1HR0T

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hr0T00
4LF6T 4B3TT 4X62T 3T1HT 1N32T 2ZM6T 4DUYT 4LF5T 4DV7T 4X64T 4JI1T 1HNWT 4AQYT 5LMNT 4DV3T 4DV1T 4DR2T 2UU9T 4B3MT 4JI0T 4GKJT 4JI2T 4LFAT 1I94T 4LF7T 4YY3T 4JI6T 2VQET 4GKKT 4DR5T 4JI7T 4DR6T 4JV5T 4LFBT 2UXDT 4JI4T 4B3ST 4JI8T 2VQFT 1J5ET 4YHHT 2UXCT 1XMQT 4DR7T 5IWAT 1HR0T 4NXNT 3T1YT 1IBLT 1N34T 4DV4T 4DV6T 2UXBT 4JI5T 1IBKT 4LF8T 1HNZT 4K0KT 4DR1T 4NXMT 1HNXT 2F4VT 4JYAT 4KHPT 1N36T 4JI3T 1XMOT 4DV5T 5BR8T 1N33T 4OX9T 1FJGT 5LMUT 4DV2T 3OTOT 4DV0T 4DR3T 2E5LT 4X66T 4LF4T 4X65T 4B3RT 2UUCT 1IBMT 2HHHT 1XNRT 4DR4T 4LFCT 1XNQT 4LF9T 2UUBT 2UUAT 4DUZT
chains in the Genus database with same CATH superfamily
2WMNA 3N2OA 3VR8A 1M62A 3PUVF 3AE6A 3CPZA 3FZKB 4ILBA 5JDMA 5JH7E 2DNXA 3C4WA 2Y48B 5CA0E 5JDQA 4QWNB 3JAEA 5LGUB 3T1HT 1XZYA 4JLEA 3ZMUB 3SFEA 3Q2MA 2ZM0A 2IW5B 4LMKA 5ABEA 3AE8A 4LF5T 1B7TA 1OWAA 2X0HA 3I0QA 4H9QC 2XQAA 3JC6D 2H7VC 4HFVA 1SHZC 4FI5A 5LCYA 3P50A 1HG5A 4IHJE 4V1Av 4X64T 2VKOA 1CHUA 1LRZA 4YHJA 3KV6A 5EK3A 5AQSB 4EV6A 3VRBA 2V6YA 4EAHA 3EHZA 4EYUA 3JCFA 4IE7A 4U33A 1LVKA 1WLXA 3HKEE 1UUSA 5AQTB 4ADZA 2BVLA 3ZEFB 4HFCA 4IDZA 2EHOD 2I6HA 3N9NA 4H9OC 4IREA 3RI5A 3KV5A 2KWHA 2Q9QB 2WBLA 3PE0A 4UXNB 3ONJA 4ZXLA 3AE4A 4GKJT 1VCTA 5FNVE 3ZCIA 3I0OA 2K48A 3N9MA 4IE6A 5H6QB 4I43B 5HWXA 1I94T 4LFAT 4HGAA 4JI6T 5HXRA 3N9QA 5FXZA 5L4HA 4DR7T 4DR6T 2UXDT 4JV5T 4LFBT 5LYJE 2FBWA 4JI4T 4OFZA 3CX6B 5AQJB 2XQ8A 4MALA 4WNKA 2SPCA 2BS4A 2FUPA 2BBHA 3KVBA 4ANJA 1J5ET 2MOZA 2IUBA 1Y01A 2VL0A 4QX7B 3NZQA 2ODUA 2W61A 2XJ7A 3OKQA 4HFIA 3ZSTA 2HN1A 2LT3A 3ZLIA 3AE5A 1VOMA 3L39A 4HKAA 4JBWF 5JVDE 1FMVA 4K0UA 4EEDA 2W0GA 4KX6A 3J9X1 3UU6A 1IAPA 3T1YT 1OXZA 3C98B 3UUMA 3QC9A 2E9XA 2PJQA 2WZIA 3FHNA 5F8PA 1S94A 2C5JA 2X9HA 2D2SA 4JI5T 3NWIA 3ZT5A 2H3RA 3VHLA 1V9DA 2W4XA 3H3MA 4HFEA 2BG9C 1HX8A 4IGUA 1HNZT 5FMNA 4O4LE 1QUUA 2YKSA 3ANWA 4IE4A 5CA1E 1X9BA 5JRCA 5C2TA 2R6GF 3UU5A 3CQXC 4PNIA 2NWBA 4TWDA 4ZZCA 2W66A 5KDMC 2XASB 3ZPOA 5L4EA 1HNXT 3I1AA 3RIAA 4YXDA 1ZP0A 5JR9A 4YSXA 4PK5A 4CQIA 4MLKA 4H9SE 1J5WA 2BVMA 4QX8B 4X20E 3F31A 2XM1A 4O4JE 2V7JA 5LNKA 4ZI3C 2PTFA 4EEBA 4JI3T 4HTEA 1SUMB 3MACA 3ZYMA 3P4SA 2BZBA 3N5LA 3KV4A 3NBXX 2V7MA 4AKIA 2J1DG 4AKLA 1Z0PA 1BR2A 3AA6B 1SA0E 4UEMA 2BKPA 1UURA 3ETVA 2QYWA 3OYZA 4O4IE 4UV8B 3VU7H 4DUZT 4P0AA 3B57A 2C5IT 1UX5A 3AEFA 2MAWA 1MNDA 1WYCA 5FVLA 1UCUA 2BKNA 3PU3A 4Z91A 4YT0A 3ZT7A 3IA3A 2FJEA 2IMLA 1J1JA 3ZMSB 4MBQA 5LMUT 4HFHA 4JEHB 5EK4A 4DV0T 2NR4A 3V5UA 3UUXB 1HFAA 2LSJA 1NEKA 5LG3A 4UIGA 2HPLA 2VWAA 3EDUA 2DLRA 1MNEA 2IAKA 3PUXF 4GYRA 2KT9A 4X1IE 5FL1A 3O9XA 1MMGA 2NOXA 2XY8B 2PFVA 3EDVA 5AQMB 3R6NA 2YEVC 1KEYA 4HE8A 4EZ4A 3PJAA 1ZHCA 4ZI2C 2V8SV 5JQGE 5J2TE 1BR4A 2A72A 3CX7B 3M3ZB 4GOUA 2DHRA 5HEJA 2XUEA 1XNQT 4DR4T 2W67A 3AA7B 2JQHA 3JC6C 4MHCA 2UUBT 4LF9T 1KK7A 3RHWA 4A56A 5AQFB 4HN9A 5GONE 3RIUA 3VKGA 4X1KE 5IUXA 2XQ7A 2BDEA 1VCSA 1US7B 3PDYA 4B3TT 3JAFA 4PFOA 2XPKA 2V7KA 1DU2A 3GN5A 3WAJA 