4WZXA

Ulk3 regulates cytokinetic abscission by phosphorylating escrt-iii proteins
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
87
structure length
87
Chain Sequence
TSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEYLKEQVKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase ULK3
publication title ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 38
structure length 87
sequence length 87
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4wzxA01
2CPTA 2DL1A 2LRLA 3ZT6A 2V6YB 4CN1A 2LRKA 2WWVA 3ZT5A 1WR0A 2CRBA 1YXRA 4ZEYA 5CGMA 2JQKA 2V6XA 2RPAA 4P1NA 2A9UA 4IT4A 5CJ5A 3EABA 5FVLA 4U2ZA 3ZT7A 4A5XA 1WFDA 2JQ9A 2JQHA 5FVKA 5LB7B 4WZXA 3ZSSA 4CN4A 2V6YA 3K1SA 4U31A 2K3WA 4U7YA 4CN6A 2XZEA 2MPKA 3ZSTA 4NIQA 4U2YA 4U7IA 4U3CA 2W2UA 4U33A 2WY2A 1WCRA
chains in the Genus database with same CATH superfamily
4H9NC 5CA0E 5L2LA 2KNDA 1U4QA 2X51A 3AEAA 5L3FB 4YT0A 4DV1T 3PURA 2YDRA 1HCIA 3AEDA 4IGUA 4UF0B 4IDZA 2QYWA 2X0YA 2L8KA 1YD8G 5FP3A 3OJAA 5H6RB 4HWCA 3TLWA 1YKHB 3P4WA 4AQFC 4ZI3D 4CXYA 4YTMA 4GYSA 4WYVA 3ANWB 4X1IE 3NZPA 2CXFA 2CWYA 4X1KE 4WZXA 2P9BA 4UR9A 4O4HE 2D9DA 2YK0A 2HPLA 2ZM2A 2WZHA 2CPTA 2LE8A 2ZLYA 4O8SA 2HPJA 3PUQA 4LF4T 3PV0F 4PK6A 3UULA 3EHZA 4LFAT 2V7KA 4F8HA 4IE4A 4U31A 3BQIA 3UQ4A 5HEHA 2MYSA 5JH7E 2XPKA 1HX1B 3UUXB 1HNZT 2E9XA 3ZT6A 3V5SA 3C4XA 3FBLA 2D5UA 3A5XA 3LK3B 1BR4A 2X9HA 3MK7C 4JI5T 3RLFF 4EZHA 1ZV4X 3ZPOA 3W15B 2CE7A 5L3EB 2VVNA 3FZMB 2Z6EA 2VKHA 3N9NA 3AECA 2F4VT 2DL1A 4X66T 2CXLA 5HCMA 3JAFA 3RH3A 3FXDB 4UELA 4H9PC 4BJMA 4HGAA 3P4PA 5AQUB 2YU1A 1KF6A 2DNXA 2XQ6A 2FBWA 2XZEA 4AKGA 2WDRA 5HXEA 2DCFA 3HA4A 4WW0A 2MTQA 5BR8T 3ZMUB 1KEYA 1IJ5A 4HFBA 5J1GA 4I55E 3PUGA 4A97A 3IHRA 1KNZA 2EHOC 4OYJA 5JQGE 2YEVC 4OK0A 5FXVA 4DR2T 3K3OA 4EEDA 3SOLA 1ZP0A 2WY2A 5HWYA 5FKYA 3ZN1B 3ZMTB 1M7KA 1Z0PA 3ZJ2A 5FXZA 2XHEB 1QSDA 5L3BB 1ZKEA 3ONXA 2W00A 3B5MA 4EYYR 4DBRA 4JI4T 5EZYE 2BKNA 3HKEE 2YU2A 3I1AA 3ZCJA 5IWAT 3RGLA 4LFBT 4AKLA 4TWDA 1R8IA 4ZOLE 3Q5XA 5HEOA 1UGOA 2KWIB 2CHNA 2X9WA 1IJ6A 4LMKA 1W0BA 2CRBA 4IT4A 1N33T 5DQVA 3AE6A 5LBQB 2DLRA 3PUZF 3LSVA 2WU5A 4DR3T 2PG8A 4DUZT 1LRZA 4DR4T 3P50A 4JI1T 3CK6A 5LCYA 1S35A 1D1AA 3PJAA 1AJ3A 3FZHB 3ZMSB 4UEMA 2Q9QC 4MLKA 1XWMA 2WMOA 4IL9A 4EOZB 3RIFA 3JAEA 4B6XA 2V7IA 4JYAT 1MMDA 4PJJA 4LMLA 3I0OA 2M6IA 3LFMA 2YOEA 4H63V 3WAKA 1MNEA 3AE2A 3EI0A 1IZNB 5AQQB 2OLTA 2VKJA 4IE6A 3ZKRA 3CKDA 2YDQA 1YKEB 4NPPA 3OTOT 5AQKB 2NP9A 2C0SA 4Z90A 2J4GA 3MA9A 2Y6XA 4EYUA 4LFCT 1ZHCA 1J1JA 2K24A 3ZC0A 2XM1A 4ZS2A 3JCFA 4H63H 4OFZA 5F5WA 3RF1A 2XQ7A 4BJNA 1XDOA 1FJGT 4CXXA 2VWAA 3KBTA 5L4HA 4DVDA 1MIWA 4YJ3E 5JR9A 5L3GB 4YSZA 3UUBA 3AXJA 5CJ5A 2DI4A 4JV5T 3VKGA 3P4RA 5LXTE 3NBXX 2KSRA 5KMGP 4HWHA 3O4XE 5J2TE 3AE1A 5E0OA 1VCTA 1ZOYA 2WU2A 3HKBE 4K0KT 2YN6A 5LOVE 3QUJA 5JRCA 5JDMA 4L5GA 2OV9A 2C5KT 3C50A 2BG9A 2CLYC 3UTKA 2BKOA 4MALA 