1HR0T

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hr0T00
1XMOT 1I94T 4JI0T 4DUYT 4LF6T 1N34T 2UXCT 4DR4T 4LF4T 1HNZT 4NXNT 4JI1T 4X62T 4X66T 4JI8T 2UUBT 4X64T 3T1HT 4B3RT 1IBLT 4DV7T 4LF9T 2UXDT 4DV2T 2VQFT 4JI3T 4DV4T 4DV0T 2VQET 4DV6T 4DV5T 1IBKT 2UU9T 4AQYT 4KHPT 1N32T 3OTOT 1J5ET 4X65T 3T1YT 4JI5T 5LMUT 4B3ST 5IWAT 4DR7T 4B3TT 4DR2T 4DV3T 1XMQT 1N36T 1N33T 2UUAT 4JYAT 1IBMT 2HHHT 2F4VT 4LFBT 4DV1T 1XNRT 5LMNT 4LFCT 1FJGT 4GKKT 1HR0T 4LF8T 2UUCT 4NXMT 4JI6T 4DR6T 1HNXT 4JV5T 4DR5T 4LFAT 4LF7T 4YY3T 1HNWT 4DR1T 4B3MT 5BR8T 4YHHT 4LF5T 4OX9T 4GKJT 4K0KT 4DUZT 4DR3T 2UXBT 4JI7T 1XNQT 2ZM6T 2E5LT 4JI2T 4JI4T
chains in the Genus database with same CATH superfamily
5LGTB 4UXNB 2VL0A 1KNZA 3PJAJ 4DBRA 5HEHA 2BBHA 4CN6A 3I0QA 4IE5A 4YJ3E 3C98B 2KWHA 3ABVA 3QUJA 4L9IA 3RIFA 3AE7A 3N9NA 4NUVA 1D1CA 1V9DA 1UCUA 3AAIA 4HFDA 2KZ7B 4L5GA 4HFCA 3RF1A 3ZMVB 3RKOA 2V7LA 2XASB 4DIDB 1WLXA 4ASKA 3UUXB 3PUGA 4MFRA 5EK3A 2X9WA 1OEDA 4OHFA 2V7MA 4O4HE 4EOZB 3RH3A 1NEKA 3IBPA 1UGOA 3AXJA 4ILAA 5ADXL 4UF0B 2QYWA 3N9QA 5HXCA 2UUBT 1OXZA 3D0TA 2JRKA 1UK5A 3LBXB 2DWKA 4O8SA 4PJLA 1Z0PA 2CHOA 3C50A 1ZHCA 2CRBA 4TZ4C 4B3RT 3P8CD 5HWXA 4YFSA 3WI3A 1HF8A 2LOPA 2N9DA 3AE5A 3JADA 4EGWA 1VOMA 1WYCA 4I4TE 3ZYKA 4DVDA 1T8BA 4HN9A 3FXEB 2XAQB 4O2AE 1WR6A 4CI2B 4EZ4A 4EZHA 2LSIA 2UXDT 3KV5A 2D5UA 3VKHA 5LBMA 2DCFA 2CBJA 4HTEA 3OJAA 1UX5A 1W09A 2LHNA 2DI4A 4IE6A 3SFDA 3RIUC 3TLUA 5HXEA 4JI3T 3P7IA 4EB6E 4DV0T 1J5WA 1JNZA 2Y8DA 4O4IE 5DQVA 5FYMA 5FVLA 4H9NC 3PUVF 2VVNA 2MAWA 2WCAA 3PV0F 4UIGA 4B6XA 3ZYLA 3QK6A 4IHJE 1L0VA 2N2NA 4ZI3D 4P0AA 4QHOA 2UU9T 2ZM0A 3OTOT 4NIQA 1J5ET 2L8KA 3AVSA 2GK9A 1AJ3A 5LHGB 2ZM8A 3ETUA 2YDQA 2WS3A 4B3ST 3U3IA 3K3OA 4ZZBA 4TUYE 2WB5A 4JBWF 4M1PA 3UFEA 2JMKA 4DR7T 1KNPA 1DU2A 4HFHA 5KMGP 1ZV4X 3HA4A 5DABA 3AEBA 3O1HA 3GN5B 2WP9A 5HYAA 4CZZB 3KINB 4AIUA 4H63H 4XAXB 3ZT7A 1MIWA 4IE0A 2YEVC 4AQFA 2CBIA 2XAFB 3HKBE 1MNEA 1OWAA 2CXDA 3I9YA 4TWDA 4U74A 4EIWA 2XSAA 2UUAT 2G0UA 3CK6A 2XQ5A 4HFBA 4CN1A 2HHHT 1E1HB 2CCQA 5FP3A 4UEMA 2CHNA 3P4SA 1NWMX 1U4QA 5ABFB 1T98A 4ILUA 4ILBA 3ONJA 2PG8A 4ZXLA 5IHYA 3ZN0B 4U3CA 1XDPA 3AE8A 4A97A 4EYYR 2XAJB 2WMOA 3AAEB 3N9MA 3EDVA 4LMKA 4NXMT 4QH1A 3AAAB 4DR6T 5LB7B 1GQEA 2LM2A 2KMFA 4PAGA 3N2GE 4JV5T 1FEWA 3ZLIA 2Z6EA 4XBFB 3RC8A 5EK2A 1Y01A 4FJOA 2R6GF 2WZHA 4LF7T 3MKDA 2NWBA 4IIJE 5JR9A 2K5BB 4KUMB 4L0RA 4DR1T 2JQKA 3PE0A 3RIUA 1YQ3A 3BQLA 3OYXA 3ZYMA 4TWHA 1XZYA 5L3CB 2D9DA 1Z8UA 3HKDE 4IDPA 2IC6A 4DR3T 3AE9A 3I1AA 3RYIE 4JI7T 3H37A 5JRCB 2LLYA 4O4JE 3SFEA 4C90A 4XZCA 3W15B 3FBLA 4JI2T 3KVAA 2FBWA 2V6XA 5AQNB 3SWHA 2OV9A 2A2FX 3AA6B 3EDUA 2AXDS 1QSDA 2YDRA 4JLEA 4QX7B 3ZMTB 2VKHA 2CMRA 1Y64B 3EHZA 1I94T 4MALA 2H88A 3M65A 2L3LA 4TNWA 3AE4A 1LVKA 4U7IA 5JDLA 2JQHA 3P4WA 2UXCT 3RLFF 1T72A 4HEAA 3ZMUB 4DR4T 1U5PA 2A72A 2BVLA 2ES0A 2BVMA 2CEAA 5CGMA 3C51A 2VKOA 2C0SA 3K1SA 3Q9DA 2BS3A 4LF4T 2LM9A 4WZXA 2WAUA 4PK6A 5AQSB 2NTYA 5JR9B 1HNZT 3NWIA 2VL8A 3A5XA 2KSRA 3FZFB 