1HR0T

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hr0T00
1HNXT 4DV2T 1IBMT 4AQYT 4JI7T 4X64T 4LF5T 4NXMT 4LF4T 2UXCT 2UXDT 4DR6T 4LF8T 4DV0T 4DR3T 5BR8T 4KHPT 4LF7T 5LMNT 1HNWT 2VQFT 4JI0T 1IBLT 4LFAT 2UUAT 2HHHT 5IWAT 4OX9T 3T1YT 1I94T 4GKKT 4LFCT 4DV3T 1N36T 4LFBT 1N32T 4B3TT 1IBKT 4YY3T 2ZM6T 4DUZT 4B3RT 1XNQT 1XNRT 1HNZT 4B3MT 4JI5T 4LF9T 4DR5T 4B3ST 4X66T 1HR0T 4DR4T 4JI2T 1N33T 4JI1T 1FJGT 2UUCT 4X65T 4JI8T 4DV1T 5LMUT 4JI6T 4JV5T 4K0KT 4DR2T 4X62T 4JI3T 3OTOT 4LF6T 4DR1T 2UXBT 2UU9T 4GKJT 4DV7T 4DUYT 4JYAT 1XMQT 1N34T 1J5ET 2VQET 2UUBT 4DV6T 1XMOT 4DV5T 4JI4T 4YHHT 4NXNT 2F4VT 4DV4T 2E5LT 4DR7T 3T1HT
chains in the Genus database with same CATH superfamily
2CBJA 3MZKB 4CI2B 2WZHA 4L0RA 4EYYR 2JMKA 4HWFA 4KMCA 4ADZA 4LF8T 1KEYA 3LJCA 3AE5A 2XUEA 3KFWX 5L3DB 4HN9A 2WS3A 5C3JA 1M7KA 5HYAA 1BR1A 4UELA 3ZMSB 4IL4A 5IHYA 5IYZE 4H9SE 2K3WA 2QA7A 3T1YT 1KF6A 1ZOYA 1NWMX 2WWUA 3L09A 5JDFA 4B3MT 1WRDA 4HKAA 1CUNA 4JEHB 4LF9T 4A56A 4WNKA 2QRXA 2DWKA 2CLYC 3Q2MA 2X0YA 2X51A 2IC6A 4TZ4C 5CGMA 5FY7A 3AA6B 3N5LA 1WYCA 3SFEA 3PV0F 3IBPA 4JV5T 2CXFA 4H9QC 4LF6T 1KNPA 5FP3A 3RPUA 3HKCE 3QK6A 4HE8A 1KNRA 3AXJA 2B76A 2JQKA 4DV6T 4DV5T 2JJ9A 2F4VT 2XAFB 3N9NA 4NUUA 1Z0PA 1W0AA 4DV2T 2LRLA 1XDPA 3LK42 3K1SA 5AQPB 3PU8A 2KMFA 5JRCB 2YKSA 3AA0B 2QVAA 3ZMUB 2V5DA 1KFYA 2LSGA 4YSYA 3BQKA 4GYRA 3CVRA 2EHOB 3RQWA 4ZZBA 2JQQA 3M65A 4QXBB 3ABVA 1T7SA 3ZT7A 3C4WA 1I94T 2V7JA 5EK4A 1YKHB 5FXWA 3FXEB 3QOFA 4HTEA 4IE5A 1XNQT 3EAMA 4C91A 3OPCA 3EI0A 5JTGA 3UUNA 3K8PC 4NPPA 2XJ7A 2PFVA 2UXXB 5ADXL 4X1KE 2BZBA 3ZCJA 3CK6A 3ZJ1A 2YU2A 2WP9A 4JI6T 2V6XA 3A5XA 2SPCA 2LT3A 3QB5A 3IA3A 3O4XE 3LDQB 1IJ5A 2AXDS 1WR0A 2UU9T 1EZ3A 3K3QC 3ZT6A 2FJEA 3WI3A 3DP7A 2W61A 4PNIA 1Y64B 1XMOT 3KVAA 1ZKEA 2EHOC 3ZCIA 4OYKA 2CMRA 3AB3B 3KV9A 3LG7A 4LF5T 5AQNB 5FXXA 3UQ7A 2XQ9A 2VKHA 3RLFF 5ETWA 3ESLA 2VB6A 3PDYA 2XAJB 4M1PA 4L9IA 4UVAB 1X9BA 5HXHA 3UU8A 1BR4A 1N36T 2OV9A 4YY3T 2L3LA 1KK7A 2V7MA 3N9OA 4B3RT 4Q25A 2WDVA 3FZHB 4B3ST 1HR0T 2X67A 4JI1T 3FBLA 3LFMA 4TUYE 3TKLB 3Q5DA 4L5GA 5BMVE 2PJQA 3KVBA 4OHFA 2ZM0A 5FL0A 2E9XD 4TV9E 4CN6A 3W15B 4N78D 3PUWF 1T8BA 3OTOT 3ONXA 1VCSA 4YHJA 1AJ3A 5DQWA 4UVBB 1WYBA 4H9PC 4AIUA 3AAEB 4X1YE 4A97A 1MIVA 4EEDA 5AQHB 4HFVA 4IT4A 3RQUA 2N1GA 4WBNE 4KHPT 2KWHA 3UUBA 4YLHA 4DNDA 3P4WA 3DTOA 5JDGA 1MNDA 2H3RA 2DI4A 2LKHA 3OYXA 2YK0A 3GMIA 2G0UA 4U7IA 4UV8B 2BG9A 4A5XA 2CRBA 3AE3A 1ZP0A 4PK4A 1SE7A 3PUGA 1N32T 2WY2A 5J2UE 3TLUA 4IE7A 2VASA 3LBXA 2M6IA 2KINB 2X9YA 3C4ZA 1HNZT 1LRZA 1IZNB 1WLXA 1VOMA 5J1GA 3NWIA 3VKGA 1YQ4A 3A7MA 3P50A 3ZC1A 4IE6A 4DR4T 3BK9A 4JI2T 3PUYF 4HGAA 2ACZA 4PK5A 2XSBA 5FXZA 5LMUT 4ZI2C 4NIQA 3I9YA 2J4GA 2R6GF 4AXPA 1E1HB 1XMQT 5LG4A 2V1DB 1UX4A 3X1DA 2KSRA 4U72A 4HWDA 3MKDA 4CN4A 2YOEA 4UIGA 2N9DA 2LRKA 5HWXA 5L4HA 4F8HA 4PFOA 5L4EA 4NXMT 2A9UA 5EK3A 3PUXF 4KBMB 4MALA 3GWHA 2X9WA 2UXDT 2NW8A 3N9MA 3SRZA 4DMWA 4F6RC 2YINA 3F31A 4A98A 1XDOA 2WU5A 4JI0T 5AQQB 2HPJA 2LKGA 5LGUB 2A72A 