1HR0T

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1hr0T00
4LF6T 1HR0T 4DR1T 1XNRT 4JI5T 4DR5T 4X65T 1XMQT 4B3MT 4DR7T 4B3ST 4JI7T 1IBMT 4DV1T 2UXCT 4LF4T 1XMOT 4DUZT 4GKKT 1I94T 5BR8T 1N32T 1HNXT 1N34T 4LFBT 4YY3T 4DV7T 4YHHT 4LF7T 2VQET 4LF9T 4KHPT 4DR3T 2UXBT 1N33T 4NXNT 4JI4T 4X66T 1XNQT 4DV2T 4DV0T 4LFAT 2F4VT 1IBLT 2UUAT 4JI6T 4DR4T 4DV6T 4JI3T 3OTOT 4DV5T 4DV4T 2E5LT 2HHHT 4OX9T 2UU9T 4X64T 4JYAT 2UXDT 4JI8T 4DR2T 3T1YT 5IWAT 4B3TT 1FJGT 4JI0T 2ZM6T 1IBKT 4JI1T 2UUBT 4DUYT 1HNZT 4LF8T 5LMNT 4DV3T 4NXMT 2UUCT 4DR6T 4K0KT 4LFCT 2VQFT 4AQYT 4JI2T 4JV5T 1J5ET 1HNWT 4GKJT 3T1HT 4X62T 1N36T 4B3RT 4LF5T 5LMUT
chains in the Genus database with same CATH superfamily
4E7SA 4U3CA 5HWYA 4C91A 1SE7A 4NIQA 4X65T 3ONJA 4UIGA 4H9SE 2X66A 4HFIA 2C0SA 3WAKA 5IHYA 3VU7H 4ZOLE 3RC8A 3PUSA 1HG5A 4ZEYA 1B7TA 4YY3T 1XDOA 4CI2B 3ZT6A 4H9PC 3AEDA 2KSRA 3KV4A 3UFEA 2BS4A 3F2EA 2NOXA 2XAGB 4NXNT 3H3AA 1WRDA 3AA6B 4TZ4C 4LMJA 2WS3A 4PFPA 2JQQA 4JI6T 3KV9A 4ZI2D 3ZMVB 2MPKA 2VL8A 2VL0A 4JYAT 2CLYC 2DWGA 4UVBB 2ZM0A 4PK4A 2YINA 2X9HA 4KBMB 2V7JA 5L3FB 4AQGA 1HS7A 4V1Av 2PTFA 5F3JA 4JUYA 5FNVE 2H3RA 4E7ZA 2DWKA 5LMUT 3LJCA 4ILBA 5J0ZA 3E0ZA 3QNUA 5LYJE 1YKEB 2E9XA 1XMQT 2WWVA 3EVYA 5JTGA 4QH1A 3B5MA 3QUJA 4YJ3E 2CXDA 5HXHA 4U2YA 3ZLIA 3MACA 4A56A 4X20E 3P4QA 4LFBT 4QX7B 3ZMUB 1IZNB 4XAXB 1UX5A 4KHPT 1R8IA 4YT0A 2LM2A 3VR8A 4CN6A 4JI4T 4UV8B 3SWHA 2LEHA 5LP6E 2LSGA 1QUUA 4O8SA 5CGMA 2DLRA 3LG7A 2ODVA 3ONXA 2JQ9A 2WU2A 1FJGT 3TLWA 4M1PA 2UUCT 2R6GF 4PJNA 4Z91A 1MMNA 1VRBA 3CKDA 5AQJB 5EK2A 2ACZA 2I59A 5FXXA 5LHGB 3NVOA 3CX7B 2A9UA 3CVRA 2EHOC 3FZLB 2NR4A 3KBTA 2K5BB 3N5LA 5FL0A 1WFDA 2KXPB 3MA9A 2IHR1 2E5VA 4B3MT 4O4LE 4AXPA 2LHNA 3EABA 2ZM8A 4DUZT 5ABEA 5EZYE 3P4PA 4PNIA 3ZCJA 3LK3B 5HEOA 3N9OA 1HTJF 1BR1A 5EK3A 4YHHT 3C64A 4EEDA 3FBZA 3TLUA 2CEAA 4JEHB 4G2AA 3RQUA 1XNQT 5FY0A 1WCRA 3M65A 2E9XD 3JC6D 1Y64B 2YKSA 4PJLA 4JI8T 1D1BA 2WZIA 3V5UA 4U72A 5IWAT 2HH7A 2X9WA 4AQYT 3LK42 4X62T 5JDGA 2JPFA 1HX8A 2JMKA 2V26A 4F8HA 3PDYA 4YSXA 5AQHB 3IBPA 2QYWA 4NPPA 4YHJA 5L4HA 4ERRA 3PUYF 4GYRA 3RIFA 4UEMA 5AQNB 3PUAA 4MFRA 4HWDA 3AEBA 3RC3A 4AKIA 3Q2MA 4YFSA 5AQIB 3EDVA 2XTLA 4ZHQE 2BS3A 3EHZA 5FY1A 3LFMA 4QHOA 4I0UA 5L3DB 4LF7T 2WP9A 4TWHA 1SA0E 3S4UA 4MBQA 2JIWA 3AEGA 3JAFA 3CX8B 5AQLB 2LKGA 4ZS2A 3D0TA 2IMLA 3HKDE 4U7YA 1UCUA 3UUXB 2X0YA 5DABA 2B1EA 2ODUA 3CWZB 4AIUA 5C3JA 4QH4A 4DR2T 3NRXA 2FUPA 2CBJA 5H6RB 3EAMA 1WR0A 2B76A 2M67A 1HNZT 3FZKB 3J7Yq 3KVBA 1ZHCA 3N9LA 3DJBA 4P1NA 2J1DG 5JREA 5L3BB 2BZBA 2WSSV 3RRCA 2WB5A 2H89A 3ONLC 3NZPA 3PUZF 2D2SA 3F57A 1OXZA 3AAIA 1BR0A 5CFBA 2X0HA 5HXCA 4DR1T 1U4QA 2WMNA 5A1LA 3JC6C 2XQ6A 1M62A 3CK6A 3ZC0A 4C90A 5HEJA 3RQWA 2NP9A 2MOZA 3RYHE 5LGTB 5J2UE 2WBLA 4DV7T 3RF1A 2LKHA 1KNZA 2LE8A 2V6XA 3RHWA 3UULA 3RYCE 3RKGA 4JLEA 4XZCA 2XQ9A 4I55E 4CQIA 2BBJA 3MJXA 1VOMA 2W00A 3TKLB 4DBRA 1LVFA 1D0ZA 3KFWX 2K24A 4JI3T 2N1GA 4IDPA 2CCQA 5ADXL 3RIAA 3QK6A 2VK9A 2M6IA 4B3TT 4GYSA 5JDLA 3UU8A 