  4KHP T;  1IBK T;  4B3M T;  4JI8 T;  1IBM T;  4DR5 T;  4DR7 T;  1XMQ T;  2VQE T;  4DR6 T;  2E5L T;  4LFB T;  1J5E T;  4AQY T;  4JI6 T;  4DV3 T;  4X64 T;  1HNZ T;  4JI5 T;  4LF5 T;  1XNQ T;  4X62 T;  2UXD T;  1N33 T;  1N36 T;  4K0K T;  4DR3 T;  2UUC T;  4DV6 T;  4JI2 T;  4X65 T;  4DV1 T;  4NXM T;  1I94 T;  4DUZ T;  4DV2 T;  2UU9 T;  5IWA T;  1N34 T;  4JI1 T;  2UUB T;  4B3R T;  1FJG T;  4DR1 T;  1XMO T;  2F4V T;  4X66 T;  2UXB T;  4JV5 T;  5LMU T;  3T1Y T;  1HNW T;  4JI7 T;  4JI4 T;  1XNR T;  4NXN T;  2VQF T;  4DUY T;  2ZM6 T;  4LF7 T;  4DV7 T;  4LFA T;  1IBL T;  1HR0 T;  4YY3 T; 
#chains in the Genus database with same CATH topology
 2CBI A;  1ZKE A;  2W61 A;  4Z90 A;  5JTG A;  4CQI A;  3J7Y q;  3PJA J;  2G0U A;  2XQY A;  4AKL A;  4ZI2 D;  4PFP A;  3WAJ A;  1I6Z A;  2XY8 B;  4HWD A;  1WR6 A;  4JI0 T;  2X9W A;  4PFO A;  3AVS A;  5LP6 E;  4ZI3 C;  2VQE T;  1G8X A;  3C50 A;  1U5P A;  2XPK A;  2CHN A;  4EEB A;  2DI4 A;  5C3J A;  4UVB B;  4X62 T;  2H7V C;  4ANJ A;  5FP3 A;  2X0H A;  4TV8 E;  2Q9Q D;  1I94 T;  4DUZ T;  4OYK A;  5AQL B;  1W09 A;  3M65 A;  1MMN A;  5HEO A;  3RYC E;  3RKO A;  4KBM B;  1MIW A;  1HX8 A;  2V7K A;  3ZN0 B;  3IBP A;  4JI7 T;  4ZHQ E;  1OED E;  3ZLI A;  4AKH A;  2XQ7 A;  4HGA A;  2YN6 A;  4ZS3 A;  2ZM6 T;  3SS1 A;  2LSG A;  2WY2 A;  1BR0 A;  4GOU A;  3K3Q C;  4DV4 T;  5LG4 A;  3MKD A;  5JRC B;  4O8S A;  4P0A A;  2ODV A;  5AQP B;  4EV6 A;  5AQF B;  3I1A A;  1UX4 A;  3ZT7 A;  5FMN A;  5F3J A;  3ONJ A;  3OYZ A;  5C8Y E;  4O4J E;  5CB4 E;  2XJ7 A;  4DV5 T;  4G63 A;  3VKH A;  4IST A;  2HPJ A;  4X1I E;  3NBX X;  2I59 A;  2W4X A;  2VAS A;  5HXH A;  3UFE A;  5HYA A;  2XAJ B;  3AEG A;  3FXD B;  2DWG A;  3RIU A;  2E5L T;  2J1D G;  3X1D A;  3C4Z A;  2H88 A;  1WYC A;  3VR9 A;  2UUC T;  5JDQ A;  3AEA A;  5FNV E;  3P4P A;  4H9N C;  1Y01 A;  3AEF A;  1O3X A;  2WQY A;  3IF8 B;  5JRE A;  2D0U A;  3PUG A;  2XQ6 A;  2UXB T;  5JDL A;  4JV5 T;  4HFI A;  4ZI2 C;  4BA9 A;  4MFR