2IUBA 4NXMT 3ONLC 2I6HA 3KVBA 3PUVF 2XQ3A 4Z8XA 2BKPA 2UUCT 5IUXA 5L3DB 2JQQA 2XAGB 2JJ9A 5LG4A 4WBNE 5L4EA 2JRKA 2JQKA 1XMOT 1H7CA 4DMWA 2E9XB 2BBJA 2WZIA 1BR0A 3PU3A 3KV9A 1V9DA 1FMWA 2BVMA 5ETWA 5C2TA 2LEHA 4MFRA 4ZEYA 2XAJB 2XJ7A 4B3TT 4YJ2E 1DU2A 5DJQC 2AXDS 4JEUB 4QH1A 4IL4A 4KMCA 5DQWA 3VR9A 3LBXA 3KV4A 1WYBA 3AEEA 1MIVA 3UUMA 5J0ZA 2ODVA 4Q25A 3U78A 5HAXA 3RYIE 5LGNB 2B76A 2V26A 1Z8UA 1XDPA 5H6QB 3AEFA 3ZSSA 3BQLA 5L3CB 4JI3T 3RC8A 2HN1A 1IBMT 1QLBA 3L39A 4HEAA 4ZHQE 3QNUA 2WAUA 4F6RC 3RYCE 4GIWA 3VU7H 2N2NA 4KX6A 3N2KE 2W63A 3N9PA 4HN9A 3RYHE 3AEGA 3VKHA 1UUSA 1OEDA 2MOZA 1E7PA 2D0UA 3NZQA 3AVRA 2RA1A 3K8PC 3KFWX 1XMQT 1E2AA 4EIWA 2ACZA 2OA5A 4DV5T 2V1DB 4NXNT 2D2SA 2WCAA 4UXNB 1YQ4A 1KK7A 1SA0E 2QA7A 5M4YA 1O3XA 4BAYB 4HWIB 3I0QA 4QXHB 2XASB 5LNKA 4QHOA 1B7TA 4I50E 3OYZA 3I9WA 1WR0A 4TWHA 3J7Yq 4ZI3C 3A7MA 5FY0A 2XTLA 5FNVE 4ILCA 1SE7A 4ZXLA 4OHFA 4YY3T 1OWAA 3UU3A 4ISTA 3GMIA 4CZZB 3ZMVB 3RKOA 2BVLA 3UQ7A 2BS4A 1BR1A 1CUNA 5JDQA 4HE8A 2LSYA 2E9XD 2V6YA 2XSBA 3GWHA 4YSYA 4OX9T 5AQMB 4LF6T 1IBKT 4V1Av 3IA3A 1N34T 4TX5A 3HI2A 5AQIB 1WRDA 2WP9A 2YINA 4XZCA 5IHYA 3AA7B 3RRWA 1WYCA 4TV8E 2ZM8A 2LKHA 3F2EA 1G73A 1HNWT 3O1IA 1YQ3A 4COFA 3AB3B 3N2GE 4WNKA 4YTNA 4B3MT 4EV6A 3GA8A 4E7ZA 4O4JE 2A72A 4JI6T 3DTOA 2LOSA 5F8PA 3VHLA 3J9X1 4CN6A 5HXCA 2FJAA 2FJDA 3B57A 1XNRT 2LLYA 4P0AA 2VASA 1CHUA 3KINB 2WWVA 3ZT5A 2IW5B 4QH5A 5ADXL 2LJLA 4H9RC 2MAWA 3ZLIA 2KXPB 2CEAA 3CQGB 1LKXA 2E2AA 1FIOA 1HTJF 5AQHB 4I0UA 3E22E 3TLSA 3SS1A 4P1NA 3TKLB 5LYJE 5JR9B 3EUHA 3FHNA 3AXJB 4U7YA 2LT3A 5HCJA 3OBVE 2CWOA 1G8XA 4LF8T 2SPCA 4X5TA 1KNPA 2XQAA 2CXDA 2HN2A 4JLEA 3A8YC 5A1LA 3PUSA 5JREA 5JRCB 2KT9A 2J47A 4XBFB 2JQ9A 5FY7A 3QOFA 4LF5T 1BR2A 3O9XA 2BG9B 1UCUA 3CX7B 3FZFB 4PK5A 3M3ZB 2C5IT 3AE8A 1QUUA 3RRCA 4YHJA 4AQFA 3FXEB 4DV4T 1HNXT 4KBMB 4QXCB 4CI3B 2GK9A 2V7JA 2LSJA 2CM0A 3UU6A 2WDQA 5LJMA 1I94T 3PUYF 4QX8B 2Y8DA 5LB7B 3BQKA 4IDOA 2N1GA 2ODUA 2NTYA 4A98A 4U7IA 1T8BA 2VVSA 2XY8B 3LBXB 3RIUC 2ZM0A 4LF9T 2AE9A 4EZ4A 3N5LA 3PDYA 5FY1A 4HFCA 4DUYT 2ES0A 4JUYA 4X20E 1WR6A 3P8CD 1D1CA 1OEDE 3MKDA 2UUBT 2LM9A 5AQPB 2WS3A 2LHRA 1YXRA 4LMJA 4O2AE 3R84B 2X0LB 2XAQB 1MMGA 4EGWA 2IAKA 2QVAA 4FI5A 4DNDA 2LRLA 2V7MA 3P4QA 4KI0F 3HKCE 3GN5A 5HEGA 1OEDB 5KDMC 3CVRA 5FVLA 2H89A 3ZT7A 1SHZC 2LSGA 2X67A 2VL0A 4L0RA 5FMNA 4TNVA 4DR7T 1HG2A 5ABFA 3AVSA 1Y64B 5FYMA 3N9QA 3MZKB 4JI8T 5C8YE 2XAFB 2IC6A 2EHOA 2VQET 3N9LA 4AI6A 3KV6A 3O1HA 5F3JA 2R6GF 2K3WA 2V5DA 3UU8A 2X9YA 3O1JA 5HEJA 2L3LA 3FZKB 5HXSA 4GYRA 5ABHA 2E5LT 4GKKT 2NW7A 5AQJB 3NWIA 2WWUA 2PJQA 1US7B 2WDVA 3RC3A 2V6YB 4Z91A 3SFEA 2Q9QD 3CIRA 4I43B 1J5WA 2H88A 5AFUL 1FMVA 4DIDB 3WAJA 1NENA 4X65T 3EVYA 4PW8A 3MJXA 4PNIA 3VRBA 5AQLB 2G0UA 2W2UA 1MMAA 2DWKA 1WCRA 3KV5A 2IC9A 4P09A 4DV0T 3UU4A 3AEBA 4O2BE 4IDNA 3OYXA 4ILBA 4ILAA 5KXJA 2H7VC 2VL8A 2J1DG 3T1YT 3RX6A 5JTGA 1SUMB 