1HR0T

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hr0T00
4B3RT 4JI3T 4YY3T 4GKJT 4DR3T 2E5LT 4JI4T 4DR7T 4X64T 4B3MT 4DR4T 3OTOT 4X62T 4LF6T 4AQYT 1IBMT 4YHHT 2UUCT 4JI8T 4NXNT 4K0KT 1N33T 4DV7T 4JI2T 1J5ET 1XNRT 1XMOT 4LF5T 4NXMT 5LMNT 4OX9T 2HHHT 4LF8T 1HNXT 4DV5T 1HR0T 2UUBT 5LMUT 1I94T 4LF7T 4JI7T 4DV1T 4LFBT 2UXBT 1XMQT 4B3ST 4JI1T 4DV2T 2UXCT 4DV4T 4LFAT 4DR5T 2ZM6T 4DR6T 4DR1T 4JYAT 5BR8T 4KHPT 1N32T 1XNQT 2VQFT 4DV0T 4JI0T 3T1HT 1IBKT 4JI6T 2UXDT 1N36T 4GKKT 4JI5T 5IWAT 4X66T 1IBLT 4DR2T 4DV3T 4DUZT 4LFCT 2UU9T 1HNZT 2F4VT 4DUYT 4B3TT 1N34T 4X65T 4JV5T 1HNWT 2UUAT 3T1YT 2VQET 4DV6T 1FJGT 4LF9T 4LF4T
chains in the Genus database with same CATH superfamily
3ZJ2A 5LCYA 2J1DG 4AQFC 1UX5A 1WR6A 2XPKA 4DMVA 3AE1A 3RLFF 2A9UA 3TLTA 4GKJT 4L0RA 4I4TE 2HPJA 3AE3A 2E5LT 2BS3A 1ZOYA 2B76A 4IDQA 3UUNA 1E2AA 3OTOT 4JEUB 2PJQA 2QYWA 1ZV4X 3N9MA 4GK5E 4H63V 4AKLA 1HG5A 5LP6E 4AQYT 3OYZA 4EZ4A 1E1HB 2UUCT 5CB4E 3ZCJA 4OFZA 3ONXA 5DQWA 1T7SA 2LE8A 2V7JA 4IHJE 2WU2A 4YFSA 3GN5A 5JQGE 1M62A 2ES0A 2XAJB 5JDQA 2DWKA 3TLSA 2LHRA 3P4PA 4JI2T 4DUYT 4HWDA 4TN7B 5HWXA 2YU2A 2KLQA 2K3WA 5LGUB 1J5ET 2EHOC 2J4GA 4IDPA 1Z8UA 1UGOA 2HN1A 2VKOA 3F31A 2E9XC 4KHZF 3UU3A 4DMWA 4Z8XA 2WMOA 4QH1A 5FL0A 3HR0A 4ZI2C 1EZ3A 5LGTB 2Y6XA 5LMNT 3ZMUB 2JQHA 4OX9T 2Q9QB 2JIWA 3LDQB 4F6RC 3AEDA 3UQ7A 4XAXB 2C5IT 3RC8A 1HFAA 3KDSE 3PTRB 1O3XA 3EDUA 2YDSA 1KNZA 2UXNB 5HEGA 2UUBT 5EK2A 2HPLA 5LMUT 3NWIA 3T8OA 4CN1A 4DV1T 3TKLB 4PJNA 4LFBT 1J1JA 5LNKA 1BR1A 4JI1T 4PAGA 2XSAA 2XUEA 4M1PA 4K0UA 3KV5A 1OXZA 5AQRB 3PUXF 2XQ7A 5HEJA 1D0ZA 2XJ7A 4KI0F 1VRBA 3AEGA 2V6YB 2X67A 3I9YA 2NW9A 3DP7A 2QA7A 3FZHB 4ISTA 5LGNB 2F4VT 3NZPA 3GA8A 1HF8A 2VWAA 4ZS3A 3ZT6A 4ASKA 4EXTA 1KNPA 5L3EB 4JYAT 2FJDA 5LHHB 4BJMA 5BR8T 3UU8A 4PW8A 3RI5A 3ZT7A 3PU3A 5LBQB 2OV9A 3CQCB 3AXJA 3I1AA 4ZXLA 2AXDS 2YDRA 4DIDB 4ZOLE 3AE2A 1CHUA 1LVKA 4IDOA 5BMVE 5ABFB 2WB5A 1XNQT 1HTJF 1W0AA 4TWFA 4CXXA 1D1AA 2VQFT 3A8YC 3E22E 3N9LA 2WZHA 3G06A 2M6BA 3O4XE 3ZLIA 3Q5DA 2XQAA 4U2ZA 1MIVA 5FXZA 4F8HA 2LHNA 4MHCA 5FY7A 4KBMB 5FYMA 3N9OA 4LFAT 4IE6A 2MAWA 2XQ4A 3EDVA 2XAQB 2W62A 2J62A 4CI3B 3OPCA 4GYSA 4UVCB 5JH7E 5AQQB 3ZMTB 1UURA 2BG9A 3LSVA 1WYBA 1XWMA 4DBQA 2X9HA 3AA0B 3CX7B 4WBNE 4AISA 4CN4A 4IREA 2WWVA 5ABHA 2E5VA 5FY0A 2A2FX 5AQMB 3HI2A 4IDNA 3MXZA 3ZSTA 2VB6A 2X51A 5L3FB 2JMHA 1Y01A 2KSRA 2C0SA 2UU9T 2LT3A 1LVFA 2CCQA 3AEFA 4X1KE 4CQIA 5C2TA 4X1YE 5HXSA 5LHGB 4MLKA 2JQKA 2W61A 2EHOB 3K1SA 3P4SA 3PV0F 2WDVA 3PJAJ 5H6QB 2BKOA 2IIUA 2CM0A 2YK0A 4PFPA 3J9X1 3RQUA 3UUXB 4DVDA 4ILUA 3W15B 2XHEB 3L09A 4PFOA 4X65T 1HNWT 3ZMZB 4YJ2E 3IBPA 4EEBA 4IGUA 5F5WA 2XQ8A 4KP3C 4YXDA 3A7MA 4AKHA 3PURA 2I59A 3KVAA 4MBQA 3C51A 2H3RA 4XZCA 4AXPA 4EOZB 2KWIB 5AQSB 5KMGP 5L3CB 3RIUC 1KK7A 2D2SA 4O4LE 3AE4A 4UXNB 3ZYLA 3ZN0B 4ZI7E 3PUZF 2K5BB 3LK42 3N9NA 4IL9A 1OWAA 1CUNA 2Y48B 3ZMSB 4YY3T 4QWNB 2YDQA 3I0OA 2KNDA 4DO0A 3ZC0A 1S94A 5E0OA 4DR3T 2BG9C 4DR7T 3ZCIA 4BJNA 4TWDA 3RYHE 4IT4A 4DR4T 