5ETWA 3RGLA 2FJAA 2CM0A 4U2ZA 3AB3B 3OBVE 2E9XC 5A1LA 4NUVA 2J4GA 3RYCE 2FJBA 4CI1B 5LMNT 4WYVA 5LA6E 4HWIB 4DV1T 2JPFA 2QVAA 3L3PA 2LEHA 3N9OA 5F3JA 1WFDA 3LBXA 3H3AA 3AVSA 1YXRA 3K3QC 4P09A 3HKCE 3RRWA 4B3MT 2I0MA 1HCIA 3ONXA 4U31A 4JI0T 5L3CB 1UK5A 1SE7A 2PG8A 3AE3A 4UF0A 2LE8A 4O2BE 3NZPA 2E9XB 3QK6A 4UVAB 3UFGA 5FVKA 2H88A 2KZ7B 2LKHA 2MBGA 3R84B 2X68A 3ZN0B 4LF7T 2NW9A 4ZEYA 5LHGB 4PK6A 1QSDA 1IZNB 3IHRA 4C91A 3LK3B 4GKKT 4JI7T 3KVAA 3ONLC 3TLUA 4QKNA 3ZC1A 1ZOYA 5HEHA 4DBQA 2J47A 4B3ST 3CMLA 2VQFT 4EYYR 2K3WA 5LXTE 3HKBE 4E7ZA 4DBRA 5FY1A 1E7PA 2BG9E 2CXLA 3DJBA 3UU8A 2K5BB 3GN5B 3A7MA 2V7LA 3RKOA 5AQKB 2K9AA 4YTMA 4DMVA 2C0SA 3V5SA 3GMIA 1MIYA 3D0TA 3PU8A 1MMDA 3QOFA 2KXPB 2WDQA 4CI3B 1H7CA 1N34T 3LFMA 4F8HA 1D1AA 4MFRA 4EXTA 5EZYE 2LM2A 3BQLA 4AI6A 4HEAA 2I59A 3C51A 1GQEA 2M6BA 4QXHB 3RPUA 1IBKT 2CLYC 2L3LA 4LF8T 3CIRA 1KNZA 3ZMTB 3BQKA 4DMWA 3VRAA 3NKZA 4DR1T 3IEEA 2UXNB 2JIWA 4TN7B 5LHIB 4NXMT 4BAYB 3I9YA 3MA9A 1T98A 1FIOA 4IDNA 4O4HE 2F4VT 3Q5WA 2CXDA 1YD8G 3SFDA 4B3RT 4JYAT 2CWOA 2Q9QC 1FEWA 2JMHA 4XZCA 1KNRA 1T8BA 4ISTA 1N36T 2BG9A 4OYJA 3X1DA 2QRXA 4I4TE 4ZOLE 3ZC0A 3VKHA 3DTOA 3LK42 2HH7A 4IDQA 1D0ZA 2W00A 3CQCB 4O2AE 3SOLA 4KP3C 3SWHA 5JTGA 3LBXB 3LDQB 2OLTA 2WS3A 4IL9A 4U72A 1T72A 4QHOA 4ZS3A 4BJMA 4JI1T 3FB2A 4PJNA 4TUYE 2XQ6A 4Z8XA 2LKGA 3OYXA 5AQVB 1XMQT 2ES0A 2RP4A 2VASA 4ILCA 4EB6E 4J2CA 1ZKEA 2V5DA 4IT4A 2RPAA 5CGMA 3KV9A 3QNUA 4DR3T 2D0UA 4BA9A 3TLSA 4A98A 3MZKB 4X66T 2N9DA 5L3FB 3VR9A 4PJLA 4LF4T 1ZV4X 2LLYA 2P9BA 2WAUA 2XQ3A 4L5GA 2WWVA 2FJDA 4CN6A 4LF6T 1EZ3A 2WDRA 4YJ2E 3QUJA 2XSAA 4ISSA 4CN1A 2UUCT 4TNVA 3PUZF 2YU1A 3RH3A 5HEGA 2D5UA 2XAFB 2BBJA 2JJ9A 3CQGB 3NVOA 2VVSA 3AE1A 3UUBA 4Z90A 5LHHB 3U78A 5E0OA 4IIJE 5AQOB 3P8CD 2YK0A 5LB7B 4QH5A 2KWIB 2XQ4A 5HCMA 3PUAA 1BR1A 3RIUC 1E2AA 1MMAA 1W9RA 4TNWA 4X62T 2WY2A 4U74A 2B1EA 2JQ9A 2IHR1 2A3DA 2LJLA 3EABA 3FZFB 2ZM6T 1MMNA 1OEDB 3C50A 2KMFA 3CWZB 2XM2A 3NRYA 2L8KA 1KNPA 3UQ7A 2Z6EA 5HAXA 5ABFA 2NW8A 4IDPA 4OK0A 4DV3T 3AEDA 3FBLA 2M67A 3EUHA 5HWYA 4HWCA 3ZCJA 3QB5K 5FY0A 1OEDE 3RQWA 4ASKA 4XAXB 4JEUB 5AQUB 2X66A 4DR2T 2XQ5A 5J2UE 4DO0A 2MTQA 3RF1A 3ZN1B 5LBMA 2E5LT 3OJAA 3GWHA 3N9PA 5DQVA 1ZEEA 3MKDA 3P4PA 4PFPA 4U7IA 3HA4A 4B6XA 3AA1B 1HS7A 2CEAA 2CHNA 5HEOA 3KINB 1O3XA 2EHOB 2XQ9A 2MYSA 3C4XA 4GK0E 4OHFA 5FXWA 2V1DB 3OPCA 3SRZA 4KUMB 4COFA 3PUQA 3UT5E 2YDRA 4DVDA 2VQET 2CPTA 3AE7A 3C64A 2LSGA 4E7SA 3LJCA 5L47A 4U2YA 3RLFF 1QLBA 3O1HA 2WU5A 4UELA 3PUYF 2NP9A 1L0VA 2V6XA 3UULA 4JI8T 1M7KA 1MIWA 5ADXL 2XAJB 3ZT6A 5FKYA 3RIFA 1R8IA 1W09A 3KBUA 2GK9A 3N9LA 5FY7A 3F57A 2MPKA 4HWHA 2YOEA 3FBZA 3O4XE 3IF8B 4H9PC 3O1IA 3Q5EA 4HWDA 2YDSA 3T8OA 2X9XA 3AEAA 3ZJ2A 5IWAT 4YSYA 1HR0T 1CUNA 2RA1A 4IE5A 3SS1A 4O8SA 5HYAA 3CX8B 5L3GB 5AFUL 5FXXA 2WZHA 1I6ZA 1LVFA 3RC3A 2VB6A 3K3OA 4GK5E 5ABFB 2N1GA 1YKEB 3K3NA 4QH4A 4EZHA 2VURA 4KHZF 5J1GA 4Q25A 4DV6T 3RX6A 4IE0A 5H6RB 4CXXA 3C4ZA 3MK7C 2XQYA 2V26A 5ABHA 5JDHA 1HTJF 2E5VA 3KDSE 2X67A 2DI4A 