4CN1A 3ZYLA 5EK3A 5AQGB 1N32T 2M67A 5TAOA 2UXDT 4JBWF 4EAHA 2Q9QA 3AAIA 2XAHB 3ZMZB 2MBGA 3QC9A 3KDSE 4UIGA 2CBJA 4H9QC 1LVKA 4UV8B 2NTXA 4TN7B 1W0AA 5ABEA 2X9XA 2V7LA 3SFDA 5LHGB 2ZMAA 1I6ZA 4YFSA 1HR0T 2FJEA 3T1HT 2LSKA 4ZS3A 2N9DA 3AE7A 2IHR1 3AE4A 2E8IA 2H3RA 4P0BA 2D0TA 3ZYKA 3LK42 3Q5DA 3IBPA 3P7IA 3H3MA 4GKJT 3L09A 3NRYA 5LGTB 4X1YE 3T8OA 1MNDA 4N78D 1EZ3A 3G06A 5JDLA 3SRZA 4IIJE 4U2ZA 4ZZBA 2XSAA 4HFHA 2VKOA 4PJNA 3P4SA 5AQFB 3C98B 4DO0A 4UVCB 4EB6E 1VRBA 4CI2B 4EEBA 4KP3C 4TNWA 4AKRB 2CA5A 5FXWA 3JC6D 3Q2MA 3RI5A 4OYKA 1MIYA 2E9XC 4ZI2D 2FUPA 2WMNA 5JDNA 2B1EA 2XQYA 4MBQA 1D1BA 2WQYA 4K0UA 4HWFA 4I4TE 2JQHA 4JEHB 1IAPA 2RP4A 2W61A 2UXNB 5CFBA 3RPUA 3AAAB 2HH7A 2VK9A 4TZ4C 2IDOB 3OKQA 2UU9T 1UURA 3IF8B 3SWHA 4IE5A 2X66A 3NKZA 2W4XA 3OVUA 2UXCT 4TUYE 1JNRA 1KNRA 3ETVA 1L0VA 2KZ7B 4DR1T 3RIAA 4XAXB 5LG3A 2KLQA 5CGMA 1HS7A 2RPAA 3UT5E 5LMNT 3B13A 1Y01A 4HTEA 3GN5B 3RKGA 3LG7A 2NW8A 4DV2T 2WB5A 3CQXC 4KHPT 2LSIA 2LKGA 2DWGA 3TLUA 3M65A 2CBIA 3DP7A 1GQEA 2H7OA 5ABFB 4G2AA 3AE5A 4QXBB 3ESLA 4ERRA 5FVKA 2KWHA 4CN4A 2EHOB 1S94A 5FXXA 4JI7T 3Q5WA 3AA0B 4UV9B 3ONJA 4H9OC 2W66A 2NWBA 3AAEB 4GK5E 1NWMX 4FJOA 1NAFA 4YHHT 3TLVA 4DR6T 4G63A 4U72A 3ZN0B 2V8SV 3CPZA 4PJLA 3UU5A 2NR4A 5IYZE 3CMLA 3ZJ1A 3RQUA 3U3IA 5BMVE 3CWZB 2W67A 3RQWA 3S4UA 2BG9E 5FL1A 3K3NA 2VKDA 3C4WA 4IE7A 2WM9A 4DV6T 4HWDA 3CX6B 5AQRB 2J62A 2NOXA 3AE9A 5LHIB 5JDFA 5HXRA 4TWFA 2Y48B 4ZI7E 3H37A 4LF7T 4QH4A 5HWXA 2LRKA 4KHZF 4U74A 3ZEFB 3WI3A 1XNQT 1E1HB 5DABA 1M62A 4WBOA 1FEWA 4KUMB 1VCSA 2Q9QB 3MXZA 2NW9A 4DR5T 3DJBA 4PFOA 4QX7B 4HKAA 4AIUA 2X68A 1T7SA 4YTPA 3KVAA 3R6NA 4ILUA 1HG5A 3ZSTA 3AA6B 5HYAA 3F31A 4DBQA 5L47A 1JNZA 2BBHA 3N2OA 2V5CA 2JMHA 4B3RT 5JR9C 4YSXA 3ETUA 5ABGA 1HX8A 4C91A 2LOPA 4CQIA 2EHOD 2BDEA 5LHHB 3HL6A 3EAMA 4BA9A 1NEKA 3QB5K 4HFIA 5EK2A 3ZCIA 4L9IA 4O4LE 2CCQA 2UXBT 3C51A 1U5PA 2BG9C 4IREA 5EK4A 5CA1E 2PTFA 2QRXA 2A9UA 4UF0A 1W09A 1T72A 4DMVA 3CQCB 2M6BA 5JDHA 3RHWA 4NIQA 3HR0A 2LHNA 4YLHA 4HFVA 3ANWA 2CLYB 2PBIA 3N9OA 3D0TA 1D0XA 4A56A 3UFEA 4AXPA 5GONE 5LA6E 2JPFA 4X64T 4AQGA 4IE0A 5AQOB 2L9QA 4IDQA 1WLXA 4J2CA 2YKSA 3BK9A 3PTRB 3ZYMA 1X9BA 4UVBB 2ZM6T 2PFVA 5C3JA 3ABVA 3PJAJ 3PUAA 4ZZCA 4H9SE 1XZYA 3L8RA 3K3QC 5HEUA 3MACA 4AISA 4U2YA 5LMUT 4U33A 4PFPA 3UFGA 1YW0A 2CMRA 2XM2A 4HFDA 3PUWF 3LDQB 5AQTB 2I0MA 2X0HA 3QK6A 4X62T 3EDUA 3PE0A 3CX8B 3N9MA 4ADZA 1UX4A 2HHHT 4JI0T 1D0ZA 3RIUA 3V5UA 1KFYA 2IMLA 4DV3T 4E7SA 2QGSA 3C4ZA 3RYFE 2VB6A 3TLTA 5AQVB 3VRAA 1OEDC 2K48A 3K1SA 1W9RA 3EDVA 3NVOA 1HFAA 3AE3A 5LP6E 4O4IE 4AKIA 4A5XA 2JIWA 5AQSB 3Q9DA 3FBZA 4CXWA 5HXHA 4IDPA 4C90A 2KINB 4IHJE 2A3DA 3OPCA 1UX5A 2W0GA 3C64A 3VR8A 2VURA 1VOMA 2XQ4A 4DV7T 4PJMA 3H3AA 2BZBA 2FJBA 4PK4A 4GK0E 1N36T 2KMFA 1LVFA 2A2FX 2DHRA 4GOUA 2BS2A 2V6XA 4AQYT 3JC6C 5LGUB 2K5BB 3E08A 1X79A 1WFDA 3Q5EA 3UUNA 2BS3A 2XQ9A 4ZI2C 2CHOA 4QWNB 