3RRCA 5F8PA 5KX5E 2LSYA 2L9QA 3NRXA 1BR2A 3RYFE 3ABVA 5EK4A 3AEBA 4NUUA 4YHHT 3HKCE 2LSGA 3VHLA 5L2LA 4NXNT 3CVRA 3IA3A 1ZHCA 4ISSA 4B6XA 4IIJE 1JNRA 4CI2B 5L3DB 3FZMB 1WFDA 4TV9E 5AQFB 4DV7T 1OEDA 4HFHA 3BQLA 4HEAA 2BBJA 5HXHA 3L39A 2X9WA 5AQLB 2MPKA 1ZEEA 2N2NA 4EYYR 5C8YE 1XMOT 4CXYA 5AQTB 1MMAA 3VRAA 3KV4A 4IE5A 3CK6A 2XQ9A 4HE8A 1SUMB 3B5MA 2NOXA 3I9WA 4IE7A 3PUWF 1UCUA 3GN5B 1SA0E 2YINA 3PUYF 3MA9A 2BG9E 3H3AA 3QUJA 3RC3A 2V5DA 1KNRA 4EGWA 1HR0T 2E9XD 2CLYC 5FVLA 1I94T 3KBUA 3AA6B 3NBXX 4I43B 3C64A 1IJ6A 1HX1B 3LBXA 5A1LA 5KDMC 4JI7T 1XZYA 4LF7T 2Q9QC 2WDRA 4B3ST 1G73A 2VL0A 3HKDE 2NWBA 3NZQA 3J7Yq 1LKXA 4AQGA 2ZMAA 2DI4A 2MYSA 2V26A 4NPPA 4Z91A 4YTPA 5JDMA 4DR5T 2ZM6T 4QX8B 4H9PC 1W09A 2KZ7B 4ZEYA 3AAAB 4MFRA 4PK4A 4HFEA 4NIQA 3AAEB 1QLBA 3RF1A 3ZPOA 2CPTA 2LM2A 3EUHA 4ANJA 2X0YA 4J2CA 2VKDA 3K3NA 3RIAA 3PU8A 3JADA 1T8BA 5HYAA 2QRXA 2M6IA 5TAOA 5AQNB 4KHPT 2Y8DA 2B1EA 2J47A 2GK9A 5JTGA 3M65A 3UTKA 5JDNA 5J2TE 1WCRA 2D9DA 5J1GA 2WM9A 2W0GA 3JAFA 1H7CA 3L8RA 5JDFA 1NWMX 4E7ZA 5J0ZA 5L4HA 5FXVA 4H9RC 4QH4A 3PUVF 4V1Av 1QUUA 1IZNB 3CQXC 4U3CA 3FB2A 5AQHB 3RGLA 4HFVA 2XM2A 3ZYKA 2VASA 4CN6A 3T1HT 1BR4A 2YEVC 3SOLA 3UFGA 3ZT5A 2BVLA 2XQ3A 3HA4A 4BA9A 5LHIB 2UXDT 1IAPA 1N36T 3O1HA 4MALA 4EB6E 3AVRA 4XBFB 4JI5T 5HEUA 3ZYMA 1QSDA 2JPFA 3PDYA 1UX4A 3OKQA 2IC6A 3UFEA 3JCFA 3UU5A 2D5UA 1HX8A 2IAKA 3RHWA 2KWHA 3FZKB 3X1DA 2WMNA 3CQGB 5GONE 5AQGB 4LFCT 4UEMA 3RKOA 5AQUB 3HKEE 4OYKA 1OEDE 4LMLA 2CXFA 4WW0A 3TLUA 2D0UA 4X1IE 1M7KA 2UXXB 4GYRA 3U78A 2K9AA 1UUSA 3EHZA 1ZP0A 2X66A 3P8CD 3Q5EA 5JVDE 3PUQA 3UU6A 4YSZA 1KF6A 1R8IA 3GMIA 3K8PC 3VRBA 2LKHA 1VCTA 3MZKB 4JV5T 2NTYA 3MK7C 3CIRA 3MJXA 3AEEA 4H9OC 2WCAA 2XAFB 2LRKA 5FXWA 2N1GA 3P4RA 2NW7A 4GOUA 4N78D 4TNVA 4QH5A 3VKHA 3H37A 4IE4A 3R84B 3P4WA 4HFBA 1FJGT 4GK0E 4PK6A 4OK0A 2RPAA 3DJBA 4ZZCA 4O4HE 5CA0E 4PJMA 3ZMVB 4TX5A 3ONLC 4U33A 5ABGA 3RYIE 4Z90A 2LJLA 3I0QA 3F2EA 2VK9A 3KVBA 3PJAA 2WQYA 2E9XB 3P4QA 2CBIA 4X64T 2Q9QA 2YU1A 5AFUL 3AAIA 3CPZA 3WAKA 1G8XA 4X62T 2MTQA 4LMJA 5L47A 2V8SV 5JRCA 1IBMT 1US7B 3VU7H 4CXWA 3KBTA 2BS2A 3FZFB 3ZEFB 4IE0A 4JI8T 2H88A 3CX6B 2W67A 2YN6A 1E7PA 3PUAA 4P09A 4UVAB 4U31A 2WP9A 4PNIA 1OEDB 4PK5A 1HCIA 2ZM8A 3WAJA 1NEKA 1GQEA 2CA5A 2I6HA 2LSIA 2ZLYA 3EVYA 1L0VA 3B57A 2CHNA 2Q9QD 3UT5E 3JC6C 1HS7A 2D0TA 1NENA 2JMKA 4LF5T 4HGAA 3LJCA 2XY8B 2N9DA 2BDEA 2LEHA 5LG4A 3AE5A 3GWHA 5HXCA 2FJEA 4BAYB 2CBJA 1OEDC 4AKIA 2W63A 3RKGA 5JDHA 4A98A 2E9XA 3C50A 4ILBA 2WY2A 4LF8T 1HNXT 2JJ9A 3RIUA 4EV6A 4U7IA 2X0LB 4HTEA 5LJNA 4TUYE 4DV5T 3BK9A 4HKAA 2IW5B 3RIFA 3AE6A 3RX6A 1T72A 3AE7A 2OLTA 3A5XA 4UV8B 3N2GE 3OYXA 2XQ6A 2FJAA 1XMQT 1KFYA 4O8SA 2IMLA 2WDQA 2QVAA 4HWHA 4LMKA 1YXRA 2P9BA 2VVSA 3IHRA 3NRYA 4FI5A 4O4JE 5HXRA 4DV4T 2W00A 2FUPA 3O9XA 4WNKA 2JQ9A 2BG9B 1D0YA 2NP9A 1S35A 4C90A 2K48A 2V1DB 3O1JA 2V6XA 4KMCA 3KINB 5FP3A 5HWYA 4WZXA 1MMGA 4KUMB 4UV9B 2CEAA 1MIWA 3K3QC 4P0AA 3RQWA 2OA5A 2XAGB 2BKNA 4AKRB 1U5PA 4DR6T 5CA1E 2VKJA 1N32T 4HFIA 