4EGWA 3NBXX 4OK0A 2I59A 2NR4A 3UUMA 2ES0A 2XQYA 2A3DA 4B3TT 3FZMB 3WAJA 3P8CD 2AE9A 3OYZA 3SFDA 2JPFA 2CE7A 2LJLA 2CA5A 3MJXA 5AQSB 5ABFB 3R84B 4P0BA 4IE4A 4MHCA 2WDRA 4KUMB 3PURA 5LYJE 4E7SA 2IC9A 4G2AA 3ETVA 2XQ7A 1JNRA 2PTFA 3MACA 3TLTA 3ZLIA 4DUYT 4QXHB 1VRBA 2JRKA 3RX6A 5KDMC 1R8IA 4JBWF 3PJAA 3ZYKA 2LSJA 2GK9A 4IL9A 2XPKA 4TN7B 2V7LA 1IBMT 2ZLYA 3N2KE 3P4SA 2Q9QD 2W63A 5KX5E 4TNWA 1W9RA 3L3PA 4FI5A 3J9X1 2HN1A 3B57A 1YQ3A 1D1AA 1FMWA 5JR9A 3V5SA 2BDEA 3VU7H 2CLYB 2J62A 4HFBA 3C98B 3BQLA 1IBLT 3CQGB 2NWBA 5LJMA 4B6XA 2FJAA 5GONE 5HEHA 5ABHA 2I0MA 1ZV4X 5IWAT 4YXDA 1E2AA 4ILAA 2LLYA 4YJ3E 1V9DA 3UU4A 2OLTA 5FVLA 3EABA 3Q9DA 2D0TA 4I50E 4JI5T 5HXCA 3AE1A 2D5UA 4X66T 2ZM8A 2D9DA 4YSZA 1N33T 3GN5A 3UQ4A 3AXJB 1FJGT 4ILCA 2LOPA 2W4XA 4JI8T 3CWZB 4U3CA 5HCMA 4Z90A 5LCYA 3ZJ2A 3I1AA 5JDNA 3JC6C 5LG3A 3VKHA 4X62T 3Q5XA 4WW0A 3VRBA 2PBIA 3HKEE 2H7OA 5FXVA 1N34T 2IDOB 2XASB 4UF0A 2Y8DA 2X0HA 2CWYA 1OXZA 3P4PA 1GQEA 4EB6E 3T1HT 5AQTB 3O9XA 3LK2B 3AAIA 4EYUA 2MPKA 5DQVA 5JDMA 5HEGA 5L3BB 3RKOA 3AECA 4KHZF 1JNZA 4YFSA 4LF7T 4YTPA 3ANWA 5IUXA 2BKOA 2WAUA 4XBFB 2XM2A 5JVDE 2YDRA 1YW0A 5ABGA 5A1LA 2E9XA 3FBZA 3FXDB 5LHHB 2ZM6T 2L9QA 4CQIA 2QGSA 3VHLA 2KWIB 4O8SA 4QH5A 4HFCA 4IREA 4DR5T 2BS4A 4Z8XA 1D0XA 4X65T 2CM0A 2K48A 3P4RA 1J1JA 1BR2A 5LGNB 3L8RA 3PU3A 4K0KT 4TX5A 5AQMB 2FJDA 1D1BA 3AEFA 3UT5E 2XM1A 1Y01A 2WB5A 3ZYMA 5FL1A 4CXYA 3UU5A 2VL0A 3GA8A 2NW7A 1IAPA 2MOZA 3N2OA 3ZMVB 3V5UA 2WCAA 2YDQA 1NEKA 1Z8UA 3ONJA 3AAAB 3H3MA 5HCJA 2CBIA 5F8PA 2C0SA 2C5IT 2WWVA 2LM9A 2IW5B 4EIWA 2E5VA 5LMNT 1FIOA 1W09A 1OEDA 4EOZB 4CN1A 2IHR1 4H9RC 3P4QA 1OEDC 3CPZA 4LFCT 3UFGA 2XQ4A 1M62A 1S94A 2RP4A 5KMGP 1WFDA 4GK5E 4IGUA 4PJLA 4AKGA 4O2BE 1U5PA 3ETUA 4GIWA 2WDQA 2MTQA 2WM9A 1G73A 1MMDA 1W0BA 5HXEA 5CJ5A 2NW9A 3PE0A 4AISA 1UURA 2XHEB 3EVYA 5TAOA 4OFZA 2WSSV 4I55E 2DWGA 4YTMA 3J7Yq 4JYAT 3OBVE 5M4YA 3WAKA 3HKDE 3JCFA 4X5TA 4DV4T 4MLKA 4CI3B 5FMNA 5LA6E 1HNXT 3HR0A 3CQCB 5CA0E 2BG9B 4HFEA 2XTLA 4CXWA 4AKRB 4UR9A 2E2AA 3PJAJ 2YEVC 2LSYA 3SS1A 3AVSA 3RIUA 1CHUA 3ZT5A 1HCIA 2X66A 3K3NA 2BKNA 2C5KT 2H89A 4HWCA 3C50A 1UGOA 4ZXLA 2JQ9A 4EV6A 4ZHQE 3JADA 4P09A 2CEAA 5JH7E 1B7TA 3O1HA 3ZSTA 5FNVE 2OA5A 2H88A 4QX8B 4G63A 4DV1T 2LE8A 3NZPA 3RC8A 3FZLB 4UVCB 4EXTA 2Q9QA 4JLEA 5JREA 2IUBA 2BG9C 1MMAA 2V5CA 2K9AA 1MNEA 2PG8A 4TWFA 4U74A 3RYFE 4JI3T 3RYHE 4KX6A 3SOLA 2Q9QC 4DR1T 2NTXA 3EHZA 2XAHB 2EHOD 4O2AE 5ABEA 2VVSA 3C4XA 5LHGB 2UUBT 5L47A 3N2GE 3ZN1B 3G06A 2LSKA 3P7IA 2D0UA 4K0UA 4UEMA 4DR7T 4V1Av 4UXNB 1XZYA 3AEEA 2XQ5A 3QUJA 3RIFA 4LF4T 2WBLA 1SUMB 4AQFA 2CWOA 4WZXA 5EZYE 4BJNA 2NP9A 1LKXA 3TLWA 2V6YB 2DCFA 5LBMA 2UUAT 4ASKA 5HEOA 4ZI7E 4QX7B 3IEEA 4BJMA 2VWAA 2HPLA 4ZI3D 3PTRB 3AE9A 5LGTB 4YTNA 4ZS3A 2K5BB 4ANJA 1YKEB 5HEJA 2WMOA 5E0OA 4ISSA 2LSIA 4AKHA 1MMNA 4HFHA 2MAWA 4MBQA 1OEDE 4IDPA 2CHOA 4IHJE 4QH4A 2K24A 3RRCA 3OVUA 5DJQC 4EAHA 5JR9B 4JI4T 1NENA 3IHRA 4NXNT 2LHNA 4O4LE 3NVOA 2CHNA 3I0QA 4PJNA 3CX8B 3RIAA 1YD8G 1ZHCA 1MMGA 