3VR9A 5FY1A 1S94A 5CJ5A 4X66T 2X51A 5CA1E 2V1DB 2V6YB 1CUNA 2BS4A 4DO0A 1LKXA 3FB2A 4X5TA 2XTLA 1FJGT 3E22E 3HKCE 3N2KE 5AQUB 1YQ4A 2XY8B 3C4WA 4PJMA 2V7JA 1UX4A 4N78D 3EABA 3A8YC 3VU7H 3C4XA 5LHHB 4TWFA 5DQWA 2ACZA 3NRXA 3PDYA 3UQ7A 4H9SE 4IDZA 2CM0A 3LSVA 3KBTA 4V1Av 5DJQC 2XAGB 5LG4A 2X9YA 2EHOD 3ETVA 2CXFA 5FY7A 2XQ8A 4WYVA 2X0LB 2W0GA 2VK9A 1UURA 3LK2B 4KI0F 2A9UA 3Q2MA 5JDGA 1HX1B 2BKNA 4LMLA 3E08A 4DV4T 3P4QA 4YT0A 2NOXA 3GN5A 2E9XC 2MOZA 4TV9E 4DV5T 2BG9E 1FIOA 4H9PC 1IJ5A 5J2UE 4KHPT 3PUSA 2KLQA 4PFOA 4X65T 4OFZA 2J4GA 2VASA 2WQYA 3WAJA 2LT3A 3NZPA 3CVRA 3OKQA 5LMUT 1W0AA 4QXCB 4HKAA 2NW8A 2W66A 2H89A 2V8SV 1H7CA 4AI6A 2CLYC 2N1GA 5HXSA 5JVDE 1OEDC 2VURA 3PUXF 4TX5A 3KBUA 1XWMA 1FMWA 2I0MA 4PFPA 1EZ3A 4X1IE 2BG9A 2W62A 3AA7B 1FMVA 5AQGB 3RYCE 5AQFB 5L47A 2J62A 5LJNA 3J7Yq 2AE9A 2C5JA 3VRAA 1VRBA 2BS2A 1BR4A 2WDQA 5JREA 3N9PA 2HH7A 2LSKA 3NRYA 5E0OA 3RRCA 3O4XE 3ZKRA 5JDQA 2ZLYA 3IHRA 3NBXX 4GYRA 3G06A 4HGAA 4PJJA 5AQTB 4JYAT 1M62A 2YN6A 4AKIA 1QLBA 2F4VT 4BA9A 4LFBT 5C3JA 2MYSA 3OVUA 2I6HA 2LKHA 3CKDA 2EHOC 2V7IA 1QUUA 5LMNT 4HFVA 3ZSTA 3UUBA 3JCFA 4TNVA 2B76A 5KX5E 3VRBA 2LE8A 5FXVA 2XQ7A 3H3AA 3ZJ2A 1HG5A 2JQQA 2NP9A 4DNDA 4U2YA 5L3BB 2LHRA 3ZMSB 1HR0T 4YHJA 2YOEA 1WRDA 3IA3A 5FKYA 1HNXT 3LBXA 4TV8E 3CX7B 4HE8A 2BG9B 4YLHA 5LCYA 3RC3A 5LGUB 2WU5A 3CMLA 3L39A 4UF0A 3GA8A 5AQHB 2Q9QC 4Z90A 3N9OA 2PFVA 3VR8A 5AQIB 5LGNB 3PJAA 2V7KA 3DTOA 4Q25A 2Y6XA 3KDSE 3RYHE 1BR1A 5BR8T 2DL1A 2XQ4A 5JTGA 5LXTE 1YKHB 3P4PA 2B1EA 5HXRA 3AEFA 3TLVA 5F3JA 4GKJT 4K0KT 3F31A 1YXRA 3PTRB 3PU8A 3RRWA 3T8OA 2UXBT 5AQOB 2CA5A 4P09A 4H63V 2PTFA 1LRZA 3A7MA 3GMIA 3CQXC 2ZM6T 2X0HA 2NR4A 3HR0A 4WNKA 4YXDA 3QB5K 5JDFA 3B5MA 3UUMA 2QRXA 2XQ6A 3EI0A 5LG3A 3KV4A 1HCIA 3Q5EA 3QB5A 4EXTA 2WWUA 5ABFA 3U78A 2KINB 3GWHA 3FBZA 2E5VA 5ABHA 1CHUA 2NW7A 5HCMA 1IAPA 2WWVA 5JDHA 4AKGA 4YTNA 3ONXA 3ZT6A 3L8RA 4U33A 3BQIA 3LFMA 2FUPA 2V26A 2LOSA 2VKDA 3KVBA 4GIWA 3L3PA 4OYKA 3PUQA 1MMAA 3ZCJA 5JDNA 5LJMA 4BJMA 4J2CA 2A3DA 1MIVA 1BR2A 4A56A 4NXNT 2V6YA 2XZEA 2BKOA 2NTXA 4UVBB 4QH5A 4JI8T 3UU6A 3X1DA 2OLTA 4AQGA 2EHOA 2JIWA 3OBVE 4UELA 3UUNA 2ZM2A 3AEAA 4U72A 4EV6A 2BKPA 2CE7A 3LG7A 3TLTA 1D0XA 2LJLA 2M67A 3T1HT 3JAEA 2MTQA 2CXLA 4DV7T 2KNDA 1US7B 2K9AA 2XQYA 3Q5WA 2PBIA 2FJEA 4IT4A 3RHWA 2XM2A 4QXHB 4CI3B 4HWFA 2K24A 2XSBA 4MBQA 5ABEA 2HN2A 4HFIA 4LF9T 3SOLA 1T7SA 2JPFA 3I0OA 4CI1B 4NPPA 5FMNA 2RPAA 2W67A 1S35A 3ZN1B 3FZLB 3V5SA 4DV2T 4ISSA 2BDEA 2IDOB 3QOFA 3WAKA 3K3NA 1O3XA 5FNVE 4C91A 2VQFT 2C5KT 4ZOLE 2WBLA 3ONLC 4X20E 1G73A 2VQET 1I6ZA 4UVCB 5JRCA 2WZIA 2XPKA 3OPCA 3AXJB 3RQUA 1IBKT 3ZC0A 3CQGB 2E2AA 1OEDB 5HEJA 3LK42 1UUSA 1WCRA 2HPLA 5CB4E 5AQRB 5AQPB 5LYJE 5IWAT 3DP7A 2JJ9A 4G63A 3TLWA 1ZKEA 5AQMB 3UTKA 2CPTA 4WBOA 5FL0A 4F8HA 1D0ZA 4CN4A 1NENA 5CA0E 4I55E 4NUUA 2X0YA 4CXYA 2X9XA 2CWYA 4PK4A 4G2AA 1N32T 3NKZA 3O1IA 4WW0A 4DR2T 1XDOA 2KWIB 4QX8B 4OYJA 1XMQT 2NW9A 5L3FB 2ODVA 1SUMB 1N36T 1ZP0A 3AE1A 2IMLA 1WFDA 3B13A 3RQWA 4AQFC 