4WZXA

Ulk3 regulates cytokinetic abscission by phosphorylating escrt-iii proteins
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
87
structure length
87
Chain Sequence
TSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEYLKEQVKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase ULK3
publication title ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 38
structure length 87
sequence length 87
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4wzxA01
5FVKA 2JQ9A 5FVLA 3ZSSA 3ZSTA 4IT4A 2K3WA 2XZEA 2LRLA 2RPAA 4A5XA 5LB7B 2LRKA 4U3CA 2V6YA 2JQKA 2V6XA 2W2UA 3ZT7A 2DL1A 4CN6A 4ZEYA 5CJ5A 3EABA 3ZT5A 4CN1A 4U7IA 4U33A 4CN4A 2JQHA 4U7YA 4U31A 1YXRA 4NIQA 4P1NA 1WFDA 2CRBA 4U2YA 4WZXA 3ZT6A 2WY2A 2A9UA 1WR0A 3K1SA 2MPKA 2CPTA 2WWVA 2V6YB 5CGMA 1WCRA 4U2ZA
chains in the Genus database with same CATH superfamily
3RKOA 4DNDA 4HFIA 1W9RA 1Y01A 2AE9A 1MNDA 2DHRA 5FKYA 4HWIB 4HN9A 2XM1A 3ZJ2A 2IC6A 4G63A 2KINB 3FBLA 1I94T 1XMQT 2VKDA 3ZN0B 4GYRA 3RLFF 5ADXL 3I9YA 3O1HA 4HFVA 2VURA 4YFSA 2B1EA 2XQ5A 3KV5A 4LMKA 2N1GA 2NTYA 3ZPOA 4DUYT 3RC8A 1WFDA 3HKCE 5DQWA 2D2SA 2YDRA 5LG4A 3JC6D 3P7IA 1UK5A 5KX5E 4AKRB 1E2AA 3Q5DA 1IBKT 2E9XD 1KNRA 3FZMB 2XQYA 3AEEA 4HEAA 3UUNA 3AE4A 3EUHA 1WCRA 4IIJE 3N2KE 3PURA 5FVKA 3AEGA 5JQGE 4HWFA 5L3BB 3MACA 3OTOT 5IWAT 2OV9A 4MALA 1UUSA 4B3RT 3JAFA 5HWYA 2XSAA 4HWHA 2D0TA 4X5TA 3AE2A 3K3NA 2C5JA 4GKKT 2MOZA 3UQ7A 2UXBT 2E9XB 2FJAA 3NWIA 5FXXA 2I59A 2WZHA 4MFRA 4LF4T 3B13A 5BMVE 2XTLA 3UU5A 4TUYE 4AQFA 4JI4T 2QA7A 1HNWT 2Q9QD 2VASA 3RQUA 4IDQA 2H88A 3ZEFB 2ZM8A 4DV6T 3ZJ1A 4L5GA 3AE5A 3TLWA 3Q5EA 3H3MA 2LSYA 5AQVB 1EZ3A 4I4TE 5JRCB 2W66A 3FBZA 1MNEA 2XAQB 2QYWA 4JBWF 2E8IA 2FJDA 5ABHA 1N34T 2VVNA 4JI1T 4DR6T 2WM9A 2BG9E 5AQOB 1WR0A 4HFEA 3UU6A 2LOSA 2Q9QB 4ILBA 3O1IA 4DV2T 1DU2A 4B3TT 3NRXA 2Z6EA 1BR4A 2I6HA 2I0MA 3NBXX 2L8KA 2D0UA 2WDQA 2W61A 2NW9A 5CA0E 5HEGA 5JR9B 3K1SA 4U2ZA 5L4EA 5FL0A 1LRZA 2XPKA 1S35A 3VKGA 3ZMSB 3C4XA 2IIUA 1MIVA 4LF7T 1CHUA 3I0QA 3RHWA 2V7MA 2L3LA 2A2FX 4IL9A 3PUXF 3FZFB 3P50A 4KMCA 5CGMA 3OVUA 3PUVF 1KEYA 1W09A 4CI1B 2CXFA 4X1IE 3ZCIA 4U3CA 2V6XA 4HKAA 4O8SA 2BZBA 4WBNE 1BR1A 3ZKRA 4QX7B 4C90A 3S4UA 3JCFA 3LBXB 1XNRT 3MK7C 4IT4A 4HFHA 2YDQA 2HN2A 2CXLA 3QUJA 4UF0A 4Q25A 3P4QA 4TWFA 4EZHA 3PUQA 3RYHE 4YTMA 3WI3A 4OK0A 1W0AA 3UU4A 2LRKA 4ZI7E 5HEJA 4DV4T 1OWAA 2RP4A 3LJCA 1D0XA 3A7MA 2XSBA 2YEVC 5FXVA 3VHLA 1D1CA 1WYBA 1HF8A 2X9YA 2ZLYA 5JDLA 4ISTA 3AAEB 4H63H 2E5VA 4CI3B 4ZXLA 3RC3A 4X65T 5J1GA 4HGAA 4TV9E 4AISA 4QWNB 4JI3T 1IJ5A 4UVCB 4A98A 5JVDE 4ZOLE 5HXSA 3SOLA 2K5BB 2WY2A 3FXDB 3C4ZA 4I50E 5IHYA 3KBUA 3HKDE 2LOPA 4X64T 1Z8UA 5HEOA 5JDGA 4NPPA 2DWKA 1XDOA 3RYCE 4IE6A 3CX6B 2BBHA 5FNVE 3AAAB 4LF6T 3A5XA 4OYKA 3AXJA 2A3DA 1IAPA 5LP6E 2XQ8A 5ABEA 1HTJF 1WRDA 3QK6A 4KBMB 3AE3A 5AFUL 4DUZT 3RYIE 4JI7T 4UVAB 4O4JE 5LBQB 2JRKA 1HG5A 1M62A 