5CB4E 5KX5E 4ANJA 2UUAT 3IEEA 1HF8A 3I9YA 4QKNA 3LK2B 4NUVA 2VQFT 4NUUA 2XQ8A 3X1DA 4AKHA 2ACXA 2MPKA 2WBLA 3PUXF 2XUEA 3NRXA 5LJNA 2XQ5A 2W62A 3KBUA 5J2UE 3FB2A 5FL0A 1OXZA 5JVDE 4ISSA 2I59A 2K9AA 4B3ST 1UK5A 4HFEA 4M1PA 3E0ZA 5LBMA 3JADA 1J5ET 5AQNB 2IIUA 4EXTA 3QB5A 3EABA 2UXXB 1D0YA 1T98A 3PU8A 4YXDA 1IBLT 3LJCA 4ASKA 2WSSV 4U3CA 3HKDE 2YDSA 4UVAB 3L3PA 2C5JA 2LM2A 3F57A 4TV9E 2JMKA 5JDGA 3AA1B 4CI1B 1ZEEA 3ZC1A 4PAGA 1MMNA 4JI2T 3FZLB 4MHCA 2E5VA
chains in the Genus database with same CATH topology
2CPTA 2DL1A 2LRLA 3ZT6A 2V6YB 4CN1A 2LRKA 2WWVA 3ZT5A 1WR0A 2CRBA 1YXRA 4ZEYA 5CGMA 2JQKA 2V6XA 2RPAA 4P1NA 2A9UA 4IT4A 5CJ5A 3EABA 5FVLA 4U2ZA 3ZT7A 4A5XA 1WFDA 2JQ9A 2JQHA 5FVKA 5LB7B 4WZXA 3ZSSA 4CN4A 2V6YA 3K1SA 4U31A 2K3WA 4U7YA 4CN6A 2XZEA 2MPKA 3ZSTA 4NIQA 4U2YA 4U7IA 4U3CA 2W2UA 4U33A 2WY2A 1WCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPT A;  2DL1 A;  2LRL A;  3ZT6 A;  2V6Y B;  4CN1 A;  2LRK A;  2WWV A;  3ZT5 A;  1WR0 A;  2CRB A;  1YXR A;  4ZEY A;  5CGM A;  2JQK A;  2V6X A;  2RPA A;  4P1N A;  2A9U A;  4IT4 A;  5CJ5 A;  3EAB A;  5FVL A;  4U2Z A;  3ZT7 A;  4A5X A;  1WFD A;  2JQ9 A;  2JQH A;  5FVK A;  5LB7 B;  4WZX A;  3ZSS A;  4CN4 A;  2V6Y A;  3K1S A;  4U31 A;  2K3W A;  4U7Y A;  4CN6 A;  2XZE A;  2MPK A;  3ZST A;  4NIQ A;  4U2Y A;  4U7I A;  4U3C A;  2W2U A;  4U33 A;  2WY2 A;  1WCR A; 
#chains in the Genus database with same CATH topology
 4H9N C;  5CA0 E;  5L2L A;  2KND A;  1U4Q A;  2X51 A;  3AEA A;  5L3F B;  4YT0 A;  4DV1 T;  3PUR A;  2YDR A;  1HCI A;  3AED A;  4IGU A;  4UF0 B;  4IDZ A;  2QYW A;  2X0Y A;  2L8K A;  1YD8 G;  5FP3 A;  3OJA A;  5H6R B;  4HWC A;  3TLW A;  1YKH B;  3P4W A;  4AQF C;  4ZI3 D;  4CXY A;  4YTM A;  4GYS A;  4WYV A;  3ANW B;  4X1I E;  3NZP A;  2CXF A;  2CWY A;  4X1K E;  4WZX A;  2P9B A;  4UR9 A;  4O4H E;  2D9D A;  2YK0 A;  2HPL A;  2ZM2 A;  2WZH A;  2CPT A;  2LE8 A;  2ZLY A;  4O8S A;  2HPJ A;  3PUQ A;  4LF4 T;  3PV0 F;  4PK6 A;  3UUL A;  3EHZ A;  4LFA T;  2V7K A;  4F8H A;  4IE4 A;  4U31 A;  3BQI A;  3UQ4 A;  5HEH A;  2MYS A;  5JH7 E;  2XPK A;  1HX1 B;  3UUX B;  1HNZ T;  2E9X A;  3ZT6 A;  3V5S A;  3C4X A;  3FBL A;  2D5U A;  3A5X A;  3LK3 B;  1BR4 A;  2X9H A;  3MK7 C;  4JI5 T;  3RLF F;  4EZH A;  1ZV4 X;  3ZPO A;  3W15 B;  2CE7 A;  5L3E B;  2VVN A;  3FZM B;  2Z6E A;  2VKH A;  3N9N A;  3AEC A;  2F4V T;  2DL1 A;  4X66 T;  2CXL A;  5HCM A;  3JAF A;  3RH3 A;  3FXD B;  4UEL A;  4H9P C;  4BJM A;  4HGA A;  3P4P A;  5AQU B;  2YU1 A;  1KF6 A;  2DNX A;  2XQ6 A;  2FBW A;  2XZE A;  4AKG A;  2WDR A;  5HXE A;  2DCF A;  3HA4 A;  4WW0 A;  2MTQ A;  5BR8 T;  3ZMU B;  1KEY A;  1IJ5 A;  4HFB A;  5J1G A;  4I55 E;  3PUG A;  4A97 A;  3IHR A;  1KNZ A;  2EHO C;  4OYJ A;  5JQG E;  2YEV C;  4OK0 A;  5FXV A;  4DR2 T;  3K3O A;  4EED A;  3SOL A;  1ZP0 A;  2WY2 A;  5HWY A;  5FKY A;  3ZN1 