3PUQA 1HF8A 2VVNA 3CKDA 3CIRA 3AEBA 4QWNB 3B13A 2V26A 2BS2A 3T8OA 2J47A 3UFEA 5LXTE 2VKOA 4LFAT 2HN2A 5JQGE 1LVFA 4LMJA 1WR6A 2ODUA 3AVRA 3GN5B 4IDNA 4EEBA 2XQ6A 4LFBT 1FMVA 3VRAA 5AQGB 1O3XA 2JQHA 2W66A 5C2TA 3PUZF 3ZSSA 5JR9C 4IDQA 2IAKA 2XAQB 3MA9A 2FBWA 3B5MA 4UF0B 4YJ2E 1T72A 4AKIA 4TV8E 3N9QA 5DABA 2YU1A 2MBGA 3C64A 1LVKA 2Y6XA 1D1CA 2BBJA 3ZYLA 4J2CA 4PJMA 3HKBE 4DO0A 1WCRA 4Z91A 5F3JA 5AQKB 5L3FB 4U31A 2L8KA 2DL1A 5CB4E 2DHRA 3ANWB 4U2YA 5CFBA 4MFRA 4O4IE 5HXRA 2LM2A 1FEWA 4H63H 2BG9E 2KLQA 1HG5A 3RRWA 4DR6T 3H3AA 3PUVF 1BR0A 4PJJA 2E9XB 2XY8B 3S4UA 3TLSA 3L39A 2BVMA 5AQUB 4TWDA 3UU6A 4PFPA 3FHNA 3MK7C 5FYMA 3CMLA 5JDLA 2HHHT 3HI2A 4P0AA 3ONLC 5AQJB 1U4QA 3UUXB 4ZEYA 5H6RB 5L3GB 1XNRT 5HXSA 3K3OA 2QYWA 1G8XA 1DU2A 3KV4A 4HFIA 3UU3A 3U3IA 3C51A 3OKQA 4U33A 2ODVA 2UUCT 5JDHA 2W67A 4I43B 3ZMTB 3E0ZA 3E22E 4IE0A 5FY1A 5L2LA 3BQIA 1S35A 2E9XC 5HEUA 2KZ7B 5AQFB 2XQ3A 4DV7T 4ISTA 1IJ6A 3N9PA 3JAFA 5HWYA 1J5ET 1HX8A 3AA7B 4JUYA 2VQET 3NRYA 4C90A 1NAFA 1OEDB 2M6BA 2NTYA 4AQYT 3Q5EA 2UXCT 2KNDA 3KDSE 3PUAA 1KNZA 3RC3A 2V7KA 2BKPA 4DV0T 4TNVA 4DR3T 3KV5A 4LMLA 1HNWT 3A8YC 4DMVA 4HEAA 3RYIE 2Z6EA 4EZHA 1VCTA 4H63V 2W2UA 2X9XA 4XAXB 4O4JE 2ZM2A 2V8SV 5EK2A 4QKNA 3VR8A 4I4TE 3ZPOA 3KINB 5JRCA 2LEHA 2H7VC 3NZQA 3D0TA 4X20E 3F2EA 3AE6A 2EHOA 2XQ8A 2E8IA 2VK9A 3E08A 2XSAA 1D0ZA 4E7ZA 4PK6A 3JC6D 3ZEFB 4ZS2A 3AE4A 1QSDA 3UULA 2I6HA 2WZIA 5LNKA 4U2ZA 2DNXA 3AEAA 4IIJE 1US7B 2UXBT 3FZKB 4BAYB 3RI5A 3ZN0B 4ERRA 2M67A 3QC9A 1D0YA 4YT0A 1UCUA 2JIWA 1UUSA 4X1IE 1SA0E 4GOUA 3ZMZB 5AQRB 3UTKA 5AQIB 1OWAA 2IMLA 3R6NA 5CA1E 4H9NC 2MYSA 4ZI3C 3FB2A 2DLRA 5C8YE 2W62A 5AQVB 1HX1B 3EDVA 5JDQA 3U78A 4DBRA 5HAXA 3KV6A 3LK3B 4FJOA 4PW8A 1IBKT 2Q9QB 5J2TE 3AA1B 3LBXB 2UXNB 3IF8B 1I6ZA 3H37A 4U7YA 5LB7B 2V7IA 1YXRA 3N9LA 3RF1A 3RIUC 3O1JA 2LOSA 4TWHA 4H9OC 2W0GA 5LP6E 1MIYA 2ACXA 5F5WA 3RHWA 2FJBA 2RPAA 4ILBA 4DR2T 3M3ZB 3EUHA 2NOXA 3AE2A 2KXPB 4CI1B 2J1DG 4COFA 3DJBA 4GYSA 1HG2A 4YHHT 2XQAA 3ZKRA 2A2FX 3NKZA 2P9BA 1QUUA 4QH1A 4O4HE 2IIUA 2KT9A 3NRXA 4XZCA 4JI7T 3LSVA 1E7PA 2HH7A 3MXZA 1UX5A 5AQOB 5AQLB 1ZEEA 4GK0E 4QHOA 5BR8T 2YN6A 5FVKA 2N2NA 4AQGA 5LJNA 4I0UA 1MIWA 4CZZB 2C5JA 2VURA 1T98A 2VKDA 4LMKA 4BA9A 4OX9T 2BS3A 3Q5WA 3AE7A 2D2SA 2RA1A 3RKGA 5AFUL 3VR9A 4QXCB 5KXJA 4DVDA 3EDUA 3AEDA 4AQFC 4HWHA 4P1NA 2XAGB 2Y48B 4IDOA 2CXDA 2FUPA 4HWIB 5H6QB 3KBUA 1H7CA 3F57A 2CCQA 4EZ4A 4HFDA 1QLBA 1HFAA 2BVLA 3QNUA 3RH3A 4KI0F 2X0LB 2B1EA 5L3EB 4GKJT 1L0VA 4ZZCA 3TLVA 3KBTA 3PUSA 5J0ZA 4CXXA 2X68A 4X64T 3O1IA 1SHZC 3RYCE 3SWHA 2YDSA 2LHRA 3HL6A 2WQYA 2X9HA 5LHIB 2VQFT 2BBHA 2W00A 2V6YA 4DBQA 4PAGA 2WMNA 3ZC0A 5FY0A 2CXLA 2WU2A 4AI6A 4OYJA 3OJAA 5L3CB 2JMHA 1X79A 3RGLA 1J5WA 4AKLA 4GKKT 4DV3T 2XZEA 4JEUB 5LBQB 4DUZT 4IDZA 3CX6B 2CPTA 1HS7A 1UK5A 5FKYA 3I0OA 4DIDB 4WBOA 3FZFB 4ZOLE 1XWMA 3HA4A 2VKJA 4YSXA 3QB5K 5ABFA 3I9WA 2ZMAA 3CX7B 1HTJF 4KP3C 4WYVA 3JAEA 4UV9B 5LOVE 3AEGA 4ZI2D 3AE8A 4ILUA 4NUVA 3CQXC 2E5LT 2VL8A