1NENA 4H63V 4TX5A 2UU9T 4ILUA 4DMVA 3ZSTA 2CBJA 2V8SV 5H6RB 2UXDT 3VRAA 2HPJA 1T72A 3Q5WA 3O9XA 4MHCA 4YJ2E 5ETWA 2Y48B 2XQAA 3Q5XA 2XASB 2WP9A 3JADA 3FXEB 4MBQA 5C3JA 4U72A 3GWHA 2IMLA 2MTQA 2YINA 5AQNB 2WSSV 1JNZA 4U33A 2CWOA 1UGOA 4QXCB 2B76A 5JREA 4PJJA 2LEHA 3AE8A 2F4VT 1L0VA 3ZC0A 5LNKA 5LG3A 4L9IA 2H3RA 2IAKA 2BVLA 2C5KT 2CXDA 4DBQA 4P1NA 3Q2MA 1QSDA 2KLQA 3FZLB 4I43B 1IZNB 4A97A 3CPZA 1YQ4A 3ZMVB 3L8RA 4QX8B 3ZMTB 5AQRB 4QH5A 3UQ4A 1B7TA 2J4GA 2BKOA 2KSRA 2YU1A 2V6YB 4BA9A 3RIUC 3RI5A 2A72A 3C64A 3RGLA 1YQ3A 2YN6A 2OA5A 1R8IA 4EZ4A 3ANWB 2VVSA 3JC6C 4WYVA 5HCJA 5L3FB 4H9QC 3CMLA 2IW5B 2WWVA 3O4XE 1D1BA 5FP3A 4GK5E 3V5UA 3R6NA 1YD8G 3VR9A 4ZZCA 4COFA 2DL1A 2JQQA 3CX8B 3NZQA 2DWGA 3KV6A 3RKGA 2NTXA 2ZMAA 3RIFA 2ACXA 3QNUA 4AIUA 4O2BE 2PJQA 3ONXA 3L39A 2LSIA 3ZCJA 2YK0A 4NXMT 3HI2A 4JLEA 2CHOA 1WYCA 2CCQA 2IUBA 4JI6T 1XNQT 1X9BA 4EV6A 1Y64B 2X9XA 4Z8XA 3TLUA 1FJGT 4FI5A 3ZT5A 2DLRA 2ES0A 1KNPA 4AQGA 2LM2A 2LSGA 2Q9QC 4ILAA 4YT0A 5JH7E 2N2NA 3NVOA 4PK5A 2KZ7B 3N9LA 5AQPB 5AQLB 5HXHA 2VQET 3AECA 4HE8A 3OBVE 2KXPB 3N5LA 4TZ4C 1HCIA 3RIUA 1VOMA 5AQJB 4PJMA 3PDYA 2LSKA 5JR9C 5LMNT 4EIWA 5L4HA 2UXCT 1QUUA 4B3ST 2NP9A 4KHZF 1HR0T 2CLYB 1YKEB 2L9QA 2BKPA 3SFDA 2E9XA 1ZV4X 4NIQA 4IDOA 5J2TE 5AQTB 4Z90A 5LCYA 5DJQC 1GQEA 1IBMT 5JTGA 3VKHA 4U2YA 2JMKA 4XBFB 2HHHT 3U78A 3ZYKA 3N9OA 4TN7B 4DR3T 5JRCA 2M6IA 4AXPA 3IA3A 2WU5A 2UUAT 4YTNA 3HKBE 5HXEA 2CBIA 2V1DB 2BKNA 5AQUB 5JDNA 2Q9QA 2WMNA 2W4XA 3UUBA 5M4YA 3IF8B 2JIWA 1SHZC 3AB3B 2WS3A 2NR4A 2M6BA 2VWAA 2CM0A 1Z0PA 5JR9A 3HKEE 3G06A 4CXXA 1XMOT 2BG9B 1I6ZA 5AQIB 4CZZB 5ABFB 3MXZA 2P9BA 2FJBA 2V26A 2V5DA 4QH4A 3UTKA 3GN5B 3AA1B 3B57A 3LG7A 2XQ9A 2X9WA 1HS7A 3AVRA 2CE7A 1BR0A 2KWIB 4HWDA 1YKHB 3VR8A 1XDPA 1SA0E 4HFBA 4ZI3C 4UXNB 5J2UE 3N9MA 2Y8DA 4I55E 1QLBA 4YSXA 4ASKA 3BQLA 3KVBA 2FBWA 2CHNA 3LBXA 2LRLA 2XAJB 4ANJA 3ONJA 1JNRA 3RIAA 5AQSB 5L3GB 5LHGB 3OJAA 2XUEA 2JPFA 3FZHB 4GYSA 4HWCA 3I1AA 3K3OA 3AE6A 4TWHA 3MZKB 2LHNA 2VK9A 3U3IA 3M3ZB 4KP3C 2XM2A 2XAGB 5CB4E 4DV1T 2K3WA 4A5XA 4ZI2C 3T8OA 2C5IT 5EK4A 3PUWF 1IBLT 3HA4A 3QOFA 4PNIA 3CQXC 1US7B 5HCMA 2WZIA 3UUXB 1VCTA 2WMOA 3MJXA 5HAXA 3AE7A 2JQ9A 4IE4A 4DV5T 4ZI3D 5HYAA 2IDOB 5JDHA 4JEUB 4P09A 1UCUA 1IJ6A 3UUMA 3IHRA 3EDUA 1BR2A 1FEWA 4IDPA 4WZXA 2EHOC 3P8CD 4N78D 1D1AA 3RX6A 1J5WA 1ZP0A 4YHHT 1MIYA 4AKGA 3WAKA 3EHZA 5LHIB 5DQVA 2ZM6T 4UIGA 5F8PA 4HFCA 2KT9A 1S94A 3LK42 2V7KA 4IDNA 4DV0T 1ZHCA 3FHNA 5CFBA 2BDEA 3HR0A 2W2UA 3FZKB 4YSZA 4YY3T 4TWDA 3AAIA 4H9SE 4M1PA 1KFYA 4JYAT 4ZI2D 4O2AE 1OEDB 4DV3T 2HN1A 2R6GF 3OPCA 3SFEA 1AJ3A 1HX8A 3AVSA 4PAGA 1G73A 3P4RA 5KDMC 3PUZF 4O4IE 4A56A 4GOUA 3SWHA 2DNXA 2ODVA 3AA6B 3KV9A 4EXTA 3NRYA 4OYJA 3UU3A 5LMUT 1W0BA 4P0AA 4GIWA 5AQFB 4EYUA 2X51A 2J62A 2VB6A 4H9NC 1T7SA 3TKLB 2WDVA 2DI4A 2EHOD 3CWZB 2LJLA 1ZKEA 4L0RA 1J5ET 3UFGA 1T8BA 5HWXA 2K48A 2YKSA 3E08A 3CK6A 