5J2TE 3RIAA 3FZHB 2LRKA 5J0ZA 2QGSA 3VKGA 4GYSA 3UU8A 2J1DG 2IW5B 2XUEA 2ACXA 4HFEA 3ZC1A 3MACA 4E7ZA 3C4ZA 4DV1T 1XNRT 4EYUA 3BQKA 2WU2A 2FJDA 5H6RB 5AQJB 4DMWA 2WY2A 4CXXA 4LFCT 4DV6T 3CQCB 4I43B 5FXZA 5JH7E 2YKSA 1HX8A 3AA0B 2DLRA 3AE3A 2V5DA 5HCJA 5HWYA 4ADZA 3V5UA 4H9QC 4IDQA 4KBMB 5F8PA 2X67A 2Q9QB 2QVAA 3F57A 2UUCT 4JI6T 3ZJ1A 5FL1A 4UV8B 2LRLA 4PW8A 4BAYB 3NVOA 3KV6A 3NZQA 2IC9A 2E9XA 2VB6A 4H9RC 5JDMA 3SRZA 4YY3T 3PUAA 2LEHA 2XM1A 3EAMA 4YJ2E 1WR0A 2DNXA 2XAHB 4YSZA 3FXDB 5LA6E 4IL4A 3CWZB 5H6QB 2P9BA 1IZNB 2M6BA 4YHHT 2UXXB 2WDVA 2YDSA 3B57A 4LF5T 3TLSA 2FJAA 4YSYA 3L09A 3VHLA 2D0UA 2VKJA 2IHR1 4A98A 4UR9A 2YK0A 4O2BE 4ZZCA 1XNQT 2FJBA 1VCTA 3N9LA 3JAFA 2PJQA 3MJXA 4JI4T 3ZEFB 4ZI3C 3MZKB 5J1GA 3PUYF 4OK0A 4E7SA 1XMOT 2E9XD 3AEDA 4EEDA 4EAHA 4A5XA 3PUWF 2BBJA 2VVSA 2IIUA 4ZI2D 4ILCA 2H7OA 3AEEA 4JI0T 3O9XA 2XQ9A 1YD8G 4DBQA 4F6RC 3IF8B 4DUYT 2LSJA 1G8XA 4EEBA 2H7VC 4ZI2C 4K0UA 4LF6T 1N34T 2HN1A 2YINA 2WMNA 5LBQB 4U31A 2MPKA 2W61A 4X1YE 5AQQB 4HWHA 4PNIA 3KV9A 3AE6A 3ZCIA 3KFWX 2WDRA 1ZOYA 3DJBA 5FVKA 2X9HA 4JI1T 2XJ7A 2CWOA 4X62T 2SPCA 1D1AA 2Y48B 3P4RA 1JNRA 2E8IA 4LMJA 3RKGA 4ZEYA 5HEGA 4YTMA 1WYBA 4X64T 2W00A 1KFYA 2I59A 3MA9A 5EK4A 2Q9QA 5L2LA 3HL6A 4H9OC 3FHNA 2ZMAA 3F2EA 4HWIB 4QKNA 5ABGA 5CFBA 1IBLT 1HTJF 2JQ9A 4ANJA 4AKHA 1X79A 4KHZF 1R8IA 1SHZC 3AB3B 3OYZA 3UU3A 2W63A 3JC6D 3CPZA 4KMCA 3ZSSA 5LP6E 1E7PA 2D0TA 3MK7C 5FXXA 3ANWA 2K48A 2W4XA 3CX6B 3C64A 2DWGA 4U7YA 4UV9B 3MXZA 4IGUA 4Z91A 1SE7A 2WM9A 5AQLB 5FXWA 5IYZE 3RYFE 4Z8XA 1KNRA 4IL9A 2XQAA 2LKGA 4O4LE 2C5IT 2RA1A 4QWNB 2BZBA 3J9X1 2IUBA 3RPUA 3K3QC 4ZHQE 1MIYA 2OA5A 2ODUA 3H3MA 3ANWB 3FZKB 3LJCA 4ZS2A 2YU2A 2YU1A 1KK7A 2L9QA 1HFAA 3AA1B 2RP4A 3CX8B 3UQ4A 2QA7A 4CXWA 2H3RA 1IJ6A 3UU5A 4QH4A 5F5WA 4ZI7E 5JR9C 4AQYT 2KT9A 4PK5A 2IAKA 5AQVB 3TKLB 2M6IA 3T1YT 4WBNE 2J47A 2JMHA 1NAFA 2LSYA 3E0ZA 1D1BA 4U2ZA 4JI5T 3UT5E 3ZPOA 4X1KE 2X66A 3JC6C 4P0BA 2WSSV 1M7KA 4GK5E 5EZYE 4BJNA 1YKEB 3P50A 4IDOA 4B3TT 3N2OA 4YTPA 1W0BA 2BG9C 4IE7A 2UXNB 5HEUA 1HG2A 5A1LA 3QNUA 5BMVE 1J1JA 3HKEE 1LVFA 1B7TA 4ISTA 5LOVE 3HI2A 3UFGA 5AFUL 2Q9QD 3AE2A 2LSGA 4FI5A 5L3EB 4GK0E 4DV3T 1HNWT 1SA0E 2V5CA 5HAXA 3O1JA 3Q5DA 5LHIB 3RX6A 2MBGA 1N33T 1MNDA 5C8YE 2K3WA 3BK9A 4PJNA 4IREA 4AXPA 1OEDE 4AKRB 5M4YA 4MHCA 3R6NA 1IBMT 1D0YA 1ZEEA 4ERRA 4YSXA 5HEOA 3RGLA 3PU3A 3UU4A 5L4HA 3UULA 3LK3B 5KXJA 1YW0A 4GKKT 4I50E 4TN7B 4HWCA 4IE4A 4MLKA 2VWAA 3CIRA 3FZMB 4JEHB 4LF8T 4JEUB 3N5LA 3QC9A 3S4UA 5IUXA 5JQGE 2EHOB 3PUZF 4KX6A 5TAOA 4JUYA 3M3ZB 3RI5A 1MMDA 4DR5T 4LFAT 2CLYB 4IDNA 3LDQB 4KP3C 5L3DB 4COFA 5KDMC 1KF6A 3AEGA 4HWDA 3K8PC 3PURA 3R84B 4P1NA 5C2TA 1BR0A 2DHRA 4GOUA 5FY0A 3IEEA 2W2UA 4I0UA 5ETWA 4AKLA 4B3MT 4UVAB 2XQ3A 1HS7A 1E2AA 3SS1A 4OX9T 2HPJA 4CQIA 1VCSA 2D2SA 4QXBB 3I9WA 5L3GB 5AQKB 5LNKA 4DUZT 1MMNA 1W9RA 2E9XB 4DMVA 1X9BA 5GONE 3ZT5A 1MMGA 3EVYA 3Q5XA 3AECA 3ZMZB 4AISA 2KXPB 3ESLA 2X68A 5L4EA 2E5LT 2XHEB 4ZS3A 3EUHA 1KEYA 3AVRA 5HXHA
