4WZXA

Ulk3 regulates cytokinetic abscission by phosphorylating escrt-iii proteins
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
87
structure length
87
Chain Sequence
TSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEYLKEQVKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Serine/threonine-protein kinase ULK3
total genus 38
structure length 87
sequence length 87
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4wzxA01
2CRBA 1YXRA 3EABA 2WWVA 5FVLA 2RPAA 3K1SA 3ZT7A 2JQ9A 2LRLA 2JQKA 2W2UA 2A9UA 1WFDA 3ZSSA 2JQHA 2MPKA 4U7IA 3ZT6A 4A5XA 5CGMA 2XZEA 4CN4A 4U33A 4U7YA 4NIQA 4CN6A 4U2YA 3ZT5A 5CJ5A 2V6XA 4U31A 4P1NA 4ZEYA 3ZSTA 2K3WA 4U3CA 2WY2A 1WCRA 2CPTA 2V6YA 2V6YB 5LB7B 2DL1A 4WZXA 4IT4A 4CN1A 5FVKA 4U2ZA 2LRKA 1WR0A
chains in the Genus database with same CATH superfamily
4K0KT 4PAGA 3Q5EA 4L5GA 4ZI3D 2FJDA 3UTKA 1I6ZA 3MK7C 3N2OA 3RGLA 5EK2A 2LHNA 3NVOA 2BG9C 4PJJA 3RIUC 3AEGA 1E2AA 2XSAA 4TZ4C 3UUBA 2V7LA 2MBGA 5FY0A 4DUZT 5AQRB 1E7PA 3FXEB 4UVCB 3ZMZB 3QB5A 3S4UA 5HXSA 3GMIA 5BR8T 2AXDS 3HKEE 3ZMSB 1JNZA 1UCUA 3CQXC 3EI0A 4QXCB 2J1DG 3ZT5A 4YTNA 2Y8DA 3QC9A 4LFBT 2DWGA 1UGOA 4B3MT 2V7JA 4YTMA 1ZV4X 4O4JE 2ODVA 2N2NA 1VRBA 3MJXA 4H9NC 2KLQA 5F8PA 1OXZA 1YQ4A 4C91A 3CX6B 2Q9QD 3LFMA 5JDFA 5ABEA 3WAJA 5LMNT 3A5XA 4ZI3C 4BJMA 2A2FX 3RI5A 4DV7T 3RPUA 3HKCE 3AA7B 4IREA 4TNVA 4MALA 4KP3C 2WWVA 1FJGT 4NXNT 2M67A 3AVSA 5GONE 3P4PA 5AQPB 1N33T 4HEAA 3TLTA 4DR2T 1W0AA 3C64A 2EHOB 1UX5A 4MHCA 3PTRB 4TX5A 4U33A 2QVAA 1D1CA 3HR0A 1XDPA 4NIQA 4Z90A 3AAEB 4U2YA 5AQMB 3O1HA 4DVDA 3OBVE 3O9XA 2CLYB 2VL8A 3CX8B 3BQLA 2CWOA 3N9LA 4JEUB 4KUMB 5AQIB 3DP7A 3UU6A 2K3WA 2BDEA 2XAGB 4EYYR 1D1BA 2HN1A 4GK0E 2E5VA 2XASB 4IE6A 1B7TA 3ABVA 2EHOD 1H7CA 3GA8A 4YXDA 2B76A 4WZXA 3PUVF 2VQET 2CBJA 4O2BE 2QYWA 2V7IA 3CQCB 2OLTA 3RYIE 1BR2A 4Q25A 2X51A 2VQFT 2YK0A 4YSXA 3ANWA 2ZM8A 3K3NA 4HFVA 5LYJE 4KHPT 2PG8A 3D0TA 2YDRA 3C4WA 3PV0F 2WZHA 4GYSA 4HWCA 4LF8T 3AE1A 3J9X1 2ODUA 3N5LA 2PFVA 4CZZB 2H7OA 3MKDA 4NUVA 2LJLA 4XBFB 1VOMA 3AE8A 4GK5E 