B;  3ZMT B;  1M7K A;  1Z0P A;  3ZJ2 A;  5FXZ A;  2XHE B;  1QSD A;  5L3B B;  1ZKE A;  3ONX A;  2W00 A;  3B5M A;  4EYY R;  4DBR A;  4JI4 T;  5EZY E;  2BKN A;  3HKE E;  2YU2 A;  3I1A A;  3ZCJ A;  5IWA T;  3RGL A;  4LFB T;  4AKL A;  4TWD A;  1R8I A;  4ZOL E;  3Q5X A;  5HEO A;  1UGO A;  2KWI B;  2CHN A;  2X9W A;  1IJ6 A;  4LMK A;  1W0B A;  2CRB A;  4IT4 A;  1N33 T;  5DQV A;  3AE6 A;  5LBQ B;  2DLR A;  3PUZ F;  3LSV A;  2WU5 A;  4DR3 T;  2PG8 A;  4DUZ T;  1LRZ A;  4DR4 T;  3P50 A;  4JI1 T;  3CK6 A;  5LCY A;  1S35 A;  1D1A A;  3PJA A;  1AJ3 A;  3FZH B;  3ZMS B;  4UEM A;  2Q9Q C;  4MLK A;  1XWM A;  2WMO A;  4IL9 A;  4EOZ B;  3RIF A;  3JAE A;  4B6X A;  2V7I A;  4JYA T;  1MMD A;  4PJJ A;  4LML A;  3I0O A;  2M6I A;  3LFM A;  2YOE A;  4H63 V;  3WAK A;  1MNE A;  3AE2 A;  3EI0 A;  1IZN B;  5AQQ B;  2OLT A;  2VKJ A;  4IE6 A;  3ZKR A;  3CKD A;  2YDQ A;  1YKE B;  4NPP A;  3OTO T;  5AQK B;  2NP9 A;  2C0S A;  4Z90 A;  2J4G A;  3MA9 A;  2Y6X A;  4EYU A;  4LFC T;  1ZHC A;  1J1J A;  2K24 A;  3ZC0 A;  2XM1 A;  4ZS2 A;  3JCF A;  4H63 H;  4OFZ A;  5F5W A;  3RF1 A;  2XQ7 A;  4BJN A;  1XDO A;  1FJG T;  4CXX A;  2VWA A;  3KBT A;  5L4H A;  4DVD A;  1MIW A;  4YJ3 E;  5JR9 A;  5L3G B;  4YSZ A;  3UUB A;  3AXJ A;  5CJ5 A;  2DI4 A;  4JV5 T;  3VKG A;  3P4R A;  5LXT E;  3NBX X;  2KSR A;  5KMG P;  4HWH A;  3O4X E;  5J2T E;  3AE1 A;  5E0O A;  1VCT A;  1ZOY A;  2WU2 A;  3HKB E;  4K0K T;  2YN6 A;  5LOV E;  3QUJ A;  5JRC A;  5JDM A;  4L5G A;  2OV9 A;  2C5K T;  3C50 A;  2BG9 A;  2CLY C;  3UTK A;  2BKO A;  4MAL A;  2IUB A;  4NXM T;  3ONL C;  2I6H A;  3KVB A;  3PUV F;  2XQ3 A;  4Z8X A;  2BKP A;  2UUC T;  5IUX A;  5L3D B;  2JQQ A;  2XAG B;  2JJ9 A;  5LG4 A;  4WBN E;  5L4E A;  2JRK A;  2JQK A;  1XMO T;  1H7C A;  4DMW A;  2E9X B;  2BBJ A;  2WZI A;  1BR0 A;  3PU3 A;  3KV9 A;  1V9D A;  1FMW A;  2BVM A;  5ETW A;  5C2T A;  2LEH A;  4MFR A;  4ZEY A;  2XAJ B;  2XJ7 A;  4B3T T;  4YJ2 E;  1DU2 A;  5DJQ C;  2AXD S;  4JEU B;  4QH1 A;  4IL4 A;  4KMC A;  5DQW A;  3VR9 A;  3LBX A;  3KV4 A;  1WYB A;  3AEE A;  1MIV A;  3UUM A;  5J0Z A;  2ODV A;  4Q25 A;  3U78 A;  5HAX A;  3RYI E;  5LGN B;  2B76 A;  2V26 A;  1Z8U A;  1XDP A;  5H6Q B;  3AEF A;  3ZSS A;  3BQL A;  5L3C B;  4JI3 T;  3RC8 A;  2HN1 A;  1IBM T;  1QLB A;  3L39 A;  4HEA A;  4ZHQ E;  3QNU A;  2WAU A;  4F6R C;  3RYC E;  4GIW A;  3VU7 H;  2N2N A;  4KX6 A;  3N2K E;  2W63 A;  3N9P A;  4HN9 A;  3RYH E;  3AEG A;  3VKH A;  1UUS A;  1OED A;  2MOZ A;  1E7P A;  2D0U A;  3NZQ A;  3AVR A;  2RA1 A;  3K8P C;  3KFW X;  1XMQ T;  1E2A A;  4EIW A;  2ACZ A;  2OA5 A;  4DV5 T;  2V1D B;  4NXN T;  2D2S A;  2WCA A;  4UXN B;  1YQ4 A;  1KK7 A;  1SA0 E;  2QA7 A;  5M4Y A;  1O3X A;  4BAY B;  4HWI B;  3I0Q A;  4QXH B;  2XAS B;  5LNK A;  4QHO A;  1B7T A;  4I50 E;  3OYZ A;  3I9W A;  1WR0 A;  4TWH A;  3J7Y q;  4ZI3 C;  3A7M A;  5FY0 