3SWHA 1V9DA 4UELA 4DV0T 2WSSV 4ADZA 4JI0T 2HN2A 4OHFA 2WWUA 3IEEA 3KV9A 2ZM2A 4A97A 4YSYA 3AXJB 5F3JA 2LSKA 2CE7A 2KXPB 4H9NC 3ZKRA 4CI1B 3Q5XA 3SRZA 3N2OA 4ILCA 5AQOB 1IBKT 2VL8A 4H9SE 3MACA 2LOSA 3DTOA 2M67A 3FZLB 3H3MA 3AE9A 4TNWA 5JR9B 4GKKT 3RYCE 1JNZA 2LOPA 4ZZBA 2PBIA 3ESLA 4O2AE 5J2UE 4AKGA 2W66A 2XQ5A 3AB3B 4YT0A 5CFBA 5IWAT 2PG8A 3AA1B 3LK2B 4ZI3C 2XSBA 4WBOA 1IBLT 3B13A 2IDOB 3V5UA 2NW8A 4DUZT 5H6RB 4P1NA 4HFDA 2DL1A 4ZHQE 2PTFA 5ABEA 2YOEA 2CLYB 2XASB 3AEAA 2LLYA 3QB5K 3Q2MA 2QGSA 3C4XA 1FMWA 3Q5WA 4U2YA 2XZEA 2XAHB 1J5WA 3E08A 2KMFA 3C98B 5DJQC 3ZSSA 2Z6EA 2JQQA 2X0HA 4G2AA 2H7VC 4DV2T 4EAHA 2V6YA 3V5SA 3CKDA 3PUSA 3ZN1B 1VCSA 1D0XA 1HG2A 5IHYA 4DNDA 1N34T 4ZI3D 1XDOA 2R6GF 3LFMA 4C91A 4EZHA 4QXBB 5HEOA 4QKNA 3UU4A 2VQET 2XQYA 3ANWB 3JAEA 4UF0B 4FJOA 2YKSA 4UVBB 2BKPA 4KX6A 4YJ3E 1ZKEA 4YLHA 4DV6T 2MOZA 2DCFA 2DNXA 1FEWA 2DWGA 2LKGA 3CWZB 2W2UA 3K3OA 2CRBA 3P7IA 4ILAA 2CXLA 4UIGA 3SFEA 4B3RT 5EK3A 5CJ5A 5KXJA 4EEDA 4JI3T 3N5LA 2A72A 2IHR1 4G63A 4X5TA 4A5XA 1MMDA 1D1CA 3EAMA 2I0MA 3AA7B 4PJJA 3RH3A 4JI4T 4B3MT 5HCMA 3CMLA 4WYVA 3KV6A 4A56A 1MMNA 2EHOA 3OVUA 4EIWA 4L5GA 2ACXA 4LF6T 4JEHB 2E8IA 1KEYA 2BS4A 2FJBA 2WBLA 5FMNA 3U3IA 3KFWX 5IUXA 2XTLA 2RA1A 2W4XA 3M3ZB 4H9QC 5DABA 1AJ3A 4K0KT 1XDPA 3UULA 1YQ4A 5HXEA 4PJLA 1N33T 3CX8B 3UQ4A 3D0TA 3LG7A 2A3DA 5LOVE 1I6ZA 2CMRA 1U4QA 2ACZA 2C5KT 4NUVA 4O2BE 1W0BA 1YKEB 4CZZB 1SE7A 2JRKA 4COFA 3BQIA 1XNRT 1BR0A 5HAXA 4U7YA 3QC9A 4YTMA 2VVNA 4NXMT 5JRCB 2CWYA 4JUYA 4QXHB 3OBVE 3MKDA 1X79A 3EABA 3F57A 3QOFA 4X20E 5FNVE 2HHHT 3C4ZA 4U74A 1DU2A 3EI0A 1FMVA 1Z0PA 1T98A 2V7IA 5LBMA 5AQKB 4AQFA 2XM1A 2ODUA 4U72A 3RPUA 3L3PA 4ZI2D 5LXTE 1SHZC 3HL6A 3NVOA 3ETVA 5C3JA 2L3LA 2KINB 5CGMA 2EHOD 4HN9A 4UR9A 3JC6D 1WLXA 2L8KA 3N2KE 4TV8E 2SPCA 2H7OA 5AQJB 4O4IE 5AQVB 2UXBT 2WS3A 3ETUA 3FBZA 3PE0A 4JBWF 4Q25A 5HCJA 5L3GB 2CXDA 4YTNA 1VOMA 2X9YA 1WR0A 2UXCT 1YQ3A 2V5CA 1UK5A 4I0UA 4JLEA 3IF8B 3LK3B 2V7KA 4E7SA 4X66T 4DR1T 2CHOA 2V7LA 3UUBA 1MNEA 2VURA 5HEHA 1X9BA 4HWCA 3QB5A 5ETWA 3VR8A 2LRLA 4TWHA 1D1BA 4EYUA 1LRZA 2KT9A 2VKHA 3AE8A 2AE9A 4TZ4C 3BQKA 1B7TA 2LSJA 2ZM0A 3LBXB 3R6NA 4ERRA 3FXEB 5ADXL 5JR9C 3OJAA 3VR9A 5FL1A 2E2AA 2IUBA 3P50A 4AI6A 4QXCB 4P0BA 2X68A 1WYCA 2NR4A 2K24A 3HKBE 3N9PA 3S4UA 4GIWA 4HWFA 4JI6T 1IJ5A 5AQIB 1NAFA 2G0UA 5LB7B 3SS1A 5M4YA 2BBHA 2BZBA 3SFDA 1MIYA 4QX7B 4YHJA 3FBLA 4ZS2A 4H63H 5ABFA 5JDGA 5L4EA 3UUMA 2H89A 2IC9A 2V7MA 2X9XA 2FBWA 2C5JA 4QHOA 5AQPB 1Y64B 2RP4A 2BVMA 5EZYE 2WAUA 3TLVA 3ZC1A 5L3BB 4DV3T 4DR2T 2DLRA 3E0ZA 5FKYA 3AVSA 2ODVA 2LM9A 3ANWA 4I50E 4UF0A 5FY1A 3TLWA 4AIUA 3RRWA 4HFCA 1YW0A 4YSXA 2WZIA 1FIOA 3N9QA 3NKZA 4L9IA 4DBRA 5LG3A 2WU5A 1HNZT 5JR9A 3FXDB 1MNDA 4B3TT 3ZJ1A 4IDZA 3VKGA 4HWIB 3PUGA 1YD8G 5JDLA 3O1IA 5FVKA 3Q9DA 4OYJA 3FHNA 2UUAT 5LYJE 2DHRA 3T1YT 4IL4A 5FXXA 2MBGA 2PFVA 3ONJA 5JREA 3QK6A 3QNUA 5LA6E 3WI3A 1YKHB 5DQVA 2NTXA 1W9RA 3AECA 5IYZE 5LJMA 4I55E 3C4WA 1WRDA 2HH7A 2CWOA 4LF9T 4LF4T