1EZ3A 2YN6A 2VASA 2IIUA 2FJEA 1T98A 2OV9A 5L3EB 5LGTB 4H9PC 3T1HT 2DI4A 3PJAA 5LBQB 5LOVE 3PUZF 2XQYA 2C5KT 4ZEYA 3ZSTA 5AQFB 4P0AA 1T8BA 5L3DB 1HF8A 1HNXT 2ES0A 4UF0A 3TLSA 5JR9B 1HX8A 1KF6A 2IC6A 2V6YA 4YJ3E 4HWFA 2E9XB 2IMLA 4KI0F 1FEWA 3L39A 3JAEA 4FJOA 2X67A 3FHNA 4H63V 2CXLA 2XM1A 3FZFB 4LMKA 2CCQA 4X5TA 3T8OA 3SWHA 2LEHA 4ZZCA 4JI1T 4PJNA 2V26A 4TWDA 5TAOA 1OEDE 2NR4A 5ETWA 5LBMA 3LBXA 3ZYLA 3PJAJ 4DMVA 3AEEA 4UIGA 1MNDA 2X9YA 3ZT7A 4H9QC 3TLUA 4DO0A 2ZMAA 4ILBA 3ZSSA 1ZHCA 3MXZA 5FXZA 3VRBA 2LSYA 3ETVA 4UVBB 2C5IT 2QA7A 3B13A 4CN4A 4MBQA 4DV6T 3I0QA 2XAJB 4AQFA 5DJQC 5FL0A 3NRYA 3ONLC 2D0UA 2W00A 2LSJA 4XAXB 2CXFA 4UVAB 3G06A 5FY7A 4HTEA 1ZKEA 5CA1E 4Z8XA 5LCYA 4ZS3A 2JJ9A 3TLWA 4ZS2A 4UF0B 3RHWA 2WWUA 2V7KA 3IA3A 5HXCA 4WBNE 3GN5B 2WP9A 2RA1A 2WDRA 4UR9A 3ZPOA 3RH3A 4QXBB 2I59A 3LK2B 3P50A 4TUYE 4U2ZA 4YHJA 4IE0A 2BG9B 2BZBA 3SRZA 2BG9E 3RIFA 3RKGA 3MA9A 1FMWA 1S35A 5AQKB 1XMQT 2D9DA 4KHZF 2JQ9A 2SPCA 3T1YT 3IF8B 5L3CB 3BQIA 2W2UA 2XQAA 3ZC1A 1W0BA 3UQ7A 2WMOA 3AXJB 3LJCA 3I0OA 4HFDA 4ASKA 2B1EA 3UU5A 4BAYB 2HPJA 2W67A 3KV9A 2NTYA 4EXTA 2WS3A 1UURA 2QGSA 2IDOB 3F2EA 3H3AA 3AECA 1ZP0A 3IHRA 5HEUA 3L8RA 4DBRA 3KVAA 3QUJA 4JI8T 2JRKA 4EYUA 1WCRA 3OJAA 4TV8E 2VVNA 2F4VT 2XQ7A 2J47A 5HWXA 1J5WA 2D0TA 4MFRA 4UV9B 1YW0A 3AAAB 3M65A 2NTXA 3C4ZA 2CMRA 5HEOA 4A56A 4YT0A 4H63H 2X9WA 1E1HB 2A72A 3FZKB 2NOXA 3P4SA 3P4RA 5JR9C 2EHOC 1O3XA 2D2SA 2LSKA 4PJLA 5AQVB 3JC6D 3V5UA 2FJBA 3AE6A 5IYZE 4K0UA 4GKKT 4IDQA 2P9BA 2CE7A 3LK3B 2HH7A 4H9RC 4N78D 4P0BA 4DV1T 2Q9QA 3CX7B 5JTGA 1XMOT 1N36T 2VKJA 3KBTA 3GWHA 3AA6B 2V6XA 1XWMA 4U31A 4Z91A 1MMAA 2LKHA 3PE0A 1KFYA 2XQ9A 3B57A 4MLKA 4QH4A 4DMWA 5A1LA 4B3ST 4JI6T 4QX8B 2VKOA 5C2TA 3ONXA 2CPTA 4WBOA 2V6YB 2E5LT 4DR4T 5LG3A 3FZHB 5JRCA 2MYSA 1MNEA 2Q9QB 5HXRA 5AQSB 4PFOA 2HPLA 2HN2A 4AKRB 3RYHE 3JCFA 4F8HA 3NZPA 1UUSA 1LVFA 2BS4A 2RPAA 2VWAA 5HEGA 5LJNA 1SA0E 3DJBA 3MZKB 1YKEB 2E8IA 2IUBA 4U72A 1SE7A 2MAWA 2E9XA 2X66A 3KV5A 2LOSA 2VVSA 3LBXB 2K48A 2MPKA 4U7IA 4JI0T 2X0LB 5H6QB 5FNVE 1SUMB 5M4YA 