A;  2XTL A;  5FNV E;  4ILC A;  1SE7 A;  4ZXL A;  4OHF A;  4YY3 T;  1OWA A;  3UU3 A;  4IST A;  3GMI A;  4CZZ B;  3ZMV B;  3RKO A;  2BVL A;  3UQ7 A;  2BS4 A;  1BR1 A;  1CUN A;  5JDQ A;  4HE8 A;  2LSY A;  2E9X D;  2V6Y A;  2XSB A;  3GWH A;  4YSY A;  4OX9 T;  5AQM B;  4LF6 T;  1IBK T;  4V1A v;  3IA3 A;  1N34 T;  4TX5 A;  3HI2 A;  5AQI B;  1WRD A;  2WP9 A;  2YIN A;  4XZC A;  5IHY A;  3AA7 B;  3RRW A;  1WYC A;  4TV8 E;  2ZM8 A;  2LKH A;  3F2E A;  1G73 A;  1HNW T;  3O1I A;  1YQ3 A;  4COF A;  3AB3 B;  3N2G E;  4WNK A;  4YTN A;  4B3M T;  4EV6 A;  3GA8 A;  4E7Z A;  4O4J E;  2A72 A;  4JI6 T;  3DTO A;  2LOS A;  5F8P A;  3VHL A;  3J9X 1;  4CN6 A;  5HXC A;  2FJA A;  2FJD A;  3B57 A;  1XNR T;  2LLY A;  4P0A A;  2VAS A;  1CHU A;  3KIN B;  2WWV A;  3ZT5 A;  2IW5 B;  4QH5 A;  5ADX L;  2LJL A;  4H9R C;  2MAW A;  3ZLI A;  2KXP B;  2CEA A;  3CQG B;  1LKX A;  2E2A A;  1FIO A;  1HTJ F;  5AQH B;  4I0U A;  3E22 E;  3TLS A;  3SS1 A;  4P1N A;  3TKL B;  5LYJ E;  5JR9 B;  3EUH A;  3FHN A;  3AXJ B;  4U7Y A;  2LT3 A;  5HCJ A;  3OBV E;  2CWO A;  1G8X A;  4LF8 T;  2SPC A;  4X5T A;  1KNP A;  2XQA A;  2CXD A;  2HN2 A;  4JLE A;  3A8Y C;  5A1L A;  3PUS A;  5JRE A;  5JRC B;  2KT9 A;  2J47 A;  4XBF B;  2JQ9 A;  5FY7 A;  3QOF A;  4LF5 T;  1BR2 A;  3O9X A;  2BG9 B;  1UCU A;  3CX7 B;  3FZF B;  4PK5 A;  3M3Z B;  2C5I T;  3AE8 A;  1QUU A;  3RRC A;  4YHJ A;  4AQF A;  3FXE B;  4DV4 T;  1HNX T;  4KBM B;  4QXC B;  4CI3 B;  2GK9 A;  2V7J A;  2LSJ A;  2CM0 A;  3UU6 A;  2WDQ A;  5LJM A;  1I94 T;  3PUY F;  4QX8 B;  2Y8D A;  5LB7 B;  3BQK A;  4IDO A;  2N1G A;  2ODU A;  2NTY A;  4A98 A;  4U7I A;  1T8B A;  2VVS A;  2XY8 B;  3LBX B;  3RIU C;  2ZM0 A;  4LF9 T;  2AE9 A;  4EZ4 A;  3N5L A;  3PDY A;  5FY1 A;  4HFC A;  4DUY T;  2ES0 A;  4JUY A;  4X20 E;  1WR6 A;  3P8C D;  1D1C A;  1OED E;  3MKD A;  2UUB T;  2LM9 A;  5AQP B;  2WS3 A;  2LHR A;  1YXR A;  4LMJ A;  4O2A E;  3R84 B;  2X0L B;  2XAQ B;  1MMG A;  4EGW A;  2IAK A;  2QVA A;  4FI5 A;  4DND A;  2LRL A;  2V7M A;  3P4Q A;  4KI0 F;  3HKC E;  3GN5 A;  5HEG A;  1OED B;  5KDM C;  3CVR A;  5FVL A;  2H89 A;  3ZT7 A;  1SHZ C;  2LSG A;  2X67 A;  2VL0 A;  4L0R A;  5FMN A;  4TNV A;  4DR7 T;  1HG2 A;  5ABF A;  3AVS A;  1Y64 B;  5FYM A;  3N9Q A;  3MZK B;  4JI8 T;  5C8Y E;  2XAF B;  2IC6 A;  2EHO A;  2VQE T;  3N9L A;  4AI6 A;  3KV6 A;  3O1H A;  5F3J A;  2R6G F;  2K3W A;  2V5D A;  3UU8 A;  2X9Y A;  3O1J A;  5HEJ A;  2L3L A;  3FZK B;  5HXS A;  4GYR A;  5ABH A;  2E5L T;  4GKK T;  2NW7 A;  5AQJ B;  3NWI A;  2WWU A;  2PJQ A;  1US7 B;  2WDV A;  3RC3 A;  2V6Y B;  4Z91 A;  3SFE A;  2Q9Q D;  3CIR A;  4I43 B;  1J5W A;  2H88 A;  5AFU L;  1FMV A;  4DID B;  3WAJ A;  1NEN A;  4X65 T;  3EVY A;  4PW8 A;  3MJX A;  4PNI A;  3VRB A;  5AQL B;  2G0U A;  2W2U A;  1MMA A;  2DWK A;  1WCR A;  3KV5 A;  2IC9 A;  4P09 A;  4DV0 T;  3UU4 A;  