4WZXA

Ulk3 regulates cytokinetic abscission by phosphorylating escrt-iii proteins
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
87
structure length
87
Chain Sequence
TSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEYLKEQVKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Serine/threonine-protein kinase ULK3
total genus 38
structure length 87
sequence length 87
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4wzxA01
4P1NA 2DL1A 2K3WA 5CGMA 4U3CA 3ZSSA 2WY2A 5FVLA 4CN4A 5FVKA 2RPAA 4IT4A 4U31A 1WR0A 4NIQA 2LRKA 2CPTA 2LRLA 2XZEA 4CN1A 5LB7B 4U2YA 4U33A 3K1SA 3ZSTA 3ZT7A 1WFDA 4U7IA 2MPKA 3EABA 2CRBA 2W2UA 4A5XA 5CJ5A 4ZEYA 2JQ9A 2A9UA 1YXRA 2JQHA 3ZT5A 2V6YA 2V6XA 1WCRA 3ZT6A 4WZXA 4U2ZA 2WWVA 2V6YB 2JQKA 4CN6A 4U7YA
chains in the Genus database with same CATH superfamily
4X1YE 2NW7A 4LF4T 3JCFA 4I55E 3FZMB 2KWHA 3AVSA 3UUMA 5L3BB 2WY2A 1D1BA 2FJBA 2ODUA 5L4HA 1MIYA 5FKYA 3O1HA 2WBLA 1XDOA 2X0YA 3RHWA 2QRXA 4DMWA 4EZHA 4CI1B 1VCTA 3ZKRA 5GONE 4HFVA 4GIWA 5AQGB 4EAHA 4K0UA 5ABEA 3Q5DA 4G63A 3Q5EA 4H63H 4JLEA 2CBIA 4HN9A 3AE6A 4NXMT 2C5KT 3EDVA 1J1JA 2XQ6A 3RYIE 4H9QC 4YHJA 3I9WA 2XAFB 2BG9C 1ZKEA 2WQYA 2N9DA 3RC3A 2IMLA 2AXDS 4WBOA 5AQHB 1IJ6A 5J1GA 2YU2A 4OK0A 4HWIB 4TNVA 5EK3A 2UXBT 3PUWF 1ZP0A 4ZHQE 2XASB 5JDLA 3WAJA 1DU2A 3O9XA 2W0GA 3OVUA 3PUQA 4HWCA 4IE4A 4CN6A 1VCSA 4Z8XA 3J7Yq 3MXZA 3RKOA 5BR8T 3AE2A 3P4PA 2MYSA 5HCMA 5IUXA 4B3MT 5J2TE 4JYAT 3NZPA 2BDEA 2AE9A 3QB5K 5FVKA 5ABFA 4JEHB 4LMJA 2LRKA 2WU5A 4JEUB 4JUYA 4UV9B 2XZEA 1MNDA 3NVOA 4COFA 4PJNA 2V7LA 5JR9A 1NWMX 2KMFA 3PUVF 2X67A 4PAGA 3RI5A 5AFUL 5LNKA 1IBLT 3AXJA 4HGAA 5JR9C 5ADXL 4MFRA 1N33T 3M3ZB 5L2LA 4HTEA 2UUCT 2W67A 2PBIA 3Q9DA 4ZEYA 4LFAT 4PJMA 1KFYA 2NW9A 2XSBA 4CXYA 4PFPA 5JQGE 3H37A 3SWHA 4X62T 1KEYA 2X9YA 4QKNA 4YLHA 1M62A 2PJQA 1SE7A 2LM9A 1MNEA 5LYJE 2IAKA 4EYYR 2D5UA 4AKIA 2VASA 3LFMA 4Z91A 5FNVE 2VVNA 5JDHA 4PJLA 5FVLA 4EEBA 3R84B 3P4QA 2RA1A 3Q2MA 5EZYE 3AE4A 4HWHA 4TN7B 3ZMZB 4DVDA 4ZI2D 5FL1A 2J62A 2W66A 4DV0T 1MMGA 4YSXA 3NRXA 4LF6T 3L8RA 2K24A 2WZHA 3CX7B 3ZSTA 5LA6E 4K0KT 3VR8A 3E08A 3ZT7A 1WFDA 2H3RA 2YINA 3RLFF 4ADZA 3AEAA 5LJMA 4M1PA 4EV6A 4J2CA 3IEEA 4X1KE 3EABA 2V7KA 2IIUA 3JADA 2GK9A 4HFIA 3HKDE 3TLUA 3UQ4A 5HEJA 3O1IA 2CXFA 3PUYF 3ZMUB 5J2UE 2N2NA 4HFCA 2XQ4A 4A56A 2BG9B 2LJLA 2Q9QC 2WWUA 2XQ9A 2XPKA 3ZMSB 3HI2A 1R8IA 2VL8A 5FXXA 3ABVA 4NUUA 3LG7A 3IHRA 1JNZA 3C4XA 3L09A 3N9PA 4HFBA 2X68A 4UR9A 3O1JA 2LSJA 3AEBA 3MA9A 3ZSSA 2H89A 4BJNA 3N9MA 2V5CA 1FMVA 1WYCA 1J5WA 2FJEA 2HH7A 4JI0T 3P7IA 4XAXB 5HCJA 4BJMA 5JDMA 5FYMA 2X9HA 4KP3C 1US7B 1SA0E 1ZHCA 2QYWA 1LRZA 1G73A 2D0TA 4P0BA 2UXXB 4PW8A 3UT5E 2E5VA 4QX7B 3ETUA 1HG5A 1KK7A 4ISSA 2D9DA 4JBWF 1N34T 2A2FX 2XAHB 3KDSE 2XAQB 3NKZA 3GMIA 4I43B 3ZYKA 4LF7T 1JNRA 1XWMA 4U72A 4ANJA 4A98A 2V6XA 2VKHA 3AEDA 1W0AA 3AE9A 2CEAA 3KVBA 2I59A 