chains in the Genus database with same CATH topology
1XMOT 1I94T 4JI0T 4DUYT 4LF6T 1N34T 2UXCT 4DR4T 4LF4T 1HNZT 4NXNT 4JI1T 4X62T 4X66T 4JI8T 2UUBT 4X64T 3T1HT 4B3RT 1IBLT 4DV7T 4LF9T 2UXDT 4DV2T 2VQFT 4JI3T 4DV4T 4DV0T 2VQET 4DV6T 4DV5T 1IBKT 2UU9T 4AQYT 4KHPT 1N32T 3OTOT 1J5ET 4X65T 3T1YT 4JI5T 5LMUT 4B3ST 5IWAT 4DR7T 4B3TT 4DR2T 4DV3T 1XMQT 1N36T 1N33T 2UUAT 4JYAT 1IBMT 2HHHT 2F4VT 4LFBT 4DV1T 1XNRT 5LMNT 4LFCT 1FJGT 4GKKT 1HR0T 4LF8T 2UUCT 4NXMT 4JI6T 4DR6T 1HNXT 4JV5T 4DR5T 4LFAT 4LF7T 4YY3T 1HNWT 4DR1T 4B3MT 5BR8T 4YHHT 4LF5T 4OX9T 4GKJT 4K0KT 4DUZT 4DR3T 2UXBT 4JI7T 1XNQT 2ZM6T 2E5LT 4JI2T 4JI4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO T;  1I94 T;  4JI0 T;  4DUY T;  4LF6 T;  1N34 T;  2UXC T;  4DR4 T;  4LF4 T;  1HNZ T;  4NXN T;  4JI1 T;  4X62 T;  4X66 T;  4JI8 T;  2UUB T;  4X64 T;  3T1H T;  4B3R T;  1IBL T;  4DV7 T;  4LF9 T;  2UXD T;  4DV2 T;  2VQF T;  4JI3 T;  4DV4 T;  4DV0 T;  2VQE T;  4DV6 T;  4DV5 T;  1IBK T;  2UU9 T;  4AQY T;  4KHP T;  1N32 T;  3OTO T;  1J5E T;  4X65 T;  3T1Y T;  4JI5 T;  5LMU T;  4B3S T;  5IWA T;  4DR7 T;  4B3T T;  4DR2 T;  4DV3 T;  1XMQ T;  1N36 T;  1N33 T;  2UUA T;  4JYA T;  1IBM T;  2HHH T;  2F4V T;  4LFB T;  4DV1 T;  1XNR T;  5LMN T;  4LFC T;  1FJG T;  4GKK T;  1HR0 T;  4LF8 T;  2UUC T;  4NXM T;  4JI6 T;  4DR6 T;  1HNX T;  4JV5 T;  4DR5 T;  4LFA T;  4LF7 T;  4YY3 T;  1HNW T;  4DR1 T;  4B3M T;  5BR8 T;  4YHH T;  4LF5 T;  4OX9 T;  4GKJ T;  4K0K T;  4DUZ T;  4DR3 T;  2UXB T;  4JI7 T;  1XNQ T;  2ZM6 T;  2E5L T;  4JI2 T;  4JI4 T; 
#chains in the Genus database with same CATH topology
 5LGT B;  4UXN B;  2VL0 A;  1KNZ A;  3PJA J;  4DBR A;  5HEH A;  2BBH A;  4CN6 A;  3I0Q A;  4IE5 A;  4YJ3 E;  3C98 B;  2KWH A;  3ABV A;  3QUJ A;  4L9I A;  3RIF A;  3AE7 A;  3N9N A;  4NUV A;  1D1C A;  1V9D A;  1UCU A;  3AAI A;  4HFD A;  2KZ7 B;  4L5G A;  4HFC A;  3RF1 A;  3ZMV B;  3RKO A;  2V7L A;  2XAS B;  4DID B;  1WLX A;  4ASK A;  3UUX B;  3PUG A;  4MFR A;  5EK3 A;  2X9W A;  1OED A;  4OHF A;  2V7M A;  4O4H E;  4EOZ B;  3RH3 A;  1NEK A;  3IBP A;  1UGO A;  3AXJ A;  4ILA A;  5ADX L;  4UF0 B;  2QYW A;  3N9Q A;  5HXC A;  2UUB T;  1OXZ A;  3D0T A;  2JRK A;  1UK5 A;  3LBX B;  2DWK A;  4O8S A;  4PJL A;  1Z0P A;  2CHO A;  3C50 A;  1ZHC A;  2CRB A;  4TZ4 C;  4B3R T;  3P8C D;  5HWX A;  4YFS A;  3WI3 A;  1HF8 A;  2LOP A;  2N9D A;  3AE5 A;  3JAD A;  4EGW A;  1VOM A;  1WYC A;  4I4T E;  3ZYK A;  4DVD A;  1T8B A;  4HN9 A;  3FXE B;  2XAQ B;  4O2A E;  1WR6 A;  4CI2 B;  4EZ4 A;  4EZH A;  2LSI A;  2UXD T;  3KV5 A;  2D5U A;  3VKH A;  5LBM A;  2DCF A;  2CBJ A;  4HTE A;  3OJA A;  1UX5 A;  1W09 A;  2LHN A;  2DI4 A;  4IE6 A;  3SFD A;  3RIU C;  3TLU A;  5HXE A;  4JI3 T;  3P7I A;  4EB6 E;  4DV0 T;  1J5W A;  1JNZ A;  2Y8D A;  4O4I E;  5DQV A;  5FYM A;  5FVL A;  4H9N C;  3PUV F;  2VVN A;  2MAW A;  2WCA A;  3PV0 F;  4UIG A;  4B6X A;  3ZYL A;  3QK6 A;  4IHJ E;  1L0V A;  2N2N A;  4ZI3 D;  4P0A A;  4QHO A;  2UU9 T;  2ZM0 A;  3OTO