3AEB A;  4O2B E;  4IDN A;  3OYX A;  4ILB A;  4ILA A;  5KXJ A;  2H7V C;  2VL8 A;  2J1D G;  3T1Y T;  3RX6 A;  5JTG A;  1SUM B;  4CN1 A;  3ZYL A;  5EK3 A;  5AQG B;  1N32 T;  2M67 A;  5TAO A;  2UXD T;  4JBW F;  4EAH A;  2Q9Q A;  3AAI A;  2XAH B;  3ZMZ B;  2MBG A;  3QC9 A;  3KDS E;  4UIG A;  2CBJ A;  4H9Q C;  1LVK A;  4UV8 B;  2NTX A;  4TN7 B;  1W0A A;  5ABE A;  2X9X A;  2V7L A;  3SFD A;  5LHG B;  2ZMA A;  1I6Z A;  4YFS A;  1HR0 T;  2FJE A;  3T1H T;  2LSK A;  4ZS3 A;  2N9D A;  3AE7 A;  2IHR 1;  3AE4 A;  2E8I A;  2H3R A;  4P0B A;  2D0T A;  3ZYK A;  3LK4 2;  3Q5D A;  3IBP A;  3P7I A;  3H3M A;  4GKJ T;  3L09 A;  3NRY A;  5LGT B;  4X1Y E;  3T8O A;  1MND A;  4N78 D;  1EZ3 A;  3G06 A;  5JDL A;  3SRZ A;  4IIJ E;  4U2Z A;  4ZZB A;  2XSA A;  4HFH A;  2VKO A;  4PJN A;  3P4S A;  5AQF B;  3C98 B;  4DO0 A;  4UVC B;  4EB6 E;  1VRB A;  4CI2 B;  4EEB A;  4KP3 C;  4TNW A;  4AKR B;  2CA5 A;  5FXW A;  3JC6 D;  3Q2M A;  3RI5 A;  4OYK A;  1MIY A;  2E9X C;  4ZI2 D;  2FUP A;  2WMN A;  5JDN A;  2B1E A;  2XQY A;  4MBQ A;  1D1B A;  2WQY A;  4K0U A;  4HWF A;  4I4T E;  2JQH A;  4JEH B;  1IAP A;  2RP4 A;  2W61 A;  2UXN B;  5CFB A;  3RPU A;  3AAA B;  2HH7 A;  2VK9 A;  4TZ4 C;  2IDO B;  3OKQ A;  2UU9 T;  1UUR A;  3IF8 B;  3SWH A;  4IE5 A;  2X66 A;  3NKZ A;  2W4X A;  3OVU A;  2UXC T;  4TUY E;  1JNR A;  1KNR A;  3ETV A;  1L0V A;  2KZ7 B;  4DR1 T;  3RIA A;  4XAX B;  5LG3 A;  2KLQ A;  5CGM A;  1HS7 A;  2RPA A;  3UT5 E;  5LMN T;  3B13 A;  1Y01 A;  4HTE A;  3GN5 B;  3RKG A;  3LG7 A;  2NW8 A;  4DV2 T;  2WB5 A;  3CQX C;  4KHP T;  2LSI A;  2LKG A;  2DWG A;  3TLU A;  3M65 A;  2CBI A;  3DP7 A;  1GQE A;  2H7O A;  5ABF B;  4G2A A;  3AE5 A;  4QXB B;  3ESL A;  4ERR A;  5FVK A;  2KWH A;  4CN4 A;  2EHO B;  1S94 A;  5FXX A;  4JI7 T;  3Q5W A;  3AA0 B;  4UV9 B;  3ONJ A;  4H9O C;  2W66 A;  2NWB A;  3AAE B;  4GK5 E;  1NWM X;  4FJO A;  1NAF A;  4YHH T;  3TLV A;  4DR6 T;  4G63 A;  4U72 A;  3ZN0 B;  2V8S V;  3CPZ A;  4PJL A;  3UU5 A;  2NR4 A;  5IYZ E;  3CML A;  3ZJ1 A;  3RQU A;  3U3I A;  5BMV E;  3CWZ B;  2W67 A;  3RQW A;  3S4U A;  2BG9 E;  5FL1 A;  3K3N A;  2VKD A;  3C4W A;  4IE7 A;  2WM9 A;  4DV6 T;  4HWD A;  3CX6 B;  5AQR B;  2J62 A;  2NOX A;  3AE9 A;  5LHI B;  5JDF A;  5HXR A;  4TWF A;  2Y48 B;  4ZI7 E;  3H37 A;  4LF7 T;  4QH4 A;  5HWX A;  2LRK A;  4KHZ F;  4U74 A;  3ZEF B;  3WI3 A;  1XNQ T;  1E1H B;  5DAB A;  1M62 A;  4WBO A;  1FEW A;  4KUM B;  1VCS A;  2Q9Q B;  3MXZ A;  2NW9 A;  4DR5 T;  3DJB A;  4PFO A;  4QX7 B;  4HKA A;  4AIU A;  2X68 A;  1T7S A;  4YTP A;  3KVA A;  3R6N A;  4ILU A;  1HG5 A;  3ZST A;  3AA6 B;  5HYA A;  3F31 A;  4DBQ A;  5L47 A;  1JNZ A;  2BBH A;  3N2O A;  2V5C A;  2JMH A;  4B3R T;  5JR9 C;  4YSX A;  3ETU A;  5ABG A;  1HX8 A;  4C91 A;  2LOP A;  4CQI A;  2EHO D;  2BDE A;  5LHH B;  3HL6 A;  3EAM A;  4BA9 A;  1NEK A;  3QB5 K;  4HFI A;  