4WZXA

Ulk3 regulates cytokinetic abscission by phosphorylating escrt-iii proteins
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
87
structure length
87
Chain Sequence
TSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEYLKEQVKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Serine/threonine-protein kinase ULK3
publication title ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 87
sequence length 87
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4wzxA01
2V6YB 4A5XA 2K3WA 2W2UA 2V6YA 2LRLA 4U3CA 3ZSTA 4CN6A 5FVKA 2CPTA 2V6XA 4U2ZA 2DL1A 4U2YA 4WZXA 4CN1A 2MPKA 4U33A 4ZEYA 2CRBA 3K1SA 1WCRA 2LRKA 4U31A 2XZEA 2A9UA 2RPAA 1WR0A 2WY2A 4P1NA 3ZSSA 2JQ9A 2JQHA 4NIQA 3ZT5A 4U7IA 2WWVA 3ZT6A 3ZT7A 4U7YA 5FVLA 5LB7B 4IT4A 1YXRA 3EABA 2JQKA 1WFDA 5CGMA 4CN4A 5CJ5A
chains in the Genus database with same CATH superfamily
2WWUA 3B5MA 2I0MA 2D0UA 2V7LA 2Q9QB 4CI3B 2W63A 3JADA 4KP3C 5CA1E 2BBHA 3NZPA 2IW5B 4DNDA 3UQ4A 4X1KE 3TLUA 3CIRA 3KVAA 3MKDA 2B1EA 4PJLA 4JI2T 4HWIB 2DCFA 2PFVA 2C0SA 3FXEB 3ZMVB 3RC3A 1MMDA 3L39A 2D0TA 3J7Yq 4AKGA 2FBWA 3I0OA 5BMVE 2DWKA 5LYJE 4QHOA 1UK5A 4LFBT 2PJQA 4ZZBA 3GWHA 2YK0A 3C50A 3GMIA 4L0RA 2BG9E 3OJAA 2WMNA 4K0KT 2XZEA 4G2AA 2KSRA 5LCYA 2PBIA 2XAGB 3VR9A 4JI8T 4TV9E 5AQIB 4C91A 2JJ9A 4GK5E 3RYIE 2XPKA 5CA0E 2W66A 5AQTB 3AEAA 1HS7A 2UU9T 4Z8XA 5ABGA 2LE8A 1G73A 5EK3A 4COFA 4X5TA 3ZLIA 5FVKA 2KWHA 4TZ4C 4YSZA 1XDPA 2VKJA 3FHNA 2KMFA 4JI4T 4ZI2D 2EHOC 4GOUA 5HYAA 2VQFT 5AQHB 5JREA 2ZM8A 4HFHA 2BS2A 1Z8UA 3AE2A 5AQMB 4I4TE 2A3DA 4A97A 4ILCA 3V5SA 2ACZA 1E7PA 1WYCA 1MMAA 5HCJA 2LM2A 2W4XA 5LHHB 2PG8A 3AA7B 3LK42 1N34T 2IUBA 4XAXB 4EYUA 2CBIA 4U7YA 4YSXA 5ADXL 3UTKA 3S4UA 4JYAT 1NWMX 2N9DA 1Y01A 2V6XA 5LJMA 3ZPOA 1L0VA 3C51A 4HGAA 3DJBA 4QX8B 3Q5DA 1D0ZA 5AQNB 4ILAA 3QUJA 2NP9A 3KVBA 1MIYA 1OEDB 4IT4A 3CKDA 5JH7E 4DBRA 2QRXA 2UUAT 2E9XA 2HH7A 4TUYE 3K3QC 2Y8DA 2B76A 4PJNA 3FZHB 1YD8G 5CFBA 4E7ZA 3RYHE 4UF0B 2BS3A 1E2AA 4DV3T 3CX6B 5FXZA 4HE8A 2V7JA 2Y6XA 2LKHA 5HXHA 2NW9A 3UQ7A 2VL8A 3N2GE 4Z91A 2H88A 3RLFF 5FL1A 1S35A 2SPCA 4DV7T 2IDOB 3RYCE 4DR6T 1W0AA 4XZCA 3HA4A 3CQCB 2VVSA 3ZT7A 4EZHA 5ABFA 2NR4A 1HCIA 5KMGP 3EDVA 4MFRA 1ZOYA 2DHRA 3ZJ2A 5IUXA 4DMWA 3FZKB 4KUMB 3BQLA 4AIUA 4LF8T 2XAJB 1XMOT 1T72A 4YLHA 1FEWA 4PNIA 5AQOB 1KNRA 2LM9A 2YDRA 4IDPA 4PFPA 1ZKEA 2CXFA 5HXSA 4YFSA 4AKRB 4BJNA 2DWGA 5C2TA 4GK0E 4ZI3D 4HFVA 2IC9A 4JLEA 1IZNB 1KFYA 2YU2A 3B57A 2X66A 4X65T 2BG9A 3Q5EA 5AQRB 3UUBA 3H3AA 2WWVA 3UFEA 3HKCE 2KT9A 5LHIB 3KV9A 2M6IA 5LXTE 4DV2T 4IE5A 1SA0E 1SUMB 5M4YA 1T8BA 3RYFE 5LBMA 3P4QA 3B13A 3VKGA 3FBLA 5FKYA 3SRZA 2WS3A 4YJ3E 2XQ6A 4U3CA 4B3TT 2WP9A 5HXCA 4HFCA 3OYXA 3A7MA 3H3MA 2PTFA 5L4HA 4TN7B 1HX8A 3BQIA 1KNZA 4P0AA 1Y64B 3Q5XA 5J0ZA 1J5ET 3WAKA 1UX4A 1MNEA 2CXLA 4QH5A 4CXXA 1SE7A 3PV0F 2FJEA 2AXDS 2A9UA 4U72A 2JQHA 3J9X1 3MJXA 3AECA 1KF6A 