3W15B 4K0KT 5LCYA 2VQFT 2KLQA 2AXDS 3HA4A 3ZN1B 1QLBA 2E8IA 3PUXF 5TAOA 1LVKA 3P7IA 2XJ7A 3OBVE 3N2GE 3ZMSB 3HKEE 1XNRT 4HWCA 4JI5T 3ZCIA 5LG4A 2XQ4A 1KEYA 3RH3A 2V7MA 4AKRB 2UXCT 4GIWA 2LSKA 4TV8E 4HWIB 4IL4A 4UF0B 5ABGA 4I43B 3O4XE 3P4RA 1I94T 4QXCB 3PJAJ 3MK7C 3AEAA 2H88A 1NEKA 5LBQB 3OYXA 2SPCA 2X67A 2C5IT 3RGLA 2VKHA 3N9NA 5AQRB 1XWMA 3ZN0B 4YTNA 4FJOA 4UF0A 3VRBA 2IC6A 2BS2A 2WM9A 3AE6A 3CQCB 2F4VT 1NWMX 3N9QA 5HXSA 4AKLA 2L8KA 4H9RC 2G0UA 2OLTA 2YDQA 4DVDA 3MXZA 3AE3A 1OWAA 4UELA 4CZZB 4DO0A 1YKHB 4IREA 3LBXA 4H63V 4TWFA 3ZSSA 3AECA 4DBQA 4CI1B 4LFCT 5AFUL 2IDOB 2H7VC 4ILUA 2CPTA 4IHJE 3B13A 3HL6A 4IE7A 1D0XA 1UUSA 3OYZA 1SHZC 3RKOA 3AXJB 2V5DA 4TX5A 3BK9A 1MMAA 5LG3A 3P50A 3NRYA 2CWYA 2BKNA 1US7B 2E9XB 2NTXA 5L2LA 4TUYE 2WY2A 4WW0A 1X9BA 3ZKRA 3RYFE 3C4XA 5FYMA 1MIYA 3PUVF 2A72A 3K3OA 3LSVA 4EOZB 5AQUB 5L3EB 3AXJA 2DI4A 3ZT7A 4HFDA 4OHFA 2JJ9A 1HFAA 4IE5A 2PBIA 2IW5B 1XDPA 2FJEA 4H9NC 3RPUA 4MHCA 4O4HE 3A5XA 4QKNA 4H9QC 2WU5A 2QRXA 4XBFB 4ADZA 2UXNB 2UU9T 3NWIA 5HXRA 2CA5A 3UT5E 2IAKA 4PK6A 4K0UA 3U78A 3P4SA 1FMVA 5JQGE 4HFBA 4LF8T 5LMNT 4CN1A 4YSYA 5FY7A 3ANWB 3N9MA 4ZZBA 4JI2T 4ZZCA 1HNWT 5IYZE 5LHHB 1MMDA 4IGUA 2XAFB 1D1AA 2XHEB 5JDQA 4EB6E 4B3RT 2FJDA 3ANWA 3AVSA 2LRLA 2NW9A 3JAEA 4P0AA 1OEDA 2QVAA 2W67A 1M7KA 2KT9A 2LHRA 4HN9A 2WMOA 5HYAA 3A7MA 2W4XA 4GOUA 3K3NA 4GK0E 4UVAB 2WZHA 3HKBE 5HCJA 1D0YA 2HN2A 1JNRA 1CHUA 4HFCA 4ZI2C 2FJBA 4UR9A 3P8CD 2QGSA 4JBWF 4G63A 4YLHA 5LBMA 1I6ZA 5ETWA 4A98A 4COFA 3Q5EA 1IJ5A 3ZMTB 2UUAT 4IDNA 1YQ4A 3BQLA 4L5GA 5JDNA 3I9WA 3AE1A 5GONE 3C4WA 4BJMA 2IIUA 3VR9A 1GQEA 3FBLA 2HPLA 3HI2A 1MNDA 4U7IA 2W62A 3KINB 4DR6T 1T8BA 3Q5WA 3KV5A 3CMLA 4JEUB 4HFHA 2LSYA 3PTRB 1WYBA 4NUVA 2W66A 3NBXX 4QH5A 3VHLA 3L3PA 1YQ3A 3ZMZB 3BQIA 3AE8A 2XQ3A 2IC9A 2HPJA 1IBMT 3U3IA 2JQKA 2Y48B 4DIDB 5JR9A 2JQHA 4PK5A 4J2CA 3I9YA 4L9IA 3QC9A 2XM2A 4IDQA 3SFEA 2VQET 1XZYA 3AVRA 1BR4A 5C8YE 3HKCE 2DCFA 1ZP0A 2FBWA 5HAXA 5LB7B 2OV9A 3ZPOA 3I0OA 3FXDB 4IIJE 3N2KE 4F6RC 5AQOB 2WCAA 4A5XA 5FXZA 3DTOA 1DU2A 2VVNA 1HX1B 2UXDT 5JVDE 4BJNA 4ISSA 1H7CA 2D9DA 2ZM6T 2RA1A 3R84B 4NXMT 4DMWA 1AJ3A 4JV5T 2A3DA 3O9XA 1NAFA 1MNEA 4TWDA 4QX8B 4Q25A 4LF6T 5CJ5A 2VURA 4HKAA 2L3LA 4U2ZA 2A2FX 1HCIA 3SRZA 3CPZA 2VB6A 2BVMA 2CHNA 3N9PA 3PJAA 3AA1B 2Q9QA 3MZKB 2KWHA 2XQ7A 4KI0F 1LRZA 3UUBA 4EGWA 4AISA 4ANJA 2X9YA 2E9XC 5HXEA 1L0VA 4DR3T 4MLKA 3UU3A 4I4TE 4X66T 5F5WA 1G8XA 2E2AA 1Y01A 1U5PA 2ES0A 4A97A 3RI5A 1WLXA 3H3MA 4KMCA 5AQKB 3LDQB 1S94A 1YW0A 2KINB 1MMGA 2N2NA 1UGOA 1HG2A 4EXTA 2ZM2A 4PJJA 4PAGA 2LT3A 3NKZA 5AQTB 2M6BA 1V9DA 2MAWA 4L0RA 3OVUA 3T8OA 2VASA 5LJMA 2V6YA 4Z90A 4HGAA 2K9AA 5AQFB 4QXBB 5JH7E 2W63A 2NW7A 2AE9A 5HEGA 3GMIA 2LOPA 3CX6B 3ZYLA 3PUWF 5FMNA 1OEDC 3UTKA 2XAQB 4WBNE 4I50E 4CXYA 4O4JE 2X0LB 2BBHA 5J2TE 3L8RA 1HNXT 3VRAA 1KNRA 4HFEA 3PU3A 5HWXA 4HE8A 1IJ6A 2CWOA 4ZI7E 4YXDA 3MKDA 1VCSA 4B6XA 4DV2T 3L09A 2K48A 3RRWA 2WAUA 4OK0A 4DV5T 4BA9A 4X64T 1T72A 4ILAA 2I6HA 2BG9A 3Q5XA 5L4EA 3AEEA 