chains in the Genus database with same CATH topology
1HNXT 4DV2T 1IBMT 4AQYT 4JI7T 4X64T 4LF5T 4NXMT 4LF4T 2UXCT 2UXDT 4DR6T 4LF8T 4DV0T 4DR3T 5BR8T 4KHPT 4LF7T 5LMNT 1HNWT 2VQFT 4JI0T 1IBLT 4LFAT 2UUAT 2HHHT 5IWAT 4OX9T 3T1YT 1I94T 4GKKT 4LFCT 4DV3T 1N36T 4LFBT 1N32T 4B3TT 1IBKT 4YY3T 2ZM6T 4DUZT 4B3RT 1XNQT 1XNRT 1HNZT 4B3MT 4JI5T 4LF9T 4DR5T 4B3ST 4X66T 1HR0T 4DR4T 4JI2T 1N33T 4JI1T 1FJGT 2UUCT 4X65T 4JI8T 4DV1T 5LMUT 4JI6T 4JV5T 4K0KT 4DR2T 4X62T 4JI3T 3OTOT 4LF6T 4DR1T 2UXBT 2UU9T 4GKJT 4DV7T 4DUYT 4JYAT 1XMQT 1N34T 1J5ET 2VQET 2UUBT 4DV6T 1XMOT 4DV5T 4JI4T 4YHHT 4NXNT 2F4VT 4DV4T 2E5LT 4DR7T 3T1HT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX T;  4DV2 T;  1IBM T;  4AQY T;  4JI7 T;  4X64 T;  4LF5 T;  4NXM T;  4LF4 T;  2UXC T;  2UXD T;  4DR6 T;  4LF8 T;  4DV0 T;  4DR3 T;  5BR8 T;  4KHP T;  4LF7 T;  5LMN T;  1HNW T;  2VQF T;  4JI0 T;  1IBL T;  4LFA T;  2UUA T;  2HHH T;  5IWA T;  4OX9 T;  3T1Y T;  1I94 T;  4GKK T;  4LFC T;  4DV3 T;  1N36 T;  4LFB T;  1N32 T;  4B3T T;  1IBK T;  4YY3 T;  2ZM6 T;  4DUZ T;  4B3R T;  1XNQ T;  1XNR T;  1HNZ T;  4B3M T;  4JI5 T;  4LF9 T;  4DR5 T;  4B3S T;  4X66 T;  1HR0 T;  4DR4 T;  4JI2 T;  1N33 T;  4JI1 T;  1FJG T;  2UUC T;  4X65 T;  4JI8 T;  4DV1 T;  5LMU T;  4JI6 T;  4JV5 T;  4K0K T;  4DR2 T;  4X62 T;  4JI3 T;  3OTO T;  4LF6 T;  4DR1 T;  2UXB T;  2UU9 T;  4GKJ T;  4DV7 T;  4DUY T;  4JYA T;  1XMQ T;  1N34 T;  1J5E T;  2VQE T;  2UUB T;  4DV6 T;  1XMO T;  4DV5 T;  4JI4 T;  4YHH T;  4NXN T;  2F4V T;  4DV4 T;  2E5L T;  4DR7 T;  3T1H T; 
#chains in the Genus database with same CATH topology
 2CBJ A;  3MZK B;  4CI2 B;  2WZH A;  4L0R A;  4EYY R;  2JMK A;  4HWF A;  4KMC A;  4ADZ A;  4LF8 T;  1KEY A;  3LJC A;  3AE5 A;  2XUE A;  3KFW X;  5L3D B;  4HN9 A;  2WS3 A;  5C3J A;  1M7K A;  5HYA A;  1BR1 A;  4UEL A;  3ZMS B;  4IL4 A;  5IHY A;  5IYZ E;  4H9S E;  2K3W A;  2QA7 A;  3T1Y T;  1KF6 A;  1ZOY A;  1NWM X;  2WWU A;  3L09 A;  5JDF A;  4B3M T;  1WRD A;  4HKA A;  1CUN A;  4JEH B;  4LF9 T;  4A56 A;  4WNK A;  2QRX A;  2DWK A;  2CLY C;  3Q2M A;  2X0Y A;  2X51 A;  2IC6 A;  4TZ4 C;  5CGM A;  5FY7 A;  3AA6 B;  3N5L A;  1WYC A;  3SFE A;  3PV0 F;  3IBP A;  4JV5 T;  2CXF A;  4H9Q C;  4LF6 T;  1KNP A;  5FP3 A;  3RPU A;  3HKC E;  3QK6 A;  4HE8 A;  1KNR A;  3AXJ A;  2B76 A;  2JQK A;  4DV6 T;  4DV5 T;  2JJ9 A;  2F4V T;  2XAF B;  3N9N A;  4NUU A;  1Z0P A;  1W0A A;  4DV2 T;  2LRL A;  1XDP A;  3LK4 2;  3K1S A;  5AQP B;  3PU8 A;  2KMF A;  5JRC B;  2YKS A;  3AA0 B;  2QVA A;  3ZMU B;  2V5D A;  1KFY A;  2LSG A;  4YSY A;  3BQK A;  4GYR A;  3CVR A;  2EHO B;  3RQW A;  4ZZB A;  2JQQ A;  3M65 A;  4QXB B;  3ABV A;  1T7S A;  3ZT7 A;  3C4W A;  1I94 T;  2V7J A;  5EK4 A;  1YKH B;  5FXW A;  3FXE B;  3QOF A;  4HTE A;  4IE5 A;  1XNQ T;  3EAM A;  4C91 A;  3OPC A;  3EI0 A;  5JTG A;  3UUN A;  3K8P C;  4NPP A;  2XJ7 A;  2PFV A;  2UXX B;  5ADX L;  4X1K E;  2BZB A;  3ZCJ A;  3CK6 A;  3ZJ1 A;  2YU2 A;  2WP9 A;  4JI6 T;  2V6X A;  3A5X