T;  4NIQ A;  1J5E T;  2L8K A;  3AVS A;  2GK9 A;  1AJ3 A;  5LHG B;  2ZM8 A;  3ETU A;  2YDQ A;  2WS3 A;  4B3S T;  3U3I A;  3K3O A;  4ZZB A;  4TUY E;  2WB5 A;  4JBW F;  4M1P A;  3UFE A;  2JMK A;  4DR7 T;  1KNP A;  1DU2 A;  4HFH A;  5KMG P;  1ZV4 X;  3HA4 A;  5DAB A;  3AEB A;  3O1H A;  3GN5 B;  2WP9 A;  5HYA A;  4CZZ B;  3KIN B;  4AIU A;  4H63 H;  4XAX B;  3ZT7 A;  1MIW A;  4IE0 A;  2YEV C;  4AQF A;  2CBI A;  2XAF B;  3HKB E;  1MNE A;  1OWA A;  2CXD A;  3I9Y A;  4TWD A;  4U74 A;  4EIW A;  2XSA A;  2UUA T;  2G0U A;  3CK6 A;  2XQ5 A;  4HFB A;  4CN1 A;  2HHH T;  1E1H B;  2CCQ A;  5FP3 A;  4UEM A;  2CHN A;  3P4S A;  1NWM X;  1U4Q A;  5ABF B;  1T98 A;  4ILU A;  4ILB A;  3ONJ A;  2PG8 A;  4ZXL A;  5IHY A;  3ZN0 B;  4U3C A;  1XDP A;  3AE8 A;  4A97 A;  4EYY R;  2XAJ B;  2WMO A;  3AAE B;  3N9M A;  3EDV A;  4LMK A;  4NXM T;  4QH1 A;  3AAA B;  4DR6 T;  5LB7 B;  1GQE A;  2LM2 A;  2KMF A;  4PAG A;  3N2G E;  4JV5 T;  1FEW A;  3ZLI A;  2Z6E A;  4XBF B;  3RC8 A;  5EK2 A;  1Y01 A;  4FJO A;  2R6G F;  2WZH A;  4LF7 T;  3MKD A;  2NWB A;  4IIJ E;  5JR9 A;  2K5B B;  4KUM B;  4L0R A;  4DR1 T;  2JQK A;  3PE0 A;  3RIU A;  1YQ3 A;  3BQL A;  3OYX A;  3ZYM A;  4TWH A;  1XZY A;  5L3C B;  2D9D A;  1Z8U A;  3HKD E;  4IDP A;  2IC6 A;  4DR3 T;  3AE9 A;  3I1A A;  3RYI E;  4JI7 T;  3H37 A;  5JRC B;  2LLY A;  4O4J E;  3SFE A;  4C90 A;  4XZC A;  3W15 B;  3FBL A;  4JI2 T;  3KVA A;  2FBW A;  2V6X A;  5AQN B;  3SWH A;  2OV9 A;  2A2F X;  3AA6 B;  3EDU A;  2AXD S;  1QSD A;  2YDR A;  4JLE A;  4QX7 B;  3ZMT B;  2VKH A;  2CMR A;  1Y64 B;  3EHZ A;  1I94 T;  4MAL A;  2H88 A;  3M65 A;  2L3L A;  4TNW A;  3AE4 A;  1LVK A;  4U7I A;  5JDL A;  2JQH A;  3P4W A;  2UXC T;  3RLF F;  1T72 A;  4HEA A;  3ZMU B;  4DR4 T;  1U5P A;  2A72 A;  2BVL A;  2ES0 A;  2BVM A;  2CEA A;  5CGM A;  3C51 A;  2VKO A;  2C0S A;  3K1S A;  3Q9D A;  2BS3 A;  4LF4 T;  2LM9 A;  4WZX A;  2WAU A;  4PK6 A;  5AQS B;  2NTY A;  5JR9 B;  1HNZ T;  3NWI A;  2VL8 A;  3A5X A;  2KSR A;  3FZF B;  3VR9 A;  5FY1 A;  1S94 A;  5CJ5 A;  4X66 T;  2X51 A;  5CA1 E;  2V1D B;  2V6Y B;  1CUN A;  2BS4 A;  4DO0 A;  1LKX A;  3FB2 A;  4X5T A;  2XTL A;  1FJG T;  3E22 E;  3HKC E;  3N2K E;  5AQU B;  1YQ4 A;  2XY8 B;  3C4W A;  4PJM A;  2V7J A;  1UX4 A;  4N78 D;  3EAB A;  3A8Y C;  3VU7 H;  3C4X A;  5LHH B;  4TWF A;  5DQW A;  2ACZ A;  3NRX A;  3PDY A;  3UQ7 A;  4H9S E;  4IDZ A;  2CM0 A;  3LSV A;  3KBT A;  4V1A v;  5DJQ C;  2XAG B;  5LG4 A;  2X9Y A;  2EHO D;  3ETV A;  2CXF A;  5FY7 A;  2XQ8 A;  4WYV A;  2X0L B;  2W0G A;  2VK9 A;  1UUR A;  3LK2 B;  4KI0 F;  2A9U A;  3Q2M A;  5JDG A;  1HX1 B;  2BKN A;  4LML A;  3E08 A;  4DV4 T;  3P4Q A;  4YT0 A;  2NOX A;  3GN5 A;  2E9X C;  2MOZ A;  4TV9 E;  4DV5 T;  2BG9 E;  1FIO A;  4H9P C;  1IJ5 A;  5J2U E;  4KHP T;  3PUS A;  2KLQ A;  4PFO A;  4X65 T;  4OFZ A;  2J4G A;  2VAS A;  2WQY A;  3WAJ A;  2LT3 A;  3NZP A;  3CVR A;  3OKQ A;  5LMU T;  1W0A A;  4QXC B;  4HKA A;  2NW8 A;  2W66 A;  