2KINB 2VVNA 3AVRA 3B13A 2LHRA 3FZHB 5HCJA 2WCAA 4A97A 3PURA 4QXCB 4UR9A 4F6RC 4HWFA 4LMJA 1KFYA 3AE2A 2CXFA 3W15B 1U4QA 3ESLA 4U7YA 5LBQB 2H7OA 4HFDA 4AKHA 2A2FX 4WBOA 5FYMA 5LP6E 2N2NA 3ZSSA 5CFBA 1D0XA 1X79A 3EVYA 3U3IA 5CJ5A 2UXXB 2WM9A 2BS3A 4ILAA 3AEBA 4CXWA 5L3DB 3EI0A 2JMKA 3A8YC 4N78D 1NAFA 2CRBA 5AQQB 2VKJA 5LJNA 3B5MA 3HI2A 5JDGA 5KX5E 3K1SA 3AECA 2ACZA 3PUGA 3ZMVB 1N33T 3K8PC 2L9QA 2X51A 3IBPA 4OX9T 2LSYA 3EAMA 2XTLA 1FJGT 2K24A 3HKDE 5BMVE 4KI0F 4DV2T 2XAHB 2Q9QD 2ZM2A 3F2EA 3QB5A 3UTKA 2QA7A 2JQQA 4QH1A 5JDNA 3H37A 3UFEA 4UVCB 3RYHE 3UU4A 1E1HB 3A5XA 3RKGA 3J7Yq 4X65T 1WR0A 1T7SA 3L8RA 4PW8A 4CN4A 2CLYB 2CBIA 2V6YB 1HG2A 4EGWA 3KBTA 5C3JA 3UQ4A 4AXPA 3CKDA 5HXHA 4KMCA 3TLTA 1IBMT 3RRCA 1VRBA 2VK9A 5KMGP 3WAKA 3PUWF 2KLQA 4LFCT 3LG7A 4G63A 5HEUA 2WU2A 2WSSV 3AAEB 3OVUA 4TV8E 4PAGA 2OV9A 5FXVA 2LOSA 1D1BA 4BJNA 1YQ4A 4C90A 4LMLA 4AKGA 1WCRA 5TAOA 2LOPA 4U3CA 1S35A 2W2UA 1IJ6A 3AE9A 4P1NA 4TZ4C 4WZXA 4JUYA 4AQFC 5AQNB 2CCQA 5JR9B 4EOZB 2YN6A 5JDLA 2D0TA 2DCFA 2Y8DA 1N32T 2HPJA 2CWYA 3E22E 4ZHQE 2WDVA 4DUYT 1UX4A 2KSRA 3P7IA 5JRCB 4AQGA 1XWMA 2AE9A 4YFSA 4WBNE 2WMOA 3S4UA 4ZI7E 1HNWT 4AQYT 3ZYLA 5HXCA 2BG9B 1NENA 2NTXA 4H63H 3NRXA 4FJOA 4AISA 3BK9A 2LRLA 2WP9A 4AQFA 3I9WA 2VKDA 3ZYKA 5JR9C 2AXDS 5LJMA 2C5KT 3TLWA 2UU9T 2E9XD 2IDOB 3P4QA 3JADA 5JDFA 2CBJA 5LOVE 3WI3A 3L09A 4I0UA 4CI2B 3TLVA 2XZEA 2ZM8A 3BQIA 4QXBB 4JI2T 2NW7A 4DV7T 2WB5A 2BKOA 2J62A 4ZI3D 3Q9DA 2E2AA 5IYZE 2M6IA 2WQYA 1HF8A 3KFWX 4UV9B 4YY3T 5F5WA 3AA0B 1D0YA 5FP3A 3PJAJ 2VKHA 4PK4A 4DR5T 3Q5DA 4P0BA 3AXJA 2LSIA 3AEEA 4PJMA 5FL0A 5ABGA 3UUNA 2EHOC 3P4WA 2E8IA 2IC9A 5AQGB 1BR0A 4EIWA 5LGNB 4GYSA 1D1CA 3E0ZA 4YHHT 3RYIE 2V5CA 2UXCT 5HXSA 4ZI2D 1Z8UA 1UGOA 2QGSA 2LRKA 4GIWA 5J0ZA 3TKLB 3HR0A 4H63V 4NXNT 4ERRA 1OEDA 4YSZA 4AIUA 1W0BA 1WRDA 2YU2A 3N2GE 4H9NC 3MXZA 4KBMB 4YTNA 2ODVA 4L0RA 1G8XA 5HXEA 1IBLT 1Y64B 4DV4T 5AQIB 3AAIA 1OEDC 1WYBA 2KNDA 1IJ5A 1YKHB 2UXBT 2LM9A 2VL8A 3GA8A 2ZLYA 4I50E 5EK2A 1YQ3A 2X9WA 4M1PA 4X1YE 1KF6A 2LSKA 2LHNA 4TX5A 2A9UA 3AAAB 4NUUA 4CXYA 3RC8A 4K0KT 2B76A 3N2KE 2Q9QA 5DABA 2X9YA 3FZMB 4TV9E 4ZS2A 4L9IA 2DL1A 2XSBA 2Y6XA 4NIQA 3UU3A 3CVRA 3LK2B 3M65A 1JNZA 3CK6A 2WWUA 2JRKA 1MIVA 4WW0A 5DQWA 5LGTB 4PJJA 4KHPT 1JNRA 3E08A 2NTYA 2W62A 1LKXA 2XHEB 5DJQC 1WR6A 4A5XA 5L2LA 3HL6A 4DNDA 2G0UA 2IC6A 4DV5T 1XMOT 2XAGB 4UF0B 4ILUA 3ZKRA 2EHOA 5L3BB 3PUSA 1G73A 2W63A 5JREA 5KXJA 4TWFA 4X5TA 5BR8T 3MJXA 5L3EB 3FXDB 5AQHB 4IDOA 3ZJ1A 3ZMZB 4AKRB 5C8YE 1HX1B 4H9RC 3O1JA 2DWGA 3FXEB 5CB4E 2D9DA 2CMRA 3RYFE 3PV0F 3Q5XA 4YLHA 3LSVA 5AQLB 4YJ3E 3OTOT 4DIDB 5M4YA 3FZLB 4NPPA 4OYKA 2ZMAA 3G06A 2YDQA 2OA5A 3DP7A 2XAQB 3ETUA 1FMWA 2X0YA 2HN2A 2IIUA 4ZZBA 5AQPB 4CZZB 4YTPA 2CHOA 2H89A 1YW0A 2DWKA 3P4RA 1XDPA 2ACXA 1NWMX 2CE7A 3RQUA 2V7IA 4IL4A 2JQKA 2BS2A 2PBIA 2HHHT 5LG4A 3ABVA 3AEGA 4UVBB 1XNRT 1AJ3A 4I55E 2X0LB 4TWHA 5IHYA 2UUAT 4G2AA 4XBFB 2YINA 1XDOA 3AXJB 4HFBA 1U5PA 3ANWB 1W0AA 2CA5A 5AQRB 3PTRB