A;  2RPA A;  1W9R A;  2LM2 A;  3G06 A;  4NXN T;  3MA9 A;  2MBG A;  2CA5 A;  1NWM X;  1HG5 A;  3ETV A;  1JNR A;  3ZT5 A;  4LF7 T;  4YFS A;  2CM0 A;  3MXZ A;  2DHR A;  1HTJ F;  1VCS A;  1Y64 B;  4DND A;  5ABF A;  1ZHC A;  5E0O A;  5ETW A;  1KNR A;  4Z91 A;  4AXP A;  1YD8 G;  2KLQ A;  3ZPO A;  1XWM A;  5LBQ B;  2IML A;  2XAS B;  3PE0 A;  1KEY A;  4ZEY A;  4DR4 T;  2XM2 A;  3ZC0 A;  3OTO T;  3RLF F;  1E1H B;  4HWH A;  1OED B;  3L39 A;  2LEH A;  2Q9Q C;  2V6Y B;  4V1A v;  3LDQ B;  2VVN A;  2WDQ A;  4EYU A;  3AVR A;  3TLT A;  1ZOY A;  2CLY C;  2QVA A;  4QKN A;  5LG3 A;  2XHE B;  4MHC A;  3ZMT B;  5AQN B;  2XQ5 A;  3J9X 1;  2JQK A;  2V8S V;  2DCF A;  2LRL A;  1LVF A;  2V7M A;  3QB5 A;  3S4U A;  3LFM A;  3JAD A;  3HR0 A;  4J2C A;  1N34 T;  4MBQ A;  2PTF A;  2XUE A;  2CRB A;  1J1J A;  5AFU L;  2W67 A;  3EAB A;  2JIW A;  2GK9 A;  3CIR A;  4DVD A;  4HWI B;  2N9D A;  4N78 D;  4JLE A;  4CI1 B;  3Q2M A;  4ILB A;  3N5L A;  4JI4 T;  2SPC A;  2L3L A;  3RC3 A;  3Q5D A;  4AKR B;  5LJM A;  4DUY T;  2XAG B;  4AKI A;  4LFA T;  1IBL T;  2VK9 A;  5JR9 A;  2B76 A;  3AAE B;  2IC6 A;  2KMF A;  4OX9 T;  5A1L A;  2QYW A;  3FHN A;  3ZCI A;  2NW7 A;  1SA0 E;  4O4H E;  2EHO B;  3UU3 A;  3U78 A;  2Y48 B;  1V9D A;  2CE7 A;  4EGW A;  2NW9 A;  4CXW A;  2CXL A;  3UT5 E;  4NIQ A;  2X0L B;  2V6X A;  5HEG A;  3UUM A;  4ZZC A;  2BG9 C;  1T8B A;  4L5G A;  2HN2 A;  4IE5 A;  3SFE A;  1B7T A;  1MMA A;  5AQU B;  2ACX A;  3RGL A;  4AQY T;  3MZK B;  4PNI A;  3JAE A;  5DQW A;  5HWY A;  3EHZ A;  3KVA A;  5J2T E;  4DV6 T;  4FJO A;  2WU2 A;  4YLH A;  3SFD A;  5KMG P;  2E9X B;  4GK0 E;  2V26 A;  4BJN A;  3KVB A;  4IGU A;  5LHH B;  3PV0 F;  2WDR A;  2WZI A;  3K3N A;  5LMU T;  2X68 A;  1W0B A;  1IJ5 A;  1WFD A;  4COF A;  3WAK A;  2IAK A;  1XDO A;  3EAM A;  3ONX A;  1US7 B;  1NAF A;  3VKG A;  5L3C B;  2HH7 A;  3D0T A;  5LNK A;  2FUP A;  5LCY A;  3T8O A;  2LKG A;  2UUA T;  2YOE A;  4CN6 A;  3AEC A;  3B13 A;  3JCF A;  1T98 A;  2E5V