chains in the Genus database with same CATH topology
4B3RT 4JI3T 4YY3T 4GKJT 4DR3T 2E5LT 4JI4T 4DR7T 4X64T 4B3MT 4DR4T 3OTOT 4X62T 4LF6T 4AQYT 1IBMT 4YHHT 2UUCT 4JI8T 4NXNT 4K0KT 1N33T 4DV7T 4JI2T 1J5ET 1XNRT 1XMOT 4LF5T 4NXMT 5LMNT 4OX9T 2HHHT 4LF8T 1HNXT 4DV5T 1HR0T 2UUBT 5LMUT 1I94T 4LF7T 4JI7T 4DV1T 4LFBT 2UXBT 1XMQT 4B3ST 4JI1T 4DV2T 2UXCT 4DV4T 4LFAT 4DR5T 2ZM6T 4DR6T 4DR1T 4JYAT 5BR8T 4KHPT 1N32T 1XNQT 2VQFT 4DV0T 4JI0T 3T1HT 1IBKT 4JI6T 2UXDT 1N36T 4GKKT 4JI5T 5IWAT 4X66T 1IBLT 4DR2T 4DV3T 4DUZT 4LFCT 2UU9T 1HNZT 2F4VT 4DUYT 4B3TT 1N34T 4X65T 4JV5T 1HNWT 2UUAT 3T1YT 2VQET 4DV6T 1FJGT 4LF9T 4LF4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R T;  4JI3 T;  4YY3 T;  4GKJ T;  4DR3 T;  2E5L T;  4JI4 T;  4DR7 T;  4X64 T;  4B3M T;  4DR4 T;  3OTO T;  4X62 T;  4LF6 T;  4AQY T;  1IBM T;  4YHH T;  2UUC T;  4JI8 T;  4NXN T;  4K0K T;  1N33 T;  4DV7 T;  4JI2 T;  1J5E T;  1XNR T;  1XMO T;  4LF5 T;  4NXM T;  5LMN T;  4OX9 T;  2HHH T;  4LF8 T;  1HNX T;  4DV5 T;  1HR0 T;  2UUB T;  5LMU T;  1I94 T;  4LF7 T;  4JI7 T;  4DV1 T;  4LFB T;  2UXB T;  1XMQ T;  4B3S T;  4JI1 T;  4DV2 T;  2UXC T;  4DV4 T;  4LFA T;  4DR5 T;  2ZM6 T;  4DR6 T;  4DR1 T;  4JYA T;  5BR8 T;  4KHP T;  1N32 T;  1XNQ T;  2VQF T;  4DV0 T;  4JI0 T;  3T1H T;  1IBK T;  4JI6 T;  2UXD T;  1N36 T;  4GKK T;  4JI5 T;  5IWA T;  4X66 T;  1IBL T;  4DR2 T;  4DV3 T;  4DUZ T;  4LFC T;  2UU9 T;  1HNZ T;  2F4V T;  4DUY T;  4B3T T;  1N34 T;  4X65 T;  4JV5 T;  1HNW T;  2UUA T;  3T1Y T;  2VQE T;  4DV6 T;  1FJG T;  4LF9 T;  4LF4 T; 
#chains in the Genus database with same CATH topology
 3ZJ2 A;  5LCY A;  2J1D G;  4AQF C;  1UX5 A;  1WR6 A;  2XPK A;  4DMV A;  3AE1 A;  3RLF F;  2A9U A;  3TLT A;  4GKJ T;  4L0R A;  4I4T E;  2HPJ A;  3AE3 A;  2E5L T;  2BS3 A;  1ZOY A;  2B76 A;  4IDQ A;  3UUN A;  1E2A A;  3OTO T;  4JEU B;  2PJQ A;  2QYW A;  1ZV4 X;  3N9M A;  4GK5 E;  4H63 V;  4AKL A;  1HG5 A;  5LP6 E;  4AQY T;  3OYZ A;  4EZ4 A;  1E1H B;  2UUC T;  5CB4 E;  3ZCJ A;  4OFZ A;  3ONX A;  5DQW A;  1T7S A;  2LE8 A;  2V7J A;  4IHJ E;  2WU2 A;  4YFS A;  3GN5 A;  5JQG E;  1M62 A;  2ES0 A;  2XAJ B;  5JDQ A;  2DWK A;  3TLS A;  2LHR A;  3P4P A;  4JI2 T;  4DUY T;  4HWD A;  4TN7 B;  5HWX A;  2YU2 A;  2KLQ A;  2K3W A;  5LGU B;  1J5E T;  2EHO C;  2J4G A;  4IDP A;  1Z8U A;  1UGO A;  2HN1 A;  2VKO A;  3F31 A;  2E9X C;  4KHZ F;  3UU3 A;  4DMW A;  4Z8X A;  2WMO A;  4QH1 A;  5FL0 A;  3HR0 A;  4ZI2 C;  1EZ3 A;  5LGT B;  2Y6X A;  5LMN T;  3ZMU B;  2JQH A;  4OX9 T;  2Q9Q B;  2JIW A;  3LDQ B;  4F6R C;  3AED A;  3UQ7 A;  4XAX B;  2C5I T;  3RC8 A;  1HFA A;  3KDS E;  3PTR B;  1O3X A;  3EDU A;  2YDS A;  1KNZ A;  2UXN B;  5HEG A;  2UUB T;  5EK2 A;  2HPL A;  5LMU T;  3NWI A;  3T8O A;  4CN1 A;  4DV1 T;  3TKL B;  4PJN A;  4LFB T;  1J1J A;  5LNK A;  1BR1 A;  4JI1 T;  4PAG A;  2XSA A;  2XUE A;  4M1P A;  4K0U A;  3KV5 A;  1OXZ A;  5AQR B;  3PUX F;  2XQ7 A;  5HEJ A;  1D0Z A;  2XJ7 A;  4KI0 F;  1VRB A;  3AEG A;  2V6Y B;  2X67 