chains in the Genus database with same CATH topology
4LF6T 4B3TT 4X62T 3T1HT 1N32T 2ZM6T 4DUYT 4LF5T 4DV7T 4X64T 4JI1T 1HNWT 4AQYT 5LMNT 4DV3T 4DV1T 4DR2T 2UU9T 4B3MT 4JI0T 4GKJT 4JI2T 4LFAT 1I94T 4LF7T 4YY3T 4JI6T 2VQET 4GKKT 4DR5T 4JI7T 4DR6T 4JV5T 4LFBT 2UXDT 4JI4T 4B3ST 4JI8T 2VQFT 1J5ET 4YHHT 2UXCT 1XMQT 4DR7T 5IWAT 1HR0T 4NXNT 3T1YT 1IBLT 1N34T 4DV4T 4DV6T 2UXBT 4JI5T 1IBKT 4LF8T 1HNZT 4K0KT 4DR1T 4NXMT 1HNXT 2F4VT 4JYAT 4KHPT 1N36T 4JI3T 1XMOT 4DV5T 5BR8T 1N33T 4OX9T 1FJGT 5LMUT 4DV2T 3OTOT 4DV0T 4DR3T 2E5LT 4X66T 4LF4T 4X65T 4B3RT 2UUCT 1IBMT 2HHHT 1XNRT 4DR4T 4LFCT 1XNQT 4LF9T 2UUBT 2UUAT 4DUZT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 T;  4B3T T;  4X62 T;  3T1H T;  1N32 T;  2ZM6 T;  4DUY T;  4LF5 T;  4DV7 T;  4X64 T;  4JI1 T;  1HNW T;  4AQY T;  5LMN T;  4DV3 T;  4DV1 T;  4DR2 T;  2UU9 T;  4B3M T;  4JI0 T;  4GKJ T;  4JI2 T;  4LFA T;  1I94 T;  4LF7 T;  4YY3 T;  4JI6 T;  2VQE T;  4GKK T;  4DR5 T;  4JI7 T;  4DR6 T;  4JV5 T;  4LFB T;  2UXD T;  4JI4 T;  4B3S T;  4JI8 T;  2VQF T;  1J5E T;  4YHH T;  2UXC T;  1XMQ T;  4DR7 T;  5IWA T;  1HR0 T;  4NXN T;  3T1Y T;  1IBL T;  1N34 T;  4DV4 T;  4DV6 T;  2UXB T;  4JI5 T;  1IBK T;  4LF8 T;  1HNZ T;  4K0K T;  4DR1 T;  4NXM T;  1HNX T;  2F4V T;  4JYA T;  4KHP T;  1N36 T;  4JI3 T;  1XMO T;  4DV5 T;  5BR8 T;  1N33 T;  4OX9 T;  1FJG T;  5LMU T;  4DV2 T;  3OTO T;  4DV0 T;  4DR3 T;  2E5L T;  4X66 T;  4LF4 T;  4X65 T;  4B3R T;  2UUC T;  1IBM T;  2HHH T;  1XNR T;  4DR4 T;  4LFC T;  1XNQ T;  4LF9 T;  2UUB T;  2UUA T;  4DUZ T; 
#chains in the Genus database with same CATH topology
 2WMN A;  3N2O A;  3VR8 A;  1M62 A;  3PUV F;  3AE6 A;  3CPZ A;  3FZK B;  4ILB A;  5JDM A;  5JH7 E;  2DNX A;  3C4W A;  2Y48 B;  5CA0 E;  5JDQ A;  4QWN B;  3JAE A;  5LGU B;  3T1H T;  1XZY A;  4JLE A;  3ZMU B;  3SFE A;  3Q2M A;  2ZM0 A;  2IW5 B;  4LMK A;  5ABE A;  3AE8 A;  4LF5 T;  1B7T A;  1OWA A;  2X0H A;  3I0Q A;  4H9Q C;  2XQA A;  3JC6 D;  2H7V C;  4HFV A;  1SHZ C;  4FI5 A;  5LCY A;  3P50 A;  1HG5 A;  4IHJ E;  4V1A v;  4X64 T;  2VKO A;  1CHU A;  1LRZ A;  4YHJ A;  3KV6 A;  5EK3 A;  5AQS B;  4EV6 A;  3VRB A;  2V6Y A;  4EAH A;  3EHZ A;  4EYU A;  3JCF A;  4IE7 A;  4U33 A;  1LVK A;  1WLX A;  3HKE E;  1UUS A;  5AQT B;  4ADZ A;  2BVL A;  3ZEF B;  4HFC A;  4IDZ A;  2EHO D;  2I6H A;  3N9N A;  4H9O C;  4IRE A;  3RI5 A;  3KV5 A;  2KWH A;  2Q9Q B;  2WBL A;  3PE0 A;  4UXN B;  3ONJ A;  4ZXL A;  3AE4 A;  4GKJ T;  1VCT A;  5FNV E;  3ZCI A;  3I0O A;  2K48 A;  3N9M A;  4IE6 A;  5H6Q B;  4I43 B;  5HWX A;  1I94 T;  4LFA T;  4HGA A;  4JI6 T;  5HXR A;  3N9Q A;  5FXZ A;  5L4H A;  4DR7 T;  4DR6 T;  2UXD T;  4JV5 T;  4LFB T;  5LYJ E;  2FBW A;  4JI4 T;  4OFZ A;  3CX6 B;  5AQJ B;  2XQ8 A;  4MAL A;  4WNK A;  2SPC A;  2BS4 A;  2FUP A;  2BBH A;  3KVB A;  4ANJ A;  1J5E T;  2MOZ A;  2IUB A;  1Y01 A;  2VL0 A;  4QX7 B;  3NZQ A;  2ODU A;  2W61 A;  2XJ7 A;  3OKQ A;  4HFI A;  3ZST A;  2HN1 A;  2LT3 A;  3ZLI A;  3AE5 A;  1VOM A;  3L39 