A;  2PG8 A;  3PUA A;  2UXC T;  2V7J A;  4U72 A;  4GKJ T;  2WMO A;  2A2F X;  4BJM A;  5J2U E;  2RA1 A;  1VCT A;  1X79 A;  4DR5 T;  4KMC A;  2LSY A;  2LSK A;  2X0Y A;  2V7L A;  3ONL C;  3CQC B;  2X9X A;  4DV3 T;  4X64 T;  3PUX F;  2VL8 A;  1N36 T;  3CWZ B;  4UF0 A;  3QNU A;  2NTX A;  2IHR 1;  4NXM T;  5CGM A;  5JQG E;  2BS2 A;  2W2U A;  1UK5 A;  4PK6 A;  4U7Y A;  4XAX B;  4F6R C;  4Z8X A;  3N9M A;  2CWO A;  3IA3 A;  1KNP A;  3RHW A;  1WCR A;  4KX6 A;  4PJM A;  3AA1 B;  4HFV A;  1XNR T;  2EHO D;  3FZM B;  2NR4 A;  2P9B A;  1D0Z A;  4U31 A;  4YSZ A;  3RI5 A;  2N1G A;  5AQH B;  5DQV A;  4WBO A;  2VUR A;  2D9D A;  5JH7 E;  4B3S T;  2XAF B;  1UCU A;  4YHH T;  3ZJ1 A;  2HHH T;  3KDS E;  3CKD A;  4LF6 T;  3T1H T;  5LYJ E;  3E0Z A;  4LFC T;  2Y8D A;  4UR9 A;  5LMN T;  4AIU A;  1HCI A;  2FBW A;  1KFY A;  3TLV A;  4GIW A;  5JDN A;  5J0Z A;  3TLS A;  4ILA A;  4UVC B;  5AQI B;  4WBN E;  4QH1 A;  4CN1 A;  2Q9Q A;  2WWV A;  2BVL A;  4QX7 B;  5FY0 A;  4YT0 A;  4DBR A;  4KHZ F;  3ZMZ B;  5LGU B;  3TLU A;  3AAA B;  4JI6 T;  3ESL A;  2FJA A;  2YEV C;  4ADZ A;  2KT9 A;  3CX8 B;  3W15 B;  2CMR A;  2NP9 A;  3ZT6 A;  3AE1 A;  5HEJ A;  4NPP A;  4YTN A;  3PUS A;  3CPZ A;  2V7I A;  5HXC A;  4F8H A;  1HF8 A;  2QRX A;  5IYZ E;  3UQ4 A;  3P7I A;  5L3G B;  3NRX A;  3HKC E;  2LE8 A;  3EDU A;  4IDP A;  1KNZ A;  4E7Z A;  1KF6 A;  3LJC A;  4GYS A;  1QSD A;  1QUU A;  2BS4 A;  4QHO A;  5EK3 A;  4UXN B;  4HKA A;  5F8P A;  4WZX A;  4YY3 T;  3CVR A;  4JI3 T;  4B6X A;  4LF4 T;  2D5U A;  1M7K A;  2V5C A;  4I4T E;  4EB6 E;  5EZY E;  4YSY A;  1LVK A;  1YQ4 A;  4LF9 T;  2XQ8 A;  3O9X A;  4A56 A;  1QLB A;  1HNX T;  4DR2 T;  2W66 A;  5ABF B;  2C5I T;  3NRY A;  3SWH A;  2BBJ A;  3AED A;  3K3O A;  2BG9 A;  4A5X A;  2RP4 A;  3FXE B;  2JRK A;  5CFB A;  2MTQ A;  4GYR A;  3VRA A;  4I43 B;  1UUS A;  3RYH E;  4IT4 A;  4YTM A;  1WRD A;  3I9W A;  4JI5 T;  2I6H A;  2WMN A;  2D0T A;  5AQJ B;  3F31 A;  1LRZ A;  3UFG A;  3PUY F;  4IL9 