4UV8B 1NEKA 3WAJA 3QB5K 2V7LA 1KNZA 4H9OC 4LF5T 3T1HT 3ZT7A 2KNDA 1N33T 3C50A 4YHJA 4AQYT 3PUGA 2XQ7A 3KBTA 4LF8T 1UX5A 2HH7A 4UELA 2EHOB 4EGWA 4LFCT 5HXCA 4BJMA 2V6YA 3KFWX 4E7ZA 2KMFA 3N2GE 4X62T 3LK2B 4FJOA 3AA0B 2WDRA 3ANWA 3DTOA 1VCSA 3AE9A 3QC9A 2X9HA 2H89A 2CLYC 5FY0A 4H9PC 4U74A 4WW0A 3PTRB 4PK4A 2H7OA 4DR5T 1LKXA 2VKHA 3BK9A 4X1KE 5FXZA 3CKDA 4YSYA 3IEEA 4PJLA 5DABA 2DCFA 2C0SA 4WNKA 3PU3A 3ZYMA 2NW8A 4ZS2A 5LGUB 4YJ3E 4DR1T 5L3EB 4O4HE 4GKJT 1SUMB 2W67A 5HEHA 4P0BA 3AEFA 4JI8T 2MAWA 4KUMB 1MMNA 3PJAA 5BR8T 4C91A 2XQ4A 1M7KA 3C51A 3ETVA 4AKIA 1VRBA 1OXZA 2LT3A 4EB6E 4B6XA 1ZEEA 5GONE 2UUBT 4UV9B 3CX7B 4AQFC 3MA9A 4UR9A 1T98A 4F8HA 4DIDB 2PFVA 5LOVE 1G8XA 5EZYE 5LYJE 1SE7A 5C2TA 4IDZA 3QB5A 4CI2B 2AXDS 5LGNB 2BG9C 5FY1A 5H6QB 5CA1E 2OLTA 3ETUA 3N9PA 3H3AA 4IE5A 3EAMA 2UUCT 3E0ZA 3RRCA 2W62A 5J0ZA 2LLYA 3LFMA 3DJBA 4K0UA 5LB7B 1WR6A 2QVAA 4LFBT 4G2AA 4DR2T 4LMJA 5IUXA 3B5MA 2MYSA 4DVDA 1J1JA 2GK9A 5AQGB 3PUSA 3F2EA 2V5CA 3ESLA 5F5WA 3RRWA 2RPAA 2LKHA 1E7PA 3ABVA 3SS1A 2WCAA 4JI5T 2X67A 4XAXB 3RH3A 3EABA 3K8PC 4U7YA 2UXXB 5KXJA 5L47A 4TNVA 3PUAA 1KK7A 4JUYA 2BS2A 2KWHA 5LA6E 1O3XA 2ODUA 3EVYA 5LXTE 1NWMX 1UURA 2NWBA 3IBPA 3UULA 4YTPA 2WBLA 1CUNA 5JDQA 2XAHB 3R84B 1V9DA 5AQMB 2LSJA 2PTFA 2VL8A 3KV4A 4WBOA 3AEBA 4QXHB 2V7IA 4PFOA 2WB5A 2XZEA 5JDMA 3UU8A 2PG8A 1NAFA 4PJNA 3LSVA 4X1YE 2BBJA 5CJ5A 3I9WA 3L3PA 4IE7A 2X66A 2BG9A 3ZMUB 3OKQA 1HNXT 1WLXA 5ABFA 2XQ3A 3GMIA 3Q9DA 4JV5T 5LGTB 2WAUA 3GN5A 3A8YC 2BVMA 1HX1B 2D9DA 2QGSA 5LJMA 2NW7A 3D0TA 5FL1A 2LE8A 2YOEA 3VU7H 3N9QA 4JI2T 2XHEB 4E7SA 3SRZA 2X0LB 4LF9T 3BQIA 3N9NA 4HFDA 5FY7A 2WQYA 2M67A 2PBIA 3ZT6A 4YLHA 2VQFT 1HFAA 3V5SA 5EK2A 3J9X1 3TLVA 3AE1A 1MMDA 3KINB 3OYXA 4IE0A 1OEDC 1YXRA 4PK6A 3ZC1A 2A9UA 4KI0F 1HG2A 2CPTA 4X20E 3KDSE 3N2OA 4AI6A 1FMVA 4KX6A 4DO0A 2W00A 2WU2A 2BS3A 2XY8B 4PW8A 1X79A 1N32T 4AKHA 1MMAA 1FMWA 5KMGP 4CXWA 3CQCB 3CVRA 5ABGA 4QKNA 4DV7T 2Y6XA 1U5PA 2X68A 2QRXA 4BAYB 3P4SA 2N9DA 4EYYR 4DBRA 2J1DG 2JQKA 5C8YE 4EEDA 2XQ6A 2NOXA 4J2CA 5FYMA 4OX9T 4U31A 2X0HA 4NXNT 4JI0T 3F31A 2MPKA 4XZCA 4NUVA 2SPCA 3I0OA 4UF0B 3CQGB 4B3MT 3PV0F 1XWMA 2YDSA 5AQHB 3K3QC 1LVFA 4EEBA 4ERRA 2HPLA 4IL4A 3DP7A 4QHOA 4ZHQE 2LKGA 1ZOYA 4LFAT 5FVLA 4DR7T 1YW0A 4AKLA 4IHJE 3PU8A 2XJ7A 4UVBB 3EDVA 4CXYA 2JQHA 4GK0E 2K24A 3CIRA 2JMHA 3TLSA 3LDQB 1UX4A 4TNWA 3NZPA 2H7VC 1OEDA 4ZS3A 2E5LT 5F3JA 5L2LA 3T1YT 1D0ZA 1D0YA 4BJNA 2CRBA 4Z91A 4I0UA 3GA8A 3C4WA 3PJAJ 2ZM2A 3EI0A 3HL6A 4ZZBA 3AEAA 4DMWA 4OHFA 3RQWA 4ILCA 1OEDE 3TLTA 2E2AA 3RPUA 3J7Yq 5L3DB 4CN6A 5LHHB 3JAEA 3AXJB 2IC9A 3MKDA 4ADZA 4CN4A 4EOZB 2CEAA 5AQQB 3ZN1B 4JEHB 2W0GA 4IGUA 1U4QA 3UFEA 2W63A 5LBMA 2VL0A 4QH1A 1KF6A 4U7IA 2JJ9A 3F57A 2CWYA 3PE0A 3O1JA 2YU2A 1MMGA 2ACZA 3P4PA 2VKOA 5LJNA 3AEDA 2X0YA 2EHOA 2LM9A 3C98B 5JDFA 4CN1A 3PUYF 3L09A 4OFZA 2WWUA 1FIOA 2D5UA 4QXBB 2MBGA 4HTEA 5AQKB 