A;  4HKA A;  4JBW F;  5JVD E;  1FMV A;  4K0U A;  4EED A;  2W0G A;  4KX6 A;  3J9X 1;  3UU6 A;  1IAP A;  3T1Y T;  1OXZ A;  3C98 B;  3UUM A;  3QC9 A;  2E9X A;  2PJQ A;  2WZI A;  3FHN A;  5F8P A;  1S94 A;  2C5J A;  2X9H A;  2D2S A;  4JI5 T;  3NWI A;  3ZT5 A;  2H3R A;  3VHL A;  1V9D A;  2W4X A;  3H3M A;  4HFE A;  2BG9 C;  1HX8 A;  4IGU A;  1HNZ T;  5FMN A;  4O4L E;  1QUU A;  2YKS A;  3ANW A;  4IE4 A;  5CA1 E;  1X9B A;  5JRC A;  5C2T A;  2R6G F;  3UU5 A;  3CQX C;  4PNI A;  2NWB A;  4TWD A;  4ZZC A;  2W66 A;  5KDM C;  2XAS B;  3ZPO A;  5L4E A;  1HNX T;  3I1A A;  3RIA A;  4YXD A;  1ZP0 A;  5JR9 A;  4YSX A;  4PK5 A;  4CQI A;  4MLK A;  4H9S E;  1J5W A;  2BVM A;  4QX8 B;  4X20 E;  3F31 A;  2XM1 A;  4O4J E;  2V7J A;  5LNK A;  4ZI3 C;  2PTF A;  4EEB A;  4JI3 T;  4HTE A;  1SUM B;  3MAC A;  3ZYM A;  3P4S A;  2BZB A;  3N5L A;  3KV4 A;  3NBX X;  2V7M A;  4AKI A;  2J1D G;  4AKL A;  1Z0P A;  1BR2 A;  3AA6 B;  1SA0 E;  4UEM A;  2BKP A;  1UUR A;  3ETV A;  2QYW A;  3OYZ A;  4O4I E;  4UV8 B;  3VU7 H;  4DUZ T;  4P0A A;  3B57 A;  2C5I T;  1UX5 A;  3AEF A;  2MAW A;  1MND A;  1WYC A;  5FVL A;  1UCU A;  2BKN A;  3PU3 A;  4Z91 A;  4YT0 A;  3ZT7 A;  3IA3 A;  2FJE A;  2IML A;  1J1J A;  3ZMS B;  4MBQ A;  5LMU T;  4HFH A;  4JEH B;  5EK4 A;  4DV0 T;  2NR4 A;  3V5U A;  3UUX B;  1HFA A;  2LSJ A;  1NEK A;  5LG3 A;  4UIG A;  2HPL A;  2VWA A;  3EDU A;  2DLR A;  1MNE A;  2IAK A;  3PUX F;  4GYR A;  2KT9 A;  4X1I E;  5FL1 A;  3O9X A;  1MMG A;  2NOX A;  2XY8 B;  2PFV A;  3EDV A;  5AQM B;  3R6N A;  2YEV C;  1KEY A;  4HE8 A;  4EZ4 A;  3PJA A;  1ZHC A;  4ZI2 C;  2V8S V;  5JQG E;  5J2T E;  1BR4 A;  2A72 A;  3CX7 B;  3M3Z B;  4GOU A;  2DHR A;  5HEJ A;  2XUE A;  1XNQ T;  4DR4 T;  2W67 A;  3AA7 B;  2JQH A;  3JC6 C;  4MHC A;  2UUB T;  4LF9 T;  1KK7 A;  3RHW A;  4A56 A;  5AQF B;  4HN9 A;  5GON E;  3RIU A;  3VKG A;  4X1K E;  5IUX A;  2XQ7 A;  2BDE A;  1VCS A;  1US7 B;  3PDY A;  4B3T T;  3JAF A;  4PFO A;  2XPK A;  2V7K A;  1DU2 A;  3GN5 A;  3WAJ A;  5ETW A;  3RGL A;  2FJA A;  2CM0 A;  4U2Z A;  3AB3 B;  3OBV E;  2E9X C;  5A1L A;  4NUV A;  2J4G A;  3RYC E;  2FJB A;  4CI1 B;  5LMN T;  4WYV A;  5LA6 E;  4HWI B;  4DV1 T;  2JPF A;  2QVA A;  3L3P A;  2LEH A;  3N9O A;  5F3J A;  1WFD A;  3LBX A;  3H3A A;  3AVS A;  1YXR A;  3K3Q C;  4P09 A;  3HKC E;  3RRW A;  4B3M T;  2I0M A;  1HCI A;  3ONX A;  4U31 A;  4JI0 T;  5L3C B;  1UK5 A;  1SE7 A;  2PG8 A;  3AE3 A;  4UF0 A;  2LE8 A;  4O2B E;  3NZP A;  2E9X B;  3QK6 A;  4UVA B;  3UFG A;  5FVK A;  2H88 A;  2KZ7 B;  2LKH A;  2MBG A;  3R84 B;  2X68 A;  3ZN0 B;  4LF7 T;  2NW9 A;  4ZEY A;  5LHG B;  4PK6 A;  1QSD A;  1IZN B;  3IHR A;  4C91 A;  3LK3 B;  4GKK T;  4JI7 T;  3KVA A;  3ONL C;  3TLU A;  4QKN A;  3ZC1 A;  1ZOY A;  5HEH A;  4DBQ A;  2J47 A;  4B3S T;  3CML A;  2VQF T;  4EYY R;  2K3W A;  5LXT E;  3HKB E;  4E7Z A;  4DBR A;  5FY1 A;  1E7P A;  2BG9 E;  2CXL A;  3DJB A;  3UU8 A;  2K5B B;  3GN5 B;  3A7M A;  2V7L A;  3RKO A;  