4NPPA 1UUSA 2IMLA 2QYWA 2W2UA 2H3RA 4H63V 3AXJB 3UU5A 2Q9QD 4QH4A 5L2LA 1MMNA 2MTQA 1XDOA 2LOPA 5A1LA 4EIWA 2W00A 2XTLA 3AEFA 5HEJA 4AQGA 4IHJE 5C8YE 4LMKA 3N5LA 5L47A 4IE6A 5DABA 5JDHA 4DUYT 2J62A 5LA6E 3D0TA 4TV8E 4IGUA 3AA0B 2X9XA 5AQQB 3ZCJA 1DU2A 4K0UA 2X0HA 3AB3B 3I9WA 4EGWA 2M67A 3LDQB 2V5DA 3ETUA 4WNKA 4FJOA 2OV9A 3KDSE 3NRXA 4ERRA 1XZYA 5JR9A 3ZT6A 5H6RB 5LBQB 4PK6A 2W62A 1YKEB 2KZ7B 2XJ7A 2BKNA 3PUXF 3M3ZB 5F8PA 2X68A 5JRCA 1XNRT 4ANJA 3AAEB 2XM1A 2Q9QC 4EEDA 2FJDA 3AEGA 4I50E 5FP3A 2JMKA 3NRYA 4UEMA 3LFMA 4DV0T 5IYZE 4AKIA 4OX9T 3RF1A 3NKZA 5LMNT 5LG3A 2AE9A 4C90A 4ZS2A 2E5LT 2XQ5A 2HHHT 5JTGA 3LJCA 5JDLA 4ISSA 2E8IA 2WAUA 4MHCA 2N2NA 3LBXB 2W61A 1R8IA 4IIJE 4CN4A 5CJ5A 1VCTA 2C5IT 5JDQA 4DR5T 1OXZA 1LKXA 5HXEA 5AQVB 1YQ3A 2KLQA 4NXNT 1WCRA 2VURA 2HN2A 1ZP0A 3OBVE 4TWDA 3OPCA 3ANWA 4UV9B 3AA6B 2JQQA 3I9YA 3JC6C 4YY3T 3WI3A 4KHPT 2K3WA 4O4HE 2VB6A 5LOVE 3MXZA 3ABVA 4P0BA 2BVMA 4U2YA 2LSGA 3T1HT 4QXBB 2XQAA 4DR4T 3R84B 1XMQT 1U4QA 4ILUA 3RQUA 5F3JA 2VQET 3FZMB 4I55E 4FI5A 4KHZF 4YTPA 5DJQC 5LP6E 4EOZB 4QX7B 3E0ZA 2M6BA 2E5VA 3IBPA 2BKOA 2VKDA 5AQUB 4CN1A 2WBLA 3FZLB 4PW8A 4PJJA 5JDFA 4IL9A 3P50A 2LRLA 2HPLA 2CMRA 4GKKT 1B7TA 3HKEE 3ZC0A 3F57A 4OHFA 3UU3A 3VR8A 3Q2MA 3C4WA 2R6GF 4TWFA 2ODUA 5FMNA 1CUNA 4H9QC 4U33A 2WB5A 4A98A 2ES0A 3AA1B 5AQLB 2HPJA 3PE0A 3AEBA 5AQFB 2JIWA 5FXVA 1WRDA 1CHUA 1OEDC 3O1HA 4IDQA 2VL0A 5HEHA 2JPFA 5ABFB 4Q25A 3GN5A 1N33T 3N9QA 3P8CD 3WAJA 4ZZCA 4AKHA 3RX6A 1J1JA 1HG5A 2NOXA 1FIOA 3RIUA 4IL4A 4YSYA 1M62A 4F8HA 3PTRB 2WDRA 5AQJB 3EDUA 3KFWX 4WBNE 1QUUA 3RC8A 3NWIA 4GYRA 3TLWA 4A5XA 3AE8A 3ETVA 3A8YC 3EUHA 4IE4A 3RHWA 2VASA 2XM2A 4PJMA 1M7KA 2H7VC 2BG9B 3RKGA 4GYSA 2J47A 1MNDA 1S94A 2V7KA 1SHZC 2CHOA 5IHYA 1QSDA 1OWAA 2WY2A 1VOMA 4ZI2C 3RI5A 4X20E 3O4XE 2MBGA 3EI0A 5KX5E 2E2AA 3SS1A 4CXWA 2WU2A 3ZSSA 2JQ9A 1US7B 4HFIA 3ZYLA 4NXMT 3VU7H 4ZI7E 4HWHA 4ZXLA 2XAFB 3JCFA 4PK4A 4JI0T 4UVAB 4PAGA 3ZJ1A 2XY8B 3GA8A 4OYJA 4DO0A 4TNWA 3EHZA 1X79A 3LK3B 2YDQA 4HFBA 3KINB 4H9PC 2NTXA 3JAEA 5JQGE 3ZN1B 3CPZA 2C5JA 4LMLA 3UULA 1FMVA 1LVFA 4CQIA 2ZLYA 1YKHB 4U31A 4DR1T 3RGLA 2L9QA 3SOLA 3ZMZB 3N2OA 3K8PC 4QWNB 2V7IA 1V9DA 4IDOA 3P4RA 4Z90A 2XQ4A 1LVKA 4ZS3A 1D1BA 1HG2A 3N9PA 3PURA 3ZMUB 2VKHA 1ZV4X 2KNDA 3ZKRA 3PUQA 4WYVA 4G63A 4H9RC 3NBXX 4HTEA 3RQWA 3FXDB 4A56A 5LG4A 2WZIA 2ZM2A 4IDNA 4ZOLE 3N9MA 4UELA 2LLYA 2BKPA 4O4IE 5JR9B 2IIUA 5FNVE 5HXRA 1EZ3A 4O2BE 1AJ3A 4LF4T 1OEDA 5L3EB 4X1YE 5ABEA 4JI3T 5AQPB 4PK5A 4HWDA 5HAXA 4TX5A 3JAFA 2XQ3A 1W09A 2A2FX 2W0GA 3E08A 2EHOA 3VKHA 2YKSA 1BR1A 4UF0A 3Q9DA 4IE0A 2BBJA 4EXTA 3ZN0B 1UCUA 1JNZA 3OYZA 3ZC1A 5EK2A 5HWYA 2RA1A 1Z0PA 2ODVA 3UU4A 4ZI3C 2YDSA 4YHHT 5J1GA 4DV4T 2CRBA 1FJGT 2WCAA 3MK7C 3KBUA 4LFAT 5DQWA 1WLXA 3FBZA 4QXHB 2V6YA 4JEUB 2CPTA 3EVYA 2FUPA 2IC6A 2YEVC 4DV6T 2K5BB 5J2UE 4X1IE 3CQGB 3LG7A 3NZQA 4QH1A 1HTJF 2W67A 3OVUA 1LRZA 