3JADA 3UQ4A 4YTPA 2XAJB 3UU4A 4MALA 5AQQB 3LBXB 4JI1T 4EZHA 1OEDE 4DV3T 2Q9QD 2IUBA 3FZFB 4AQFA 1VCTA 3EI0A 2XPKA 3R6NA 1J5ET 3K3QC 4X1KE 1W9RA 4PJMA 2UXXB 5LXTE 2BKPA 3E08A 2JMHA 3FB2A 3ZEFB 1J5WA 2DL1A 5DJQC 5FP3A 4TN7B 2DHRA 3PUGA 3BQKA 2YEVC 2RPAA 3O1HA 2NW8A 2PJQA 4B3ST 1CUNA 5JDMA 4LF4T 2L9QA 2EHOD 3ZYMA 1E2AA 5LNKA 5JR9C 5AQGB 4LMKA 2WDRA 1HF8A 3Q5DA 5KDMC 3V5SA 4EYYR 2Y8DA 3IHRA 4UXNB 5DQWA 4OFZA 3OJAA 4ZS3A 4DV0T 2XSAA 3PU8A 2CXFA 4DV6T 3OTOT 2RP4A 4DV4T 2E5LT 2YDSA 3ZJ1A 3TLSA 2VKOA 4H63H 4X1YE 2XASB 3M3ZB 1UURA 4GK5E 4EIWA 1IAPA 5AQPB 5HEUA 4KX6A 4DUYT 2YU2A 3RIUA 4TV9E 3PUQA 1KK7A 5LOVE 5CB4E 3WI3A 5ABHA 2WDVA 4P0BA 2PG8A 3PE0A 4LF5T 1MIWA 4ASKA 1KNPA 3FZHB 3UU5A 3NZQA 1S35A 1OEDB 4LMLA 4Z8XA 1NENA 3H37A 5FXVA 3UUMA 4GKKT 2YK0A 3IA3A 1YD8G 5FVKA 5JRCB 3OPCA 2Q9QC 5M4YA 1N34T 3RYIE 2GK9A 4AKGA 1KF6A 4WZXA 5LHIB 4BAYB 2CRBA 4CXWA 2ZLYA 4ISTA 5E0OA 5JRCA 3SOLA 2C5KT 5CA0E 1IBLT 4WYVA 5L3CB 4DR4T 3KDSE 1MIVA 1LKXA 2D0UA 3AE2A 3I0QA 2PFVA 1WR6A 4U33A 4EEBA 3AAAB 3GN5B 4JI0T 2KNDA 3ZT5A 3Q9DA 2X9XA 1KFYA 2XM1A 4DMVA 3GWHA 5LA6E 4QWNB 4NUUA 2Y6XA 2MBGA 3ZSTA 2BDEA 4ILCA 3TLVA 4GKJT 5F8PA 1ZOYA 4KHZF 2XY8B 1N36T 3X1DA 3GA8A 3GN5A 3AB3B 3EDUA 3ESLA 2LSIA 1D1CA 4KP3C 4WNKA 4DR7T 2X68A 2J4GA 4YSZA 2J62A 1FIOA 5JR9B 3KBUA 2LSJA 3A8YC 2CM0A 2I0MA 5L3GB 1ZEEA 2LJLA 3OKQA 5BR8T 5DQVA 3ZYKA 2VWAA 2K3WA 3DP7A 5L47A 2NWBA 2CLYB 4LF9T 2OA5A 2WDQA 5JDFA 2XQYA 3RX6A 2H7OA 2XAHB 3L39A 1SUMB 2HN1A 3FZMB 4FI5A 4HFVA 1JNZA 4TNVA 4IE0A 1J1JA 3HR0A 4YJ2E 2WQYA 4N78D 4AKHA 4UVCB 1Z0PA 3KVAA 4EZ4A 2D0TA 2CBIA 2MYSA 3AEFA 3C51A 1O3XA 3VKGA 3T1YT 3AA0B 2BG9C 2KWIB 3AAEB 4ZXLA 5KX5E 4U31A 3B57A 4WBOA 4X1IE 3SFDA 2V7IA 3AE9A 4IDZA 3CQGB 4AQFC 3O1IA 5JDHA 2YOEA 4QXHB 1ZV4X 5FXWA 4UV9B 4HTEA 3ZJ2A 1YXRA 4TNWA 2LM9A 5H6QB 4CXXA 3F31A 4YTMA 4DNDA 2LOSA 1HR0T 5HCMA 3FXEB 4ZI3D 1T98A 2FJAA 3TLTA 4DR5T 4CN4A 1Z8UA 2NTYA 5CA1E 3SS1A 4X5TA 5C2TA 1XMOT 3K8PC 1QSDA 4IE4A 2V1DB 2Q9QB 1N32T 5AQSB 1FMWA 4AI6A 2BG9E 3ETVA 3QB5A 4IE6A 1E7PA 5EK4A 2XQAA 2UXBT 4H9OC 1N33T 3K1SA 4KUMB 3C4ZA 3UFGA 5FKYA 4PW8A 3C98B 2MTQA 2JRKA 2HHHT 2CE7A 3PV0F 5LJNA 3ABVA 1UX4A 2EHOB 3JCFA 3RLFF 4OYKA 5FL1A 3N2OA 2DNXA 2V7KA 4IT4A 1IBKT 2V8SV 2J47A 2YU1A 2BKOA 3RIUC 1ZKEA 2VKDA 3LK2B 5AQVB 1W0AA 2KMFA 2ZMAA 1E1HB 2CHOA 3C50A 3T1HT 4HEAA 2V6YB 2EHOA 3IF8B 5LGNB 4P09A 3J9X1 3FHNA 3VKHA 1W0BA 2N9DA 1T7SA 2V7LA 5LGUB 2XQ8A 3AE4A 5IUXA 4CI3B 2LLYA 1WYCA 2WWUA 4JI7T 4DV1T 3UUNA 2V5CA 5FVLA 2KZ7B 1EZ3A 4EV6A 2CXLA 2XUEA 2YN6A 3PURA 2ACXA 3ETUA 3AE5A 3AE7A 2VKJA 2W61A 4O2BE 4O4IE 3UU6A 5KXJA 2XQ5A 3G06A 5J1GA 4O2AE 3ZC1A 5BMVE 5ABFB 2XSBA 3WAJA 3QB5K 5KMGP 4U74A 2D5UA 3CIRA 2VVSA 3UQ7A 4LFAT 4EYUA 3O1JA 4ZI3C 1X79A 2XZEA 3E22E 4OX9T 2QA7A 5ABFA 3I1AA 4OYJA 4HWFA 1BR2A 2CMRA 2Z6EA 1W09A 4PFOA 2BG9B 4HWHA 3KV6A 2P9BA 3P4WA 3AA7B 2BVLA 2UUBT 2YDRA 5AQMB 2W2UA 2X51A 2C5JA 3CQXC 1FEWA 4IDOA 5HEHA 4EAHA 3IEEA 3EUHA 1UK5A 4IL9A 3QOFA 1G73A 2LRKA 2W0GA