A;  3ZKR A;  4QX8 B;  4JI1 T;  4XZC A;  3EDV A;  3AXJ A;  5KDM C;  4H9Q C;  2UXX B;  4AIS A;  2XAH B;  3JC6 D;  3A5X A;  3PJA A;  2UXN B;  4ILU A;  5AQV B;  4I50 E;  4JEH B;  3OYX A;  3RX6 A;  5LA6 E;  5LXT E;  1FEW A;  2W63 A;  2VWA A;  4TNW A;  4U2Y A;  4DID B;  1OXZ A;  4IIJ E;  4O2B E;  4X20 E;  1MNE A;  3UU8 A;  2K24 A;  4TV9 E;  3ZMU B;  2JPF A;  5L2L A;  5JR9 B;  3Q5E A;  2CWY A;  4QH5 A;  3A7M A;  3BK9 A;  1Z0P A;  4H9P C;  3AA0 B;  3AEB A;  4KP3 C;  2YIN A;  3N9Q A;  4P1N A;  3H3A A;  4DO0 A;  1MND A;  4OFZ A;  1UUR A;  3M3Z B;  4CXY A;  3HL6 A;  4HWF A;  2MYS A;  3ABV A;  1XNQ T;  2XQ4 A;  1YKH B;  3FZK B;  1WYB A;  5FY7 A;  2J47 A;  2VB6 A;  2X51 A;  4IDQ A;  3AA6 B;  2MOZ A;  2BBH A;  1T7S A;  4X66 T;  1ZP0 A;  2NOX A;  3VR8 A;  5F5W A;  5ABH A;  1HNW T;  3RKG A;  2H7O A;  2ZMA A;  2YU1 A;  5AQK B;  1J5W A;  3L3P A;  3UUX B;  4BAY B;  3O1J A;  2LHR A;  5FVK A;  5FYM A;  2LLY A;  4EYY R;  2H3R A;  4ZZB A;  4JYA T;  2VL0 A;  1SHZ C;  2X9Y A;  4E7S A;  4GKK T;  2CHO A;  3AA7 B;  4IE0 A;  4C91 A;  2C5K T;  4PW8 A;  4QXC B;  1AJ3 A;  4B3T T;  2AE9 A;  4PJL A;  3VRB A;  4EAH A;  3AAI A;  4IRE A;  2FJD A;  2W62 A;  2J62 A;  2A9U A;  4CXX A;  1WLX A;  4KI0 F;  2DWK A;  3ZC1 A;  3E08 A;  4U33 A;  2A72 A;  2YKS A;  2IUB A;  3N9O A;  3PU8 A;  5KXJ A;  4H9R C;  3JC6 C;  2IDO B;  5AQG B;  1NEN A;  3F57 A;  2MPK A;  3PDY A;  4IE7 A;  3AE4 A;  3R84 B;  3DP7 A;  2LSJ A;  4JUY A;  2CBJ A;  3HA4 A;  2WDV A;  3V5S A;  2Y6X A;  4QH4 A;  3RPU A;  4P09 A;  5FXV A;  3PTR B;  1X9B A;  3ZEF B;  4UF0 B;  3VHL A;  5HXR A;  4QXB B;  2BKO A;  5FVL A;  1XDP A;  4YXD A;  3ANW A;  4PK4 A;  4TNV A;  4U7I A;  3E22 E;  4JEU B;  4G2A A;  3BQK A;  3CX6 B;  2VKO A;  4DMV A;  5FXZ A;  2X9H A;  2XSA A;  4U74 A;  4LMJ A;  2BG9 E;  2CPT A;  3KV6 A;  5C2T A;  2YK0 A;  4LF8 T;  2YDS A;  3OVU A;  3OBV E;  5FL0 A;  2BKN A;  2E2A A;  2Z6E A;  3EVY A;  5ADX L;  3KBT A;  3ZYL A;  5HXE A;  2N2N A;  5AQQ B;  5LB7 