3ZLIA 4EAHA 4IREA 2IHR1 3P4WA 2BS4A 4DR4T 4KHPT 3KVAA 5HXRA 3FB2A 5TAOA 3ZMZB 4ZEYA 4UEMA 4MLKA 4PFPA 3AA7B 2G0UA 3X1DA 5L3CB 4X66T 3VRBA 1H7CA 4YXDA 5FMNA 3ZYLA 4NUUA 5FXWA 4ISSA 3M65A 3W15B 1XZYA 3UT5E 2CMRA 2UXNB 2LHRA 3RYFE 4K0KT 3LK3B 4LMLA 5IYZE 1HNZT 4CQIA 3RF1A 5HEUA 1MIWA 2XAFB 2FJEA 4H9RC 5E0OA 1LVKA 2CA5A 3OYZA 3E22E 4TV8E 5EK3A 2K9AA 5A1LA 2V7JA 2E9XC 3ZSSA 1N36T 2J47A 2RA1A 3BQKA 3NKZA 4O4LE 3H37A 3ONLC 2ZM0A 1E1HB 4F6RC 2FUPA 4V1Av 2VKJA
chains in the Genus database with same CATH topology
5FVKA 2JQ9A 5FVLA 3ZSSA 3ZSTA 4IT4A 2K3WA 2XZEA 2LRLA 2RPAA 4A5XA 5LB7B 2LRKA 4U3CA 2V6YA 2JQKA 2V6XA 2W2UA 3ZT7A 2DL1A 4CN6A 4ZEYA 5CJ5A 3EABA 3ZT5A 4CN1A 4U7IA 4U33A 4CN4A 2JQHA 4U7YA 4U31A 1YXRA 4NIQA 4P1NA 1WFDA 2CRBA 4U2YA 4WZXA 3ZT6A 2WY2A 2A9UA 1WR0A 3K1SA 2MPKA 2CPTA 2WWVA 2V6YB 5CGMA 1WCRA 4U2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVK A;  2JQ9 A;  5FVL A;  3ZSS A;  3ZST A;  4IT4 A;  2K3W A;  2XZE A;  2LRL A;  2RPA A;  4A5X A;  5LB7 B;  2LRK A;  4U3C A;  2V6Y A;  2JQK A;  2V6X A;  2W2U A;  3ZT7 A;  2DL1 A;  4CN6 A;  4ZEY A;  5CJ5 A;  3EAB A;  3ZT5 A;  4CN1 A;  4U7I A;  4U33 A;  4CN4 A;  2JQH A;  4U7Y A;  4U31 A;  1YXR A;  4NIQ A;  4P1N A;  1WFD A;  2CRB A;  4U2Y A;  4WZX A;  3ZT6 A;  2WY2 A;  2A9U A;  1WR0 A;  3K1S A;  2MPK A;  2CPT A;  2WWV A;  2V6Y B;  5CGM A;  1WCR A;  4U2Z A; 
#chains in the Genus database with same CATH topology
 3RKO A;  4DND A;  4HFI A;  1W9R A;  1Y01 A;  2AE9 A;  1MND A;  2DHR A;  5FKY A;  4HWI B;  4HN9 A;  2XM1 A;  3ZJ2 A;  2IC6 A;  4G63 A;  2KIN B;  3FBL A;  1I94 T;  1XMQ T;  2VKD A;  3ZN0 B;  4GYR A;  3RLF F;  5ADX L;  3I9Y A;  3O1H A;  4HFV A;  2VUR A;  4YFS A;  2B1E A;  2XQ5 A;  3KV5 A;  4LMK A;  2N1G A;  2NTY A;  3ZPO A;  4DUY T;  3RC8 A;  1WFD A;  3HKC E;  5DQW A;  2D2S A;  2YDR A;  5LG4 A;  3JC6 D;  3P7I A;  1UK5 A;  5KX5 E;  4AKR B;  1E2A A;  3Q5D A;  1IBK T;  2E9X D;  1KNR A;  3FZM B;  2XQY A;  3AEE A;  4HEA A;  3UUN A;  3AE4 A;  3EUH A;  1WCR A;  4IIJ E;  3N2K E;  3PUR A;  5FVK A;  3AEG A;  5JQG E;  4HWF A;  5L3B B;  3MAC A;  3OTO T;  5IWA T;  2OV9 A;  4MAL A;  1UUS A;  4B3R T;  3JAF A;  5HWY A;  2XSA A;  4HWH A;  2D0T A;  4X5T A;  3AE2 A;  3K3N A;  2C5J A;  4GKK T;  2MOZ A;  3UQ7 A;  2UXB T;  2E9X B;  2FJA A;  3NWI A;  5FXX A;  2I59 A;  2WZH A;  4MFR A;  4LF4 T;  3B13 A;  5BMV E;  2XTL A;  3UU5 A;  4TUY E;  4AQF A;  4JI4 T;  2QA7 A;  1HNW T;  2Q9Q D;  2VAS A;  3RQU A;  4IDQ A;  2H88 A;  3ZEF B;  2ZM8 A;  4DV6 T;  3ZJ1 A;  4L5G A;  3AE5 A;  3TLW A;  3Q5E A;  3H3M A;  2LSY A;  5AQV B;  1EZ3 A;  4I4T E;  5JRC B;  2W66 A;  3FBZ A;  1MNE A;  2XAQ B;  2QYW A;  4JBW F;  2E8I A;  2FJD A;  5ABH A;  1N34 T;  2VVN A;  4JI1 T;  4DR6 T;  2WM9 A;  2BG9 E;  5AQO B;  1WR0 A;  4HFE A;  3UU6 A;  2LOS A;  2Q9Q B;  4ILB A;  3O1I A;  4DV2 T;  1DU2 A;  4B3T