chains in the Genus database with same CATH topology
4LF6T 1HR0T 4DR1T 1XNRT 4JI5T 4DR5T 4X65T 1XMQT 4B3MT 4DR7T 4B3ST 4JI7T 1IBMT 4DV1T 2UXCT 4LF4T 1XMOT 4DUZT 4GKKT 1I94T 5BR8T 1N32T 1HNXT 1N34T 4LFBT 4YY3T 4DV7T 4YHHT 4LF7T 2VQET 4LF9T 4KHPT 4DR3T 2UXBT 1N33T 4NXNT 4JI4T 4X66T 1XNQT 4DV2T 4DV0T 4LFAT 2F4VT 1IBLT 2UUAT 4JI6T 4DR4T 4DV6T 4JI3T 3OTOT 4DV5T 4DV4T 2E5LT 2HHHT 4OX9T 2UU9T 4X64T 4JYAT 2UXDT 4JI8T 4DR2T 3T1YT 5IWAT 4B3TT 1FJGT 4JI0T 2ZM6T 1IBKT 4JI1T 2UUBT 4DUYT 1HNZT 4LF8T 5LMNT 4DV3T 4NXMT 2UUCT 4DR6T 4K0KT 4LFCT 2VQFT 4AQYT 4JI2T 4JV5T 1J5ET 1HNWT 4GKJT 3T1HT 4X62T 1N36T 4B3RT 4LF5T 5LMUT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 T;  1HR0 T;  4DR1 T;  1XNR T;  4JI5 T;  4DR5 T;  4X65 T;  1XMQ T;  4B3M T;  4DR7 T;  4B3S T;  4JI7 T;  1IBM T;  4DV1 T;  2UXC T;  4LF4 T;  1XMO T;  4DUZ T;  4GKK T;  1I94 T;  5BR8 T;  1N32 T;  1HNX T;  1N34 T;  4LFB T;  4YY3 T;  4DV7 T;  4YHH T;  4LF7 T;  2VQE T;  4LF9 T;  4KHP T;  4DR3 T;  2UXB T;  1N33 T;  4NXN T;  4JI4 T;  4X66 T;  1XNQ T;  4DV2 T;  4DV0 T;  4LFA T;  2F4V T;  1IBL T;  2UUA T;  4JI6 T;  4DR4 T;  4DV6 T;  4JI3 T;  3OTO T;  4DV5 T;  4DV4 T;  2E5L T;  2HHH T;  4OX9 T;  2UU9 T;  4X64 T;  4JYA T;  2UXD T;  4JI8 T;  4DR2 T;  3T1Y T;  5IWA T;  4B3T T;  1FJG T;  4JI0 T;  2ZM6 T;  1IBK T;  4JI1 T;  2UUB T;  4DUY T;  1HNZ T;  4LF8 T;  5LMN T;  4DV3 T;  4NXM T;  2UUC T;  4DR6 T;  4K0K T;  4LFC T;  2VQF T;  4AQY T;  4JI2 T;  4JV5 T;  1J5E T;  1HNW T;  4GKJ T;  3T1H T;  4X62 T;  1N36 T;  4B3R T;  4LF5 T;  5LMU T; 
#chains in the Genus database with same CATH topology
 4E7S A;  4U3C A;  5HWY A;  4C91 A;  1SE7 A;  4NIQ A;  4X65 T;  3ONJ A;  4UIG A;  4H9S E;  2X66 A;  4HFI A;  2C0S A;  3WAK A;  5IHY A;  3VU7 H;  4ZOL E;  3RC8 A;  3PUS A;  1HG5 A;  4ZEY A;  1B7T A;  4YY3 T;  1XDO A;  4CI2 B;  3ZT6 A;  4H9P C;  3AED A;  2KSR A;  3KV4 A;  3UFE A;  2BS4 A;  3F2E A;  2NOX A;  2XAG B;  4NXN T;  3H3A A;  1WRD A;  3AA6 B;  4TZ4 C;  4LMJ A;  2WS3 A;  4PFP A;  2JQQ A;  4JI6 T;  3KV9 A;  4ZI2 D;  3ZMV B;  2MPK A;  2VL8 A;  2VL0 A;  4JYA T;  2CLY C;  2DWG A;  4UVB B;  2ZM0 A;  4PK4 A;  2YIN A;  2X9H A;  4KBM B;  2V7J A;  5L3F B;  4AQG A;  1HS7 A;  4V1A v;  2PTF A;  5F3J A;  4JUY A;  5FNV E;  2H3R A;  4E7Z A;  2DWK A;  5LMU T;  3LJC A;  4ILB A;  5J0Z A;  3E0Z A;  3QNU A;  5LYJ E;  1YKE B;  2E9X A;  1XMQ T;  2WWV A;  3EVY A;  5JTG A;  4QH1 A;  3B5M A;  3QUJ A;  4YJ3 E;  2CXD A;  5HXH A;  4U2Y A;  3ZLI A;  3MAC A;  4A56 A;  4X20 E;  3P4Q A;  4LFB T;  4QX7 B;  3ZMU B;  1IZN B;  4XAX B;  1UX5 A;  4KHP T;  1R8I A;  4YT0 A;  2LM2 A;  3VR8 A;  4CN6 A;  4JI4 T;  4UV8 B;  3SWH A;  2LEH A;  5LP6 E;  2LSG A;  1QUU A;  4O8S A;  5CGM A;  2DLR A;  3LG7 A;  2ODV A;  3ONX A;  2JQ9 A;  2WU2 A;  1FJG T;  3TLW A;  4M1P A;  2UUC T;  2R6G F;  4PJN A;  4Z91 A;  1MMN A;  1VRB A;  3CKD A;  5AQJ B;  5EK2 A;  2ACZ A;  2I59 A;  5FXX A;  5LHG B;  3NVO A;  3CX7 B;  2A9U A;  3CVR A;  2EHO C;  3FZL B;  2NR4 