5IWAT 3L09A 3R6NA 4TV9E 5LXTE 2WM9A 5BMVE 2CM0A 1W09A 3E22E 1IAPA 2XAFB 3Q5XA 3KBUA 3H3MA 4I55E 2W63A 1MIYA 3PUXF 5FY1A 4H9SE 4AIUA 4LF4T 3N2KE 1ZEEA 2PBIA 4V1Av 2LM9A 3RYFE 5JDQA 4DV4T 1IBMT 4NXMT 3VKHA 2C0SA 2FUPA 2LE8A 4PW8A 5ABFB 4WYVA 1KNRA 2CBIA 3ZKRA 5EK4A 5CB4E 2WU2A 4DR6T 2XSBA 4X1YE 3GN5A 5JQGE 4QX7B 2H88A 3N9PA 3Q5WA 3K3QC 3CK6A 2WDVA 4LMJA 1U5PA 4NPPA 4IHJE 4X20E 5EZYE 5LHHB 2UUBT 4DR1T 2PJQA 4IDNA 3LSVA 2HHHT 5CA0E 3K8PC 4J2CA 3MACA 2MOZA 5IHYA 3ZN0B 4B6XA 1D0XA 3OTOT 2DWKA 3AXJA 1MIWA 2UUAT 2UUCT 4AQGA 4HWHA 5JH7E 4AQFC 3KV6A 5AFUL 2W66A 4E7ZA 4CI1B 3PUAA 3LDQB 4ZI2C 1QSDA 3R84B 1HG5A 2ACZA 2YU1A 3WI3A 2UXCT 1YQ3A 2I0MA 2UXXB 3OVUA 2IC9A 3UU8A 5JDLA 5ABGA 2CHNA 3UUXB 2XQ4A 4ZOLE 4GKJT 3I9WA 2WB5A 1L0VA 2RP4A 3KVBA 5DQVA 5C8YE 3AVRA 3JADA 2H7VC 2JIWA 2N1GA 2W61A 4HWDA 3N9OA 3K3OA 2XAHB 3PU8A 4JI7T 4TNWA 5FXVA 1WR0A 2KNDA 4HN9A 2LSIA 4O4IE 4CXYA 1IBLT 4JI3T 4PK5A 2VKDA 1N32T 3EHZA 4EOZB 3RF1A 2NWBA 5FP3A 2Q9QC 3KINB 2LKGA 3EUHA 1W9RA 1XDOA 2YDSA 3CMLA 2JQKA 1T72A 1Y64B 3KV4A 4AXPA 4DV2T 1MMNA 4G63A 5LJMA 4DV0T 1HG2A 2BS3A 1KNPA 4ZXLA 4ISSA 2DCFA 2L8KA 4QXHB 2XQ5A 2UXDT 1GQEA 4QWNB 4JI2T 3ZLIA 2EHOA 1NWMX 3RQWA 3X1DA 5CJ5A 1Y01A 1NEKA 3UULA 1N34T 4L0RA 2DNXA 3RRWA 2KMFA 2VK9A 2WY2A 5IUXA 3L3PA 4PNIA 5AQGB 4HWIB 5FMNA 5L3FB 4XZCA 2A3DA 1BR4A 2XHEB 3FZLB 3NZQA 3AEBA 1LKXA 1NAFA 1ZOYA 2CLYC 1MMDA 3OYZA 4IL4A 4IT4A 4JUYA 2ZLYA 4WNKA 2WMNA 5FVKA 3F31A 1G73A 2YU2A 3DTOA 5EK3A 2CRBA 3W15B 3IBPA 3PURA 3UUNA 2CA5A 2LLYA 1R8IA 2CHOA 2YDQA 3Q9DA 3OKQA 4NUUA 4QH5A 4QHOA 2UU9T 1X79A 2CWYA 3ZMVB 4EAHA 2OA5A 4E7SA 2J62A 2NW8A 5LNKA 1JNRA 1WFDA 3CIRA 3O1JA 4DR3T 3ZT6A 5J2UE 3UUMA 4HFHA 1UK5A 5HXEA 4CXWA 4UXNB 4CQIA 4JV5T 5HEHA 3U3IA 3PUYF 3ZYMA 4P1NA 4ISTA 3H37A 4CI3B 3E08A 3PU3A 4JBWF 4DIDB 1I94T 2VKHA 3IEEA 2BBJA 1T7SA 2V5CA 4FI5A 4YSZA 4LFAT 2WZIA 3JC6C 1HTJF 2K9AA 4H9OC 5FKYA 4AKHA 4I4TE 2VL0A 1WYCA 4IE5A 1IJ5A 1D0ZA 3CVRA 4CN1A 3P4WA 1FIOA 2VURA 2X68A 3CKDA 1FMVA 3NBXX 3NKZA 3AEDA 4ADZA 1D1AA 5ABFA 1MMGA 4JLEA 1HNWT 3M3ZB 3HKBE 