5HWXA 3UUNA 5JDNA 4UR9A 5KDMC 3RRCA 4YT0A 3N9NA 4YTNA 4EZ4A 2WDQA 5FXWA 1HFAA 2LKGA 2XQ8A 4BAYB 2HN1A 5LJNA 5H6QB 4IREA 5ABHA 1NENA 2LOSA 2E9XD 4DUZT 3OTOT 2N1GA 4DV5T 3MACA 4AKLA 3DP7A 2QVAA 5LGTB 2X0YA 5FYMA 2CLYB 2XASB 1WR6A 2UXCT 4BJMA 2OLTA 4P09A 4DR3T 3CK6A 1WFDA 3UT5E 3TLTA 1HX1B 2WMOA 3X1DA 4AXPA 3PUWF 3RKOA 3KV5A 2X9WA 4X62T 4CI1B 3OKQA 1D0YA 1WR0A 1HNXT 3I0QA 2LSJA 2KXPB 2JQKA 2BDEA 4ADZA 3QB5K 1XNQT 3RPUA 1BR0A 3NVOA 4OFZA 3Q5WA 1HF8A 3V5UA 3BK9A 5L3FB 3KV4A 3AE3A 4CI2B 2BVLA 3HKDE 1W9RA 3PJAA 2VKOA 5JDGA 4F6RC 3CWZB 5AQGB 5AQKB 3CX7B 2VK9A 4JI1T 1GQEA 2UXXB 5HEOA 3MZKB 3HL6A 3VRBA 3C98B 3QOFA 3PJAJ 3AXJA 3SWHA 2UUCT 5FY1A 2DI4A 2LT3A 2P9BA 4LF5T 2ZM0A 3P7IA 2XQ7A 1I6ZA 4MLKA 4V1Av 4L9IA 1QLBA 4H9OC 2J4GA 4EAHA 1KK7A 2NWBA 5LNKA 2MYSA 3HI2A 4B3MT 1HNWT 3O1IA 2X51A 3LK2B 3UU6A 5L3BB 1O3XA 3QNUA 3IEEA 5EZYE 2KINB 2IHR1 1T98A 4UVCB 5LGNB 5KXJA 1ZEEA 4PFOA 1J5WA 2Y48B 2E9XB 3ONLC 2X9YA 2EHOD 5HEUA 4B3RT 1D0XA 3PUZF 4CXYA 2XAHB 3UU8A 2ZMAA 4U74A 4O4JE 2CWYA 3T1YT 2D5UA 4WZXA 5JVDE 3T8OA 4EB6E 1YQ4A 2YN6A 3HR0A 2UUBT 2BG9C 2F4VT 3SFEA 1OEDE 3IF8B 4DV1T 2ACXA 3EABA 2V7MA 2XSAA 5L3DB 5FXXA 3MA9A 4HFEA 5LGUB 3N9OA 4NUUA 3CX8B 2X0LB 4U7IA 4QXCB 4ASKA 3LBXA 3PUAA 2CE7A 3AVSA 2YOEA 3AE4A 4CN6A 3VHLA 3AAAB 2J1DG 3LSVA 4ZEYA 2LEHA 4UIGA 5JDMA 3CVRA 3ZT5A 1NAFA 2WQYA 3ONXA 3P4SA 1D1CA 3O1JA 4KMCA 4B3ST 5LMUT 4DBQA 2Q9QA 4DMVA 1IJ5A 2UXNB 2OA5A 2XUEA 5HEGA 4DVDA 2UXBT 4KX6A 3C4XA 4EEBA 4YXDA 1JNRA 1IBLT 4UXNB 1E1HB 5TAOA 4ZHQE 3ZYMA 5FVLA 3UUXB 1YXRA 2CBJA 3N9LA 4WW0A 2VVNA 2H89A 1U5PA 2V26A 2EHOB 4JI6T 4M1PA 2WDVA 1ZHCA 4TWHA 2I59A 2NTYA 3HKBE 4YTMA 3PUGA 2X67A 4JUYA 3EAMA 3L3PA 2CEAA 4XBFB 1KEYA 2LSYA 3UUMA 5FY7A 1HR0T 2K48A 4HN9A 3R6NA 2CXDA 5AQSB 2YINA 2V8SV 3ESLA 4P1NA 3RIFA 5JR9C 2FJAA 5LB7B 3FB2A 4YHJA 5DQVA 1HNZT 2V6YB 3KV6A 5LHGB 1I94T 1FMWA 2XAQB 3VRAA 4LFCT 3RH3A 4H9NC 3I1AA 2XHEB 5CB4E 5ETWA 1NEKA 5FL0A 4KI0F 3SFDA 1IJ6A 2C5KT 4HFDA 2BS4A 5L4EA 4AQFC 5HCMA 3TLSA 2G0UA 3RRWA 4U2ZA 2V5CA 4DIDB 3BQKA 3QK6A 4I43B 2MAWA 4HEAA 2BZBA 2UXDT 5IWAT 4LF6T 3A5XA 4AISA 3ZEFB 1N32T 4X64T 2IAKA 2GK9A 2RPAA 2L8KA 3F31A 1VRBA 4HWFA 4O8SA 4OK0A 2DLRA 4O4LE 1BR2A 4MBQA 3DTOA 1G8XA 5JRCB 4O2AE 4IE7A 5C3JA 1KNPA 4JEHB 2LHNA 3AVRA 2CHNA 4NIQA 4DR2T 4WBOA 3U78A 2LHRA 4JV5T 3ZMSB 3ZSTA 4BA9A 2ZM6T 2CLYC 1WYBA 4H63H 1IBKT 2Z6EA 3P4WA 3FZFB 4UVBB 4OYKA 4JI5T 3PUSA 3W15B 3L8RA 3AE7A 3TKLB 4HKAA 2WM9A 1X9BA 1IAPA 2WZHA 4B6XA 3PU8A 4LF7T 3ZYKA 3UFGA 3K1SA 2DNXA 5J2TE 1MMGA 3RIAA 2CA5A 1XWMA 4UV8B 3PUVF 2K24A 4ILBA 3K3NA 3ANWB 2V1DB 4LF9T 3AE6A 3AE1A 1MIVA 2WU5A 3CMLA 3G06A 1T7SA 2D9DA 4ISTA 2H7OA 2MPKA 2D2SA 2LJLA 2A72A 2NW7A 4NUVA 3AEDA 3E22E 3ZCIA 4MALA 2YU1A 4DR7T 2K9AA 2LSKA 4QKNA 1IBMT 2CM0A 2CWOA 4I0UA 3L09A 3ONJA 3QB5A 2DL1A 4JBWF 4E7SA 2FJBA 2QGSA 5FY0A 4AI6A 1N36T 4CZZB 2VWAA 4J2CA 2I6HA 2NW8A 2JRKA 5EK4A 