A;  3KBT A;  2K5B B;  3N5L A;  5FL0 A;  1WFD A;  2KXP B;  3MA9 A;  2IHR 1;  2E5V A;  4B3M T;  4O4L E;  4AXP A;  2LHN A;  3EAB A;  2ZM8 A;  4DUZ T;  5ABE A;  5EZY E;  3P4P A;  4PNI A;  3ZCJ A;  3LK3 B;  5HEO A;  3N9O A;  1HTJ F;  1BR1 A;  5EK3 A;  4YHH T;  3C64 A;  4EED A;  3FBZ A;  3TLU A;  2CEA A;  4JEH B;  4G2A A;  3RQU A;  1XNQ T;  5FY0 A;  1WCR A;  3M65 A;  2E9X D;  3JC6 D;  1Y64 B;  2YKS A;  4PJL A;  4JI8 T;  1D1B A;  2WZI A;  3V5U A;  4U72 A;  5IWA T;  2HH7 A;  2X9W A;  4AQY T;  3LK4 2;  4X62 T;  5JDG A;  2JPF A;  1HX8 A;  2JMK A;  2V26 A;  4F8H A;  3PDY A;  4YSX A;  5AQH B;  3IBP A;  2QYW A;  4NPP A;  4YHJ A;  5L4H A;  4ERR A;  3PUY F;  4GYR A;  3RIF A;  4UEM A;  5AQN B;  3PUA A;  4MFR A;  4HWD A;  3AEB A;  3RC3 A;  4AKI A;  3Q2M A;  4YFS A;  5AQI B;  3EDV A;  2XTL A;  4ZHQ E;  2BS3 A;  3EHZ A;  5FY1 A;  3LFM A;  4QHO A;  4I0U A;  5L3D B;  4LF7 T;  2WP9 A;  4TWH A;  1SA0 E;  3S4U A;  4MBQ A;  2JIW A;  3AEG A;  3JAF A;  3CX8 B;  5AQL B;  2LKG A;  4ZS2 A;  3D0T A;  2IML A;  3HKD E;  4U7Y A;  1UCU A;  3UUX B;  2X0Y A;  5DAB A;  2B1E A;  2ODU A;  3CWZ B;  4AIU A;  5C3J A;  4QH4 A;  4DR2 T;  3NRX A;  2FUP A;  2CBJ A;  5H6R B;  3EAM A;  1WR0 A;  2B76 A;  2M67 A;  1HNZ T;  3FZK B;  3J7Y q;  3KVB A;  1ZHC A;  3N9L A;  3DJB A;  4P1N A;  2J1D G;  5JRE A;  5L3B B;  2BZB A;  2WSS V;  3RRC A;  2WB5 A;  2H89 A;  3ONL C;  3NZP A;  3PUZ F;  2D2S A;  3F57 A;  1OXZ A;  3AAI A;  1BR0 A;  5CFB A;  2X0H A;  5HXC A;  4DR1 T;  1U4Q A;  2WMN A;  5A1L A;  3JC6 C;  2XQ6 A;  1M62 A;  3CK6 A;  3ZC0 A;  4C90 A;  5HEJ A;  3RQW A;  2NP9 A;  2MOZ A;  3RYH E;  5LGT B;  5J2U E;  2WBL A;  4DV7 T;  3RF1 A;  2LKH A;  1KNZ A;  2LE8 A;  2V6X A;  3RHW A;  3UUL A;  3RYC E;  3RKG A;  4JLE A;  4XZC A;  2XQ9 A;  4I55 E;  4CQI A;  2BBJ A;  3MJX A;  1VOM A;  2W00 A;  3TKL B;  4DBR A;  1LVF A;  1D0Z A;  3KFW X;  2K24 A;  4JI3 T;  2N1G A;  4IDP A;  2CCQ A;  5ADX L;  3RIA A;  3QK6 A;  2VK9 A;  2M6I A;  4B3T T;  4GYS A;  5JDL A;  3UU8 A;  3W15 B;  4K0K T;  5LCY A;  2VQF T;  2KLQ A;  2AXD S;  3HA4 A;  3ZN1 B;  1QLB A;  2E8I A;  3PUX F;  5TAO A;  1LVK A;  3P7I A;  2XJ7 A;  3OBV E;  3N2G E;  3ZMS B;  3HKE E;  1XNR T;  4HWC A;  4JI5 T;  3ZCI A;  5LG4 A;  2XQ4 A;  1KEY A;  3RH3 A;  2V7M A;  4AKR B;  2UXC T;  4GIW A;  2LSK A;  4TV8 E;  4HWI B;  4IL4 A;  4UF0 B;  5ABG A;  4I43 B;  3O4X E;  3P4R A;  1I94 T;  4QXC B;  3PJA J;  3MK7 C;  3AEA A;  2H88 A;  1NEK A;  5LBQ B;  3OYX A;  2SPC A;  2X67 A;  2C5I T;  3RGL A;  2VKH A;  3N9N A;  5AQR B;  1XWM A;  3ZN0 B;  4YTN A;  4FJO A;  4UF0 A;  3VRB A;  2IC6 A;  2BS2 A;  2WM9 A;  3AE6 A;  3CQC B;  2F4V T;  1NWM X;  3N9Q A;  5HXS A;  4AKL A;  2L8K A;  4H9R C;  2G0U A;  2OLT A;  2YDQ A;  4DVD A;  3MXZ A;  3AE3 A;  1OWA A;  4UEL A;  4CZZ B;  4DO0 A;  1YKH B;  4IRE A;  3LBX A;  4H63 V;  4TWF A;  3ZSS A;  3AEC A;  4DBQ A;  4CI1 B;  4LFC T;  5AFU L;  2IDO B;  2H7V C;  4ILU A;  2CPT A;  4IHJ E;  3B13 A;  3HL6 A;  