3QOFA 3QNUA 3ETUA 3RKOA 1MIVA 1YKHB 2J4GA 5JDMA 4AKIA 2L3LA 2WQYA 3AE4A 3LG7A 3AEAA 2YINA 3QB5K 4OX9T 3SOLA 4DV5T 3C4XA 2XZEA 3FB2A 3O1IA 4WW0A 2BG9A 2LM2A 2WAUA 2LHRA 3EDVA 3F57A 4TWFA 4U74A 4HFBA 3UU4A 5ABHA 5AQTB 3VR8A 4UEMA 2NW7A 5CFBA 4QKNA 2V8SV 2KSRA 2UXNB 2BKPA 3AA0B 4YJ2E 4YTPA 1S94A 4DV3T 5F5WA 2XY8B 3ZCJA 4OFZA 5J0ZA 1YD8G 2XM2A 3ZN1B 2D5UA 4BJNA 1HNZT 4JYAT 4AKGA 1DU2A 2KWHA 4YFSA 3B5MA 4UELA 1J1JA 4CI2B 1X9BA 3HA4A 1HFAA 2X9HA 1BR0A 4EV6A 2XQ6A 4ERRA 2FJAA 4DNDA 3O4XE 5ADXL 5KXJA 5HXHA 2BS2A 4EIWA 4ZI2D 3EABA 2PTFA 1NENA 3RIAA 5JDHA 5LGUB 2M6BA 2V1DB 3AAIA 3BK9A 4HFIA 1KEYA 1U4QA 2MTQA 1LVKA 3AEFA 2CEAA 3ZEFB 3A7MA 2IW5B 5J2TE 2A9UA 3BQKA 3N9NA 4HGAA 4PK4A 4G2AA 1SHZC 4IE7A 2LSGA 1QUUA 3AE9A 3AE3A 4IDOA 1J5ET 3UFEA 1KK7A 4QH1A 3AB3B 4UV8B 3ZJ2A 4PK6A 4HFCA 4YLHA 4B3TT 1HS7A 2BKNA 4KX6A 2XAQB 2WSSV 5L2LA 4AKLA 2W4XA 4GYRA 2JMHA 2WU5A 4P09A 1XNRT 4O4HE 4KMCA 3RQUA 3U78A 4LF9T 1M7KA 2QRXA 2BBHA 2DLRA 5HWYA 3C50A 3VR9A 4ZHQE 2W62A 2IHR1 5HCMA 3ZYKA 1WLXA 5DABA 5AQLB 4B3RT 3Q2MA 4X64T 3PUWF 3UT5E 1IJ6A 2WBLA 2K24A 3ZCIA 5HEJA 2KXPB 4O4LE 4YY3T 3ZJ1A 4YSYA 1HCIA 4IDPA 5FL1A 3KFWX 5AQQB 2Y48B 2X9XA 4I50E 5AQJB 1VCSA 3PDYA 5LP6E 4F6RC 4M1PA 3P7IA 4X1IE 5LMUT 3ZMUB 1KNZA 2XJ7A 3PUSA 4AI6A 3AE5A 3CWZB 2KWIB 4IE4A 2G0UA 5AQHB 5LHGB 3Q5DA 4DR7T 5L3GB 5HAXA 2M6IA 3SFDA 3I9YA 3RX6A 1OWAA 2XQ8A 4AISA 2IAKA 3RLFF 1OEDB 4EEBA 4IGUA 1VCTA 3CQGB 2H89A 4HFEA 4KBMB 1Z8UA 5L4HA 3TLVA 4LFCT 3FZMB 3HI2A 3KDSE 3P4QA 3V5SA 4A98A 5LG4A 2NP9A 5KX5E 1OEDA 1CHUA 1YXRA 5JRCB 5FVLA 3ZC0A 5AQOB 5LHIB 2JMKA 3C51A 4IIJE 1IZNB 4JI5T 3CPZA 2E2AA 2LRLA 1HR0T 5LA6E 4OYJA 3J7Yq 2V7MA 4GOUA 4X1KE 4COFA 3SFEA 4EZHA 1V9DA 3AE2A 1XNQT 5KMGP 1BR1A 3RIUA 4LF5T 1M62A 5C3JA 3E0ZA 3TKLB 4EEDA 3WAKA 5JREA 4EZ4A 2LOPA 1OEDC 2XQ3A 3P8CD 3EDUA 1WR6A 5FXWA 4DR5T 1D0YA 3VRAA 4GIWA 4OHFA 3RRCA 2E9XD 4ILUA 1UX4A 4OK0A 4I43B 4YHHT 4CXXA 3UFGA 2ZM2A 1IBKT 5LGNB 5L3BB 5JDGA 2ZM6T 3N9QA 3N2GE 5KDMC 1US7B 3LK42 2N9DA 4I0UA 4PJMA 2CXDA 2K5BB 2FBWA 2KZ7B 3C98B 5J1GA 2JQHA 2I6HA 