A;  2SPC A;  2LT3 A;  3QB5 A;  3IA3 A;  3O4X E;  3LDQ B;  1IJ5 A;  2AXD S;  1WR0 A;  2UU9 T;  1EZ3 A;  3K3Q C;  3ZT6 A;  2FJE A;  3WI3 A;  3DP7 A;  2W61 A;  4PNI A;  1Y64 B;  1XMO T;  3KVA A;  1ZKE A;  2EHO C;  3ZCI A;  4OYK A;  2CMR A;  3AB3 B;  3KV9 A;  3LG7 A;  4LF5 T;  5AQN B;  5FXX A;  3UQ7 A;  2XQ9 A;  2VKH A;  3RLF F;  5ETW A;  3ESL A;  2VB6 A;  3PDY A;  2XAJ B;  4M1P A;  4L9I A;  4UVA B;  1X9B A;  5HXH A;  3UU8 A;  1BR4 A;  1N36 T;  2OV9 A;  4YY3 T;  2L3L A;  1KK7 A;  2V7M A;  3N9O A;  4B3R T;  4Q25 A;  2WDV A;  3FZH B;  4B3S T;  1HR0 T;  2X67 A;  4JI1 T;  3FBL A;  3LFM A;  4TUY E;  3TKL B;  3Q5D A;  4L5G A;  5BMV E;  2PJQ A;  3KVB A;  4OHF A;  2ZM0 A;  5FL0 A;  2E9X D;  4TV9 E;  4CN6 A;  3W15 B;  4N78 D;  3PUW F;  1T8B A;  3OTO T;  3ONX A;  1VCS A;  4YHJ A;  1AJ3 A;  5DQW A;  4UVB B;  1WYB A;  4H9P C;  4AIU A;  3AAE B;  4X1Y E;  4A97 A;  1MIV A;  4EED A;  5AQH B;  4HFV A;  4IT4 A;  3RQU A;  2N1G A;  4WBN E;  4KHP T;  2KWH A;  3UUB A;  4YLH A;  4DND A;  3P4W A;  3DTO A;  5JDG A;  1MND A;  2H3R A;  2DI4 A;  2LKH A;  3OYX A;  2YK0 A;  3GMI A;  2G0U A;  4U7I A;  4UV8 B;  2BG9 A;  4A5X A;  2CRB A;  3AE3 A;  1ZP0 A;  4PK4 A;  1SE7 A;  3PUG A;  1N32 T;  2WY2 A;  5J2U E;  3TLU A;  4IE7 A;  2VAS A;  3LBX A;  2M6I A;  2KIN B;  2X9Y A;  3C4Z A;  1HNZ T;  1LRZ A;  1IZN B;  1WLX A;  1VOM A;  5J1G A;  3NWI A;  3VKG A;  1YQ4 A;  3A7M A;  3P50 A;  3ZC1 A;  4IE6 A;  4DR4 T;  3BK9 A;  4JI2 T;  3PUY F;  4HGA A;  2ACZ A;  4PK5 A;  2XSB A;  5FXZ A;  5LMU T;  4ZI2 C;  4NIQ A;  3I9Y A;  2J4G A;  2R6G F;  4AXP A;  1E1H B;  1XMQ T;  5LG4 A;  2V1D B;  1UX4 A;  3X1D A;  2KSR A;  4U72 A;  4HWD A;  3MKD A;  4CN4 A;  2YOE A;  4UIG A;  2N9D A;  2LRK A;  5HWX A;  5L4H A;  4F8H A;  4PFO A;  5L4E A;  4NXM T;  2A9U A;  5EK3 A;  3PUX F;  4KBM B;  4MAL A;  3GWH A;  2X9W A;  2UXD T;  2NW8 A;  3N9M A;  3SRZ A;  4DMW A;  4F6R C;  2YIN A;  3F31 A;  4A98 A;  1XDO A;  2WU5 A;  4JI0 T;  5AQQ B;  2HPJ A;  2LKG A;  5LGU B;  2A72 A;  4EGW A;  3NBX X;  4OK0 A;  2I59 A;  2NR4 A;  3UUM A;  2ES0 A;  2XQY A;  2A3D A;  4B3T T;  3FZM B;  3WAJ A;  3P8C D;  2AE9 A;  3OYZ A;  3SFD A;  2JPF A;  2CE7 A;  2LJL A;  2CA5 A;  3MJX A;  5AQS B;  5ABF B;  3R84 B;  4P0B A;  4IE4 A;  4MHC A;  2WDR A;  4KUM B;  3PUR A;  5LYJ E;  4E7S A;  2IC9 A;  4G2A A;  3ETV A;  2XQ7 A;  1JNR A;  2PTF A;  3MAC A;  3TLT A;  3ZLI A;  4DUY T;  4QXH B;  1VRB A;  2JRK A;  3RX6 A;  5KDM C;  1R8I A;  4JBW F;  3PJA A;  3ZYK A;  2LSJ A;  2GK9 A;  4IL9 A;  2XPK A;  4TN7 B;  2V7L A;  1IBM T;  2ZLY A;  3N2K E;  3P4S A;  2Q9Q D;  2W63 A;  5KX5 E;  4TNW A;  1W9R A;  3L3P A;  4FI5 A;  3J9X 1;  2HN1 A;  3B57 A;  1YQ3 A;  1D1A A;  1FMW A;  5JR9 A;  3V5S A;  2BDE A;  3VU7 H;  2CLY B;  2J62 A;  4HFB A;  3C98 B;  3BQL A;  1IBL T;  3CQG B;  2NWB A;  5LJM A;  4B6X A;  2FJA A;  5GON E;  5HEH A;  5ABH A;  2I0M A;  1ZV4 X;  5IWA T;  4YXD A;  1E2A A;  4ILA A;  2LLY A;  4YJ3 E;  1V9D A;  3UU4 A;  