5L3CB 4IDZA 4JI7T 4KBMB 3P4PA 3PU3A 3AAIA 4TNVA 3RIUC 3K3OA 3QC9A 2CCQA 4HWCA 3KBTA 3TLVA 2L3LA 3JC6D 4N78D 1UX5A 4H9SE 4X66T 3F2EA 1D1AA 2KWIB 2JMHA 5E0OA 4GIWA 1W0BA 4GKJT 4AQYT 3M65A 2QA7A 4L5GA 1UURA 4YJ2E 1MIWA 3U3IA 3N2KE 4AQFA 3H37A 3AE5A 4LMJA 2XSBA 2E9XC 5BR8T 1UGOA 3CQXC 1VCSA 3O9XA 5AFUL 2WSSV 5GONE 4EV6A 3AEEA 3GN5B 4EYYR 1BR4A 3C64A 5F5WA 1YW0A 2LSIA 2MOZA 2LRKA 3IHRA 3PDYA 5L3GB 2X9HA 3PUYF 1H7CA 2XQ9A 3C4ZA 2RP4A 3IA3A 2XQYA 3ZMTB 3AE9A 5CGMA
chains in the Genus database with same CATH topology
2V6YB 4A5XA 2K3WA 2W2UA 2V6YA 2LRLA 4U3CA 3ZSTA 4CN6A 5FVKA 2CPTA 2V6XA 4U2ZA 2DL1A 4U2YA 4WZXA 4CN1A 2MPKA 4U33A 4ZEYA 2CRBA 3K1SA 1WCRA 2LRKA 4U31A 2XZEA 2A9UA 2RPAA 1WR0A 2WY2A 4P1NA 3ZSSA 2JQ9A 2JQHA 4NIQA 3ZT5A 4U7IA 2WWVA 3ZT6A 3ZT7A 4U7YA 5FVLA 5LB7B 4IT4A 1YXRA 3EABA 2JQKA 1WFDA 5CGMA 4CN4A 5CJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6Y B;  4A5X A;  2K3W A;  2W2U A;  2V6Y A;  2LRL A;  4U3C A;  3ZST A;  4CN6 A;  5FVK A;  2CPT A;  2V6X A;  4U2Z A;  2DL1 A;  4U2Y A;  4WZX A;  4CN1 A;  2MPK A;  4U33 A;  4ZEY A;  2CRB A;  3K1S A;  1WCR A;  2LRK A;  4U31 A;  2XZE A;  2A9U A;  2RPA A;  1WR0 A;  2WY2 A;  4P1N A;  3ZSS A;  2JQ9 A;  2JQH A;  4NIQ A;  3ZT5 A;  4U7I A;  2WWV A;  3ZT6 A;  3ZT7 A;  4U7Y A;  5FVL A;  5LB7 B;  4IT4 A;  1YXR A;  3EAB A;  2JQK A;  1WFD A;  5CGM A;  4CN4 A;  5CJ5 A; 
#chains in the Genus database with same CATH topology
 2WWU A;  3B5M A;  2I0M A;  2D0U A;  2V7L A;  2Q9Q B;  4CI3 B;  2W63 A;  3JAD A;  4KP3 C;  5CA1 E;  2BBH A;  3NZP A;  2IW5 B;  4DND A;  3UQ4 A;  4X1K E;  3TLU A;  3CIR A;  3KVA A;  3MKD A;  2B1E A;  4PJL A;  4JI2 T;  4HWI B;  2DCF A;  2PFV A;  2C0S A;  3FXE B;  3ZMV B;  3RC3 A;  1MMD A;  3L39 A;  2D0T A;  3J7Y q;  4AKG A;  2FBW A;  3I0O A;  5BMV E;  2DWK A;  5LYJ E;  4QHO A;  1UK5 A;  4LFB T;  2PJQ A;  4ZZB A;  3GWH A;  2YK0 A;  3C50 A;  3GMI A;  4L0R A;  2BG9 E;  3OJA A;  2WMN A;  4K0K T;  2XZE A;  4G2A A;  2KSR A;  5LCY A;  2PBI A;  2XAG B;  3VR9 A;  4JI8 T;  4TV9 E;  5AQI B;  4C91 A;  2JJ9 A;  4GK5 E;  3RYI E;  2XPK A;  5CA0 E;  2W66 A;  5AQT B;  3AEA A;  1HS7 A;  2UU9 T;  4Z8X A;  5ABG A;  2LE8 A;  1G73 A;  5EK3 A;  4COF A;  4X5T A;  3ZLI A;  5FVK A;  2KWH A;  4TZ4 C;  4YSZ A;  1XDP A;  2VKJ A;  3FHN A;  2KMF A;  4JI4 T;  4ZI2 D;  2EHO C;  4GOU A;  5HYA A;  2VQF T;  5AQH B;  5JRE A;  2ZM8 A;  4HFH A;  2BS2 A;  1Z8U A;  3AE2 A;  5AQM B;  4I4T E;  2A3D A;  4A97 A;  4ILC A;  3V5S A;  2ACZ A;  1E7P A;  1WYC A;  1MMA A;  5HCJ A;  2LM2 A;  2W4X A;  5LHH B;  2PG8 A;  3AA7 B;  3LK4 2;  1N34 T;  2IUB A;  4XAX B;  4EYU A;  2CBI A;  4U7Y A;  4YSX A;  5ADX L;  3UTK A;  3S4U A;  4JYA T;  1NWM X;  2N9D A;  1Y01 A;  2V6X A;  5LJM A;  3ZPO A;  1L0V A;  3C51 A;  4HGA A;  3DJB A;  4QX8 B;  3Q5D A;  1D0Z A;  5AQN B;  4ILA A;  3QUJ A;  2NP9 A;  3KVB A;  