A;  3I9Y A;  2NW9 A;  3DP7 A;  2QA7 A;  3FZH B;  4IST A;  5LGN B;  2F4V T;  3NZP A;  3GA8 A;  1HF8 A;  2VWA A;  4ZS3 A;  3ZT6 A;  4ASK A;  4EXT A;  1KNP A;  5L3E B;  4JYA T;  2FJD A;  5LHH B;  4BJM A;  5BR8 T;  3UU8 A;  4PW8 A;  3RI5 A;  3ZT7 A;  3PU3 A;  5LBQ B;  2OV9 A;  3CQC B;  3AXJ A;  3I1A A;  4ZXL A;  2AXD S;  2YDR A;  4DID B;  4ZOL E;  3AE2 A;  1CHU A;  1LVK A;  4IDO A;  5BMV E;  5ABF B;  2WB5 A;  1XNQ T;  1HTJ F;  1W0A A;  4TWF A;  4CXX A;  1D1A A;  2VQF T;  3A8Y C;  3E22 E;  3N9L A;  2WZH A;  3G06 A;  2M6B A;  3O4X E;  3ZLI A;  3Q5D A;  2XQA A;  4U2Z A;  1MIV A;  5FXZ A;  4F8H A;  2LHN A;  4MHC A;  5FY7 A;  4KBM B;  5FYM A;  3N9O A;  4LFA T;  4IE6 A;  2MAW A;  2XQ4 A;  3EDV A;  2XAQ B;  2W62 A;  2J62 A;  4CI3 B;  3OPC A;  4GYS A;  4UVC B;  5JH7 E;  5AQQ B;  3ZMT B;  1UUR A;  2BG9 A;  3LSV A;  1WYB A;  1XWM A;  4DBQ A;  2X9H A;  3AA0 B;  3CX7 B;  4WBN E;  4AIS A;  4CN4 A;  4IRE A;  2WWV A;  5ABH A;  2E5V A;  5FY0 A;  2A2F X;  5AQM B;  3HI2 A;  4IDN A;  3MXZ A;  3ZST A;  2VB6 A;  2X51 A;  5L3F B;  2JMH A;  1Y01 A;  2KSR A;  2C0S A;  2UU9 T;  2LT3 A;  1LVF A;  2CCQ A;  3AEF A;  4X1K E;  4CQI A;  5C2T A;  4X1Y E;  5HXS A;  5LHG B;  4MLK A;  2JQK A;  2W61 A;  2EHO B;  3K1S A;  3P4S A;  3PV0 F;  2WDV A;  3PJA J;  5H6Q B;  2BKO A;  2IIU A;  2CM0 A;  2YK0 A;  4PFP A;  3J9X 1;  3RQU A;  3UUX B;  4DVD A;  4ILU A;  3W15 B;  2XHE B;  3L09 A;  4PFO A;  4X65 T;  1HNW T;  3ZMZ B;  4YJ2 E;  3IBP A;  4EEB A;  4IGU A;  5F5W A;  2XQ8 A;  4KP3 C;  4YXD A;  3A7M A;  4AKH A;  3PUR A;  2I59 A;  3KVA A;  4MBQ A;  3C51 A;  2H3R A;  4XZC A;  4AXP A;  4EOZ B;  2KWI B;  5AQS B;  5KMG P;  5L3C B;  3RIU C;  1KK7 A;  2D2S A;  4O4L E;  3AE4 A;  4UXN B;  3ZYL A;  3ZN0 B;  4ZI7 E;  3PUZ F;  2K5B B;  3LK4 2;  3N9N A;  4IL9 A;  1OWA A;  1CUN A;  2Y48 B;  3ZMS B;  4YY3 T;  4QWN B;  2YDQ A;  3I0O A;  2KND A;  4DO0 A;  3ZC0 A;  1S94 A;  5E0O A;  4DR3 T;  2BG9 C;  4DR7 T;  3ZCI A;  4BJN A;  4TWD A;  3RYH E;  4IT4 A;  4DR4 T;  3RRC A;  5F8P A;  5KX5 E;  2LSY A;  2L9Q A;  3NRX A;  1BR2 A;  3RYF E;  3ABV A;  5EK4 A;  3AEB A;  4NUU A;  4YHH T;  3HKC E;  2LSG A;  3VHL A;  5L2L A;  4NXN T;  3CVR A;  3IA3 A;  1ZHC A;  4ISS A;  4B6X A;  4IIJ E;  1JNR A;  4CI2 B;  5L3D B;  3FZM B;  1WFD A;  4TV9 E;  5AQF B;  4DV7 T;  1OED A;  4HFH A;  3BQL A;  4HEA A;  2BBJ A;  5HXH A;  3L39 A;  2X9W A;  5AQL B;  2MPK A;  1ZEE A;  2N2N A;  4EYY R;  5C8Y E;  1XMO T;  4CXY A;  5AQT B;  1MMA A;  3VRA A;  3KV4 A;  4IE5 A;  3CK6 A;  2XQ9 A;  4HE8 A;  1SUM B;  3B5M A;  2NOX A;  3I9W A;  4IE7 A;  3PUW F;  1UCU A;  3GN5 B;  1SA0 E;  2YIN A;  3PUY F;  3MA9 A;  2BG9 E;  3H3A A;  3QUJ A;  3RC3 A;  2V5D A;  1KNR A;  4EGW A;  1HR0 T;  2E9X D;  2CLY C;  5FVL A;  1I94 T;  3KBU A;  3AA6 B;  3NBX X;  4I43 B;  3C64 A;  1IJ6 A;  1HX1 B;  3LBX A;  5A1L A;  5KDM C;  4JI7 T;  1XZY A;  4LF7 T;  2Q9Q C;  2WDR A;  4B3S T;  1G73 A;  2VL0 A;  3HKD E;  2NWB A;  3NZQ A;  3J7Y q;  