T;  3NRX A;  2Z6E A;  1BR4 A;  2I6H A;  2I0M A;  3NBX X;  2L8K A;  2D0U A;  2WDQ A;  2W61 A;  2NW9 A;  5CA0 E;  5HEG A;  5JR9 B;  3K1S A;  4U2Z A;  5L4E A;  5FL0 A;  1LRZ A;  2XPK A;  1S35 A;  3VKG A;  3ZMS B;  3C4X A;  2IIU A;  1MIV A;  4LF7 T;  1CHU A;  3I0Q A;  3RHW A;  2V7M A;  2L3L A;  2A2F X;  4IL9 A;  3PUX F;  3FZF B;  3P50 A;  4KMC A;  5CGM A;  3OVU A;  3PUV F;  1KEY A;  1W09 A;  4CI1 B;  2CXF A;  4X1I E;  3ZCI A;  4U3C A;  2V6X A;  4HKA A;  4O8S A;  2BZB A;  4WBN E;  1BR1 A;  3ZKR A;  4QX7 B;  4C90 A;  3S4U A;  3JCF A;  3LBX B;  1XNR T;  3MK7 C;  4IT4 A;  4HFH A;  2YDQ A;  2HN2 A;  2CXL A;  3QUJ A;  4UF0 A;  4Q25 A;  3P4Q A;  4TWF A;  4EZH A;  3PUQ A;  3RYH E;  4YTM A;  3WI3 A;  4OK0 A;  1W0A A;  3UU4 A;  2LRK A;  4ZI7 E;  5HEJ A;  4DV4 T;  1OWA A;  2RP4 A;  3LJC A;  1D0X A;  3A7M A;  2XSB A;  2YEV C;  5FXV A;  3VHL A;  1D1C A;  1WYB A;  1HF8 A;  2X9Y A;  2ZLY A;  5JDL A;  4IST A;  3AAE B;  4H63 H;  2E5V A;  4CI3 B;  4ZXL A;  3RC3 A;  4X65 T;  5J1G A;  4HGA A;  4TV9 E;  4AIS A;  4QWN B;  4JI3 T;  1IJ5 A;  4UVC B;  4A98 A;  5JVD E;  4ZOL E;  5HXS A;  3SOL A;  2K5B B;  2WY2 A;  3FXD B;  3C4Z A;  4I50 E;  5IHY A;  3KBU A;  3HKD E;  2LOP A;  4X64 T;  1Z8U A;  5HEO A;  5JDG A;  4NPP A;  2DWK A;  1XDO A;  3RYC E;  4IE6 A;  3CX6 B;  2BBH A;  5FNV E;  3AAA B;  4LF6 T;  3A5X A;  4OYK A;  3AXJ A;  2A3D A;  1IAP A;  5LP6 E;  2XQ8 A;  5ABE A;  1HTJ F;  1WRD A;  3QK6 A;  4KBM B;  3AE3 A;  5AFU L;  4DUZ T;  3RYI E;  4JI7 T;  4UVA B;  4O4J E;  5LBQ B;  2JRK A;  1HG5 A;  1M62 A;  1NEN A;  4H63 V;  4TX5 A;  2UU9 T;  4ILU A;  4DMV A;  3ZST A;  2CBJ A;  2V8S V;  5H6R B;  2UXD T;  3VRA A;  2HPJ A;  1T72 A;  3Q5W A;  3O9X A;  4MHC A;  4YJ2 E;  5ETW A;  2Y48 B;  2XQA A;  3Q5X A;  2XAS B;  2WP9 A;  3JAD A;  3FXE B;  4MBQ A;  5C3J A;  4U72 A;  3GWH A;  2IML A;  2MTQ A;  2YIN A;  5AQN B;  2WSS V;  1JNZ A;  4U33 A;  2CWO A;  1UGO A;  4QXC B;  2B76 A;  5JRE A;  4PJJ A;  2LEH A;  3AE8 A;  2F4V T;  1L0V A;  3ZC0 A;  5LNK A;  5LG3 A;  4L9I A;  2H3R A;  2IAK A;  2BVL A;  2C5K T;  2CXD A;  4DBQ A;  4P1N A;  3Q2M A;  1QSD A;  2KLQ A;  3FZL B;  4I43 B;  1IZN B;  4A97 A;  3CPZ A;  1YQ4 A;  3ZMV B;  3L8R A;  4QX8 B;  3ZMT B;  5AQR B;  4QH5 A;  3UQ4 A;  1B7T A;  2J4G A;  2BKO A;  2KSR A;  2YU1 A;  2V6Y B;  4BA9 A;  3RIU C;  3RI5 A;  2A72 A;  3C64 A;  3RGL A;  1YQ3 A;  2YN6 A;  2OA5 A;  1R8I A;  4EZ4 A;  3ANW B;  2VVS A;  3JC6 C;  4WYV A;  5HCJ A;  5L3F B;  4H9Q C;  3CML A;  2IW5 B;  2WWV A;  3O4X E;  1D1B A;  5FP3 A;  4GK5 E;  3V5U A;  3R6N A;  1YD8 G;  3VR9 A;  4ZZC A;  4COF A;  2DL1 A;  2JQQ A;  3CX8 B;  3NZQ A;  2DWG A;  3KV6 A;  3RKG A;  2NTX A;  2ZMA A;  3RIF A;  2ACX A;  3QNU A;  4AIU A;  4O2B E;  2PJQ A;  3ONX A;  3L39 A;  2LSI A;  3ZCJ A;  2YK0 A;  4NXM T;  3HI2 A;  4JLE A;  2CHO A;  1WYC A;  2CCQ A;  2IUB A;  4JI6 