4IE7 A;  1D0X A;  1UUS A;  3OYZ A;  1SHZ C;  3RKO A;  3AXJ B;  2V5D A;  4TX5 A;  3BK9 A;  1MMA A;  5LG3 A;  3P50 A;  3NRY A;  2CWY A;  2BKN A;  1US7 B;  2E9X B;  2NTX A;  5L2L A;  4TUY E;  2WY2 A;  4WW0 A;  1X9B A;  3ZKR A;  3RYF E;  3C4X A;  5FYM A;  1MIY A;  3PUV F;  2A72 A;  3K3O A;  3LSV A;  4EOZ B;  5AQU B;  5L3E B;  3AXJ A;  2DI4 A;  3ZT7 A;  4HFD A;  4OHF A;  2JJ9 A;  1HFA A;  4IE5 A;  2PBI A;  2IW5 B;  1XDP A;  2FJE A;  4H9N C;  3RPU A;  4MHC A;  4O4H E;  3A5X A;  4QKN A;  4H9Q C;  2WU5 A;  2QRX A;  4XBF B;  4ADZ A;  2UXN B;  2UU9 T;  3NWI A;  5HXR A;  2CA5 A;  3UT5 E;  2IAK A;  4PK6 A;  4K0U A;  3U78 A;  3P4S A;  1FMV A;  5JQG E;  4HFB A;  4LF8 T;  5LMN T;  4CN1 A;  4YSY A;  5FY7 A;  3ANW B;  3N9M A;  4ZZB A;  4JI2 T;  4ZZC A;  1HNW T;  5IYZ E;  5LHH B;  1MMD A;  4IGU A;  2XAF B;  1D1A A;  2XHE B;  5JDQ A;  4EB6 E;  4B3R T;  2FJD A;  3ANW A;  3AVS A;  2LRL A;  2NW9 A;  3JAE A;  4P0A A;  1OED A;  2QVA A;  2W67 A;  1M7K A;  2KT9 A;  2LHR A;  4HN9 A;  2WMO A;  5HYA A;  3A7M A;  2W4X A;  4GOU A;  3K3N A;  4GK0 E;  4UVA B;  2WZH A;  3HKB E;  5HCJ A;  1D0Y A;  2HN2 A;  1JNR A;  1CHU A;  4HFC A;  4ZI2 C;  2FJB A;  4UR9 A;  3P8C D;  2QGS A;  4JBW F;  4G63 A;  4YLH A;  5LBM A;  1I6Z A;  5ETW A;  4A98 A;  4COF A;  3Q5E A;  1IJ5 A;  3ZMT B;  2UUA T;  4IDN A;  1YQ4 A;  3BQL A;  4L5G A;  5JDN A;  3I9W A;  3AE1 A;  5GON E;  3C4W A;  4BJM A;  2IIU A;  3VR9 A;  1GQE A;  3FBL A;  2HPL A;  3HI2 A;  1MND A;  4U7I A;  2W62 A;  3KIN B;  4DR6 T;  1T8B A;  3Q5W A;  3KV5 A;  3CML A;  4JEU B;  4HFH A;  2LSY A;  3PTR B;  1WYB A;  4NUV A;  2W66 A;  3NBX X;  4QH5 A;  3VHL A;  3L3P A;  1YQ3 A;  3ZMZ B;  3BQI A;  3AE8 A;  2XQ3 A;  2IC9 A;  2HPJ A;  1IBM T;  3U3I A;  2JQK A;  2Y48 B;  4DID B;  5JR9 A;  2JQH A;  4PK5 A;  4J2C A;  3I9Y A;  4L9I A;  3QC9 A;  2XM2 A;  4IDQ A;  3SFE A;  2VQE T;  1XZY A;  3AVR A;  1BR4 A;  5C8Y E;  3HKC E;  2DCF A;  1ZP0 A;  2FBW A;  5HAX A;  5LB7 B;  2OV9 A;  3ZPO A;  3I0O A;  3FXD B;  4IIJ E;  3N2K E;  4F6R C;  5AQO B;  2WCA A;  4A5X A;  5FXZ A;  3DTO A;  1DU2 A;  2VVN A;  1HX1 B;  2UXD T;  5JVD E;  4BJN A;  4ISS A;  1H7C A;  2D9D A;  2ZM6 T;  2RA1 A;  3R84 B;  4NXM T;  4DMW A;  1AJ3 A;  4JV5 T;  2A3D A;  3O9X A;  1NAF A;  1MNE A;  4TWD A;  4QX8 B;  4Q25 A;  4LF6 T;  5CJ5 A;  2VUR A;  4HKA A;  2L3L A;  4U2Z A;  2A2F X;  1HCI A;  3SRZ A;  3CPZ A;  2VB6 A;  2BVM A;  2CHN A;  3N9P A;  3PJA A;  3AA1 B;  2Q9Q A;  3MZK B;  2KWH A;  2XQ7 A;  4KI0 F;  1LRZ A;  3UUB A;  4EGW A;  4AIS A;  4ANJ A;  2X9Y A;  2E9X C;  5HXE A;  1L0V A;  4DR3 T;  4MLK A;  3UU3 A;  4I4T E;  4X66 T;  5F5W A;  1G8X A;  2E2A A;  1Y01 A;  1U5P A;  2ES0 A;  4A97 A;  3RI5 A;  1WLX A;  3H3M A;  4KMC A;  5AQK B;  3LDQ B;  1S94 A;  1YW0 A;  2KIN B;  1MMG A;  2N2N A;  1UGO A;  1HG2 A;  4EXT A;  2ZM2 A;  4PJJ A;  4PAG A;  2LT3 A;  3NKZ A;  5AQT B;  2M6B A;  1V9D A;  2MAW A;  4L0R A;  3OVU A;  3T8O A;  2VAS A;  5LJM A;  2V6Y A;  4Z90 