1LKX A;  4AQG A;  2ZMA A;  2DI4 A;  2MYS A;  2V26 A;  4NPP A;  4Z91 A;  4YTP A;  5JDM A;  4DR5 T;  2ZM6 T;  4QX8 B;  4H9P C;  1W09 A;  2KZ7 B;  4ZEY A;  3AAA B;  4MFR A;  4PK4 A;  4HFE A;  4NIQ A;  3AAE B;  1QLB A;  3RF1 A;  3ZPO A;  2CPT A;  2LM2 A;  3EUH A;  4ANJ A;  2X0Y A;  4J2C A;  2VKD A;  3K3N A;  3RIA A;  3PU8 A;  3JAD A;  1T8B A;  5HYA A;  2QRX A;  2M6I A;  5TAO A;  5AQN B;  4KHP T;  2Y8D A;  2B1E A;  2J47 A;  2GK9 A;  5JTG A;  3M65 A;  3UTK A;  5JDN A;  5J2T E;  1WCR A;  2D9D A;  5J1G A;  2WM9 A;  2W0G A;  3JAF A;  1H7C A;  3L8R A;  5JDF A;  1NWM X;  4E7Z A;  5J0Z A;  5L4H A;  5FXV A;  4H9R C;  4QH4 A;  3PUV F;  4V1A v;  1QUU A;  1IZN B;  3CQX C;  4U3C A;  3FB2 A;  5AQH B;  3RGL A;  4HFV A;  2XM2 A;  3ZYK A;  2VAS A;  4CN6 A;  3T1H T;  1BR4 A;  2YEV C;  3SOL A;  3UFG A;  3ZT5 A;  2BVL A;  2XQ3 A;  3HA4 A;  4BA9 A;  5LHI B;  2UXD T;  1IAP A;  1N36 T;  3O1H A;  4MAL A;  4EB6 E;  3AVR A;  4XBF B;  4JI5 T;  5HEU A;  3ZYM A;  1QSD A;  2JPF A;  3PDY A;  1UX4 A;  3OKQ A;  2IC6 A;  3UFE A;  3JCF A;  3UU5 A;  2D5U A;  1HX8 A;  2IAK A;  3RHW A;  2KWH A;  3FZK B;  3X1D A;  2WMN A;  3CQG B;  5GON E;  5AQG B;  4LFC T;  4UEM A;  3RKO A;  5AQU B;  3HKE E;  4OYK A;  1OED E;  4LML A;  2CXF A;  4WW0 A;  3TLU A;  2D0U A;  4X1I E;  1M7K A;  2UXX B;  4GYR A;  3U78 A;  2K9A A;  1UUS A;  3EHZ A;  1ZP0 A;  2X66 A;  3P8C D;  3Q5E A;  5JVD E;  3PUQ A;  3UU6 A;  4YSZ A;  1KF6 A;  1R8I A;  3GMI A;  3K8P C;  3VRB A;  2LKH A;  1VCT A;  3MZK B;  4JV5 T;  2NTY A;  3MK7 C;  3CIR A;  3MJX A;  3AEE A;  4H9O C;  2WCA A;  2XAF B;  2LRK A;  5FXW A;  2N1G A;  3P4R A;  2NW7 A;  4GOU A;  4N78 D;  4TNV A;  4QH5 A;  3VKH A;  3H37 A;  4IE4 A;  3R84 B;  3P4W A;  4HFB A;  1FJG T;  4GK0 E;  4PK6 A;  4OK0 A;  2RPA A;  3DJB A;  4ZZC A;  4O4H E;  5CA0 E;  4PJM A;  3ZMV B;  4TX5 A;  3ONL C;  4U33 A;  5ABG A;  3RYI E;  4Z90 A;  2LJL A;  3I0Q A;  3F2E A;  2VK9 A;  3KVB A;  3PJA A;  2WQY A;  2E9X B;  3P4Q A;  2CBI A;  4X64 T;  2Q9Q A;  2YU1 A;  5AFU L;  3AAI A;  3CPZ A;  3WAK A;  1G8X A;  4X62 T;  2MTQ A;  4LMJ A;  5L47 A;  2V8S V;  5JRC A;  1IBM T;  1US7 B;  3VU7 H;  4CXW A;  3KBT A;  2BS2 A;  3FZF B;  3ZEF B;  4IE0 A;  4JI8 T;  2H88 A;  3CX6 B;  2W67 A;  2YN6 A;  1E7P A;  3PUA A;  4P09 A;  4UVA B;  4U31 A;  2WP9 A;  4PNI A;  1OED B;  4PK5 A;  1HCI A;  2ZM8 A;  3WAJ A;  1NEK A;  1GQE A;  2CA5 A;  2I6H A;  2LSI A;  2ZLY A;  3EVY A;  1L0V A;  3B57 A;  2CHN A;  2Q9Q D;  3UT5 E;  3JC6 C;  1HS7 A;  2D0T A;  1NEN A;  2JMK A;  4LF5 T;  4HGA A;  3LJC A;  2XY8 B;  2N9D A;  2BDE A;  2LEH A;  5LG4 A;  3AE5 A;  3GWH A;  5HXC A;  2FJE A;  4BAY B;  2CBJ A;  1OED C;  4AKI A;  2W63 A;  3RKG A;  5JDH A;  4A98 A;  2E9X A;  3C50 A;  4ILB A;  2WY2 A;  4LF8 T;  1HNX T;  2JJ9 A;  3RIU A;  4EV6 A;  4U7I A;  2X0L B;  4HTE A;  5LJN A;  4TUY E;  4DV5 T;  3BK9 A;  4HKA A;  2IW5 B;  3RIF A;  3AE6 A;  3RX6 A;  1T72 A;  3AE7 A;  2OLT A;  3A5X A;  4UV8 B;  3N2G E;  3OYX