2H89 A;  2V8S V;  1H7C A;  4AI6 A;  2CLY C;  2N1G A;  5HXS A;  5JVD E;  1OED C;  2VUR A;  3PUX F;  4TX5 A;  3KBU A;  1XWM A;  1FMW A;  2I0M A;  4PFP A;  1EZ3 A;  4X1I E;  2BG9 A;  2W62 A;  3AA7 B;  1FMV A;  5AQG B;  3RYC E;  5AQF B;  5L47 A;  2J62 A;  5LJN A;  3J7Y q;  2AE9 A;  2C5J A;  3VRA A;  1VRB A;  2BS2 A;  1BR4 A;  2WDQ A;  5JRE A;  3N9P A;  2HH7 A;  2LSK A;  3NRY A;  5E0O A;  3RRC A;  3O4X E;  3ZKR A;  5JDQ A;  2ZLY A;  3IHR A;  3NBX X;  4GYR A;  3G06 A;  4HGA A;  4PJJ A;  5AQT B;  4JYA T;  1M62 A;  2YN6 A;  4AKI A;  1QLB A;  2F4V T;  4BA9 A;  4LFB T;  5C3J A;  2MYS A;  3OVU A;  2I6H A;  2LKH A;  3CKD A;  2EHO C;  2V7I A;  1QUU A;  5LMN T;  4HFV A;  3ZST A;  3UUB A;  3JCF A;  4TNV A;  2B76 A;  5KX5 E;  3VRB A;  2LE8 A;  5FXV A;  2XQ7 A;  3H3A A;  3ZJ2 A;  1HG5 A;  2JQQ A;  2NP9 A;  4DND A;  4U2Y A;  5L3B B;  2LHR A;  3ZMS B;  1HR0 T;  4YHJ A;  2YOE A;  1WRD A;  3IA3 A;  5FKY A;  1HNX T;  3LBX A;  4TV8 E;  3CX7 B;  4HE8 A;  2BG9 B;  4YLH A;  5LCY A;  3RC3 A;  5LGU B;  2WU5 A;  3CML A;  3L39 A;  4UF0 A;  3GA8 A;  5AQH B;  2Q9Q C;  4Z90 A;  3N9O A;  2PFV A;  3VR8 A;  5AQI B;  5LGN B;  3PJA A;  2V7K A;  3DTO A;  4Q25 A;  2Y6X A;  3KDS E;  3RYH E;  1BR1 A;  5BR8 T;  2DL1 A;  2XQ4 A;  5JTG A;  5LXT E;  1YKH B;  3P4P A;  2B1E A;  5HXR A;  3AEF A;  3TLV A;  5F3J A;  4GKJ T;  4K0K T;  3F31 A;  1YXR A;  3PTR B;  3PU8 A;  3RRW A;  3T8O A;  2UXB T;  5AQO B;  2CA5 A;  4P09 A;  4H63 V;  2PTF A;  1LRZ A;  3A7M A;  3GMI A;  3CQX C;  2ZM6 T;  2X0H A;  2NR4 A;  3HR0 A;  4WNK A;  4YXD A;  3QB5 K;  5JDF A;  3B5M A;  3UUM A;  2QRX A;  2XQ6 A;  3EI0 A;  5LG3 A;  3KV4 A;  1HCI A;  3Q5E A;  3QB5 A;  4EXT A;  2WWU A;  5ABF A;  3U78 A;  2KIN B;  3GWH A;  3FBZ A;  2E5V A;  5ABH A;  1CHU A;  2NW7 A;  5HCM A;  1IAP A;  2WWV A;  5JDH A;  4AKG A;  4YTN A;  3ONX A;  3ZT6 A;  3L8R A;  4U33 A;  3BQI A;  3LFM A;  2FUP A;  2V26 A;  2LOS A;  2VKD A;  3KVB A;  4GIW A;  3L3P A;  4OYK A;  3PUQ A;  1MMA A;  3ZCJ A;  5JDN A;  5LJM A;  4BJM A;  4J2C A;  2A3D A;  1MIV A;  1BR2 A;  4A56 A;  4NXN T;  2V6Y A;  2XZE A;  2BKO A;  2NTX A;  4UVB B;  4QH5 A;  4JI8 T;  3UU6 A;  3X1D A;  2OLT A;  4AQG A;  2EHO A;  2JIW A;  3OBV E;  4UEL A;  3UUN A;  2ZM2 A;  3AEA A;  4U72 A;  4EV6 A;  2BKP A;  2CE7 A;  3LG7 A;  3TLT A;  1D0X A;  2LJL A;  2M67 A;  3T1H T;  3JAE A;  2MTQ A;  2CXL A;  4DV7 T;  2KND A;  1US7 B;  2K9A A;  2XQY A;  3Q5W A;  2PBI A;  2FJE A;  4IT4 A;  3RHW A;  2XM2 A;  4QXH B;  4CI3 B;  4HWF A;  2K24 A;  2XSB A;  4MBQ A;  5ABE A;  2HN2 A;  4HFI A;  4LF9 T;  3SOL A;  1T7S A;  2JPF A;  3I0O A;  4CI1 B;  4NPP A;  5FMN A;  2RPA A;  2W67 A;  1S35 A;  3ZN1 B;  3FZL B;  3V5S A;  4DV2 T;  4ISS A;  2BDE A;  2IDO B;  3QOF A;  3WAK A;  3K3N A;  1O3X A;  5FNV E;  4C91 A;  2VQF T;  2C5K T;  4ZOL E;  2WBL A;  3ONL C;  4X20 E;  1G73 A;  2VQE T;  1I6Z A;  4UVC B;  5JRC A;  2WZI A;  2XPK A;  3OPC A;  3AXJ B;  3RQU A;  1IBK T;  3ZC0 A;  3CQG B;  2E2A