5H6RB 4JEHB 2NW9A 5CGMA 2GK9A 4CN6A 2C5JA 4HKAA 5L47A 2BVLA 2YEVC 3PUQA 4OYKA 4LF7T 3ANWB 3HKDE 5JR9A 2KT9A 2E9XC 3QK6A 4ANJA 4IL9A 4C90A 4X66T 2AE9A 4DUYT 4U3CA 1G8XA 5L4EA 3OYXA 4JI4T 2BKOA 2XUEA 4ILAA 4X65T 4BA9A 3NWIA 5AQNB 5LB7B 2UXBT 1Z0PA 2Y6XA 2YOEA 4HE8A 2WCAA 4PFPA 4TN7B 3PUGA 2V5DA 3HL6A 3I1AA 2JQQA 4ZI7E 2ACXA 5DQWA 5AQUB 4O2AE 5HYAA 2XTLA 2DHRA 1WYBA 2VB6A 3AA1B 3K1SA 3ONJA 1XZYA 3VU7H 2YKSA 5JVDE 3UU3A 2Z6EA 5JDNA 3RC8A 4TWHA 4X62T 3VKGA 5E0OA 4EGWA 2X0YA 4EB6E 3NRXA 2LT3A 2WDQA 3A8YC 2L9QA 5F3JA 3OPCA 2R6GF 4A5XA 4L9IA 1WRDA 4LMLA 1CUNA 3EVYA 3FXDB 3VHLA 3ZMTB 4LF6T 1LRZA 1AJ3A 4U7YA 4DBQA 2KINB 4IDZA 3AE7A 1HX1B 5FXXA 3N9MA 4ZZBA 3SS1A 3ESLA 2X0HA 2XPKA 5HCJA 2BVMA 1QLBA 2DL1A 2JPFA 5FYMA 3RC3A 3JAFA 3EAMA 2ZM0A 4ILCA 4A97A 3FBZA 3RYCE 3FBLA 4AQYT 2H3RA 3UQ4A 2LRKA 4O8SA 2W0GA
chains in the Genus database with same CATH topology
2CRBA 1YXRA 3EABA 2WWVA 5FVLA 2RPAA 3K1SA 3ZT7A 2JQ9A 2LRLA 2JQKA 2W2UA 2A9UA 1WFDA 3ZSSA 2JQHA 2MPKA 4U7IA 3ZT6A 4A5XA 5CGMA 2XZEA 4CN4A 4U33A 4U7YA 4NIQA 4CN6A 4U2YA 3ZT5A 5CJ5A 2V6XA 4U31A 4P1NA 4ZEYA 3ZSTA 2K3WA 4U3CA 2WY2A 1WCRA 2CPTA 2V6YA 2V6YB 5LB7B 2DL1A 4WZXA 4IT4A 4CN1A 5FVKA 4U2ZA 2LRKA 1WR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRB A;  1YXR A;  3EAB A;  2WWV A;  5FVL A;  2RPA A;  3K1S A;  3ZT7 A;  2JQ9 A;  2LRL A;  2JQK A;  2W2U A;  2A9U A;  1WFD A;  3ZSS A;  2JQH A;  2MPK A;  4U7I A;  3ZT6 A;  4A5X A;  5CGM A;  2XZE A;  4CN4 A;  4U33 A;  4U7Y A;  4NIQ A;  4CN6 A;  4U2Y A;  3ZT5 A;  5CJ5 A;  2V6X A;  4U31 A;  4P1N A;  4ZEY A;  3ZST A;  2K3W A;  4U3C A;  2WY2 A;  1WCR A;  2CPT A;  2V6Y A;  2V6Y B;  5LB7 B;  2DL1 A;  4WZX A;  4IT4 A;  4CN1 A;  5FVK A;  4U2Z A;  2LRK A;  1WR0 A; 
#chains in the Genus database with same CATH topology