3PJAA 2VVSA 4HFDA 4HWDA 2J4GA 3JAEA 4UEMA 3ZT6A 1IBKT 4KHPT 2VQET 3AA1B 3N9OA 5L3EB 1W9RA 1MMAA 3T8OA 3E0ZA 1HG2A 1UX5A 2BKOA 2E8IA 3CMLA 3T1HT 3AAAB 3GA8A 3HL6A 2IC6A 3CVRA 1OEDB 4P0AA 4ILBA 1WR0A 2YN6A 2WSSV 3AB3B 4C91A 4AISA 3C64A 3G06A 4CQIA 3UU6A 3DTOA 5M4YA 2WDQA 2W62A 3E22E 2BBHA 3UFEA 2XUEA 5JR9B 1X79A 2VQFT 2XM1A 2HPJA 4PJJA 2C5IT 5JVDE 3U78A 2C0SA 1NEKA 1S94A 2MPKA 4EXTA 1YD8G 4UIGA 1VRBA 1IAPA 1HNWT 4EIWA 2CXLA 1HNZT 3F31A 2FJDA 3QOFA 3A7MA 3PU3A 3PUAA 3PUXF 4UF0A 4UELA 2BG9A 4WW0A 2BS3A 1QUUA 2HPLA 2BS4A 2YDQA 3J9X1 3H3AA 3N2GE 2A72A 2H88A 2XTLA 3AE3A 2YDRA 5AQTB 5CGMA 2CWOA 5C2TA 2UXCT 3OPCA 1HS7A 3EI0A 2OLTA 4IE6A 4UXNB 4WBNE 2XQ3A 4G2AA 1WRDA 1HX8A 4X64T 2BVLA 2JMKA 4B3RT 5E0OA 2Z6EA 2IUBA 3VRAA 5JTGA 5L47A 4DR3T 2QGSA 1J5ET 5ABFB 4YSZA 1Y64B 2JMHA 4H9OC 4NXNT 4GKJT 4QHOA 1KNRA 2XM2A 2LSYA 2PTFA 1T8BA 3FXDB 4IDQA 5FXVA 3NBXX 3WI3A 2W4XA 3RRCA 5KMGP 4A5XA 2X66A 2J1DG 4LFCT 1D1AA 2X0LB 3ZT5A 2UXDT 2M6IA 1MMNA 3RIFA 2JPFA 2YOEA 4ISTA 5LP6E 4KHZF 5ABHA 2MAWA 2YEVC 4OHFA 2VKDA 2Q9QD 3HKEE 2WWVA 3C50A 3CIRA 4EZ4A 3AVRA 5LMNT 4JI1T 5C8YE 4DNDA 4P1NA 3CK6A 2YU1A 2XAJB 2V7JA 3ONXA 5HXRA 4AKLA 5CB4E 4IDZA 3A8YC 5DABA 3K3OA 3FZKB 4U31A 4PK5A 1FIOA 2Y48B 5AQJB 3KFWX 1LVKA 2JIWA 2KLQA 2KZ7B 2LRLA 2VURA 3PU8A 4TV8E 2K9AA 1HNXT 3PUGA 3Q5XA 4GK5E 5L3FB 3RQUA 1BR2A 2B1EA 2CM0A 2WB5A 3QK6A 5LHGB 5A1LA 4DUYT 3CKDA 4HEAA 3W15B 1G8XA 1CUNA 1U4QA 2LM2A 2XQ5A 4C90A 5EK2A 4DR1T 3SFEA 1MIWA 3KINB 5HYAA 1E1HB 2LLYA 2V6YA 2LSKA 5H6QB 4H9RC 3X1DA 1Z0PA 4LMLA 3I1AA 4I50E 3IA3A 1HX1B 4UF0B 3CX8B 3SOLA 4ILUA 5JDNA 1AJ3A 2LHRA 3ZC1A 3UTKA 4DR6T 2DL1A 5AQIB 4AKHA 3P50A 3PTRB 2VL0A 2J47A 2W00A 2X9WA 2CA5A 4IDPA 2PFVA 2V26A 3MK7C 4O2AE 3ZYLA 3AE1A 3VKHA 5HXSA 1YKEB 5LG4A 3PUSA 3N9QA 2NWBA 2OA5A 1HCIA 2CPTA 1E2AA 2LKHA 2XQYA 4QXBB 4TV9E 4TWDA 4CN1A 3K3NA 4AKGA 5HEGA 4Z90A 5F5WA 2XY8B 4DV1T 5LG3A 2ZMAA 3QC9A 4YJ2E 3EHZA 3GN5A 3OTOT 2DI4A 2DWKA 4U7IA 3UUNA 1XDPA 3SRZA 3WAKA 2NTYA 5JREA 2I0MA 2JRKA 4EYUA 4TUYE 1VOMA 1FJGT 1OEDE 4DMVA 3ZCJA 1FMWA 3ETVA 2M67A 1S35A 4ILCA 4TNWA 5L4EA 2ZM6T 1WCRA 5F8PA 3FZFB 2BVMA 2NP9A 3DJBA 4JI2T 3RH3A 2DNXA 2L3LA 1SHZC 3UU5A 4FI5A 4IE0A 5JDQA 2CXDA 3H3MA 1HFAA 3RIUC 2I6HA 2MOZA 3B57A 4EEDA 3RPUA 4H63V 3V5SA 4ZZBA 4XZCA 4AQFA 2NTXA 3AXJB 4MALA 2CCQA 4MBQA 4N78D 3RYHE 1U5PA 1YKHB 3C4WA 3LK3B 3PE0A 4HWFA 1YW0A 5KX5E 1LKXA 2CLYB 5LB7B 1KNZA 4X5TA 1OEDA 5AQUB 4AI6A 4KMCA 5FP3A 1LVFA 3RF1A 5DQVA 5ABGA 4ASKA 4FJOA 4HKAA 3T1YT 4HE8A 2ACXA 2V1DB 1BR4A 2W2UA 3UUXB 5HEHA 4H9SE 5HXCA 4L0RA 4IE7A 2JQHA 4DV2T 3VKGA 3B5MA 3OKQA 4B3ST 3BQKA 1IJ5A 2HN2A 4HFEA 2FJAA 2JQKA 1ZV4X 3ZPOA 1FEWA 4U7YA 4E7SA 2EHOC 3TLVA 5LCYA 4AXPA 1I94T 4OX9T 3AEEA 4IHJE 3TLTA 2BBJA 3D0TA 2JJ9A 3CQGB 3ANWB 2V8SV 2N1GA 2XQAA 5LJNA 3ZLIA 2BS2A 1XNRT 2K48A 5HWXA 4JI7T 2X0HA 2KXPB 3JAFA 3OJAA 2HHHT 2RP4A 5AQPB 3LJCA 4UVAB 4LF8T 