1MIY A;  1OED B;  4IT4 A;  3CKD A;  5JH7 E;  4DBR A;  2QRX A;  2UUA T;  2E9X A;  2HH7 A;  4TUY E;  3K3Q C;  2Y8D A;  2B76 A;  4PJN A;  3FZH B;  1YD8 G;  5CFB A;  4E7Z A;  3RYH E;  4UF0 B;  2BS3 A;  1E2A A;  4DV3 T;  3CX6 B;  5FXZ A;  4HE8 A;  2V7J A;  2Y6X A;  2LKH A;  5HXH A;  2NW9 A;  3UQ7 A;  2VL8 A;  3N2G E;  4Z91 A;  2H88 A;  3RLF F;  5FL1 A;  1S35 A;  2SPC A;  4DV7 T;  2IDO B;  3RYC E;  4DR6 T;  1W0A A;  4XZC A;  3HA4 A;  3CQC B;  2VVS A;  3ZT7 A;  4EZH A;  5ABF A;  2NR4 A;  1HCI A;  5KMG P;  3EDV A;  4MFR A;  1ZOY A;  2DHR A;  3ZJ2 A;  5IUX A;  4DMW A;  3FZK B;  4KUM B;  3BQL A;  4AIU A;  4LF8 T;  2XAJ B;  1XMO T;  1T72 A;  4YLH A;  1FEW A;  4PNI A;  5AQO B;  1KNR A;  2LM9 A;  2YDR A;  4IDP A;  4PFP A;  1ZKE A;  2CXF A;  5HXS A;  4YFS A;  4AKR B;  4BJN A;  2DWG A;  5C2T A;  4GK0 E;  4ZI3 D;  4HFV A;  2IC9 A;  4JLE A;  1IZN B;  1KFY A;  2YU2 A;  3B57 A;  2X66 A;  4X65 T;  2BG9 A;  3Q5E A;  5AQR B;  3UUB A;  3H3A A;  2WWV A;  3UFE A;  3HKC E;  2KT9 A;  5LHI B;  3KV9 A;  2M6I A;  5LXT E;  4DV2 T;  4IE5 A;  1SA0 E;  1SUM B;  5M4Y A;  1T8B A;  3RYF E;  5LBM A;  3P4Q A;  3B13 A;  3VKG A;  3FBL A;  5FKY A;  3SRZ A;  2WS3 A;  4YJ3 E;  2XQ6 A;  4U3C A;  4B3T T;  2WP9 A;  5HXC A;  4HFC A;  3OYX A;  3A7M A;  3H3M A;  2PTF A;  5L4H A;  4TN7 B;  1HX8 A;  3BQI A;  1KNZ A;  4P0A A;  1Y64 B;  3Q5X A;  5J0Z A;  1J5E T;  3WAK A;  1UX4 A;  1MNE A;  2CXL A;  4QH5 A;  4CXX A;  1SE7 A;  3PV0 F;  2FJE A;  2AXD S;  2A9U A;  4U72 A;  2JQH A;  3J9X 1;  3MJX A;  3AEC A;  1KF6 A;  4NPP A;  1UUS A;  2IML A;  2QYW A;  2W2U A;  2H3R A;  4H63 V;  3AXJ B;  3UU5 A;  2Q9Q D;  4QH4 A;  5L2L A;  1MMN A;  2MTQ A;  1XDO A;  2LOP A;  5A1L A;  4EIW A;  2W00 A;  2XTL A;  3AEF A;  5HEJ A;  4AQG A;  4IHJ E;  5C8Y E;  4LMK A;  3N5L A;  5L47 A;  4IE6 A;  5DAB A;  5JDH A;  4DUY T;  2J62 A;  5LA6 E;  3D0T A;  4TV8 E;  4IGU A;  3AA0 B;  2X9X A;  5AQQ B;  3ZCJ A;  1DU2 A;  4K0U A;  2X0H A;  3AB3 B;  3I9W A;  4EGW A;  2M67 A;  3LDQ B;  2V5D A;  3ETU A;  4WNK A;  4FJO A;  2OV9 A;  3KDS E;  3NRX A;  4ERR A;  1XZY A;  5JR9 A;  3ZT6 A;  5H6R B;  5LBQ B;  4PK6 A;  2W62 A;  1YKE B;  2KZ7 B;  2XJ7 A;  2BKN A;  3PUX F;  3M3Z B;  5F8P A;  2X68 A;  5JRC A;  1XNR T;  4ANJ A;  3AAE B;  2XM1 A;  2Q9Q C;  4EED A;  2FJD A;  3AEG A;  4I50 E;  5FP3 A;  2JMK A;  3NRY A;  4UEM A;  3LFM A;  4DV0 T;  5IYZ E;  4AKI A;  4OX9 T;  3RF1 A;  3NKZ A;  5LMN T;  5LG3 A;  2AE9 A;  4C90 A;  4ZS2 A;  2E5L T;  2XQ5 A;  2HHH T;  5JTG A;  3LJC A;  5JDL A;  4ISS A;  2E8I A;  2WAU A;  4MHC A;  2N2N A;  3LBX B;  2W61 A;  1R8I A;  4IIJ E;  4CN4 A;  5CJ5 A;  1VCT A;  2C5I T;  5JDQ A;  4DR5 T;  1OXZ A;  1LKX A;  5HXE A;  5AQV B;  1YQ3 A;  2KLQ A;  4NXN T;  1WCR A;  2VUR A;  2HN2 A;  1ZP0 A;  3OBV E;  4TWD A;  3OPC A;  3ANW A;  4UV9 B;  3AA6 B;  2JQQ A;  3I9Y A;  3JC6 C;  4YY3 T;  