A;  1OED B;  5HEJ A;  3LK4 2;  1UUS A;  1WCR A;  2HPL A;  5CB4 E;  5AQR B;  5AQP B;  5LYJ E;  5IWA T;  3DP7 A;  2JJ9 A;  4G63 A;  3TLW A;  1ZKE A;  5AQM B;  3UTK A;  2CPT A;  4WBO A;  5FL0 A;  4F8H A;  1D0Z A;  4CN4 A;  1NEN A;  5CA0 E;  4I55 E;  4NUU A;  2X0Y A;  4CXY A;  2X9X A;  2CWY A;  4PK4 A;  4G2A A;  1N32 T;  3NKZ A;  3O1I A;  4WW0 A;  4DR2 T;  1XDO A;  2KWI B;  4QX8 B;  4OYJ A;  1XMQ T;  2NW9 A;  5L3F B;  2ODV A;  1SUM B;  1N36 T;  1ZP0 A;  3AE1 A;  2IML A;  1WFD A;  3B13 A;  3RQW A;  4AQF C;  5J2T E;  3RIA A;  3FZH B;  2LRK A;  5J0Z A;  2QGS A;  3VKG A;  4GYS A;  3UU8 A;  2J1D G;  2IW5 B;  2XUE A;  2ACX A;  4HFE A;  3ZC1 A;  3MAC A;  4E7Z A;  3C4Z A;  4DV1 T;  1XNR T;  4EYU A;  3BQK A;  2WU2 A;  2FJD A;  5H6R B;  5AQJ B;  4DMW A;  2WY2 A;  4CXX A;  4LFC T;  4DV6 T;  3CQC B;  4I43 B;  5FXZ A;  5JH7 E;  2YKS A;  1HX8 A;  3AA0 B;  2DLR A;  3AE3 A;  2V5D A;  5HCJ A;  5HWY A;  4ADZ A;  3V5U A;  4H9Q C;  4IDQ A;  4KBM B;  5F8P A;  2X67 A;  2Q9Q B;  2QVA A;  3F57 A;  2UUC T;  4JI6 T;  3ZJ1 A;  5FL1 A;  4UV8 B;  2LRL A;  4PW8 A;  4BAY B;  3NVO A;  3KV6 A;  3NZQ A;  2IC9 A;  2E9X A;  2VB6 A;  4H9R C;  5JDM A;  3SRZ A;  4YY3 T;  3PUA A;  2LEH A;  2XM1 A;  3EAM A;  4YJ2 E;  1WR0 A;  2DNX A;  2XAH B;  4YSZ A;  3FXD B;  5LA6 E;  4IL4 A;  3CWZ B;  5H6Q B;  2P9B A;  1IZN B;  2M6B A;  4YHH T;  2UXX B;  2WDV A;  2YDS A;  3B57 A;  4LF5 T;  3TLS A;  2FJA A;  4YSY A;  3L09 A;  3VHL A;  2D0U A;  2VKJ A;  2IHR 1;  4A98 A;  4UR9 A;  2YK0 A;  4O2B E;  4ZZC A;  1XNQ T;  2FJB A;  1VCT A;  3N9L A;  3JAF A;  2PJQ A;  3MJX A;  4JI4 T;  3ZEF B;  4ZI3 C;  3MZK B;  5J1G A;  3PUY F;  4OK0 A;  4E7S A;  1XMO T;  2E9X D;  3AED A;  4EED A;  4EAH A;  4A5X A;  3PUW F;  2BBJ A;  2VVS A;  2IIU A;  4ZI2 D;  4ILC A;  2H7O A;  3AEE A;  4JI0 T;  3O9X A;  2XQ9 A;  1YD8 G;  4DBQ A;  4F6R C;  3IF8 B;  4DUY T;  2LSJ A;  1G8X A;  4EEB A;  2H7V C;  4ZI2 C;  4K0U A;  4LF6 T;  1N34 T;  2HN1 A;  2YIN A;  2WMN A;  5LBQ B;  4U31 A;  2MPK A;  2W61 A;  4X1Y E;  5AQQ B;  4HWH A;  4PNI A;  3KV9 A;  3AE6 A;  3ZCI A;  3KFW X;  2WDR A;  1ZOY A;  3DJB A;  5FVK A;  2X9H A;  4JI1 T;  2XJ7 A;  2CWO A;  4X62 T;  2SPC A;  1D1A A;  2Y48 B;  3P4R A;  1JNR A;  2E8I A;  4LMJ A;  3RKG A;  4ZEY A;  5HEG A;  4YTM A;  1WYB A;  4X64 T;  2W00 A;  1KFY A;  2I59 A;  3MA9 A;  5EK4 A;  2Q9Q A;  5L2L A;  3HL6 A;  4H9O C;  3FHN A;  2ZMA A;  3F2E A;  4HWI B;  4QKN A;  5ABG A;  5CFB A;  1IBL T;  1HTJ F;  2JQ9 A;  4ANJ A;  4AKH A;  1X79 A;  4KHZ F;  1R8I A;  1SHZ C;  3AB3 B;  3OYZ A;  3UU3 A;  2W63 A;  3JC6 D;  3CPZ A;  4KMC A;  3ZSS A;  5LP6 E;  1E7P A;  2D0T A;  3MK7 C;  5FXX A;  3ANW A;  2K48 A;  2W4X A;  3CX6 B;  3C64 A;  2DWG A;  4U7Y A;  4UV9 B;  3MXZ A;  4IGU A;  4Z91 A;  1SE7 A;  2WM9 A;  5AQL B;  5FXW A;  5IYZ E;  3RYF E;  4Z8X A;  1KNR A;  4IL9 A;  2XQA A;  2LKG A;  4O4L E;  2C5I T;  2RA1 A;  4QWN B;  2BZB A;  3J9X 1;  2IUB A;  3RPU A;  3K3Q C;  4ZHQ E;  1MIY A;  