3C4ZA 2WDVA 2ODVA 4YT0A 1UGOA 2QVAA 1KNPA 4IDNA 3L39A 1D0XA 4O2BE 3UU3A 4CI2B 2H7VC 4QXCB 2XJ7A 1E7PA 3OYZA 2VKJA 3QUJA 5FL0A 5FY7A 1XMOT 3CQCB 3AAIA 2BZBA 3FZLB 2WDRA 3ZYMA 1XMQT 2V7IA 4IGUA 3FHNA 2W61A 5C3JA 2XHEB 3I0QA 3B13A 4JI5T 2L8KA 3BK9A 2BKNA 3TLSA 2ZM0A 2NR4A 4OYKA 3VR9A 4ERRA 2XAGB 4U3CA 4EGWA 4YTNA 4CN4A 3HR0A 1UURA 1V9DA 3F57A 1UK5A 2XQ8A 3KBUA 1NENA 4DV6T 1N36T 3KV5A 3AA7B 3AE8A 4JI4T 3MZKB 2WP9A 4GK0E 4L9IA 4LMKA 4NUVA 4YXDA 4DV4T 2LT3A 3N2KE 3MACA 2MTQA 4O4JE 1Y01A 4ZI2C 3O4XE 2CHOA 3SFDA 3ZJ2A 2JQQA 5AQQB 4A97A 4O4IE 2YDSA 3AA6B 5CJ5A 3LK42 3ZMVB 2A3DA 2A9UA 4QH4A 5AQFB 3KV6A 1UUSA 2ZLYA 5CA1E 4QX8B 4UV8B 4BAYB 4F8HA 3RIUA 3UU4A 4YJ3E 3CQXC 5LBMA 1ZOYA 5AQSB 3ESLA 4DUZT 2Y6XA 5HWYA 5CFBA 2XQ7A 4QH1A 3KV4A 2VK9A 5AQMB 2XSAA 5HXEA 3FXEB 2UU9T 2X51A 3N9NA 2EHOB 2CWYA 3RIAA 4IT4A 2LOPA 3KV9A 3P4RA 4Q25A 2DCFA 5FMNA 4E7ZA 3LDQB 1YQ3A 3NRYA 1QLBA 1XZYA 3UUBA 1D1CA 2E9XB 5TAOA 5LXTE 4CZZB 2ZM2A 1WR6A 3AECA 2WS3A 3HKCE 3K1SA 3RQWA 2WZIA 3I0OA 4KBMB 3EDUA 2IHR1 3LBXB 3CX6B 3QNUA 3KVAA 3VU7H 4DR4T 3HKBE 2WMNA 4PK6A 5HAXA 1MMDA 2W63A 4ZI7E 1I6ZA 1T72A 2JQ9A 3AE5A 3PJAJ 4I0UA 4QWNB 5CA0E 2E2AA 4YY3T 3PDYA 3LSVA 4PFOA 5JH7E 5LGTB 4IE5A 3SS1A 4WZXA 5AQOB 4ZI3C 1IBMT 5JRCB 2CE7A 2D2SA 2V7MA 3VHLA 2K3WA 4AQYT 1QSDA 2HN1A 2YK0A 3GWHA 3I9YA 3P4SA 2KT9A 3LBXA 4KX6A 4DR5T 3Q5WA 3ONLC 2ES0A 1WYBA 4H9PC 4NIQA 4YTMA 3RYCE 4BA9A 4F6RC 2YKSA 3IF8B 5DQWA 5AQRB 2CMRA 3AAEB 3M65A 2UXNB 3ZC0A 4UVBB 4DBQA 1BR0A 5L3CB 3K8PC 4DIDB 1HR0T 4LF9T 5LGNB 3MJXA 4V1Av 1OXZA 3FBZA 2CBJA 3TKLB 4DV5T 2K5BB 3U3IA 3RX6A 4GYSA 4ZXLA 5LHIB 1HTJF 2KINB 4GYRA 3RC8A 2BG9E 2SPCA 1EZ3A 3C98B 3CWZB 2DWGA 4OFZA 3JC6D 4TWHA 2FBWA 3ZN0B 4ZI3D 4DV3T 2ZM8A 3NZQA 2L9QA 2LEHA 3AA0B 3OYXA 4IDOA 1D0YA 1IZNB 1W0BA 2OV9A 3CPZA 4IIJE 4ILAA 3EVYA 3DP7A 4WYVA 5FY1A 3MKDA 2LSGA 3P4WA 4CI3B 2KNDA 2V5DA 1OEDC 2VKOA 4P09A 2Q9QA 4TX5A 5LGUB 4JI6T 3BQIA 1UCUA 5AQVB 4JI3T 1B7TA 2R6GF 3GN5B 2C5JA 3PV0F 4NPPA 2CLYC 3KBTA 3OBVE 3ZCIA 5L3DB 2E5LT 4H9NC 4AQFC 5LBQB 4DO0A 3FBLA 2E9XA 4IREA 4WNKA 5EK4A 4CXWA 5HXHA 2UUBT 2IC9A 2X9XA 3R6NA 2BKPA 3IBPA 4X20E 3AEFA 1D0ZA 5KXJA 2WMOA 1M7KA 1MIVA 4X65T 4JV5T 2KSRA 1CHUA 3ANWA 4XBFB 1YQ4A 2Q9QB 3EAMA 2CHNA 4O4LE 4YFSA 1OWAA 3UFGA 2WM9A 4O4HE 3UULA 1UX4A 2G0UA 4DBRA 4YTPA 3UU8A 3ZMTB 5FXZA 1NAFA 2B76A 2VWAA 5LHHB 2LE8A 1SUMB 4HFHA 4O8SA 3N9LA 4OYJA 4TWFA 5IHYA 2Y8DA 5LMUT 4QH5A 3AE7A 3ZN1B 3A5XA 3QB5A 5IYZE 2F4VT 2M6BA 4IL4A 4ZOLE 3HA4A 3ONJA 2NOXA 3PURA 3RKGA 3TLWA 4EB6E 5L3GB 2E9XC 4UVCB 3ZEFB 3C51A 1X9BA 3FZHB 4KUMB 5HEUA 3NWIA 3RYFE 4YHHT 1Z8UA 2DHRA 1T7SA 5H6RB 3ZJ1A 4U2YA 3LK2B 5J0ZA 2E9XD 4JI8T 2MBGA 3P8CD 2KWIB 4KI0F 4U74A 1WLXA 3S4UA 3N5LA 5FXWA 3VRBA 1T98A 4B3TT 5F3JA 4GKKT 2CRBA 3EUHA 1BR1A 2P9BA 4PK4A 4LFBT 1YXRA 2VB6A 5ETWA 2DLRA 5AQLB 3K3QC 5IWAT 4L5GA 4I4TE 5JDGA 4AIUA 5BMVE 4U2ZA 2V6YB 1HF8A 