5AQK B;  2K9A A;  4YTM A;  4DMV A;  2C0S A;  3V5S A;  3GMI A;  1MIY A;  3D0T A;  3PU8 A;  1MMD A;  3QOF A;  2KXP B;  2WDQ A;  4CI3 B;  1H7C A;  1N34 T;  3LFM A;  4F8H A;  1D1A A;  4MFR A;  4EXT A;  5EZY E;  2LM2 A;  3BQL A;  4AI6 A;  4HEA A;  2I59 A;  3C51 A;  1GQE A;  2M6B A;  4QXH B;  3RPU A;  1IBK T;  2CLY C;  2L3L A;  4LF8 T;  3CIR A;  1KNZ A;  3ZMT B;  3BQK A;  4DMW A;  3VRA A;  3NKZ A;  4DR1 T;  3IEE A;  2UXN B;  2JIW A;  4TN7 B;  5LHI B;  4NXM T;  4BAY B;  3I9Y A;  3MA9 A;  1T98 A;  1FIO A;  4IDN A;  4O4H E;  2F4V T;  3Q5W A;  2CXD A;  1YD8 G;  3SFD A;  4B3R T;  4JYA T;  2CWO A;  2Q9Q C;  1FEW A;  2JMH A;  4XZC A;  1KNR A;  1T8B A;  4IST A;  1N36 T;  2BG9 A;  4OYJ A;  3X1D A;  2QRX A;  4I4T E;  4ZOL E;  3ZC0 A;  3VKH A;  3DTO A;  3LK4 2;  2HH7 A;  4IDQ A;  1D0Z A;  2W00 A;  3CQC B;  4O2A E;  3SOL A;  4KP3 C;  3SWH A;  5JTG A;  3LBX B;  3LDQ B;  2OLT A;  2WS3 A;  4IL9 A;  4U72 A;  1T72 A;  4QHO A;  4ZS3 A;  4BJM A;  4JI1 T;  3FB2 A;  4PJN A;  4TUY E;  2XQ6 A;  4Z8X A;  2LKG A;  3OYX A;  5AQV B;  1XMQ T;  2ES0 A;  2RP4 A;  2VAS A;  4ILC A;  4EB6 E;  4J2C A;  1ZKE A;  2V5D A;  4IT4 A;  2RPA A;  5CGM A;  3KV9 A;  3QNU A;  4DR3 T;  2D0U A;  4BA9 A;  3TLS A;  4A98 A;  3MZK B;  4X66 T;  2N9D A;  5L3F B;  3VR9 A;  4PJL A;  4LF4 T;  1ZV4 X;  2LLY A;  2P9B A;  2WAU A;  2XQ3 A;  4L5G A;  2WWV A;  2FJD A;  4CN6 A;  4LF6 T;  1EZ3 A;  2WDR A;  4YJ2 E;  3QUJ A;  2XSA A;  4ISS A;  4CN1 A;  2UUC T;  4TNV A;  3PUZ F;  2YU1 A;  3RH3 A;  5HEG A;  2D5U A;  2XAF B;  2BBJ A;  2JJ9 A;  3CQG B;  3NVO A;  2VVS A;  3AE1 A;  3UUB A;  4Z90 A;  5LHH B;  3U78 A;  5E0O A;  4IIJ E;  5AQO B;  3P8C D;  2YK0 A;  5LB7 B;  4QH5 A;  2KWI B;  2XQ4 A;  5HCM A;  3PUA A;  1BR1 A;  3RIU C;  1E2A A;  1MMA A;  1W9R A;  4TNW A;  4X62 T;  2WY2 A;  4U74 A;  2B1E A;  2JQ9 A;  2IHR 1;  2A3D A;  2LJL A;  3EAB A;  3FZF B;  2ZM6 T;  1MMN A;  1OED B;  3C50 A;  2KMF A;  3CWZ B;  2XM2 A;  3NRY A;  2L8K A;  1KNP A;  3UQ7 A;  2Z6E A;  5HAX A;  5ABF A;  2NW8 A;  4IDP A;  4OK0 A;  4DV3 T;  3AED A;  3FBL A;  2M67 A;  3EUH A;  5HWY A;  4HWC A;  3ZCJ A;  3QB5 K;  5FY0 A;  1OED E;  3RQW A;  4ASK A;  4XAX B;  4JEU B;  5AQU B;  2X66 A;  4DR2 T;  2XQ5 A;  5J2U E;  4DO0 A;  2MTQ A;  3RF1 A;  3ZN1 B;  5LBM A;  2E5L T;  3OJA A;  3GWH A;  3N9P A;  5DQV A;  1ZEE A;  3MKD A;  3P4P A;  4PFP A;  4U7I A;  3HA4 A;  4B6X A;  3AA1 B;  1HS7 A;  2CEA A;  2CHN A;  5HEO A;  3KIN B;  1O3X A;  2EHO B;  2XQ9 A;  2MYS A;  3C4X A;  4GK0 E;  4OHF A;  5FXW A;  2V1D B;  3OPC A;  3SRZ A;  4KUM B;  4COF A;  3PUQ A;  3UT5 E;  2YDR A;  4DVD A;  2VQE T;  2CPT A;  3AE7 A;  3C64 A;  2LSG A;  4E7S A;  3LJC A;  5L47 A;  4U2Y A;  3RLF F;  1QLB A;  3O1H A;  2WU5 A;  4UEL A;  3PUY F;  2NP9 A;  1L0V A;  2V6X A;  3UUL A;  4JI8 T;  1M7K A;  1MIW A;  5ADX L;  2XAJ B;  3ZT6 A;  5FKY A;  3RIF A;  1R8I A;  1W09 A;  3KBU A;  2GK9 A;  3N9L A;  5FY7 A;  3F57 A;  2MPK A;  4HWH A;  2YOE A;  3FBZ A;  3O4X