A;  4HGA A;  2K9A A;  5AQF B;  4QXB B;  5JH7 E;  2W63 A;  2NW7 A;  2AE9 A;  5HEG A;  3GMI A;  2LOP A;  3CX6 B;  3ZYL A;  3PUW F;  5FMN A;  1OED C;  3UTK A;  2XAQ B;  4WBN E;  4I50 E;  4CXY A;  4O4J E;  2X0L B;  2BBH A;  5J2T E;  3L8R A;  1HNX T;  3VRA A;  1KNR A;  4HFE A;  3PU3 A;  5HWX A;  4HE8 A;  1IJ6 A;  2CWO A;  4ZI7 E;  4YXD A;  3MKD A;  1VCS A;  4B6X A;  4DV2 T;  3L09 A;  2K48 A;  3RRW A;  2WAU A;  4OK0 A;  4DV5 T;  4BA9 A;  4X64 T;  1T72 A;  4ILA A;  2I6H A;  2BG9 A;  3Q5X A;  5L4E A;  3AEE A;  3JAD A;  3UQ4 A;  4YTP A;  2XAJ B;  3UU4 A;  4MAL A;  5AQQ B;  3LBX B;  4JI1 T;  4EZH A;  1OED E;  4DV3 T;  2Q9Q D;  2IUB A;  3FZF B;  4AQF A;  1VCT A;  3EI0 A;  2XPK A;  3R6N A;  1J5E T;  3K3Q C;  4X1K E;  1W9R A;  4PJM A;  2UXX B;  5LXT E;  2BKP A;  3E08 A;  2JMH A;  3FB2 A;  3ZEF B;  1J5W A;  2DL1 A;  5DJQ C;  5FP3 A;  4TN7 B;  2DHR A;  3PUG A;  3BQK A;  2YEV C;  2RPA A;  3O1H A;  2NW8 A;  2PJQ A;  4B3S T;  1CUN A;  5JDM A;  4LF4 T;  2L9Q A;  2EHO D;  3ZYM A;  1E2A A;  5LNK A;  5JR9 C;  5AQG B;  4LMK A;  2WDR A;  1HF8 A;  3Q5D A;  5KDM C;  3V5S A;  4EYY R;  2Y8D A;  3IHR A;  4UXN B;  5DQW A;  4OFZ A;  3OJA A;  4ZS3 A;  4DV0 T;  2XSA A;  3PU8 A;  2CXF A;  4DV6 T;  3OTO T;  2RP4 A;  4DV4 T;  2E5L T;  2YDS A;  3ZJ1 A;  3TLS A;  2VKO A;  4H63 H;  4X1Y E;  2XAS B;  3M3Z B;  1UUR A;  4GK5 E;  4EIW A;  1IAP A;  5AQP B;  5HEU A;  4KX6 A;  4DUY T;  2YU2 A;  3RIU A;  4TV9 E;  3PUQ A;  1KK7 A;  5LOV E;  5CB4 E;  3WI3 A;  5ABH A;  2WDV A;  4P0B A;  2PG8 A;  3PE0 A;  4LF5 T;  1MIW A;  4ASK A;  1KNP A;  3FZH B;  3UU5 A;  3NZQ A;  1S35 A;  1OED B;  4LML A;  4Z8X A;  1NEN A;  3H37 A;  5FXV A;  3UUM A;  4GKK T;  2YK0 A;  3IA3 A;  1YD8 G;  5FVK A;  5JRC B;  3OPC A;  2Q9Q C;  5M4Y A;  1N34 T;  3RYI E;  2GK9 A;  4AKG A;  1KF6 A;  4WZX A;  5LHI B;  4BAY B;  2CRB A;  4CXW A;  2ZLY A;  4IST A;  5E0O A;  5JRC A;  3SOL A;  2C5K T;  5CA0 E;  1IBL T;  4WYV A;  5L3C B;  4DR4 T;  3KDS E;  1MIV A;  1LKX A;  2D0U A;  3AE2 A;  3I0Q A;  2PFV A;  1WR6 A;  4U33 A;  4EEB A;  3AAA B;  3GN5 B;  4JI0 T;  2KND A;  3ZT5 A;  3Q9D A;  2X9X A;  1KFY A;  2XM1 A;  4DMV A;  3GWH A;  5LA6 E;  4QWN B;  4NUU A;  2Y6X A;  2MBG A;  3ZST A;  2BDE A;  4ILC A;  3TLV A;  4GKJ T;  5F8P A;  1ZOY A;  4KHZ F;  2XY8 B;  1N36 T;  3X1D A;  3GA8 A;  3GN5 A;  3AB3 B;  3EDU A;  3ESL A;  2LSI A;  1D1C A;  4KP3 C;  4WNK A;  4DR7 T;  2X68 A;  2J4G A;  4YSZ A;  2J62 A;  1FIO A;  5JR9 B;  3KBU A;  2LSJ A;  3A8Y C;  2CM0 A;  2I0M A;  5L3G B;  1ZEE A;  2LJL A;  3OKQ A;  5BR8 T;  5DQV A;  3ZYK A;  2VWA A;  2K3W A;  3DP7 A;  5L47 A;  2NWB A;  2CLY B;  4LF9 T;  2OA5 A;  2WDQ A;  5JDF A;  2XQY A;  3RX6 A;  2H7O A;  2XAH B;  3L39 A;  1SUM B;  2HN1 A;  3FZM B;  4FI5 A;  4HFV A;  1JNZ A;  4TNV A;  4IE0 A;  1J1J A;  3HR0 A;  4YJ2 E;  2WQY A;  4N78 D;  4AKH A;  4UVC B;  1Z0P A;  3KVA A;  4EZ4 A;  2D0T A;  2CBI A;  2MYS A;  3AEF A;  3C51 A;  1O3X A;  3VKG A;  3T1Y T;  3AA0 B;  2BG9 