5JRCA 2WCAA 5DJQC 2NW8A 2UUAT 4MLKA 4DR7T 5JDFA 5KDMC 3N2OA 5AQKB 4DV7T 3V5UA 3BQLA 4AKRB 2RPAA 1W09A 2LHNA 3FB2A 4PNIA 4QXHB 4B6XA 4YSYA 4X66T 2FUPA 1N32T 5HEOA 5LOVE 4TZ4C 4ZZCA 2IW5B 4U33A 4DR2T 1H7CA 4AQGA 2D0UA 3AEGA 2LSIA 2PG8A 3F2EA 3L3PA 3RRWA 2WAUA 3UQ7A 5AQNB 1XNQT 1KF6A 4GOUA 1O3XA 4MHCA 3PUZF 4IL9A 4CXXA 2LKGA 2H7OA 1L0VA 2EHOA 4ZS3A 2EHOD 2QA7A 1GQEA 2WU2A 2LOSA 4ZS2A 3RGLA 2ACZA 3JC6C 5FY0A 4EOZB 1ZEEA 4X1IE 4LF5T 2IDOB
chains in the Genus database with same CATH topology
4P1NA 2DL1A 2K3WA 5CGMA 4U3CA 3ZSSA 2WY2A 5FVLA 4CN4A 5FVKA 2RPAA 4IT4A 4U31A 1WR0A 4NIQA 2LRKA 2CPTA 2LRLA 2XZEA 4CN1A 5LB7B 4U2YA 4U33A 3K1SA 3ZSTA 3ZT7A 1WFDA 4U7IA 2MPKA 3EABA 2CRBA 2W2UA 4A5XA 5CJ5A 4ZEYA 2JQ9A 2A9UA 1YXRA 2JQHA 3ZT5A 2V6YA 2V6XA 1WCRA 3ZT6A 4WZXA 4U2ZA 2WWVA 2V6YB 2JQKA 4CN6A 4U7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1N A;  2DL1 A;  2K3W A;  5CGM A;  4U3C A;  3ZSS A;  2WY2 A;  5FVL A;  4CN4 A;  5FVK A;  2RPA A;  4IT4 A;  4U31 A;  1WR0 A;  4NIQ A;  2LRK A;  2CPT A;  2LRL A;  2XZE A;  4CN1 A;  5LB7 B;  4U2Y A;  4U33 A;  3K1S A;  3ZST A;  3ZT7 A;  1WFD A;  4U7I A;  2MPK A;  3EAB A;  2CRB A;  2W2U A;  4A5X A;  5CJ5 A;  4ZEY A;  2JQ9 A;  2A9U A;  1YXR A;  2JQH A;  3ZT5 A;  2V6Y A;  2V6X A;  1WCR A;  3ZT6 A;  4WZX A;  4U2Z A;  2WWV A;  2V6Y B;  2JQK A;  4CN6 A;  4U7Y A; 
#chains in the Genus database with same CATH topology
 4X1Y E;  2NW7 A;  4LF4 T;  3JCF A;  4I55 E;  3FZM B;  2KWH A;  3AVS A;  3UUM A;  5L3B B;  2WY2 A;  1D1B A;  2FJB A;  2ODU A;  5L4H A;  1MIY A;  5FKY A;  3O1H A;  2WBL A;  1XDO A;  2X0Y A;  3RHW A;  2QRX A;  4DMW A;  4EZH A;  4CI1 B;  1VCT A;  3ZKR A;  5GON E;  4HFV A;  4GIW A;  5AQG B;  4EAH A;  4K0U A;  5ABE A;  3Q5D A;  4G63 A;  3Q5E A;  4H63 H;  4JLE A;  2CBI A;  4HN9 A;  3AE6 A;  4NXM T;  2C5K T;  3EDV A;  1J1J A;  2XQ6 A;  3RYI E;  4H9Q C;  4YHJ A;  3I9W A;  2XAF B;  2BG9 C;  1ZKE A;  2WQY A;  2N9D A;  3RC3 A;  2IML A;  2AXD S;  4WBO A;  5AQH B;  1IJ6 A;  5J1G A;  2YU2 A;  4OK0 A;  4HWI B;  4TNV A;  5EK3 A;  2UXB T;  3PUW F;  1ZP0 A;  4ZHQ E;  2XAS B;  5JDL A;  3WAJ A;  1DU2 A;  3O9X A;  2W0G A;  3OVU A;  3PUQ A;  4HWC A;  4IE4 A;  4CN6 A;  1VCS A;  4Z8X A;  3J7Y q;  3MXZ A;  3RKO A;  5BR8 T;  3AE2 A;  3P4P A;  2MYS A;  5HCM A;  5IUX A;  4B3M T;  5J2T E;  4JYA T;  3NZP A;  2BDE A;  2AE9 A;  3QB5 K;  5FVK A;  5ABF A;  4JEH B;  4LMJ A;  2LRK A;  2WU5 A;  4JEU B;  4JUY A;  4UV9 B;  2XZE A;  1MND A;  3NVO A;  4COF A;  4PJN A;  2V7L A;  5JR9 A;  1NWM X;  2KMF A;  3PUV F;  2X67 A;  4PAG A;  3RI5 A;  5AFU L;  5LNK A;  1IBL T;  3AXJ A;  4HGA A;  5JR9 C;  5ADX L;  4MFR A;  1N33 T;  3M3Z B;  5L2L A;  4HTE A;  2UUC T;  2W67 A;  2PBI A;  3Q9D A;  4ZEY A;  4LFA T;  4PJM A;  1KFY A;  2NW9 A;  2XSB A;  4CXY A;  4PFP A;  5JQG E;  3H37 A;  3SWH A;  4X62 T;  1KEY A;  2X9Y