2OLT A;  5FVL A;  3EAB A;  3Q9D A;  2D0T A;  4I50 E;  4JI5 T;  5HXC A;  3AE1 A;  2D5U A;  4X66 T;  2ZM8 A;  2D9D A;  4YSZ A;  1N33 T;  3GN5 A;  3UQ4 A;  3AXJ B;  1FJG T;  4ILC A;  2LOP A;  2W4X A;  4JI8 T;  3CWZ B;  4U3C A;  5HCM A;  4Z90 A;  5LCY A;  3ZJ2 A;  3I1A A;  5JDN A;  3JC6 C;  5LG3 A;  3VKH A;  4X62 T;  3Q5X A;  4WW0 A;  3VRB A;  2PBI A;  3HKE E;  2H7O A;  5FXV A;  1N34 T;  2IDO B;  2XAS B;  4UF0 A;  2Y8D A;  2X0H A;  2CWY A;  1OXZ A;  3P4P A;  1GQE A;  4EB6 E;  3T1H T;  5AQT B;  3O9X A;  3LK2 B;  3AAI A;  4EYU A;  2MPK A;  5DQV A;  5JDM A;  5HEG A;  5L3B B;  3RKO A;  3AEC A;  4KHZ F;  1JNZ A;  4YFS A;  4LF7 T;  4YTP A;  3ANW A;  5IUX A;  2BKO A;  2WAU A;  4XBF B;  2XM2 A;  5JVD E;  2YDR A;  1YW0 A;  5ABG A;  5A1L A;  2E9X A;  3FBZ A;  3FXD B;  5LHH B;  2ZM6 T;  2L9Q A;  4CQI A;  2QGS A;  3VHL A;  2KWI B;  4O8S A;  4QH5 A;  4HFC A;  4IRE A;  4DR5 T;  2BS4 A;  4Z8X A;  1D0X A;  4X65 T;  2CM0 A;  2K48 A;  3P4R A;  1J1J A;  1BR2 A;  5LGN B;  3L8R A;  3PU3 A;  4K0K T;  4TX5 A;  5AQM B;  2FJD A;  1D1B A;  3AEF A;  3UT5 E;  2XM1 A;  1Y01 A;  2WB5 A;  3ZYM A;  5FL1 A;  4CXY A;  3UU5 A;  2VL0 A;  3GA8 A;  2NW7 A;  1IAP A;  2MOZ A;  3N2O A;  3ZMV B;  3V5U A;  2WCA A;  2YDQ A;  1NEK A;  1Z8U A;  3ONJ A;  3AAA B;  3H3M A;  5HCJ A;  2CBI A;  5F8P A;  2C0S A;  2C5I T;  2WWV A;  2LM9 A;  2IW5 B;  4EIW A;  2E5V A;  5LMN T;  1FIO A;  1W09 A;  1OED A;  4EOZ B;  4CN1 A;  2IHR 1;  4H9R C;  3P4Q A;  1OED C;  3CPZ A;  4LFC T;  3UFG A;  2XQ4 A;  1M62 A;  1S94 A;  2RP4 A;  5KMG P;  1WFD A;  4GK5 E;  4IGU A;  4PJL A;  4AKG A;  4O2B E;  1U5P A;  3ETU A;  4GIW A;  2WDQ A;  2MTQ A;  2WM9 A;  1G73 A;  1MMD A;  1W0B A;  5HXE A;  5CJ5 A;  2NW9 A;  3PE0 A;  4AIS A;  1UUR A;  2XHE B;  3EVY A;  5TAO A;  4OFZ A;  2WSS V;  4I55 E;  2DWG A;  4YTM A;  3J7Y q;  4JYA T;  3OBV E;  5M4Y A;  3WAK A;  3HKD E;  3JCF A;  4X5T A;  4DV4 T;  4MLK A;  4CI3 B;  5FMN A;  5LA6 E;  1HNX T;  3HR0 A;  3CQC B;  5CA0 E;  2BG9 B;  4HFE A;  2XTL A;  4CXW A;  4AKR B;  4UR9 A;  2E2A A;  3PJA J;  2YEV C;  2LSY A;  3SS1 A;  3AVS A;  3RIU A;  1CHU A;  3ZT5 A;  1HCI A;  2X66 A;  3K3N A;  2BKN A;  2C5K T;  2H89 A;  4HWC A;  3C50 A;  1UGO A;  4ZXL A;  2JQ9 A;  4EV6 A;  4ZHQ E;  3JAD A;  4P09 A;  2CEA A;  5JH7 E;  1B7T A;  3O1H A;  3ZST A;  5FNV E;  2OA5 A;  2H88 A;  4QX8 B;  4G63 A;  4DV1 T;  2LE8 A;  3NZP A;  3RC8 A;  3FZL B;  4UVC B;  4EXT A;  2Q9Q A;  4JLE A;  5JRE A;  2IUB A;  2BG9 C;  1MMA A;  2V5C A;  2K9A A;  1MNE A;  2PG8 A;  4TWF A;  4U74 A;  3RYF E;  4JI3 T;  3RYH E;  4KX6 A;  3SOL A;  2Q9Q C;  4DR1 T;  2NTX A;  3EHZ A;  2XAH B;  2EHO D;  4O2A E;  5ABE A;  2VVS A;  3C4X A;  5LHG B;  2UUB T;  5L47 A;  3N2G E;  3ZN1 B;  3G06 A;  2LSK A;  3P7I A;  2D0U A;  4K0U A;  4UEM A;  4DR7 T;  4V1A v;  4UXN B;  1XZY A;  3AEE A;  2XQ5 A;  3QUJ A;  3RIF A;  4LF4 T;  2WBL A;  1SUM B;  4AQF A;  2CWO A;  4WZX A;  5EZY E;  4BJN A;  2NP9 A;  1LKX A;  3TLW A;  2V6Y