B;  4WYV A;  2B1E A;  4LFB T;  4O2A E;  3HKD E;  3CQX C;  5HEH A;  3N9L A;  4K0K T;  3LK2 B;  2Q9Q B;  3C98 B;  4TUY E;  4QWN B;  3HKE E;  2AXD S;  1R8I A;  5IWA T;  2CLY B;  3DJB A;  3CQG B;  3QC9 A;  3UUN A;  2HPL A;  2NTY A;  1MMD A;  1OWA A;  1XMO T;  2XQ3 A;  5HEU A;  3P8C D;  1MIY A;  2F4V T;  3RQU A;  3CML A;  3VU7 H;  1HX1 B;  4M1P A;  1LKX A;  4TWD A;  4Q25 A;  3RQW A;  4MAL A;  5HCJ A;  2ZM2 A;  3F2E A;  4WW0 A;  4HEA A;  3FBZ A;  5L47 A;  2IC9 A;  2WP9 A;  3I9Y A;  1YW0 A;  1BR4 A;  3C4X A;  3NKZ A;  1G73 A;  3AE3 A;  1XZY A;  2LM9 A;  2LJL A;  4OHF A;  2IW5 B;  5AQM B;  3EUH A;  3FZF B;  4TWF A;  4TWH A;  2I0M A;  4LMK A;  4EOZ B;  3KV4 A;  5L4H A;  3KV9 A;  2PJQ A;  3LSV A;  5LOV E;  4NUU A;  4AQG A;  3N2O A;  1IJ6 A;  3FB2 A;  1N32 T;  3P4W A;  1IBK T;  3Q5X A;  3UU6 A;  1HS7 A;  5AQO B;  3MAC A;  2V1D B;  3SRZ A;  4AQF C;  4C90 A;  2LOS A;  4YHJ A;  1CUN A;  1VOM A;  4EZ4 A;  2M6B A;  4IE6 A;  2BG9 B;  5IHY A;  5CJ5 A;  2JQQ A;  1FMW A;  2L8K A;  3IEE A;  5JDG A;  3GN5 B;  2CCQ A;  1VRB A;  5L3E B;  4YSX A;  2OLT A;  3OJA A;  4YTP A;  2E9X D;  4OK0 A;  1NEK A;  1H7C A;  2YDQ A;  3ZJ2 A;  1KK7 A;  3AE2 A;  5EK2 A;  3RH3 A;  2ODU A;  4O4I E;  4P0B A;  4UIG A;  3DTO A;  4X1Y E;  4AI6 A;  5CA0 E;  3HI2 A;  4UEL A;  3AXJ B;  1ZV4 X;  3KIN B;  3IHR A;  5L3D B;  4ISS A;  5IUX A;  1W0A A;  3B57 A;  1OED C;  3PUR A;  1BR2 A;  4ILC A;  3UQ7 A;  3HKB E;  2OA5 A;  3RYF E;  2H89 A;  1IZN B;  3AE8 A;  4K0U A;  4HFC A;  3QUJ A;  4EZH A;  3RRC A;  4KHP T;  2XQA A;  2R6G F;  4GK5 E;  1IBM T;  3Q5W A;  1S94 A;  2HN1 A;  3N2K E;  3ZYK A;  3PUW F;  3LK3 B;  3FBL A;  3P4S A;  2BZB A;  3RYI E;  2ACZ A;  5LGT B;  1FMV A;  2LHN A;  1GQE A;  4X1K E;  4TZ4 C;  5JDH A;  1MMG A;  1HFA A;  4DV2 T;  3GN5 A;  3N9N A;  4I0U A;  3LBX A;  1D1B A;  3RRW A;  2DNX A;  2WM9 A;  2KZ7 B;  1SE7 A;  4HE8 A;  4KUM B;  5H6R B;  1BR1 A;  3PUZ F;  5JVD E;  2EHO C;  2WSS V;  3GA8 A;  2WAU A;  4CI3 B;  4DV7 