 4K0K T;  4PAG A;  3Q5E A;  4L5G A;  4ZI3 D;  2FJD A;  3UTK A;  1I6Z A;  3MK7 C;  3N2O A;  3RGL A;  5EK2 A;  2LHN A;  3NVO A;  2BG9 C;  4PJJ A;  3RIU C;  3AEG A;  1E2A A;  2XSA A;  4TZ4 C;  3UUB A;  2V7L A;  2MBG A;  5FY0 A;  4DUZ T;  5AQR B;  1E7P A;  3FXE B;  4UVC B;  3ZMZ B;  3QB5 A;  3S4U A;  5HXS A;  3GMI A;  5BR8 T;  2AXD S;  3HKE E;  3ZMS B;  1JNZ A;  1UCU A;  3CQX C;  3EI0 A;  4QXC B;  2J1D G;  3ZT5 A;  4YTN A;  2Y8D A;  3QC9 A;  4LFB T;  2DWG A;  1UGO A;  4B3M T;  2V7J A;  4YTM A;  1ZV4 X;  4O4J E;  2ODV A;  2N2N A;  1VRB A;  3MJX A;  4H9N C;  2KLQ A;  5F8P A;  1OXZ A;  1YQ4 A;  4C91 A;  3CX6 B;  2Q9Q D;  3LFM A;  5JDF A;  5ABE A;  3WAJ A;  5LMN T;  3A5X A;  4ZI3 C;  4BJM A;  2A2F X;  3RI5 A;  4DV7 T;  3RPU A;  3HKC E;  3AA7 B;  4IRE A;  4TNV A;  4MAL A;  4KP3 C;  2WWV A;  1FJG T;  4NXN T;  2M67 A;  3AVS A;  5GON E;  3P4P A;  5AQP B;  1N33 T;  4HEA A;  3TLT A;  4DR2 T;  1W0A A;  3C64 A;  2EHO B;  1UX5 A;  4MHC A;  3PTR B;  4TX5 A;  4U33 A;  2QVA A;  1D1C A;  3HR0 A;  1XDP A;  4NIQ A;  4Z90 A;  3AAE B;  4U2Y A;  5AQM B;  3O1H A;  4DVD A;  3OBV E;  3O9X A;  2CLY B;  2VL8 A;  3CX8 B;  3BQL A;  2CWO A;  3N9L A;  4JEU B;  4KUM B;  5AQI B;  3DP7 A;  3UU6 A;  2K3W A;  2BDE A;  2XAG B;  4EYY R;  1D1B A;  2HN1 A;  4GK0 E;  2E5V A;  2XAS B;  4IE6 A;  1B7T A;  3ABV A;  2EHO D;  1H7C A;  3GA8 A;  4YXD A;  2B76 A;  4WZX A;  3PUV F;  2VQE T;  2CBJ A;  4O2B E;  2QYW A;  2V7I A;  3CQC B;  2OLT A;  3RYI E;  1BR2 A;  4Q25 A;  2X51 A;  2VQF T;  2YK0 A;  4YSX A;  3ANW A;  2ZM8 A;  3K3N A;  4HFV A;  5LYJ E;  4KHP T;  2PG8 A;  3D0T A;  2YDR A;  3C4W A;  3PV0 F;  2WZH A;  4GYS A;  4HWC A;  4LF8 T;  3AE1 A;  3J9X 1;  2ODU A;  3N5L A;  2PFV A;  4CZZ B;  2H7O A;  3MKD A;  4NUV A;  2LJL A;  4XBF B;  1VOM A;  3AE8 A;  4GK5 E;  1EZ3 A;  2YN6 A;  2VAS A;  2IIU A;  2FJE A;  1T98 A;  2OV9 A;  5L3E B;  5LGT B;  4H9P C;  3T1H T;  2DI4 A;  3PJA A;  5LBQ B;  5LOV E;  3PUZ F;  2XQY A;  2C5K T;  4ZEY A;  3ZST A;  5AQF B;  4P0A A;  1T8B A;  5L3D B;  1HF8 A;  1HNX T;  2ES0 A;  4UF0 A;  3TLS A;  5JR9 B;  1HX8 A;  1KF6 A;  2IC6 A;  2V6Y A;  4YJ3 E;  4HWF A;  2E9X B;  2IML A;  4KI0 F;  1FEW A;  3L39 A;  3JAE A;  4FJO A;  2X67 A;  3FHN A;  4H63 V;  2CXL A;  2XM1 A;  3FZF B;  4LMK A;  2CCQ A;  4X5T