A;  4QKN A;  4YLH A;  1M62 A;  2PJQ A;  1SE7 A;  2LM9 A;  1MNE A;  5LYJ E;  2IAK A;  4EYY R;  2D5U A;  4AKI A;  2VAS A;  3LFM A;  4Z91 A;  5FNV E;  2VVN A;  5JDH A;  4PJL A;  5FVL A;  4EEB A;  3R84 B;  3P4Q A;  2RA1 A;  3Q2M A;  5EZY E;  3AE4 A;  4HWH A;  4TN7 B;  3ZMZ B;  4DVD A;  4ZI2 D;  5FL1 A;  2J62 A;  2W66 A;  4DV0 T;  1MMG A;  4YSX A;  3NRX A;  4LF6 T;  3L8R A;  2K24 A;  2WZH A;  3CX7 B;  3ZST A;  5LA6 E;  4K0K T;  3VR8 A;  3E08 A;  3ZT7 A;  1WFD A;  2H3R A;  2YIN A;  3RLF F;  4ADZ A;  3AEA A;  5LJM A;  4M1P A;  4EV6 A;  4J2C A;  3IEE A;  4X1K E;  3EAB A;  2V7K A;  2IIU A;  3JAD A;  2GK9 A;  4HFI A;  3HKD E;  3TLU A;  3UQ4 A;  5HEJ A;  3O1I A;  2CXF A;  3PUY F;  3ZMU B;  5J2U E;  2N2N A;  4HFC A;  2XQ4 A;  4A56 A;  2BG9 B;  2LJL A;  2Q9Q C;  2WWU A;  2XQ9 A;  2XPK A;  3ZMS B;  3HI2 A;  1R8I A;  2VL8 A;  5FXX A;  3ABV A;  4NUU A;  3LG7 A;  3IHR A;  1JNZ A;  3C4X A;  3L09 A;  3N9P A;  4HFB A;  2X68 A;  4UR9 A;  3O1J A;  2LSJ A;  3AEB A;  3MA9 A;  3ZSS A;  2H89 A;  4BJN A;  3N9M A;  2V5C A;  1FMV A;  1WYC A;  1J5W A;  2FJE A;  2HH7 A;  4JI0 T;  3P7I A;  4XAX B;  5HCJ A;  4BJM A;  5JDM A;  5FYM A;  2X9H A;  4KP3 C;  1US7 B;  1SA0 E;  1ZHC A;  2QYW A;  1LRZ A;  1G73 A;  2D0T A;  4P0B A;  2UXX B;  4PW8 A;  3UT5 E;  2E5V A;  4QX7 B;  3ETU A;  1HG5 A;  1KK7 A;  4ISS A;  2D9D A;  4JBW F;  1N34 T;  2A2F X;  2XAH B;  3KDS E;  2XAQ B;  3NKZ A;  3GMI A;  4I43 B;  3ZYK A;  4LF7 T;  1JNR A;  1XWM A;  4U72 A;  4ANJ A;  4A98 A;  2V6X A;  2VKH A;  3AED A;  1W0A A;  3AE9 A;  2CEA A;  3KVB A;  2I59 A;  3PJA A;  2VVS A;  4HFD A;  4HWD A;  2J4G A;  3JAE A;  4UEM A;  3ZT6 A;  1IBK T;  4KHP T;  2VQE T;  3AA1 B;  3N9O A;  5L3E B;  1W9R A;  1MMA A;  3T8O A;  3E0Z A;  1HG2 A;  1UX5 A;  2BKO A;  2E8I A;  3CML A;  3T1H T;  3AAA B;  3GA8 A;  3HL6 A;  2IC6 A;  3CVR A;  1OED B;  4P0A A;  4ILB A;  1WR0 A;  2YN6 A;  2WSS V;  3AB3 B;  4C91 A;  4AIS A;  3C64 A;  3G06 A;  4CQI A;  3UU6 A;  3DTO A;  5M4Y A;  2WDQ A;  2W62 A;  3E22 E;  2BBH A;  3UFE A;  2XUE A;  5JR9 B;  1X79 A;  2VQF T;  2XM1 A;  2HPJ A;  4PJJ A;  2C5I T;  5JVD E;  3U78 A;  2C0S A;  1NEK A;  1S94 A;  2MPK A;  4EXT A;  1YD8 G;  4UIG A;  1VRB A;  1IAP A;  1HNW T;  4EIW A;  2CXL A;  1HNZ T;  3F31 A;  2FJD A;  3QOF A;  3A7M A;  3PU3 A;  3PUA A;  3PUX F;  4UF0 A;  4UEL A;  2BG9 A;  4WW0 A;  2BS3 A;  1QUU A;  2HPL A;  2BS4 A;  2YDQ A;  3J9X 1;  3H3A A;  3N2G E;  2A72 A;  2H88 A;  2XTL A;  3AE3 A;  2YDR A;  5AQT B;  5CGM A;  2CWO A;  5C2T A;  2UXC T;  3OPC A;  1HS7 A;  3EI0 A;  2OLT A;  4IE6 A;  4UXN B;  4WBN E;  2XQ3 A;  4G2A A;  1WRD A;  1HX8 A;  4X64 T;  2BVL A;  2JMK A;  4B3R T;  5E0O A;  2Z6E A;  2IUB A;  3VRA A;  5JTG A;  5L47 A;  4DR3 T;  2QGS A;  1J5E T;  5ABF B;  4YSZ A;  1Y64 B;  2JMH A;  4H9O C;  4NXN T;  4GKJ T;  4QHO A;  1KNR A;  2XM2 A;  2LSY