T;  5JDM A;  5AQT B;  3QB5 K;  5L3B B;  2M67 A;  1DU2 A;  1YXR A;  3OKQ A;  5AQS B;  3B5M A;  3AE7 A;  5FXW A;  3KBU A;  2JMK A;  3AE9 A;  4L0R A;  2IIU A;  3H3M A;  2PBI A;  1YKE B;  3P50 A;  3I0Q A;  3N2G E;  2E8I A;  3FZL B;  4L9I A;  3ZMS B;  2FJB A;  2OV9 A;  1E7P A;  4PJN A;  3R6N A;  3BQI A;  4DR7 T;  1XMQ T;  5ABE A;  2E9X C;  4HFH A;  5J1G A;  2W00 A;  3FZH B;  5KX5 E;  1J5E T;  3LK4 2;  5FL1 A;  4UV8 B;  4IL4 A;  2NW8 A;  2UXD T;  2L9Q A;  2KWI B;  3NWI A;  3ETU A;  5M4Y A;  1L0V A;  2VVS A;  1YQ3 A;  2XZE A;  4H63 V;  2K9A A;  5TAO A;  3SOL A;  4U3C A;  4CN4 A;  3T1Y T;  1D1C A;  3K8P C;  5JRC A;  3ZST A;  2KIN B;  2MAW A;  2VQF T;  1D0X A;  2XAQ B;  3KFW X;  4WNK A;  3MJX A;  2D2S A;  1S35 A;  2XSB A;  4AKG A;  4TX5 A;  4XBF B;  4A97 A;  3CK6 A;  3JAF A;  4FI5 A;  3ANW B;  3ZYM A;  5GON E;  1E2A A;  4H9O C;  4ZS2 A;  2LKH A;  3EI0 A;  2XTL A;  4ZOL E;  3RIF A;  2DL1 A;  5BR8 T;  4U2Z A;  2LOP A;  2CXD A;  4B3M T;  4YJ2 E;  5LGN B;  2CXF A;  3AB3 B;  4AQF A;  2WU5 A;  3BQL A;  3ZN1 B;  2LT3 A;  2QA7 A;  3ZMV B;  4DR3 T;  2ZM8 A;  5FXX A;  1SUM B;  1M62 A;  5BMV E;  1IAP A;  4TN7 B;  1D0Y A;  1CHU A;  4B3R T;  1FJG T;  4ERR A;  2CEA A;  5HWX A;  3C4W A;  3U3I A;  3AE5 A;  4UV9 B;  4DMW A;  4LML A;  2VKH A;  4ASK A;  5FKY A;  3UTK A;  2WZH A;  2NWB A;  3H37 A;  3L09 A;  3ZCJ A;  2JMH A;  3O1I A;  1FIO A;  2YDR A;  1HR0 T;  2K3W A;  5LHI B;  3GWH A;  5ABG A;  4HTE A;  1OED A;  2V5D A;  5LJN A;  3KV5 A;  3UU5 A;  2V6Y A;  2BVM A;  3TLW A;  4HFD A;  2M6I A;  2C0S A;  4EXT A;  3AE6 A;  2WWU A;  1U4Q A;  4EIW A;  2KXP B;  2VKD A;  1HG2 A;  2LSI A;  1UGO A;  2J4G A;  4DV0 T;  2K5B B;  4DBQ A;  3O4X E;  3P4R A;  3O1H A;  2C5J A;  4ZI7 E;  3CX7 B;  4JBW F;  3ZSS A;  3TKL B;  5HXS A;  3Q9D A;  1WR0 A;  5DJQ C;  3RIU C;  4DR6 T;  3C51 A;  2X66 A;  2A3D A;  5LBM A;  5HAX A;  3RF1 A;  2W0G A;  3V5U A;  2QGS A;  4PJJ A;  2DLR A;  2XQ9 A;  3PU3 A;  4X65 T;  3QK6 A;  2KND A;  4DV1 