A;  3T8O A;  3SWH A;  2LEH A;  4ZZC A;  4JI1 T;  4PJN A;  2V26 A;  4TWD A;  5TAO A;  1OED E;  2NR4 A;  5ETW A;  5LBM A;  3LBX A;  3ZYL A;  3PJA J;  4DMV A;  3AEE A;  4UIG A;  1MND A;  2X9Y A;  3ZT7 A;  4H9Q C;  3TLU A;  4DO0 A;  2ZMA A;  4ILB A;  3ZSS A;  1ZHC A;  3MXZ A;  5FXZ A;  3VRB A;  2LSY A;  3ETV A;  4UVB B;  2C5I T;  2QA7 A;  3B13 A;  4CN4 A;  4MBQ A;  4DV6 T;  3I0Q A;  2XAJ B;  4AQF A;  5DJQ C;  5FL0 A;  3NRY A;  3ONL C;  2D0U A;  2W00 A;  2LSJ A;  4XAX B;  2CXF A;  4UVA B;  3G06 A;  5FY7 A;  4HTE A;  1ZKE A;  5CA1 E;  4Z8X A;  5LCY A;  4ZS3 A;  2JJ9 A;  3TLW A;  4ZS2 A;  4UF0 B;  3RHW A;  2WWU A;  2V7K A;  3IA3 A;  5HXC A;  4WBN E;  3GN5 B;  2WP9 A;  2RA1 A;  2WDR A;  4UR9 A;  3ZPO A;  3RH3 A;  4QXB B;  2I59 A;  3LK2 B;  3P50 A;  4TUY E;  4U2Z A;  4YHJ A;  4IE0 A;  2BG9 B;  2BZB A;  3SRZ A;  2BG9 E;  3RIF A;  3RKG A;  3MA9 A;  1FMW A;  1S35 A;  5AQK B;  1XMQ T;  2D9D A;  4KHZ F;  2JQ9 A;  2SPC A;  3T1Y T;  3IF8 B;  5L3C B;  3BQI A;  2W2U A;  2XQA A;  3ZC1 A;  1W0B A;  3UQ7 A;  2WMO A;  3AXJ B;  3LJC A;  3I0O A;  4HFD A;  4ASK A;  2B1E A;  3UU5 A;  4BAY B;  2HPJ A;  2W67 A;  3KV9 A;  2NTY A;  4EXT A;  2WS3 A;  1UUR A;  2QGS A;  2IDO B;  3F2E A;  3H3A A;  3AEC A;  1ZP0 A;  3IHR A;  5HEU A;  3L8R A;  4DBR A;  3KVA A;  3QUJ A;  4JI8 T;  2JRK A;  4EYU A;  1WCR A;  3OJA A;  4TV8 E;  2VVN A;  2F4V T;  2XQ7 A;  2J47 A;  5HWX A;  1J5W A;  2D0T A;  4MFR A;  4UV9 B;  1YW0 A;  3AAA B;  3M65 A;  2NTX A;  3C4Z A;  2CMR A;  5HEO A;  4A56 A;  4YT0 A;  4H63 H;  2X9W A;  1E1H B;  2A72 A;  3FZK B;  2NOX A;  3P4S A;  3P4R A;  5JR9 C;  2EHO C;  1O3X A;  2D2S A;  2LSK A;  4PJL A;  5AQV B;  3JC6 D;  3V5U A;  2FJB A;  3AE6 A;  5IYZ E;  4K0U A;  4GKK T;  4IDQ A;  2P9B A;  2CE7 A;  3LK3 B;  2HH7 A;  4H9R C;  4N78 D;  4P0B A;  4DV1 T;  2Q9Q A;  3CX7 B;  5JTG A;  1XMO T;  1N36 T;  2VKJ A;  3KBT A;  3GWH A;  3AA6 B;  2V6X A;  1XWM A;  4U31 A;  4Z91 A;  1MMA A;  2LKH A;  3PE0 A;  1KFY A;  2XQ9 A;  3B57 A;  4MLK A;  4QH4 A;  4DMW A;  5A1L A;  4B3S