3WI3 A;  4KHP T;  2K3W A;  4O4H E;  2VB6 A;  5LOV E;  3MXZ A;  3ABV A;  4P0B A;  2BVM A;  4U2Y A;  2LSG A;  3T1H T;  4QXB B;  2XQA A;  4DR4 T;  3R84 B;  1XMQ T;  1U4Q A;  4ILU A;  3RQU A;  5F3J A;  2VQE T;  3FZM B;  4I55 E;  4FI5 A;  4KHZ F;  4YTP A;  5DJQ C;  5LP6 E;  4EOZ B;  4QX7 B;  3E0Z A;  2M6B A;  2E5V A;  3IBP A;  2BKO A;  2VKD A;  5AQU B;  4CN1 A;  2WBL A;  3FZL B;  4PW8 A;  4PJJ A;  5JDF A;  4IL9 A;  3P50 A;  2LRL A;  2HPL A;  2CMR A;  4GKK T;  1B7T A;  3HKE E;  3ZC0 A;  3F57 A;  4OHF A;  3UU3 A;  3VR8 A;  3Q2M A;  3C4W A;  2R6G F;  4TWF A;  2ODU A;  5FMN A;  1CUN A;  4H9Q C;  4U33 A;  2WB5 A;  4A98 A;  2ES0 A;  3AA1 B;  5AQL B;  2HPJ A;  3PE0 A;  3AEB A;  5AQF B;  2JIW A;  5FXV A;  1WRD A;  1CHU A;  1OED C;  3O1H A;  4IDQ A;  2VL0 A;  5HEH A;  2JPF A;  5ABF B;  4Q25 A;  3GN5 A;  1N33 T;  3N9Q A;  3P8C D;  3WAJ A;  4ZZC A;  4AKH A;  3RX6 A;  1J1J A;  1HG5 A;  2NOX A;  1FIO A;  3RIU A;  4IL4 A;  4YSY A;  1M62 A;  4F8H A;  3PTR B;  2WDR A;  5AQJ B;  3EDU A;  3KFW X;  4WBN E;  1QUU A;  3RC8 A;  3NWI A;  4GYR A;  3TLW A;  4A5X A;  3AE8 A;  3ETV A;  3A8Y C;  3EUH A;  4IE4 A;  3RHW A;  2VAS A;  2XM2 A;  4PJM A;  1M7K A;  2H7V C;  2BG9 B;  3RKG A;  4GYS A;  2J47 A;  1MND A;  1S94 A;  2V7K A;  1SHZ C;  2CHO A;  5IHY A;  1QSD A;  1OWA A;  2WY2 A;  1VOM A;  4ZI2 C;  3RI5 A;  4X20 E;  3O4X E;  2MBG A;  3EI0 A;  5KX5 E;  2E2A A;  3SS1 A;  4CXW A;  2WU2 A;  3ZSS A;  2JQ9 A;  1US7 B;  4HFI A;  3ZYL A;  4NXM T;  3VU7 H;  4ZI7 E;  4HWH A;  4ZXL A;  2XAF B;  3JCF A;  4PK4 A;  4JI0 T;  4UVA B;  4PAG A;  3ZJ1 A;  2XY8 B;  3GA8 A;  4OYJ A;  4DO0 A;  4TNW A;  3EHZ A;  1X79 A;  3LK3 B;  2YDQ A;  4HFB A;  3KIN B;  4H9P C;  2NTX A;  3JAE A;  5JQG E;  3ZN1 B;  3CPZ A;  2C5J A;  4LML A;  3UUL A;  1FMV A;  1LVF A;  4CQI A;  2ZLY A;  1YKH B;  4U31 A;  4DR1 T;  3RGL A;  2L9Q A;  3SOL A;  3ZMZ B;  3N2O A;  3K8P C;  4QWN B;  2V7I A;  1V9D A;  4IDO A;  3P4R A;  4Z90 A;  2XQ4 A;  1LVK A;  4ZS3 A;  1D1B A;  1HG2 A;  3N9P A;  3PUR A;  3ZMU B;  2VKH A;  1ZV4 X;  2KND A;  3ZKR A;  3PUQ A;  4WYV A;  4G63 A;  4H9R C;  3NBX X;  4HTE A;  3RQW A;  3FXD B;  4A56 A;  5LG4 A;  2WZI A;  2ZM2 A;  4IDN A;  4ZOL E;  3N9M A;  4UEL A;  2LLY A;  2BKP A;  4O4I E;  5JR9 B;  2IIU A;  5FNV E;  5HXR A;  1EZ3 A;  4O2B E;  1AJ3 A;  4LF4 T;  1OED A;  5L3E B;  4X1Y E;  5ABE A;  4JI3 T;  5AQP B;  4PK5 A;  4HWD A;  5HAX A;  4TX5 A;  3JAF A;  2XQ3 A;  1W09 A;  2A2F X;  2W0G A;  3E08 A;  2EHO A;  3VKH A;  2YKS A;  1BR1 A;  4UF0 A;  3Q9D A;  4IE0 A;  2BBJ A;  4EXT A;  3ZN0 B;  1UCU A;  1JNZ A;  3OYZ A;  3ZC1 A;  5EK2 A;  5HWY A;  2RA1 A;  1Z0P A;  2ODV A;  3UU4 A;  4ZI3 C;  2YDS A;  4YHH T;  5J1G A;  4DV4 T;  2CRB A;  1FJG T;  2WCA A;  3MK7 C;  3KBU A;  4LFA T;  5DQW A;  1WLX A;  3FBZ A;  4QXH B;  2V6Y A;  4JEU B;  2CPT A;  3EVY A;  2FUP A;  2IC6 A;  