A;  2PTF A;  1T8B A;  3FXD B;  4IDQ A;  5FXV A;  3NBX X;  3WI3 A;  2W4X A;  3RRC A;  5KMG P;  4A5X A;  2X66 A;  2J1D G;  4LFC T;  1D1A A;  2X0L B;  3ZT5 A;  2UXD T;  2M6I A;  1MMN A;  3RIF A;  2JPF A;  2YOE A;  4IST A;  5LP6 E;  4KHZ F;  5ABH A;  2MAW A;  2YEV C;  4OHF A;  2VKD A;  2Q9Q D;  3HKE E;  2WWV A;  3C50 A;  3CIR A;  4EZ4 A;  3AVR A;  5LMN T;  4JI1 T;  5C8Y E;  4DND A;  4P1N A;  3CK6 A;  2YU1 A;  2XAJ B;  2V7J A;  3ONX A;  5HXR A;  4AKL A;  5CB4 E;  4IDZ A;  3A8Y C;  5DAB A;  3K3O A;  3FZK B;  4U31 A;  4PK5 A;  1FIO A;  2Y48 B;  5AQJ B;  3KFW X;  1LVK A;  2JIW A;  2KLQ A;  2KZ7 B;  2LRL A;  2VUR A;  3PU8 A;  4TV8 E;  2K9A A;  1HNX T;  3PUG A;  3Q5X A;  4GK5 E;  5L3F B;  3RQU A;  1BR2 A;  2B1E A;  2CM0 A;  2WB5 A;  3QK6 A;  5LHG B;  5A1L A;  4DUY T;  3CKD A;  4HEA A;  3W15 B;  1G8X A;  1CUN A;  1U4Q A;  2LM2 A;  2XQ5 A;  4C90 A;  5EK2 A;  4DR1 T;  3SFE A;  1MIW A;  3KIN B;  5HYA A;  1E1H B;  2LLY A;  2V6Y A;  2LSK A;  5H6Q B;  4H9R C;  3X1D A;  1Z0P A;  4LML A;  3I1A A;  4I50 E;  3IA3 A;  1HX1 B;  4UF0 B;  3CX8 B;  3SOL A;  4ILU A;  5JDN A;  1AJ3 A;  2LHR A;  3ZC1 A;  3UTK A;  4DR6 T;  2DL1 A;  5AQI B;  4AKH A;  3P50 A;  3PTR B;  2VL0 A;  2J47 A;  2W00 A;  2X9W A;  2CA5 A;  4IDP A;  2PFV A;  2V26 A;  3MK7 C;  4O2A E;  3ZYL A;  3AE1 A;  3VKH A;  5HXS A;  1YKE B;  5LG4 A;  3PUS A;  3N9Q A;  2NWB A;  2OA5 A;  1HCI A;  2CPT A;  1E2A A;  2LKH A;  2XQY A;  4QXB B;  4TV9 E;  4TWD A;  4CN1 A;  3K3N A;  4AKG A;  5HEG A;  4Z90 A;  5F5W A;  2XY8 B;  4DV1 T;  5LG3 A;  2ZMA A;  3QC9 A;  4YJ2 E;  3EHZ A;  3GN5 A;  3OTO T;  2DI4 A;  2DWK A;  4U7I A;  3UUN A;  1XDP A;  3SRZ A;  3WAK A;  2NTY A;  5JRE A;  2I0M A;  2JRK A;  4EYU A;  4TUY E;  1VOM A;  1FJG T;  1OED E;  4DMV A;  3ZCJ A;  1FMW A;  3ETV A;  2M67 A;  1S35 A;  4ILC A;  4TNW A;  5L4E A;  2ZM6 T;  1WCR A;  5F8P A;  3FZF B;  2BVM A;  2NP9 A;  3DJB A;  4JI2 T;  3RH3 A;  2DNX A;  2L3L A;  1SHZ C;  3UU5 A;  4FI5 A;  4IE0 A;  5JDQ A;  2CXD A;  3H3M A;  1HFA A;  3RIU C;  2I6H A;  2MOZ A;  3B57 A;  4EED A;  3RPU A;  4H63 V;  3V5S A;  4ZZB A;  4XZC A;  4AQF A;  2NTX A;  3AXJ B;  4MAL A;  2CCQ A;  4MBQ A;  4N78 D;  3RYH E;  1U5P A;  1YKH B;  3C4W A;  3LK3 B;  3PE0 A;  4HWF A;  1YW0 A;  5KX5 E;  1LKX A;  2CLY B;  5LB7 B;  1KNZ A;  4X5T A;  1OED A;  5AQU B;  4AI6 A;  4KMC A;  5FP3 A;  1LVF A;  3RF1 A;  5DQV A;  5ABG A;  4ASK A;  4FJO A;  4HKA A;  3T1Y T;  4HE8 A;  2ACX A;  2V1D B;  1BR4 A;  2W2U A;  3UUX B;  5HEH A;  4H9S E;  5HXC A;  4L0R A;  4IE7 A;  2JQH A;  4DV2 T;  3VKG A;  3B5M A;  3OKQ A;  4B3S T;  3BQK A;  1IJ5 A;  2HN2 A;  4HFE A;  2FJA A;  2JQK A;  1ZV4 X;  3ZPO A;  1FEW A;  4U7Y A;  4E7S A;  2EHO C;  3TLV A;  5LCY A;  4AXP A;  1I94 T;  4OX9 T;  3AEE A;  4IHJ E;  3TLT A;  2BBJ A;  3D0T A;  2JJ9 A;  3CQG B;  3ANW B;  2V8S V;  2N1G A;  2XQA A;  