B;  2DCF A;  5LBM A;  2UUA T;  4ASK A;  5HEO A;  4ZI7 E;  4QX7 B;  3IEE A;  4BJM A;  2VWA A;  2HPL A;  4ZI3 D;  3PTR B;  3AE9 A;  5LGT B;  4YTN A;  4ZS3 A;  2K5B B;  4ANJ A;  1YKE B;  5HEJ A;  2WMO A;  5E0O A;  4ISS A;  2LSI A;  4AKH A;  1MMN A;  4HFH A;  2MAW A;  4MBQ A;  1OED E;  4IDP A;  2CHO A;  4IHJ E;  4QH4 A;  2K24 A;  3RRC A;  3OVU A;  5DJQ C;  4EAH A;  5JR9 B;  4JI4 T;  1NEN A;  3IHR A;  4NXN T;  2LHN A;  4O4L E;  3NVO A;  2CHN A;  3I0Q A;  4PJN A;  3CX8 B;  3RIA A;  1YD8 G;  1ZHC A;  1MMG A;  3PUQ A;  1HF8 A;  2VVN A;  3CKD A;  3CIR A;  3AEB A;  4QWN B;  3B13 A;  2V26 A;  2BS2 A;  3T8O A;  2J47 A;  3UFE A;  5LXT E;  2VKO A;  4LFA T;  2HN2 A;  5JQG E;  1LVF A;  4LMJ A;  1WR6 A;  2ODU A;  3AVR A;  3GN5 B;  4IDN A;  4EEB A;  2XQ6 A;  4LFB T;  1FMV A;  3VRA A;  5AQG B;  1O3X A;  2JQH A;  2W66 A;  5C2T A;  3PUZ F;  3ZSS A;  5JR9 C;  4IDQ A;  2IAK A;  2XAQ B;  3MA9 A;  2FBW A;  3B5M A;  4UF0 B;  4YJ2 E;  1T72 A;  4AKI A;  4TV8 E;  3N9Q A;  5DAB A;  2YU1 A;  2MBG A;  3C64 A;  1LVK A;  2Y6X A;  1D1C A;  2BBJ A;  3ZYL A;  4J2C A;  4PJM A;  3HKB E;  4DO0 A;  1WCR A;  4Z91 A;  5F3J A;  5AQK B;  5L3F B;  4U31 A;  2L8K A;  2DL1 A;  5CB4 E;  2DHR A;  3ANW B;  4U2Y A;  5CFB A;  4MFR A;  4O4I E;  5HXR A;  2LM2 A;  1FEW A;  4H63 H;  2BG9 E;  2KLQ A;  1HG5 A;  3RRW A;  4DR6 T;  3H3A A;  3PUV F;  1BR0 A;  4PJJ A;  2E9X B;  2XY8 B;  3S4U A;  3TLS A;  3L39 A;  2BVM A;  5AQU B;  4TWD A;  3UU6 A;  4PFP A;  3FHN A;  3MK7 C;  5FYM A;  3CML A;  5JDL A;  2HHH T;  3HI2 A;  4P0A A;  3ONL C;  5AQJ B;  1U4Q A;  3UUX B;  4ZEY A;  5H6R B;  5L3G B;  1XNR T;  5HXS A;  3K3O A;  2QYW A;  1G8X A;  1DU2 A;  3KV4 A;  4HFI A;  3UU3 A;  3U3I A;  3C51 A;  3OKQ A;  4U33 A;  2ODV A;  2UUC T;  5JDH A;  2W67 A;  4I43 B;  3ZMT B;  3E0Z A;  3E22 E;  4IE0 A;  5FY1 A;  5L2L A;  3BQI A;  1S35 A;  2E9X C;  5HEU A;  2KZ7 B;  5AQF B;  2XQ3 A;  4DV7 T;  4IST A;  1IJ6 A;  3N9P A;  3JAF A;  5HWY A;  1J5E T;  1HX8 A;  3AA7 B;  4JUY A;  2VQE T;  3NRY A;  4C90 A;  1NAF A;  1OED B;  2M6B A;  2NTY A;  4AQY T;  3Q5E A;  2UXC T;  2KND A;  3KDS E;  3PUA A;  1KNZ A;  3RC3 A;  2V7K A;  2BKP A;  4DV0 T;  4TNV A;  4DR3 T;  3KV5 A;  4LML A;  1HNW T;  3A8Y C;  4DMV A;  4HEA A;  3RYI E;  2Z6E A;  4EZH A;  1VCT A;  4H63 V;  2W2U A;  2X9X A;  4XAX B;  4O4J E;  2ZM2 A;  2V8S V;  5EK2 A;  4QKN A;  3VR8 A;  4I4T E;  3ZPO A;  3KIN B;  5JRC A;  2LEH A;  2H7V C;  3NZQ A;  3D0T A;  4X20 E;  3F2E A;  3AE6 A;  2EHO A;  2XQ8 A;  2E8I A;  2VK9 A;  3E08 A;  2XSA A;  1D0Z A;  4E7Z A;  4PK6 A;  3JC6 D;  3ZEF B;  4ZS2 A;  3AE4 A;  1QSD A;  3UUL A;  2I6H A;  2WZI A;  5LNK A;  4U2Z A;  2DNX A;  3AEA A;  4IIJ E;  1US7 B;  2UXB T;  3FZK B;  4BAY B;  3RI5 A;  3ZN0 B;  4ERR A;  2M67 A;  3QC9 A;  1D0Y A;  4YT0 A;  1UCU A;  2JIW A;  1UUS A;  4X1I E;  1SA0 E;  4GOU A;  3ZMZ B;  5AQR B;  3UTK A;  5AQI B;  1OWA A;  2IML A;  3R6N A;  5CA1 E;  4H9N C;  2MYS A;  4ZI3 C;  3FB2 A;  2DLR A;  5C8Y