A;  2XQ6 A;  2FJA A;  1XMQ T;  1KFY A;  4O8S A;  2IML A;  2WDQ A;  2QVA A;  4HWH A;  4LMK A;  1YXR A;  2P9B A;  2VVS A;  3IHR A;  3NRY A;  4FI5 A;  4O4J E;  5HXR A;  4DV4 T;  2W00 A;  2FUP A;  3O9X A;  4WNK A;  2JQ9 A;  2BG9 B;  1D0Y A;  2NP9 A;  1S35 A;  4C90 A;  2K48 A;  2V1D B;  3O1J A;  2V6X A;  4KMC A;  3KIN B;  5FP3 A;  5HWY A;  4WZX A;  1MMG A;  4KUM B;  4UV9 B;  2CEA A;  1MIW A;  3K3Q C;  4P0A A;  3RQW A;  2OA5 A;  2XAG B;  2BKN A;  4AKR B;  1U5P A;  4DR6 T;  5CA1 E;  2VKJ A;  1N32 T;  4HFI A;  3SWH A;  1V9D A;  4UEL A;  4DV0 T;  2WSS V;  4ADZ A;  4JI0 T;  2HN2 A;  4OHF A;  2WWU A;  3IEE A;  3KV9 A;  2ZM2 A;  4A97 A;  4YSY A;  3AXJ B;  5F3J A;  2LSK A;  2CE7 A;  2KXP B;  4H9N C;  3ZKR A;  4CI1 B;  3Q5X A;  3SRZ A;  3N2O A;  4ILC A;  5AQO B;  1IBK T;  2VL8 A;  4H9S E;  3MAC A;  2LOS A;  3DTO A;  2M67 A;  3FZL B;  3H3M A;  3AE9 A;  4TNW A;  5JR9 B;  4GKK T;  3RYC E;  1JNZ A;  2LOP A;  4ZZB A;  2PBI A;  3ESL A;  4O2A E;  5J2U E;  4AKG A;  2W66 A;  2XQ5 A;  3AB3 B;  4YT0 A;  5CFB A;  5IWA T;  2PG8 A;  3AA1 B;  3LK2 B;  4ZI3 C;  2XSB A;  4WBO A;  1IBL T;  3B13 A;  2IDO B;  3V5U A;  2NW8 A;  4DUZ T;  5H6R B;  4P1N A;  4HFD A;  2DL1 A;  4ZHQ E;  2PTF A;  5ABE A;  2YOE A;  2CLY B;  2XAS B;  3AEA A;  2LLY A;  3QB5 K;  3Q2M A;  2QGS A;  3C4X A;  1FMW A;  3Q5W A;  4U2Y A;  2XZE A;  2XAH B;  1J5W A;  3E08 A;  2KMF A;  3C98 B;  5DJQ C;  3ZSS A;  2Z6E A;  2JQQ A;  2X0H A;  4G2A A;  2H7V C;  4DV2 T;  4EAH A;  2V6Y A;  3V5S A;  3CKD A;  3PUS A;  3ZN1 B;  1VCS A;  1D0X A;  1HG2 A;  5IHY A;  4DND A;  1N34 T;  4ZI3 D;  1XDO A;  2R6G F;  3LFM A;  4C91 A;  4EZH A;  4QXB B;  5HEO A;  4QKN A;  3UU4 A;  2VQE T;  2XQY A;  3ANW B;  3JAE A;  4UF0 B;  4FJO A;  2YKS A;  4UVB B;  2BKP A;  4KX6 A;  4YJ3 E;  1ZKE A;  4YLH A;  4DV6 T;  2MOZ A;  2DCF A;  2DNX A;  1FEW A;  2DWG A;  2LKG A;  3CWZ B;  2W2U A;  3K3O A;  2CRB A;  3P7I A;  4ILA A;  2CXL A;  4UIG A;  3SFE A;  4B3R T;  5EK3 A;  5CJ5 A;  5KXJ A;  4EED A;  4JI3 T;  3N5L A;  2A72 A;  2IHR 1;  4G63 A;  4X5T A;  4A5X A;  1MMD A;  1D1C A;  3EAM A;  2I0M A;  3AA7 B;  4PJJ A;  3RH3 A;  4JI4 T;  4B3M T;  5HCM A;  3CML A;  4WYV A;  3KV6 A;  4A56 A;  1MMN A;  2EHO A;  3OVU A;  4EIW A;  4L5G A;  2ACX A;  4LF6 T;  4JEH B;  2E8I A;  1KEY A;  2BS4 A;  2FJB A;  2WBL A;  5FMN A;  3U3I A;  3KFW X;  5IUX A;  2XTL A;  2RA1 A;  2W4X A;  3M3Z B;  4H9Q C;  5DAB A;  1AJ3 A;  4K0K T;  1XDP A;  3UUL A;  1YQ4 A;  5HXE A;  4PJL A;  1N33 T;  3CX8 B;  3UQ4 A;  3D0T A;  3LG7 A;  2A3D A;  5LOV E;  1I6Z A;  2CMR A;  1U4Q A;  2ACZ A;  2C5K T;  4NUV A;  4O2B E;  1W0B A;  1YKE B;  4CZZ B;  1SE7 A;  2JRK A;  4COF A;  3BQI A;  1XNR T;  1BR0 A;  5HAX A;  4U7Y A;  3QC9 A;  4YTM A;  2VVN A;  4NXM T;  5JRC B;  2CWY A;  4JUY A;  4QXH B;  3OBV E;  3MKD A;  1X79 A;  3EAB A;  3F57 A;  3QOF A;  4X20 E;  5FNV E;  2HHH T;  3C4Z A;  4U74 A;  1DU2 A;  3EI0 A;  1FMV A;  1Z0P A;  1T98 A;  2V7I A;  5LBM A;  5AQK B;  