T;  1XNQ T;  1X9B A;  4EV6 A;  1Y64 B;  2X9X A;  4Z8X A;  3TLU A;  1FJG T;  4FI5 A;  3ZT5 A;  2DLR A;  2ES0 A;  1KNP A;  4AQG A;  2LM2 A;  2LSG A;  2Q9Q C;  4ILA A;  4YT0 A;  5JH7 E;  2N2N A;  3NVO A;  4PK5 A;  2KZ7 B;  3N9L A;  5AQP B;  5AQL B;  5HXH A;  2VQE T;  3AEC A;  4HE8 A;  3OBV E;  2KXP B;  3N5L A;  4TZ4 C;  1HCI A;  3RIU A;  1VOM A;  5AQJ B;  4PJM A;  3PDY A;  2LSK A;  5JR9 C;  5LMN T;  4EIW A;  5L4H A;  2UXC T;  1QUU A;  4B3S T;  2NP9 A;  4KHZ F;  1HR0 T;  2CLY B;  1YKE B;  2L9Q A;  2BKP A;  3SFD A;  2E9X A;  1ZV4 X;  4NIQ A;  4IDO A;  5J2T E;  5AQT B;  4Z90 A;  5LCY A;  5DJQ C;  1GQE A;  1IBM T;  5JTG A;  3VKH A;  4U2Y A;  2JMK A;  4XBF B;  2HHH T;  3U78 A;  3ZYK A;  3N9O A;  4TN7 B;  4DR3 T;  5JRC A;  2M6I A;  4AXP A;  3IA3 A;  2WU5 A;  2UUA T;  4YTN A;  3HKB E;  5HXE A;  2CBI A;  2V1D B;  2BKN A;  5AQU B;  5JDN A;  2Q9Q A;  2WMN A;  2W4X A;  3UUB A;  5M4Y A;  3IF8 B;  2JIW A;  1SHZ C;  3AB3 B;  2WS3 A;  2NR4 A;  2M6B A;  2VWA A;  2CM0 A;  1Z0P A;  5JR9 A;  3HKE E;  3G06 A;  4CXX A;  1XMO T;  2BG9 B;  1I6Z A;  5AQI B;  4CZZ B;  5ABF B;  3MXZ A;  2P9B A;  2FJB A;  2V26 A;  2V5D A;  4QH4 A;  3UTK A;  3GN5 B;  3AA1 B;  3B57 A;  3LG7 A;  2XQ9 A;  2X9W A;  1HS7 A;  3AVR A;  2CE7 A;  1BR0 A;  2KWI B;  4HWD A;  1YKH B;  3VR8 A;  1XDP A;  1SA0 E;  4HFB A;  4ZI3 C;  4UXN B;  5J2U E;  3N9M A;  2Y8D A;  4I55 E;  1QLB A;  4YSX A;  4ASK A;  3BQL A;  3KVB A;  2FBW A;  2CHN A;  3LBX A;  2LRL A;  2XAJ B;  4ANJ A;  3ONJ A;  1JNR A;  3RIA A;  5AQS B;  5L3G B;  5LHG B;  3OJA A;  2XUE A;  2JPF A;  3FZH B;  4GYS A;  4HWC A;  3I1A A;  3K3O A;  3AE6 A;  4TWH A;  3MZK B;  2LHN A;  2VK9 A;  3U3I A;  3M3Z B;  4KP3 C;  2XM2 A;  2XAG B;  5CB4 E;  4DV1 T;  2K3W A;  4A5X A;  4ZI2 C;  3T8O A;  2C5I T;  5EK4 A;  3PUW F;  1IBL T;  3HA4 A;  3QOF A;  4PNI A;  3CQX C;  1US7 B;  5HCM A;  2WZI A;  3UUX B;  1VCT A;  2WMO A;  3MJX A;  5HAX A;  3AE7 A;  2JQ9 A;  4IE4 A;  4DV5 T;  4ZI3 D;  5HYA A;  2IDO B;  5JDH A;  4JEU B;  4P09 A;  1UCU A;  1IJ6 A;  3UUM A;  3IHR A;  3EDU A;  1BR2 A;  1FEW A;  4IDP A;  4WZX A;  2EHO C;  3P8C D;  4N78 D;  1D1A A;  3RX6 A;  1J5W A;  1ZP0 A;  4YHH T;  1MIY A;  4AKG A;  3WAK A;  3EHZ A;  5LHI B;  5DQV A;  2ZM6 T;  4UIG A;  5F8P A;  4HFC A;  2KT9 A;  1S94 A;  3LK4 2;  2V7K A;  4IDN A;  4DV0 T;  1ZHC A;  3FHN A;  5CFB A;  2BDE A;  3HR0 A;  2W2U A;  3FZK B;  4YSZ A;  4YY3 T;  4TWD A;  3AAI A;  4H9S E;  4M1P A;  1KFY A;  4JYA T;  4ZI2 D;  4O2A E;  1OED B;  4DV3 T;  2HN1 A;  2R6G F;  3OPC A;  3SFE A;  1AJ3 A;  1HX8 A;  3AVS A;  4PAG A;  1G73 A;  3P4R A;  5KDM C;  3PUZ F;  4O4I E;  4A56 A;  4GOU A;  3SWH A;  2DNX A;  2ODV A;  3AA6 B;  3KV9 A;  4EXT A;  3NRY A;  4OYJ A;  3UU3 A;  5LMU T;  1W0B A;  4P0A A;  4GIW A;  5AQF B;  4EYU A;  2X51 A;  2J62 A;  2VB6 A;  4H9N C;  1T7S A;  3TKL B;  2WDV A;  