C;  2KWI B;  3AAE B;  4ZXL A;  5KX5 E;  4U31 A;  3B57 A;  4WBO A;  4X1I E;  3SFD A;  2V7I A;  3AE9 A;  4IDZ A;  3CQG B;  4AQF C;  3O1I A;  5JDH A;  2YOE A;  4QXH B;  1ZV4 X;  5FXW A;  4UV9 B;  4HTE A;  3ZJ2 A;  1YXR A;  4TNW A;  2LM9 A;  5H6Q B;  4CXX A;  3F31 A;  4YTM A;  4DND A;  2LOS A;  1HR0 T;  5HCM A;  3FXE B;  4ZI3 D;  1T98 A;  2FJA A;  3TLT A;  4DR5 T;  4CN4 A;  1Z8U A;  2NTY A;  5CA1 E;  3SS1 A;  4X5T A;  5C2T A;  1XMO T;  3K8P C;  1QSD A;  4IE4 A;  2V1D B;  2Q9Q B;  1N32 T;  5AQS B;  1FMW A;  4AI6 A;  2BG9 E;  3ETV A;  3QB5 A;  4IE6 A;  1E7P A;  5EK4 A;  2XQA A;  2UXB T;  4H9O C;  1N33 T;  3K1S A;  4KUM B;  3C4Z A;  3UFG A;  5FKY A;  4PW8 A;  3C98 B;  2MTQ A;  2JRK A;  2HHH T;  2CE7 A;  3PV0 F;  5LJN A;  3ABV A;  1UX4 A;  2EHO B;  3JCF A;  3RLF F;  4OYK A;  5FL1 A;  3N2O A;  2DNX A;  2V7K A;  4IT4 A;  1IBK T;  2V8S V;  2J47 A;  2YU1 A;  2BKO A;  3RIU C;  1ZKE A;  2VKD A;  3LK2 B;  5AQV B;  1W0A A;  2KMF A;  2ZMA A;  1E1H B;  2CHO A;  3C50 A;  3T1H T;  4HEA A;  2V6Y B;  2EHO A;  3IF8 B;  5LGN B;  4P09 A;  3J9X 1;  3FHN A;  3VKH A;  1W0B A;  2N9D A;  1T7S A;  2V7L A;  5LGU B;  2XQ8 A;  3AE4 A;  5IUX A;  4CI3 B;  2LLY A;  1WYC A;  2WWU A;  4JI7 T;  4DV1 T;  3UUN A;  2V5C A;  5FVL A;  2KZ7 B;  1EZ3 A;  4EV6 A;  2CXL A;  2XUE A;  2YN6 A;  3PUR A;  2ACX A;  3ETU A;  3AE5 A;  3AE7 A;  2VKJ A;  2W61 A;  4O2B E;  4O4I E;  3UU6 A;  5KXJ A;  2XQ5 A;  3G06 A;  5J1G A;  4O2A E;  3ZC1 A;  5BMV E;  5ABF B;  2XSB A;  3WAJ A;  3QB5 K;  5KMG P;  4U74 A;  2D5U A;  3CIR A;  2VVS A;  3UQ7 A;  4LFA T;  4EYU A;  3O1J A;  4ZI3 C;  1X79 A;  2XZE A;  3E22 E;  4OX9 T;  2QA7 A;  5ABF A;  3I1A A;  4OYJ A;  4HWF A;  1BR2 A;  2CMR A;  2Z6E A;  1W09 A;  4PFO A;  2BG9 B;  4HWH A;  3KV6 A;  2P9B A;  3P4W A;  3AA7 B;  2BVL A;  2UUB T;  2YDR A;  5AQM B;  2W2U A;  2X51 A;  2C5J A;  3CQX C;  1FEW A;  4IDO A;  5HEH A;  4EAH A;  3IEE A;  3EUH A;  1UK5 A;  4IL9 A;  3QOF A;  1G73 A;  2LRK A;  2W0G A; 
#chains in the Genus database with same CATH homology
 4LF6 T;  1HR0 T;  4DR1 T;  1XNR T;  4JI5 T;  4DR5 T;  4X65 T;  1XMQ T;  4B3M T;  4DR7 T;  4B3S T;  4JI7 T;  1IBM T;  4DV1 T;  2UXC T;  4LF4 T;  1XMO T;  4DUZ T;  4GKK T;  1I94 T;  5BR8 T;  1N32 T;  1HNX T;  1N34 T;  4LFB T;  4YY3 T;  4DV7 T;  4YHH T;  4LF7 T;  2VQE T;  4LF9 T;  4KHP T;  4DR3 T;  2UXB T;  1N33 T;  4NXN T;  4JI4 T;  4X66 T;  1XNQ T;  4DV2 T;  4DV0 T;  4LFA T;  2F4V T;  1IBL T;  2UUA T;  4JI6 T;  4DR4 T;  4DV6 T;  4JI3 T;  3OTO T;  4DV5 T;  4DV4 T;  2E5L T;  2HHH T;  4OX9 T;  2UU9 T;  4X64 T;  4JYA T;  2UXD T;  4JI8 T;  4DR2 T;  3T1Y T;  5IWA T;  4B3T T;  1FJG T;  4JI0 T;  2ZM6 T;  1IBK T;  4JI1 T;  2UUB T;  4DUY T;  1HNZ T;  4LF8 T;  5LMN T;  4DV3 T;  4NXM T;  2UUC T;  4DR6 T;  4K0K T;  4LFC T;  2VQF T;  4AQY T;  4JI2 T;  4JV5 T;  1J5E T;  1HNW T;  4GKJ T;  3T1H T;  4X62 T;  1N36 T;  4B3R T;  4LF5 T;  5LMU T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...