E;  3IF8 B;  4H9P C;  3O1I A;  3Q5E A;  4HWD A;  2YDS A;  3T8O A;  2X9X A;  3AEA A;  3ZJ2 A;  5IWA T;  4YSY A;  1HR0 T;  1CUN A;  2RA1 A;  4IE5 A;  3SS1 A;  4O8S A;  5HYA A;  3CX8 B;  5L3G B;  5AFU L;  5FXX A;  2WZH A;  1I6Z A;  1LVF A;  3RC3 A;  2VB6 A;  3K3O A;  4GK5 E;  5ABF B;  2N1G A;  1YKE B;  3K3N A;  4QH4 A;  4EZH A;  2VUR A;  4KHZ F;  5J1G A;  4Q25 A;  4DV6 T;  3RX6 A;  4IE0 A;  5H6R B;  4CXX A;  3C4Z A;  3MK7 C;  2XQY A;  2V26 A;  5ABH A;  5JDH A;  1HTJ F;  2E5V A;  3KDS E;  2X67 A;  2DI4 A;  2KIN B;  2VVN A;  3AVR A;  3B13 A;  2LHR A;  3FZH B;  5HCJ A;  2WCA A;  4A97 A;  3PUR A;  4QXC B;  4UR9 A;  4F6R C;  4HWF A;  4LMJ A;  1KFY A;  3AE2 A;  2CXF A;  3W15 B;  1U4Q A;  3ESL A;  4U7Y A;  5LBQ B;  2H7O A;  4HFD A;  4AKH A;  2A2F X;  4WBO A;  5FYM A;  5LP6 E;  2N2N A;  3ZSS A;  5CFB A;  1D0X A;  1X79 A;  3EVY A;  3U3I A;  5CJ5 A;  2UXX B;  2WM9 A;  2BS3 A;  4ILA A;  3AEB A;  4CXW A;  5L3D B;  3EI0 A;  2JMK A;  3A8Y C;  4N78 D;  1NAF A;  2CRB A;  5AQQ B;  2VKJ A;  5LJN A;  3B5M A;  3HI2 A;  5JDG A;  5KX5 E;  3K1S A;  3AEC A;  2ACZ A;  3PUG A;  3ZMV B;  1N33 T;  3K8P C;  2L9Q A;  2X51 A;  3IBP A;  4OX9 T;  2LSY A;  3EAM A;  2XTL A;  1FJG T;  2K24 A;  3HKD E;  5BMV E;  4KI0 F;  4DV2 T;  2XAH B;  2Q9Q D;  2ZM2 A;  3F2E A;  3QB5 A;  3UTK A;  2QA7 A;  2JQQ A;  4QH1 A;  5JDN A;  3H37 A;  3UFE A;  4UVC B;  3RYH E;  3UU4 A;  1E1H B;  3A5X A;  3RKG A;  3J7Y q;  4X65 T;  1WR0 A;  1T7S A;  3L8R A;  4PW8 A;  4CN4 A;  2CLY B;  2CBI A;  2V6Y B;  1HG2 A;  4EGW A;  3KBT A;  5C3J A;  3UQ4 A;  4AXP A;  3CKD A;  5HXH A;  4KMC A;  3TLT A;  1IBM T;  3RRC A;  1VRB A;  2VK9 A;  5KMG P;  3WAK A;  3PUW F;  2KLQ A;  4LFC T;  3LG7 A;  4G63 A;  5HEU A;  2WU2 A;  2WSS V;  3AAE B;  3OVU A;  4TV8 E;  4PAG A;  2OV9 A;  5FXV A;  2LOS A;  1D1B A;  4BJN A;  1YQ4 A;  4C90 A;  4LML A;  4AKG A;  1WCR A;  5TAO A;  2LOP A;  4U3C A;  1S35 A;  2W2U A;  1IJ6 A;  3AE9 A;  4P1N A;  4TZ4 C;  4WZX A;  4JUY A;  4AQF C;  5AQN B;  2CCQ A;  5JR9 B;  4EOZ B;  2YN6 A;  5JDL A;  2D0T A;  2DCF A;  2Y8D A;  1N32 T;  2HPJ A;  2CWY A;  3E22 E;  4ZHQ E;  2WDV A;  4DUY T;  1UX4 A;  2KSR A;  3P7I A;  5JRC B;  4AQG A;  1XWM A;  2AE9 A;  4YFS A;  4WBN E;  2WMO A;  3S4U A;  4ZI7 E;  1HNW T;  4AQY T;  3ZYL A;  5HXC A;  2BG9 B;  1NEN A;  2NTX A;  4H63 H;  3NRX A;  4FJO A;  4AIS A;  3BK9 A;  2LRL A;  2WP9 A;  4AQF A;  3I9W A;  2VKD A;  3ZYK A;  5JR9 C;  2AXD S;  5LJM A;  2C5K T;  3TLW A;  2UU9 T;  2E9X D;  2IDO B;  3P4Q A;  3JAD A;  5JDF A;  2CBJ A;  5LOV E;  3WI3 A;  3L09 A;  4I0U A;  4CI2 B;  3TLV A;  2XZE A;  2ZM8 A;  3BQI A;  4QXB B;  4JI2 T;  2NW7 A;  4DV7 T;  2WB5 A;  2BKO A;  2J62 A;  4ZI3 D;  3Q9D A;  2E2A A;  5IYZ E;  2M6I A;  2WQY A;  1HF8 A;  3KFW X;  4UV9 B;  4YY3 T;  5F5W A;  3AA0 B;  1D0Y A;  5FP3 A;  3PJA J;  2VKH A;  4PK4 A;  4DR5 T;  3Q5D A;  4P0B A;  3AXJ A;  2LSI A;  3AEE A;  4PJM A;  5FL0 A;  5ABG A;  3UUN A;  2EHO C;  3P4W A;  2E8I A;  