2DI4 A;  2EHO D;  3CWZ B;  2LJL A;  1ZKE A;  4L0R A;  1J5E T;  3UFG A;  1T8B A;  5HWX A;  2K48 A;  2YKS A;  3E08 A;  3CK6 A;  4UV8 B;  1NEK A;  3WAJ A;  3QB5 K;  2V7L A;  1KNZ A;  4H9O C;  4LF5 T;  3T1H T;  3ZT7 A;  2KND A;  1N33 T;  3C50 A;  4YHJ A;  4AQY T;  3PUG A;  2XQ7 A;  3KBT A;  4LF8 T;  1UX5 A;  2HH7 A;  4UEL A;  2EHO B;  4EGW A;  4LFC T;  5HXC A;  4BJM A;  2V6Y A;  3KFW X;  4E7Z A;  2KMF A;  3N2G E;  4X62 T;  3LK2 B;  4FJO A;  3AA0 B;  2WDR A;  3ANW A;  3DTO A;  1VCS A;  3AE9 A;  3QC9 A;  2X9H A;  2H89 A;  2CLY C;  5FY0 A;  4H9P C;  4U74 A;  4WW0 A;  3PTR B;  4PK4 A;  2H7O A;  4DR5 T;  1LKX A;  2VKH A;  3BK9 A;  4X1K E;  5FXZ A;  3CKD A;  4YSY A;  3IEE A;  4PJL A;  5DAB A;  2DCF A;  2C0S A;  4WNK A;  3PU3 A;  3ZYM A;  2NW8 A;  4ZS2 A;  5LGU B;  4YJ3 E;  4DR1 T;  5L3E B;  4O4H E;  4GKJ T;  1SUM B;  2W67 A;  5HEH A;  4P0B A;  3AEF A;  4JI8 T;  2MAW A;  4KUM B;  1MMN A;  3PJA A;  5BR8 T;  4C91 A;  2XQ4 A;  1M7K A;  3C51 A;  3ETV A;  4AKI A;  1VRB A;  1OXZ A;  2LT3 A;  4EB6 E;  4B6X A;  1ZEE A;  5GON E;  2UUB T;  4UV9 B;  3CX7 B;  4AQF C;  3MA9 A;  4UR9 A;  1T98 A;  4F8H A;  4DID B;  2PFV A;  5LOV E;  1G8X A;  5EZY E;  5LYJ E;  1SE7 A;  5C2T A;  4IDZ A;  3QB5 A;  4CI2 B;  2AXD S;  5LGN B;  2BG9 C;  5FY1 A;  5H6Q B;  5CA1 E;  2OLT A;  3ETU A;  3N9P A;  3H3A A;  4IE5 A;  3EAM A;  2UUC T;  3E0Z A;  3RRC A;  2W62 A;  5J0Z A;  2LLY A;  3LFM A;  3DJB A;  4K0U A;  5LB7 B;  1WR6 A;  2QVA A;  4LFB T;  4G2A A;  4DR2 T;  4LMJ A;  5IUX A;  3B5M A;  2MYS A;  4DVD A;  1J1J A;  2GK9 A;  5AQG B;  3PUS A;  3F2E A;  2V5C A;  3ESL A;  5F5W A;  3RRW A;  2RPA A;  2LKH A;  1E7P A;  3ABV A;  3SS1 A;  2WCA A;  4JI5 T;  2X67 A;  4XAX B;  3RH3 A;  3EAB A;  3K8P C;  4U7Y A;  2UXX B;  5KXJ A;  5L47 A;  4TNV A;  3PUA A;  1KK7 A;  4JUY A;  2BS2 A;  2KWH A;  5LA6 E;  1O3X A;  2ODU A;  3EVY A;  5LXT E;  1NWM X;  1UUR A;  2NWB A;  3IBP A;  3UUL A;  4YTP A;  2WBL A;  1CUN A;  5JDQ A;  2XAH B;  3R84 B;  1V9D A;  5AQM B;  2LSJ A;  2PTF A;  2VL8 A;  3KV4 A;  4WBO A;  3AEB A;  4QXH B;  2V7I A;  4PFO A;  2WB5 A;  2XZE A;  5JDM A;  3UU8 A;  2PG8 A;  1NAF A;  4PJN A;  3LSV A;  4X1Y E;  2BBJ A;  5CJ5 A;  3I9W A;  3L3P A;  4IE7 A;  2X66 A;  2BG9 A;  3ZMU B;  3OKQ A;  1HNX T;  1WLX A;  5ABF A;  2XQ3 A;  3GMI A;  3Q9D A;  4JV5 T;  5LGT B;  2WAU A;  3GN5 A;  3A8Y C;  2BVM A;  1HX1 B;  2D9D A;  2QGS A;  5LJM A;  2NW7 A;  3D0T A;  5FL1 A;  2LE8 A;  2YOE A;  3VU7 H;  3N9Q A;  4JI2 T;  2XHE B;  4E7S A;  3SRZ A;  2X0L B;  4LF9 T;  3BQI A;  3N9N A;  4HFD A;  5FY7 A;  2WQY A;  2M67 A;  2PBI A;  3ZT6 A;  4YLH A;  2VQF T;  1HFA A;  3V5S A;  5EK2 A;  3J9X 1;  3TLV A;  3AE1 A;  1MMD A;  3KIN B;  3OYX A;  4IE0 A;  1OED C;  1YXR A;  4PK6 A;  3ZC1 A;  2A9U A;  4KI0 F;  1HG2 A;  2CPT A;  4X20 E;  3KDS E;  3N2O A;  4AI6 A;  1FMV A;  4KX6 A;  4DO0 A;  