2OA5 A;  2ODU A;  3H3M A;  3ANW B;  3FZK B;  3LJC A;  4ZS2 A;  2YU2 A;  2YU1 A;  1KK7 A;  2L9Q A;  1HFA A;  3AA1 B;  2RP4 A;  3CX8 B;  3UQ4 A;  2QA7 A;  4CXW A;  2H3R A;  1IJ6 A;  3UU5 A;  4QH4 A;  5F5W A;  4ZI7 E;  5JR9 C;  4AQY T;  2KT9 A;  4PK5 A;  2IAK A;  5AQV B;  3TKL B;  2M6I A;  3T1Y T;  4WBN E;  2J47 A;  2JMH A;  1NAF A;  2LSY A;  3E0Z A;  1D1B A;  4U2Z A;  4JI5 T;  3UT5 E;  3ZPO A;  4X1K E;  2X66 A;  3JC6 C;  4P0B A;  2WSS V;  1M7K A;  4GK5 E;  5EZY E;  4BJN A;  1YKE B;  3P50 A;  4IDO A;  4B3T T;  3N2O A;  4YTP A;  1W0B A;  2BG9 C;  4IE7 A;  2UXN B;  5HEU A;  1HG2 A;  5A1L A;  3QNU A;  5BMV E;  1J1J A;  3HKE E;  1LVF A;  1B7T A;  4IST A;  5LOV E;  3HI2 A;  3UFG A;  5AFU L;  2Q9Q D;  3AE2 A;  2LSG A;  4FI5 A;  5L3E B;  4GK0 E;  4DV3 T;  1HNW T;  1SA0 E;  2V5C A;  5HAX A;  3O1J A;  3Q5D A;  5LHI B;  3RX6 A;  2MBG A;  1N33 T;  1MND A;  5C8Y E;  2K3W A;  3BK9 A;  4PJN A;  4IRE A;  4AXP A;  1OED E;  4AKR B;  5M4Y A;  4MHC A;  3R6N A;  1IBM T;  1D0Y A;  1ZEE A;  4ERR A;  4YSX A;  5HEO A;  3RGL A;  3PU3 A;  3UU4 A;  5L4H A;  3UUL A;  3LK3 B;  5KXJ A;  1YW0 A;  4GKK T;  4I50 E;  4TN7 B;  4HWC A;  4IE4 A;  4MLK A;  2VWA A;  3CIR A;  3FZM B;  4JEH B;  4LF8 T;  4JEU B;  3N5L A;  3QC9 A;  3S4U A;  5IUX A;  5JQG E;  2EHO B;  3PUZ F;  4KX6 A;  5TAO A;  4JUY A;  3M3Z B;  3RI5 A;  1MMD A;  4DR5 T;  4LFA T;  2CLY B;  4IDN A;  3LDQ B;  4KP3 C;  5L3D B;  4COF A;  5KDM C;  1KF6 A;  3AEG A;  4HWD A;  3K8P C;  3PUR A;  3R84 B;  4P1N A;  5C2T A;  1BR0 A;  2DHR A;  4GOU A;  5FY0 A;  3IEE A;  2W2U A;  4I0U A;  5ETW A;  4AKL A;  4B3M T;  4UVA B;  2XQ3 A;  1HS7 A;  1E2A A;  3SS1 A;  4OX9 T;  2HPJ A;  4CQI A;  1VCS A;  2D2S A;  4QXB B;  3I9W A;  5L3G B;  5AQK B;  5LNK A;  4DUZ T;  1MMN A;  1W9R A;  2E9X B;  4DMV A;  1X9B A;  5GON E;  3ZT5 A;  1MMG A;  3EVY A;  3Q5X A;  3AEC A;  3ZMZ B;  4AIS A;  2KXP B;  3ESL A;  2X68 A;  5L4E A;  2E5L T;  2XHE B;  4ZS3 A;  3EUH A;  1KEY A;  3AVR A;  5HXH A; 
#chains in the Genus database with same CATH homology
 1XMO T;  1I94 T;  4JI0 T;  4DUY T;  4LF6 T;  1N34 T;  2UXC T;  4DR4 T;  4LF4 T;  1HNZ T;  4NXN T;  4JI1 T;  4X62 T;  4X66 T;  4JI8 T;  2UUB T;  4X64 T;  3T1H T;  4B3R T;  1IBL T;  4DV7 T;  4LF9 T;  2UXD T;  4DV2 T;  2VQF T;  4JI3 T;  4DV4 T;  4DV0 T;  2VQE T;  4DV6 T;  4DV5 T;  1IBK T;  2UU9 T;  4AQY T;  4KHP T;  1N32 T;  3OTO T;  1J5E T;  4X65 T;  3T1Y T;  4JI5 T;  5LMU T;  4B3S T;  5IWA T;  4DR7 T;  4B3T T;  4DR2 T;  4DV3 T;  1XMQ T;  1N36 T;  1N33 T;  2UUA T;  4JYA T;  1IBM T;  2HHH T;  2F4V T;  4LFB T;  4DV1 T;  1XNR T;  5LMN T;  4LFC T;  1FJG T;  4GKK T;  1HR0 T;  4LF8 T;  2UUC T;  4NXM T;  4JI6 T;  4DR6 T;  1HNX T;  4JV5 T;  4DR5 T;  4LFA T;  4LF7 T;  4YY3 T;  1HNW T;  4DR1 T;  4B3M T;  5BR8 T;  4YHH T;  4LF5 T;  4OX9 T;  4GKJ T;  4K0K T;  4DUZ T;  4DR3 T;  2UXB T;  4JI7 T;  1XNQ T;  2ZM6 T;  2E5L T;  4JI2 T;  4JI4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...