5LJN A;  3ZLI A;  2BS2 A;  1XNR T;  2K48 A;  5HWX A;  4JI7 T;  2X0H A;  2KXP B;  3JAF A;  3OJA A;  2HHH T;  2RP4 A;  5AQP B;  3LJC A;  4UVA B;  4LF8 T;  3C4Z A;  2WDV A;  2ODV A;  4YT0 A;  1UGO A;  2QVA A;  1KNP A;  4IDN A;  3L39 A;  1D0X A;  4O2B E;  3UU3 A;  4CI2 B;  2H7V C;  4QXC B;  2XJ7 A;  1E7P A;  3OYZ A;  2VKJ A;  3QUJ A;  5FL0 A;  5FY7 A;  1XMO T;  3CQC B;  3AAI A;  2BZB A;  3FZL B;  2WDR A;  3ZYM A;  1XMQ T;  2V7I A;  4IGU A;  3FHN A;  2W61 A;  5C3J A;  2XHE B;  3I0Q A;  3B13 A;  4JI5 T;  2L8K A;  3BK9 A;  2BKN A;  3TLS A;  2ZM0 A;  2NR4 A;  4OYK A;  3VR9 A;  4ERR A;  2XAG B;  4U3C A;  4EGW A;  4YTN A;  4CN4 A;  3HR0 A;  1UUR A;  1V9D A;  3F57 A;  1UK5 A;  2XQ8 A;  3KBU A;  1NEN A;  4DV6 T;  1N36 T;  3KV5 A;  3AA7 B;  3AE8 A;  4JI4 T;  3MZK B;  2WP9 A;  4GK0 E;  4L9I A;  4LMK A;  4NUV A;  4YXD A;  4DV4 T;  2LT3 A;  3N2K E;  3MAC A;  2MTQ A;  4O4J E;  1Y01 A;  4ZI2 C;  3O4X E;  2CHO A;  3SFD A;  3ZJ2 A;  2JQQ A;  5AQQ B;  4A97 A;  4O4I E;  2YDS A;  3AA6 B;  5CJ5 A;  3LK4 2;  3ZMV B;  2A3D A;  2A9U A;  4QH4 A;  5AQF B;  3KV6 A;  1UUS A;  2ZLY A;  5CA1 E;  4QX8 B;  4UV8 B;  4BAY B;  4F8H A;  3RIU A;  3UU4 A;  4YJ3 E;  3CQX C;  5LBM A;  1ZOY A;  5AQS B;  3ESL A;  4DUZ T;  2Y6X A;  5HWY A;  5CFB A;  2XQ7 A;  4QH1 A;  3KV4 A;  2VK9 A;  5AQM B;  2XSA A;  5HXE A;  3FXE B;  2UU9 T;  2X51 A;  3N9N A;  2EHO B;  2CWY A;  3RIA A;  4IT4 A;  2LOP A;  3KV9 A;  3P4R A;  4Q25 A;  2DCF A;  5FMN A;  4E7Z A;  3LDQ B;  1YQ3 A;  3NRY A;  1QLB A;  1XZY A;  3UUB A;  1D1C A;  2E9X B;  5TAO A;  5LXT E;  4CZZ B;  2ZM2 A;  1WR6 A;  3AEC A;  2WS3 A;  3HKC E;  3K1S A;  3RQW A;  2WZI A;  3I0O A;  4KBM B;  3EDU A;  2IHR 1;  3LBX B;  3CX6 B;  3QNU A;  3KVA A;  3VU7 H;  4DR4 T;  3HKB E;  2WMN A;  4PK6 A;  5HAX A;  1MMD A;  2W63 A;  4ZI7 E;  1I6Z A;  1T72 A;  2JQ9 A;  3AE5 A;  3PJA J;  4I0U A;  4QWN B;  5CA0 E;  2E2A A;  4YY3 T;  3PDY A;  3LSV A;  4PFO A;  5JH7 E;  5LGT B;  4IE5 A;  3SS1 A;  4WZX A;  5AQO B;  4ZI3 C;  1IBM T;  5JRC B;  2CE7 A;  2D2S A;  2V7M A;  3VHL A;  2K3W A;  4AQY T;  1QSD A;  2HN1 A;  2YK0 A;  3GWH A;  3I9Y A;  3P4S A;  2KT9 A;  3LBX A;  4KX6 A;  4DR5 T;  3Q5W A;  3ONL C;  2ES0 A;  1WYB A;  4H9P C;  4NIQ A;  4YTM A;  3RYC E;  4BA9 A;  4F6R C;  2YKS A;  3IF8 B;  5DQW A;  5AQR B;  2CMR A;  3AAE B;  3M65 A;  2UXN B;  3ZC0 A;  4UVB B;  4DBQ A;  1BR0 A;  5L3C B;  3K8P C;  4DID B;  1HR0 T;  4LF9 T;  5LGN B;  3MJX A;  4V1A v;  1OXZ A;  3FBZ A;  2CBJ A;  3TKL B;  4DV5 T;  2K5B B;  3U3I A;  3RX6 A;  4GYS A;  4ZXL A;  5LHI B;  1HTJ F;  2KIN B;  4GYR A;  3RC8 A;  2BG9 E;  2SPC A;  1EZ3 A;  3C98 B;  3CWZ B;  2DWG A;  4OFZ A;  3JC6 D;  4TWH A;  2FBW A;  3ZN0 B;  4ZI3 D;  4DV3 T;  2ZM8 A;  3NZQ A;  2L9Q A;  2LEH A;  3AA0 B;  3OYX A;  4IDO A;  1D0Y A;  1IZN B;  1W0B A;  2OV9 A;  3CPZ A;  4IIJ E;  4ILA A;  3EVY