2W00 A;  2WU2 A;  2BS3 A;  2XY8 B;  4PW8 A;  1X79 A;  1N32 T;  4AKH A;  1MMA A;  1FMW A;  5KMG P;  4CXW A;  3CQC B;  3CVR A;  5ABG A;  4QKN A;  4DV7 T;  2Y6X A;  1U5P A;  2X68 A;  2QRX A;  4BAY B;  3P4S A;  2N9D A;  4EYY R;  4DBR A;  2J1D G;  2JQK A;  5C8Y E;  4EED A;  2XQ6 A;  2NOX A;  4J2C A;  5FYM A;  4OX9 T;  4U31 A;  2X0H A;  4NXN T;  4JI0 T;  3F31 A;  2MPK A;  4XZC A;  4NUV A;  2SPC A;  3I0O A;  4UF0 B;  3CQG B;  4B3M T;  3PV0 F;  1XWM A;  2YDS A;  5AQH B;  3K3Q C;  1LVF A;  4EEB A;  4ERR A;  2HPL A;  4IL4 A;  3DP7 A;  4QHO A;  4ZHQ E;  2LKG A;  1ZOY A;  4LFA T;  5FVL A;  4DR7 T;  1YW0 A;  4AKL A;  4IHJ E;  3PU8 A;  2XJ7 A;  4UVB B;  3EDV A;  4CXY A;  2JQH A;  4GK0 E;  2K24 A;  3CIR A;  2JMH A;  3TLS A;  3LDQ B;  1UX4 A;  4TNW A;  3NZP A;  2H7V C;  1OED A;  4ZS3 A;  2E5L T;  5F3J A;  5L2L A;  3T1Y T;  1D0Z A;  1D0Y A;  4BJN A;  2CRB A;  4Z91 A;  4I0U A;  3GA8 A;  3C4W A;  3PJA J;  2ZM2 A;  3EI0 A;  3HL6 A;  4ZZB A;  3AEA A;  4DMW A;  4OHF A;  3RQW A;  4ILC A;  1OED E;  3TLT A;  2E2A A;  3RPU A;  3J7Y q;  5L3D B;  4CN6 A;  5LHH B;  3JAE A;  3AXJ B;  2IC9 A;  3MKD A;  4ADZ A;  4CN4 A;  4EOZ B;  2CEA A;  5AQQ B;  3ZN1 B;  4JEH B;  2W0G A;  4IGU A;  1U4Q A;  3UFE A;  2W63 A;  5LBM A;  2VL0 A;  4QH1 A;  1KF6 A;  4U7I A;  2JJ9 A;  3F57 A;  2CWY A;  3PE0 A;  3O1J A;  2YU2 A;  1MMG A;  2ACZ A;  3P4P A;  2VKO A;  5LJN A;  3AED A;  2X0Y A;  2EHO A;  2LM9 A;  3C98 B;  5JDF A;  4CN1 A;  3PUY F;  3L09 A;  4OFZ A;  2WWU A;  1FIO A;  2D5U A;  4QXB B;  2MBG A;  4HTE A;  5AQK B;  3ZLI A;  4EAH A;  4IRE A;  2IHR 1;  3P4W A;  2BS4 A;  4DR4 T;  4KHP T;  3KVA A;  5HXR A;  3FB2 A;  5TAO A;  3ZMZ B;  4ZEY A;  4UEM A;  4MLK A;  4PFP A;  3AA7 B;  2G0U A;  3X1D A;  5L3C B;  4X66 T;  3VRB A;  1H7C A;  4YXD A;  5FMN A;  3ZYL A;  4NUU A;  5FXW A;  4ISS A;  3M65 A;  3W15 B;  1XZY A;  3UT5 E;  2CMR A;  2UXN B;  2LHR A;  3RYF E;  4K0K T;  3LK3 B;  4LML A;  5IYZ E;  1HNZ T;  4CQI A;  3RF1 A;  5HEU A;  1MIW A;  2XAF B;  2FJE A;  4H9R C;  5E0O A;  1LVK A;  2CA5 A;  3OYZ A;  3E22 E;  4TV8 E;  5EK3 A;  2K9A A;  5A1L A;  2V7J A;  2E9X C;  3ZSS A;  1N36 T;  2J47 A;  2RA1 A;  3BQK A;  3NKZ A;  4O4L E;  3H37 A;  3ONL C;  2ZM0 A;  1E1H B;  4F6R C;  2FUP A;  4V1A v;  2VKJ A; 
#chains in the Genus database with same CATH homology
 5FVK A;  2JQ9 A;  5FVL A;  3ZSS A;  3ZST A;  4IT4 A;  2K3W A;  2XZE A;  2LRL A;  2RPA A;  4A5X A;  5LB7 B;  2LRK A;  4U3C A;  2V6Y A;  2JQK A;  2V6X A;  2W2U A;  3ZT7 A;  2DL1 A;  4CN6 A;  4ZEY A;  5CJ5 A;  3EAB A;  3ZT5 A;  4CN1 A;  4U7I A;  4U33 A;  4CN4 A;  2JQH A;  4U7Y A;  4U31 A;  1YXR A;  4NIQ A;  4P1N A;  1WFD A;  2CRB A;  4U2Y A;  4WZX A;  3ZT6 A;  2WY2 A;  2A9U A;  1WR0 A;  3K1S A;  2MPK A;  2CPT A;  2WWV A;  2V6Y B;  5CGM A;  1WCR A;  4U2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...