2YEV C;  4DV6 T;  2K5B B;  5J2U E;  4X1I E;  3CQG B;  3LG7 A;  3NZQ A;  4QH1 A;  1HTJ F;  2W67 A;  3OVU A;  1LRZ A;  5HWX A;  3UUN A;  5JDN A;  4UR9 A;  5KDM C;  3RRC A;  4YT0 A;  3N9N A;  4YTN A;  4EZ4 A;  2WDQ A;  5FXW A;  1HFA A;  2LKG A;  2XQ8 A;  4BAY B;  2HN1 A;  5LJN A;  5H6Q B;  4IRE A;  5ABH A;  1NEN A;  2LOS A;  2E9X D;  4DUZ T;  3OTO T;  2N1G A;  4DV5 T;  3MAC A;  4AKL A;  3DP7 A;  2QVA A;  5LGT B;  2X0Y A;  5FYM A;  2CLY B;  2XAS B;  1WR6 A;  2UXC T;  4BJM A;  2OLT A;  4P09 A;  4DR3 T;  3CK6 A;  1WFD A;  3UT5 E;  3TLT A;  1HX1 B;  2WMO A;  3X1D A;  4AXP A;  3PUW F;  3RKO A;  3KV5 A;  2X9W A;  4X62 T;  4CI1 B;  3OKQ A;  1D0Y A;  1WR0 A;  1HNX T;  3I0Q A;  2LSJ A;  2KXP B;  2JQK A;  2BDE A;  4ADZ A;  3QB5 K;  1XNQ T;  3RPU A;  1BR0 A;  3NVO A;  4OFZ A;  3Q5W A;  1HF8 A;  3V5U A;  3BK9 A;  5L3F B;  3KV4 A;  3AE3 A;  4CI2 B;  2BVL A;  3HKD E;  1W9R A;  3PJA A;  2VKO A;  5JDG A;  4F6R C;  3CWZ B;  5AQG B;  5AQK B;  3CX7 B;  2VK9 A;  4JI1 T;  1GQE A;  2UXX B;  5HEO A;  3MZK B;  3HL6 A;  3VRB A;  3C98 B;  3QOF A;  3PJA J;  3AXJ A;  3SWH A;  2UUC T;  5FY1 A;  2DI4 A;  2LT3 A;  2P9B A;  4LF5 T;  2ZM0 A;  3P7I A;  2XQ7 A;  1I6Z A;  4MLK A;  4V1A v;  4L9I A;  1QLB A;  4H9O C;  2J4G A;  4EAH A;  1KK7 A;  2NWB A;  5LNK A;  2MYS A;  3HI2 A;  4B3M T;  1HNW T;  3O1I A;  2X51 A;  3LK2 B;  3UU6 A;  5L3B B;  1O3X A;  3QNU A;  3IEE A;  5EZY E;  2KIN B;  2IHR 1;  1T98 A;  4UVC B;  5LGN B;  5KXJ A;  1ZEE A;  4PFO A;  1J5W A;  2Y48 B;  2E9X B;  3ONL C;  2X9Y A;  2EHO D;  5HEU A;  4B3R T;  1D0X A;  3PUZ F;  4CXY A;  2XAH B;  3UU8 A;  2ZMA A;  4U74 A;  4O4J E;  2CWY A;  3T1Y T;  2D5U A;  4WZX A;  5JVD E;  3T8O A;  4EB6 E;  1YQ4 A;  2YN6 A;  3HR0 A;  2UUB T;  2BG9 C;  2F4V T;  3SFE A;  1OED E;  3IF8 B;  4DV1 T;  2ACX A;  3EAB A;  2V7M A;  2XSA A;  5L3D B;  5FXX A;  3MA9 A;  4HFE A;  5LGU B;  3N9O A;  4NUU A;  3CX8 B;  2X0L B;  4U7I A;  4QXC B;  4ASK A;  3LBX A;  3PUA A;  2CE7 A;  3AVS A;  2YOE A;  3AE4 A;  4CN6 A;  3VHL A;  3AAA B;  2J1D G;  3LSV A;  4ZEY A;  2LEH A;  4UIG A;  5JDM A;  3CVR A;  3ZT5 A;  1NAF A;  2WQY A;  3ONX A;  3P4S A;  1D1C A;  3O1J A;  4KMC A;  4B3S T;  5LMU T;  4DBQ A;  2Q9Q A;  4DMV A;  1IJ5 A;  2UXN B;  2OA5 A;  2XUE A;  5HEG A;  4DVD A;  2UXB T;  4KX6 A;  3C4X A;  4EEB A;  4YXD A;  1JNR A;  1IBL T;  4UXN B;  1E1H B;  5TAO A;  4ZHQ E;  3ZYM A;  5FVL A;  3UUX B;  1YXR A;  2CBJ A;  3N9L A;  4WW0 A;  2VVN A;  2H89 A;  1U5P A;  2V26 A;  2EHO B;  4JI6 T;  4M1P A;  2WDV A;  1ZHC A;  4TWH A;  2I59 A;  2NTY A;  3HKB E;  4YTM A;  3PUG A;  2X67 A;  4JUY A;  3EAM A;  3L3P A;  2CEA A;  4XBF B;  1KEY A;  2LSY A;  3UUM A;  5FY7 A;  1HR0 T;  2K48 A;  4HN9 A;  3R6N A;  2CXD A;  5AQS B;  2YIN A;  2V8S V;  3ESL A;  4P1N A;  3RIF A;  5JR9 C;  2FJA A;  5LB7 B;  3FB2 A;  4YHJ A;  5DQV A;  1HNZ T;  2V6Y B;  