A;  3DP7 A;  4WYV A;  5FY1 A;  3MKD A;  2LSG A;  3P4W A;  4CI3 B;  2KND A;  2V5D A;  1OED C;  2VKO A;  4P09 A;  2Q9Q A;  4TX5 A;  5LGU B;  4JI6 T;  3BQI A;  1UCU A;  5AQV B;  4JI3 T;  1B7T A;  2R6G F;  3GN5 B;  2C5J A;  3PV0 F;  4NPP A;  2CLY C;  3KBT A;  3OBV E;  3ZCI A;  5L3D B;  2E5L T;  4H9N C;  4AQF C;  5LBQ B;  4DO0 A;  3FBL A;  2E9X A;  4IRE A;  4WNK A;  5EK4 A;  4CXW A;  5HXH A;  2UUB T;  2IC9 A;  2X9X A;  3R6N A;  2BKP A;  3IBP A;  4X20 E;  3AEF A;  1D0Z A;  5KXJ A;  2WMO A;  1M7K A;  1MIV A;  4X65 T;  4JV5 T;  2KSR A;  1CHU A;  3ANW A;  4XBF B;  1YQ4 A;  2Q9Q B;  3EAM A;  2CHN A;  4O4L E;  4YFS A;  1OWA A;  3UFG A;  2WM9 A;  4O4H E;  3UUL A;  1UX4 A;  2G0U A;  4DBR A;  4YTP A;  3UU8 A;  3ZMT B;  5FXZ A;  1NAF A;  2B76 A;  2VWA A;  5LHH B;  2LE8 A;  1SUM B;  4HFH A;  4O8S A;  3N9L A;  4OYJ A;  4TWF A;  5IHY A;  2Y8D A;  5LMU T;  4QH5 A;  3AE7 A;  3ZN1 B;  3A5X A;  3QB5 A;  5IYZ E;  2F4V T;  2M6B A;  4IL4 A;  4ZOL E;  3HA4 A;  3ONJ A;  2NOX A;  3PUR A;  3RKG A;  3TLW A;  4EB6 E;  5L3G B;  2E9X C;  4UVC B;  3ZEF B;  3C51 A;  1X9B A;  3FZH B;  4KUM B;  5HEU A;  3NWI A;  3RYF E;  4YHH T;  1Z8U A;  2DHR A;  1T7S A;  5H6R B;  3ZJ1 A;  4U2Y A;  3LK2 B;  5J0Z A;  2E9X D;  4JI8 T;  2MBG A;  3P8C D;  2KWI B;  4KI0 F;  4U74 A;  1WLX A;  3S4U A;  3N5L A;  5FXW A;  3VRB A;  1T98 A;  4B3T T;  5F3J A;  4GKK T;  2CRB A;  3EUH A;  1BR1 A;  2P9B A;  4PK4 A;  4LFB T;  1YXR A;  2VB6 A;  5ETW A;  2DLR A;  5AQL B;  3K3Q C;  5IWA T;  4L5G A;  4I4T E;  5JDG A;  4AIU A;  5BMV E;  4U2Z A;  2V6Y B;  1HF8 A;  5JRC A;  2WCA A;  5DJQ C;  2NW8 A;  2UUA T;  4MLK A;  4DR7 T;  5JDF A;  5KDM C;  3N2O A;  5AQK B;  4DV7 T;  3V5U A;  3BQL A;  4AKR B;  2RPA A;  1W09 A;  2LHN A;  3FB2 A;  4PNI A;  4QXH B;  4B6X A;  4YSY A;  4X66 T;  2FUP A;  1N32 T;  5HEO A;  5LOV E;  4TZ4 C;  4ZZC A;  2IW5 B;  4U33 A;  4DR2 T;  1H7C A;  4AQG A;  2D0U A;  3AEG A;  2LSI A;  2PG8 A;  3F2E A;  3L3P A;  3RRW A;  2WAU A;  3UQ7 A;  5AQN B;  1XNQ T;  1KF6 A;  4GOU A;  1O3X A;  4MHC A;  3PUZ F;  4IL9 A;  4CXX A;  2LKG A;  2H7O A;  1L0V A;  2EHO A;  4ZS3 A;  2EHO D;  2QA7 A;  1GQE A;  2WU2 A;  2LOS A;  4ZS2 A;  3RGL A;  2ACZ A;  3JC6 C;  5FY0 A;  4EOZ B;  1ZEE A;  4X1I E;  4LF5 T;  2IDO B; 
#chains in the Genus database with same CATH homology
 4P1N A;  2DL1 A;  2K3W A;  5CGM A;  4U3C A;  3ZSS A;  2WY2 A;  5FVL A;  4CN4 A;  5FVK A;  2RPA A;  4IT4 A;  4U31 A;  1WR0 A;  4NIQ A;  2LRK A;  2CPT A;  2LRL A;  2XZE A;  4CN1 A;  5LB7 B;  4U2Y A;  4U33 A;  3K1S A;  3ZST A;  3ZT7 A;  1WFD A;  4U7I A;  2MPK A;  3EAB A;  2CRB A;  2W2U A;  4A5X A;  5CJ5 A;  4ZEY A;  2JQ9 A;  2A9U A;  1YXR A;  2JQH A;  3ZT5 A;  2V6Y A;  2V6X A;  1WCR A;  3ZT6 A;  4WZX A;  4U2Z A;  2WWV A;  2V6Y B;  2JQK A;  4CN6 A;  4U7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...