5EK2 A;  3ZCI A;  4L9I A;  4O4L E;  2CCQ A;  2UXB T;  3C51 A;  1U5P A;  2BG9 C;  4IRE A;  5EK4 A;  5CA1 E;  2PTF A;  2QRX A;  2A9U A;  4UF0 A;  1W09 A;  1T72 A;  4DMV A;  3CQC B;  2M6B A;  5JDH A;  3RHW A;  4NIQ A;  3HR0 A;  2LHN A;  4YLH A;  4HFV A;  3ANW A;  2CLY B;  2PBI A;  3N9O A;  3D0T A;  1D0X A;  4A56 A;  3UFE A;  4AXP A;  5GON E;  5LA6 E;  2JPF A;  4X64 T;  4AQG A;  4IE0 A;  5AQO B;  2L9Q A;  4IDQ A;  1WLX A;  4J2C A;  2YKS A;  3BK9 A;  3PTR B;  3ZYM A;  1X9B A;  4UVB B;  2ZM6 T;  2PFV A;  5C3J A;  3ABV A;  3PJA J;  3PUA A;  4ZZC A;  4H9S E;  1XZY A;  3L8R A;  3K3Q C;  5HEU A;  3MAC A;  4AIS A;  4U2Y A;  5LMU T;  4U33 A;  4PFP A;  3UFG A;  1YW0 A;  2CMR A;  2XM2 A;  4HFD A;  3PUW F;  3LDQ B;  5AQT B;  2I0M A;  2X0H A;  3QK6 A;  4X62 T;  3EDU A;  3PE0 A;  3CX8 B;  3N9M A;  4ADZ A;  1UX4 A;  2HHH T;  4JI0 T;  1D0Z A;  3RIU A;  3V5U A;  1KFY A;  2IML A;  4DV3 T;  4E7S A;  2QGS A;  3C4Z A;  3RYF E;  2VB6 A;  3TLT A;  5AQV B;  3VRA A;  1OED C;  2K48 A;  3K1S A;  1W9R A;  3EDV A;  3NVO A;  1HFA A;  3AE3 A;  5LP6 E;  4O4I E;  4AKI A;  4A5X A;  2JIW A;  5AQS B;  3Q9D A;  3FBZ A;  4CXW A;  5HXH A;  4IDP A;  4C90 A;  2KIN B;  4IHJ E;  2A3D A;  3OPC A;  1UX5 A;  2W0G A;  3C64 A;  3VR8 A;  2VUR A;  1VOM A;  2XQ4 A;  4DV7 T;  4PJM A;  3H3A A;  2BZB A;  2FJB A;  4PK4 A;  4GK0 E;  1N36 T;  2KMF A;  1LVF A;  2A2F X;  2DHR A;  4GOU A;  2BS2 A;  2V6X A;  4AQY T;  3JC6 C;  5LGU B;  2K5B B;  3E08 A;  1X79 A;  1WFD A;  3Q5E A;  3UUN A;  2BS3 A;  2XQ9 A;  4ZI2 C;  2CHO A;  4QWN B;  5CB4 E;  5KX5 E;  4ANJ A;  2UUA T;  3IEE A;  1HF8 A;  3I9Y A;  4QKN A;  3LK2 B;  4NUV A;  2VQF T;  4NUU A;  2XQ8 A;  3X1D A;  4AKH A;  2ACX A;  2MPK A;  2WBL A;  3PUX F;  2XUE A;  3NRX A;  5LJN A;  2XQ5 A;  2W62 A;  3KBU A;  5J2U E;  3FB2 A;  5FL0 A;  1OXZ A;  5JVD E;  4ISS A;  2I59 A;  2K9A A;  4B3S T;  1UK5 A;  4HFE A;  4M1P A;  3E0Z A;  5LBM A;  3JAD A;  1J5E T;  5AQN B;  2IIU A;  4EXT A;  3QB5 A;  3EAB A;  2UXX B;  1D0Y A;  1T98 A;  3PU8 A;  4YXD A;  1IBL T;  3LJC A;  4ASK A;  2WSS V;  4U3C A;  3HKD E;  2YDS A;  4UVA B;  3L3P A;  2C5J A;  2LM2 A;  3F57 A;  4TV9 E;  2JMK A;  5JDG A;  3AA1 B;  4CI1 B;  1ZEE A;  3ZC1 A;  4PAG A;  1MMN A;  4JI2 T;  3FZL B;  4MHC A;  2E5V A; 
#chains in the Genus database with same CATH homology
 2CPT A;  2DL1 A;  2LRL A;  3ZT6 A;  2V6Y B;  4CN1 A;  2LRK A;  2WWV A;  3ZT5 A;  1WR0 A;  2CRB A;  1YXR A;  4ZEY A;  5CGM A;  2JQK A;  2V6X A;  2RPA A;  4P1N A;  2A9U A;  4IT4 A;  5CJ5 A;  3EAB A;  5FVL A;  4U2Z A;  3ZT7 A;  4A5X A;  1WFD A;  2JQ9 A;  2JQH A;  5FVK A;  5LB7 B;  4WZX A;  3ZSS A;  4CN4 A;  2V6Y A;  3K1S A;  4U31 A;  2K3W A;  4U7Y A;  4CN6 A;  2XZE A;  2MPK A;  3ZST A;  4NIQ A;  4U2Y A;  4U7I A;  4U3C A;  2W2U A;  4U33 A;  2WY2 A;  1WCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...