T;  4HN9 A;  4ZI3 D;  3LG7 A;  4YJ3 E;  2UU9 T;  4X5T A;  1UX5 A;  4IDN A;  5L4E A;  3I0O A;  2BDE A;  2YU2 A;  4QXH B;  4HWC A;  3N9P A;  3WI3 A;  2JQH A;  2BS3 A;  2EHO A;  2WCA A;  5DAB A;  4UEM A;  2KSR A;  4HFE A;  2FJE A;  3QOF A;  1D1A A;  4ZXL A;  2JJ9 A;  5LHG B;  2PFV A;  1EZ3 A;  2K48 A;  4UVA B;  4HFB A;  5H6Q B;  5FY1 A;  5JDF A;  3PUV F;  3NVO A;  2LRK A;  3C64 A;  3GMI A;  4IDO A;  4A98 A;  2JQ9 A;  3RIA A;  4JI8 T;  1T72 A;  3RC8 A;  4CI2 B;  4PK5 A;  3A8Y C;  2WS3 A;  3UU4 A;  4IDZ A;  2X67 A;  4H9S E;  2E9X A;  3P4Q A;  3PUQ A;  4NUV A;  5CA1 E;  2XM1 A;  1HNZ T;  3UUB A;  4LF5 T;  2BKP A;  1N33 T;  5AQR B;  5L3F B;  3NZQ A;  4JI2 T;  3OPC A;  4O4L E;  4OYJ A;  2WBL A;  2WB5 A;  5EK4 A;  3UUL A;  3K1S A;  5HCM A;  4PAG A;  3L8R A;  3NZP A;  2ES0 A;  2ZLY A;  2UUB T;  4IHJ E;  4DR1 T;  3AEE A;  4I55 E;  1JNZ A;  4CZZ B;  4IE4 A;  2KWH A;  4H63 H;  4EED A;  1ZEE A;  3LBX B;  3MK7 C;  1MIV A;  2ZM0 A;  4MLK A;  1Z8U A;  5JR9 C;  2VKJ A; 
#chains in the Genus database with same CATH homology
 4DV4 T;  4B3S T;  4OX9 T;  4YHH T;  4JI3 T;  2HHH T;  4LF4 T;  4JYA T;  4LF6 T;  3T1H T;  2UUA T;  4GKK T;  4LFC T;  4LF9 T;  4LF8 T;  4DR4 T;  4B3T T;  3OTO T;  2UXC T;  1HNX T;  5LMN T;  4DR2 T;  1N32 T;  4JI0 T;  4DV5 T;  4DV0 T;  4GKJ T;  5BR8 T;  4KHP T;  1IBK T;  4B3M T;  4JI8 T;  1IBM T;  4DR5 T;  4DR7 T;  1XMQ T;  2VQE T;  4DR6 T;  2E5L T;  4LFB T;  1J5E T;  4AQY T;  4JI6 T;  4DV3 T;  4X64 T;  1HNZ T;  4JI5 T;  4LF5 T;  1XNQ T;  4X62 T;  2UXD T;  1N33 T;  1N36 T;  4K0K T;  4DR3 T;  2UUC T;  4DV6 T;  4JI2 T;  4X65 T;  4DV1 T;  4NXM T;  1I94 T;  4DUZ T;  4DV2 T;  2UU9 T;  5IWA T;  1N34 T;  4JI1 T;  2UUB T;  4B3R T;  1FJG T;  4DR1 T;  1XMO T;  2F4V T;  4X66 T;  2UXB T;  4JV5 T;  5LMU T;  3T1Y T;  1HNW T;  4JI7 T;  4JI4 T;  1XNR T;  4NXN T;  2VQF T;  4DUY T;  2ZM6 T;  4LF7 T;  4DV7 T;  4LFA T;  1IBL T;  1HR0 T;  4YY3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...