4AQF A;  2XM1 A;  2ODU A;  4U72 A;  3RPU A;  3L3P A;  4ZI2 D;  5LXT E;  1SHZ C;  3HL6 A;  3NVO A;  3ETV A;  5C3J A;  2L3L A;  2KIN B;  5CGM A;  2EHO D;  4HN9 A;  4UR9 A;  3JC6 D;  1WLX A;  2L8K A;  3N2K E;  4TV8 E;  2SPC A;  2H7O A;  5AQJ B;  4O4I E;  5AQV B;  2UXB T;  2WS3 A;  3ETU A;  3FBZ A;  3PE0 A;  4JBW F;  4Q25 A;  5HCJ A;  5L3G B;  2CXD A;  4YTN A;  1VOM A;  2X9Y A;  1WR0 A;  2UXC T;  1YQ3 A;  2V5C A;  1UK5 A;  4I0U A;  4JLE A;  3IF8 B;  3LK3 B;  2V7K A;  4E7S A;  4X66 T;  4DR1 T;  2CHO A;  2V7L A;  3UUB A;  1MNE A;  2VUR A;  5HEH A;  1X9B A;  4HWC A;  3QB5 A;  5ETW A;  3VR8 A;  2LRL A;  4TWH A;  1D1B A;  4EYU A;  1LRZ A;  2KT9 A;  2VKH A;  3AE8 A;  2AE9 A;  4TZ4 C;  3BQK A;  1B7T A;  2LSJ A;  2ZM0 A;  3LBX B;  3R6N A;  4ERR A;  3FXE B;  5ADX L;  5JR9 C;  3OJA A;  3VR9 A;  5FL1 A;  2E2A A;  2IUB A;  3P50 A;  4AI6 A;  4QXC B;  4P0B A;  2X68 A;  1WYC A;  2NR4 A;  2K24 A;  3HKB E;  3N9P A;  3S4U A;  4GIW A;  4HWF A;  4JI6 T;  1IJ5 A;  5AQI B;  1NAF A;  2G0U A;  5LB7 B;  3SS1 A;  5M4Y A;  2BBH A;  2BZB A;  3SFD A;  1MIY A;  4QX7 B;  4YHJ A;  3FBL A;  4ZS2 A;  4H63 H;  5ABF A;  5JDG A;  5L4E A;  3UUM A;  2H89 A;  2IC9 A;  2V7M A;  2X9X A;  2FBW A;  2C5J A;  4QHO A;  5AQP B;  1Y64 B;  2RP4 A;  2BVM A;  5EZY E;  2WAU A;  3TLV A;  3ZC1 A;  5L3B B;  4DV3 T;  4DR2 T;  2DLR A;  3E0Z A;  5FKY A;  3AVS A;  2ODV A;  2LM9 A;  3ANW A;  4I50 E;  4UF0 A;  5FY1 A;  3TLW A;  4AIU A;  3RRW A;  4HFC A;  1YW0 A;  4YSX A;  2WZI A;  1FIO A;  3N9Q A;  3NKZ A;  4L9I A;  4DBR A;  5LG3 A;  2WU5 A;  1HNZ T;  5JR9 A;  3FXD B;  1MND A;  4B3T T;  3ZJ1 A;  4IDZ A;  3VKG A;  4HWI B;  3PUG A;  1YD8 G;  5JDL A;  3O1I A;  5FVK A;  3Q9D A;  4OYJ A;  3FHN A;  2UUA T;  5LYJ E;  2DHR A;  3T1Y T;  4IL4 A;  5FXX A;  2MBG A;  2PFV A;  3ONJ A;  5JRE A;  3QK6 A;  3QNU A;  5LA6 E;  3WI3 A;  1YKH B;  5DQV A;  2NTX A;  1W9R A;  3AEC A;  5IYZ E;  5LJM A;  4I55 E;  3C4W A;  1WRD A;  2HH7 A;  2CWO A;  4LF9 T;  4LF4 T; 
#chains in the Genus database with same CATH homology
 4B3R T;  4JI3 T;  4YY3 T;  4GKJ T;  4DR3 T;  2E5L T;  4JI4 T;  4DR7 T;  4X64 T;  4B3M T;  4DR4 T;  3OTO T;  4X62 T;  4LF6 T;  4AQY T;  1IBM T;  4YHH T;  2UUC T;  4JI8 T;  4NXN T;  4K0K T;  1N33 T;  4DV7 T;  4JI2 T;  1J5E T;  1XNR T;  1XMO T;  4LF5 T;  4NXM T;  5LMN T;  4OX9 T;  2HHH T;  4LF8 T;  1HNX T;  4DV5 T;  1HR0 T;  2UUB T;  5LMU T;  1I94 T;  4LF7 T;  4JI7 T;  4DV1 T;  4LFB T;  2UXB T;  1XMQ T;  4B3S T;  4JI1 T;  4DV2 T;  2UXC T;  4DV4 T;  4LFA T;  4DR5 T;  2ZM6 T;  4DR6 T;  4DR1 T;  4JYA T;  5BR8 T;  4KHP T;  1N32 T;  1XNQ T;  2VQF T;  4DV0 T;  4JI0 T;  3T1H T;  1IBK T;  4JI6 T;  2UXD T;  1N36 T;  4GKK T;  4JI5 T;  5IWA T;  4X66 T;  1IBL T;  4DR2 T;  4DV3 T;  4DUZ T;  4LFC T;  2UU9 T;  1HNZ T;  2F4V T;  4DUY T;  4B3T T;  1N34 T;  4X65 T;  4JV5 T;  1HNW T;  2UUA T;  3T1Y T;  2VQE T;  4DV6 T;  1FJG T;  4LF9 T;  4LF4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...