2IC9 A;  5AQG B;  1BR0 A;  4EIW A;  5LGN B;  4GYS A;  1D1C A;  3E0Z A;  4YHH T;  3RYI E;  2V5C A;  2UXC T;  5HXS A;  4ZI2 D;  1Z8U A;  1UGO A;  2QGS A;  2LRK A;  4GIW A;  5J0Z A;  3TKL B;  3HR0 A;  4H63 V;  4NXN T;  4ERR A;  1OED A;  4YSZ A;  4AIU A;  1W0B A;  1WRD A;  2YU2 A;  3N2G E;  4H9N C;  3MXZ A;  4KBM B;  4YTN A;  2ODV A;  4L0R A;  1G8X A;  5HXE A;  1IBL T;  1Y64 B;  4DV4 T;  5AQI B;  3AAI A;  1OED C;  1WYB A;  2KND A;  1IJ5 A;  1YKH B;  2UXB T;  2LM9 A;  2VL8 A;  3GA8 A;  2ZLY A;  4I50 E;  5EK2 A;  1YQ3 A;  2X9W A;  4M1P A;  4X1Y E;  1KF6 A;  2LSK A;  2LHN A;  4TX5 A;  2A9U A;  3AAA B;  4NUU A;  4CXY A;  3RC8 A;  4K0K T;  2B76 A;  3N2K E;  2Q9Q A;  5DAB A;  2X9Y A;  3FZM B;  4TV9 E;  4ZS2 A;  4L9I A;  2DL1 A;  2XSB A;  2Y6X A;  4NIQ A;  3UU3 A;  3CVR A;  3LK2 B;  3M65 A;  1JNZ A;  3CK6 A;  2WWU A;  2JRK A;  1MIV A;  4WW0 A;  5DQW A;  5LGT B;  4PJJ A;  4KHP T;  1JNR A;  3E08 A;  2NTY A;  2W62 A;  1LKX A;  2XHE B;  5DJQ C;  1WR6 A;  4A5X A;  5L2L A;  3HL6 A;  4DND A;  2G0U A;  2IC6 A;  4DV5 T;  1XMO T;  2XAG B;  4UF0 B;  4ILU A;  3ZKR A;  2EHO A;  5L3B B;  3PUS A;  1G73 A;  2W63 A;  5JRE A;  5KXJ A;  4TWF A;  4X5T A;  5BR8 T;  3MJX A;  5L3E B;  3FXD B;  5AQH B;  4IDO A;  3ZJ1 A;  3ZMZ B;  4AKR B;  5C8Y E;  1HX1 B;  4H9R C;  3O1J A;  2DWG A;  3FXE B;  5CB4 E;  2D9D A;  2CMR A;  3RYF E;  3PV0 F;  3Q5X A;  4YLH A;  3LSV A;  5AQL B;  4YJ3 E;  3OTO T;  4DID B;  5M4Y A;  3FZL B;  4NPP A;  4OYK A;  2ZMA A;  3G06 A;  2YDQ A;  2OA5 A;  3DP7 A;  2XAQ B;  3ETU A;  1FMW A;  2X0Y A;  2HN2 A;  2IIU A;  4ZZB A;  5AQP B;  4CZZ B;  4YTP A;  2CHO A;  2H89 A;  1YW0 A;  2DWK A;  3P4R A;  1XDP A;  2ACX A;  1NWM X;  2CE7 A;  3RQU A;  2V7I A;  4IL4 A;  2JQK A;  2BS2 A;  2PBI A;  2HHH T;  5LG4 A;  3ABV A;  3AEG A;  4UVB B;  1XNR T;  1AJ3 A;  4I55 E;  2X0L B;  4TWH A;  5IHY A;  2UUA T;  4G2A A;  4XBF B;  2YIN A;  1XDO A;  3AXJ B;  4HFB A;  1U5P A;  3ANW B;  1W0A A;  2CA5 A;  5AQR B;  3PTR B; 
#chains in the Genus database with same CATH homology
 4LF6 T;  4B3T T;  4X62 T;  3T1H T;  1N32 T;  2ZM6 T;  4DUY T;  4LF5 T;  4DV7 T;  4X64 T;  4JI1 T;  1HNW T;  4AQY T;  5LMN T;  4DV3 T;  4DV1 T;  4DR2 T;  2UU9 T;  4B3M T;  4JI0 T;  4GKJ T;  4JI2 T;  4LFA T;  1I94 T;  4LF7 T;  4YY3 T;  4JI6 T;  2VQE T;  4GKK T;  4DR5 T;  4JI7 T;  4DR6 T;  4JV5 T;  4LFB T;  2UXD T;  4JI4 T;  4B3S T;  4JI8 T;  2VQF T;  1J5E T;  4YHH T;  2UXC T;  1XMQ T;  4DR7 T;  5IWA T;  1HR0 T;  4NXN T;  3T1Y T;  1IBL T;  1N34 T;  4DV4 T;  4DV6 T;  2UXB T;  4JI5 T;  1IBK T;  4LF8 T;  1HNZ T;  4K0K T;  4DR1 T;  4NXM T;  1HNX T;  2F4V T;  4JYA T;  4KHP T;  1N36 T;  4JI3 T;  1XMO T;  4DV5 T;  5BR8 T;  1N33 T;  4OX9 T;  1FJG T;  5LMU T;  4DV2 T;  3OTO T;  4DV0 T;  4DR3 T;  2E5L T;  4X66 T;  4LF4 T;  4X65 T;  4B3R T;  2UUC T;  1IBM T;  2HHH T;  1XNR T;  4DR4 T;  4LFC T;  1XNQ T;  4LF9 T;  2UUB T;  2UUA T;  4DUZ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...