E;  2W62 A;  5AQV B;  1HX1 B;  3EDV A;  5JDQ A;  3U78 A;  4DBR A;  5HAX A;  3KV6 A;  3LK3 B;  4FJO A;  4PW8 A;  1IBK T;  2Q9Q B;  5J2T E;  3AA1 B;  3LBX B;  2UXN B;  3IF8 B;  1I6Z A;  3H37 A;  4U7Y A;  5LB7 B;  2V7I A;  1YXR A;  3N9L A;  3RF1 A;  3RIU C;  3O1J A;  2LOS A;  4TWH A;  4H9O C;  2W0G A;  5LP6 E;  1MIY A;  2ACX A;  5F5W A;  3RHW A;  2FJB A;  2RPA A;  4ILB A;  4DR2 T;  3M3Z B;  3EUH A;  2NOX A;  3AE2 A;  2KXP B;  4CI1 B;  2J1D G;  4COF A;  3DJB A;  4GYS A;  1HG2 A;  4YHH T;  2XQA A;  3ZKR A;  2A2F X;  3NKZ A;  2P9B A;  1QUU A;  4QH1 A;  4O4H E;  2IIU A;  2KT9 A;  3NRX A;  4XZC A;  4JI7 T;  3LSV A;  1E7P A;  2HH7 A;  3MXZ A;  1UX5 A;  5AQO B;  5AQL B;  1ZEE A;  4GK0 E;  4QHO A;  5BR8 T;  2YN6 A;  5FVK A;  2N2N A;  4AQG A;  5LJN A;  4I0U A;  1MIW A;  4CZZ B;  2C5J A;  2VUR A;  1T98 A;  2VKD A;  4LMK A;  4BA9 A;  4OX9 T;  2BS3 A;  3Q5W A;  3AE7 A;  2D2S A;  2RA1 A;  3RKG A;  5AFU L;  3VR9 A;  4QXC B;  5KXJ A;  4DVD A;  3EDU A;  3AED A;  4AQF C;  4HWH A;  4P1N A;  2XAG B;  2Y48 B;  4IDO A;  2CXD A;  2FUP A;  4HWI B;  5H6Q B;  3KBU A;  1H7C A;  3F57 A;  2CCQ A;  4EZ4 A;  4HFD A;  1QLB A;  1HFA A;  2BVL A;  3QNU A;  3RH3 A;  4KI0 F;  2X0L B;  2B1E A;  5L3E B;  4GKJ T;  1L0V A;  4ZZC A;  3TLV A;  3KBT A;  3PUS A;  5J0Z A;  4CXX A;  2X68 A;  4X64 T;  3O1I A;  1SHZ C;  3RYC E;  3SWH A;  2YDS A;  2LHR A;  3HL6 A;  2WQY A;  2X9H A;  5LHI B;  2VQF T;  2BBH A;  2W00 A;  2V6Y A;  4DBQ A;  4PAG A;  2WMN A;  3ZC0 A;  5FY0 A;  2CXL A;  2WU2 A;  4AI6 A;  4OYJ A;  3OJA A;  5L3C B;  2JMH A;  1X79 A;  3RGL A;  1J5W A;  4AKL A;  4GKK T;  4DV3 T;  2XZE A;  4JEU B;  5LBQ B;  4DUZ T;  4IDZ A;  3CX6 B;  2CPT A;  1HS7 A;  1UK5 A;  5FKY A;  3I0O A;  4DID B;  4WBO A;  3FZF B;  4ZOL E;  1XWM A;  3HA4 A;  2VKJ A;  4YSX A;  3QB5 K;  5ABF A;  3I9W A;  2ZMA A;  3CX7 B;  1HTJ F;  4KP3 C;  4WYV A;  3JAE A;  4UV9 B;  5LOV E;  3AEG A;  4ZI2 D;  3AE8 A;  4ILU A;  4NUV A;  3CQX C;  2E5L T;  2VL8 A; 
#chains in the Genus database with same CATH homology
 1HNX T;  4DV2 T;  1IBM T;  4AQY T;  4JI7 T;  4X64 T;  4LF5 T;  4NXM T;  4LF4 T;  2UXC T;  2UXD T;  4DR6 T;  4LF8 T;  4DV0 T;  4DR3 T;  5BR8 T;  4KHP T;  4LF7 T;  5LMN T;  1HNW T;  2VQF T;  4JI0 T;  1IBL T;  4LFA T;  2UUA T;  2HHH T;  5IWA T;  4OX9 T;  3T1Y T;  1I94 T;  4GKK T;  4LFC T;  4DV3 T;  1N36 T;  4LFB T;  1N32 T;  4B3T T;  1IBK T;  4YY3 T;  2ZM6 T;  4DUZ T;  4B3R T;  1XNQ T;  1XNR T;  1HNZ T;  4B3M T;  4JI5 T;  4LF9 T;  4DR5 T;  4B3S T;  4X66 T;  1HR0 T;  4DR4 T;  4JI2 T;  1N33 T;  4JI1 T;  1FJG T;  2UUC T;  4X65 T;  4JI8 T;  4DV1 T;  5LMU T;  4JI6 T;  4JV5 T;  4K0K T;  4DR2 T;  4X62 T;  4JI3 T;  3OTO T;  4LF6 T;  4DR1 T;  2UXB T;  2UU9 T;  4GKJ T;  4DV7 T;  4DUY T;  4JYA T;  1XMQ T;  1N34 T;  1J5E T;  2VQE T;  2UUB T;  4DV6 T;  1XMO T;  4DV5 T;  4JI4 T;  4YHH T;  4NXN T;  2F4V T;  4DV4 T;  2E5L T;  4DR7 T;  3T1H T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...