3KV6 A;  5LHG B;  1I94 T;  1FMW A;  2XAQ B;  3VRA A;  4LFC T;  3RH3 A;  4H9N C;  3I1A A;  2XHE B;  5CB4 E;  5ETW A;  1NEK A;  5FL0 A;  4KI0 F;  3SFD A;  1IJ6 A;  2C5K T;  4HFD A;  2BS4 A;  5L4E A;  4AQF C;  5HCM A;  3TLS A;  2G0U A;  3RRW A;  4U2Z A;  2V5C A;  4DID B;  3BQK A;  3QK6 A;  4I43 B;  2MAW A;  4HEA A;  2BZB A;  2UXD T;  5IWA T;  4LF6 T;  3A5X A;  4AIS A;  3ZEF B;  1N32 T;  4X64 T;  2IAK A;  2GK9 A;  2RPA A;  2L8K A;  3F31 A;  1VRB A;  4HWF A;  4O8S A;  4OK0 A;  2DLR A;  4O4L E;  1BR2 A;  4MBQ A;  3DTO A;  1G8X A;  5JRC B;  4O2A E;  4IE7 A;  5C3J A;  1KNP A;  4JEH B;  2LHN A;  3AVR A;  2CHN A;  4NIQ A;  4DR2 T;  4WBO A;  3U78 A;  2LHR A;  4JV5 T;  3ZMS B;  3ZST A;  4BA9 A;  2ZM6 T;  2CLY C;  1WYB A;  4H63 H;  1IBK T;  2Z6E A;  3P4W A;  3FZF B;  4UVB B;  4OYK A;  4JI5 T;  3PUS A;  3W15 B;  3L8R A;  3AE7 A;  3TKL B;  4HKA A;  2WM9 A;  1X9B A;  1IAP A;  2WZH A;  4B6X A;  3PU8 A;  4LF7 T;  3ZYK A;  3UFG A;  3K1S A;  2DNX A;  5J2T E;  1MMG A;  3RIA A;  2CA5 A;  1XWM A;  4UV8 B;  3PUV F;  2K24 A;  4ILB A;  3K3N A;  3ANW B;  2V1D B;  4LF9 T;  3AE6 A;  3AE1 A;  1MIV A;  2WU5 A;  3CML A;  3G06 A;  1T7S A;  2D9D A;  4IST A;  2H7O A;  2MPK A;  2D2S A;  2LJL A;  2A72 A;  2NW7 A;  4NUV A;  3AED A;  3E22 E;  3ZCI A;  4MAL A;  2YU1 A;  4DR7 T;  2K9A A;  2LSK A;  4QKN A;  1IBM T;  2CM0 A;  2CWO A;  4I0U A;  3L09 A;  3ONJ A;  3QB5 A;  2DL1 A;  4JBW F;  4E7S A;  2FJB A;  2QGS A;  5FY0 A;  4AI6 A;  1N36 T;  4CZZ B;  2VWA A;  4J2C A;  2I6H A;  2NW8 A;  2JRK A;  5EK4 A;  5L3C B;  4IDZ A;  4JI7 T;  4KBM B;  3P4P A;  3PU3 A;  3AAI A;  4TNV A;  3RIU C;  3K3O A;  3QC9 A;  2CCQ A;  4HWC A;  3KBT A;  3TLV A;  2L3L A;  3JC6 D;  4N78 D;  1UX5 A;  4H9S E;  4X66 T;  3F2E A;  1D1A A;  2KWI B;  2JMH A;  5E0O A;  4GIW A;  1W0B A;  4GKJ T;  4AQY T;  3M65 A;  2QA7 A;  4L5G A;  1UUR A;  4YJ2 E;  1MIW A;  3U3I A;  3N2K E;  4AQF A;  3H37 A;  3AE5 A;  4LMJ A;  2XSB A;  2E9X C;  5BR8 T;  1UGO A;  3CQX C;  1VCS A;  3O9X A;  5AFU L;  2WSS V;  5GON E;  4EV6 A;  3AEE A;  3GN5 B;  4EYY R;  1BR4 A;  3C64 A;  5F5W A;  1YW0 A;  2LSI A;  2MOZ A;  2LRK A;  3IHR A;  3PDY A;  5L3G B;  2X9H A;  3PUY F;  1H7C A;  2XQ9 A;  3C4Z A;  2RP4 A;  3IA3 A;  2XQY A;  3ZMT B;  3AE9 A;  5CGM A; 
#chains in the Genus database with same CATH homology
 2V6Y B;  4A5X A;  2K3W A;  2W2U A;  2V6Y A;  2LRL A;  4U3C A;  3ZST A;  4CN6 A;  5FVK A;  2CPT A;  2V6X A;  4U2Z A;  2DL1 A;  4U2Y A;  4WZX A;  4CN1 A;  2MPK A;  4U33 A;  4ZEY A;  2CRB A;  3K1S A;  1WCR A;  2LRK A;  4U31 A;  2XZE A;  2A9U A;  2RPA A;  1WR0 A;  2WY2 A;  4P1N A;  3ZSS A;  2JQ9 A;  2JQH A;  4NIQ A;  3ZT5 A;  4U7I A;  2WWV A;  3ZT6 A;  3ZT7 A;  4U7Y A;  5FVL A;  5LB7 B;  4IT4 A;  1YXR A;  3EAB A;  2JQK A;  1WFD A;  5CGM A;  4CN4 A;  5CJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...