T;  4JI6 T;  4QX8 B;  2VKO A;  5C2T A;  3ONX A;  2CPT A;  4WBO A;  2V6Y B;  2E5L T;  4DR4 T;  5LG3 A;  3FZH B;  5JRC A;  2MYS A;  1MNE A;  2Q9Q B;  5HXR A;  5AQS B;  4PFO A;  2HPL A;  2HN2 A;  4AKR B;  3RYH E;  3JCF A;  4F8H A;  3NZP A;  1UUS A;  1LVF A;  2BS4 A;  2RPA A;  2VWA A;  5HEG A;  5LJN A;  1SA0 E;  3DJB A;  3MZK B;  1YKE B;  2E8I A;  2IUB A;  4U72 A;  1SE7 A;  2MAW A;  2E9X A;  2X66 A;  3KV5 A;  2LOS A;  2VVS A;  3LBX B;  2K48 A;  2MPK A;  4U7I A;  4JI0 T;  2X0L B;  5H6Q B;  5FNV E;  1SUM B;  5M4Y A;  5IWA T;  3L09 A;  3R6N A;  4TV9 E;  5LXT E;  2WM9 A;  5BMV E;  2CM0 A;  1W09 A;  3E22 E;  1IAP A;  2XAF B;  3Q5X A;  3KBU A;  3H3M A;  4I55 E;  2W63 A;  1MIY A;  3PUX F;  5FY1 A;  4H9S E;  4AIU A;  4LF4 T;  3N2K E;  1ZEE A;  2PBI A;  4V1A v;  2LM9 A;  3RYF E;  5JDQ A;  4DV4 T;  1IBM T;  4NXM T;  3VKH A;  2C0S A;  2FUP A;  2LE8 A;  4PW8 A;  5ABF B;  4WYV A;  1KNR A;  2CBI A;  3ZKR A;  5EK4 A;  5CB4 E;  2WU2 A;  4DR6 T;  2XSB A;  4X1Y E;  3GN5 A;  5JQG E;  4QX7 B;  2H88 A;  3N9P A;  3Q5W A;  3K3Q C;  3CK6 A;  2WDV A;  4LMJ A;  1U5P A;  4NPP A;  4IHJ E;  4X20 E;  5EZY E;  5LHH B;  2UUB T;  4DR1 T;  2PJQ A;  4IDN A;  3LSV A;  2HHH T;  5CA0 E;  3K8P C;  4J2C A;  3MAC A;  2MOZ A;  5IHY A;  3ZN0 B;  4B6X A;  1D0X A;  3OTO T;  2DWK A;  3AXJ A;  1MIW A;  2UUA T;  2UUC T;  4AQG A;  4HWH A;  5JH7 E;  4AQF C;  3KV6 A;  5AFU L;  2W66 A;  4E7Z A;  4CI1 B;  3PUA A;  3LDQ B;  4ZI2 C;  1QSD A;  3R84 B;  1HG5 A;  2ACZ A;  2YU1 A;  3WI3 A;  2UXC T;  1YQ3 A;  2I0M A;  2UXX B;  3OVU A;  2IC9 A;  3UU8 A;  5JDL A;  5ABG A;  2CHN A;  3UUX B;  2XQ4 A;  4ZOL E;  4GKJ T;  3I9W A;  2WB5 A;  1L0V A;  2RP4 A;  3KVB A;  5DQV A;  5C8Y E;  3AVR A;  3JAD A;  2H7V C;  2JIW A;  2N1G A;  2W61 A;  4HWD A;  3N9O A;  3K3O A;  2XAH B;  3PU8 A;  4JI7 T;  4TNW A;  5FXV A;  1WR0 A;  2KND A;  4HN9 A;  2LSI A;  4O4I E;  4CXY A;  1IBL T;  4JI3 T;  4PK5 A;  2VKD A;  1N32 T;  3EHZ A;  4EOZ B;  3RF1 A;  2NWB A;  5FP3 A;  2Q9Q C;  3KIN B;  2LKG A;  3EUH A;  1W9R A;  1XDO A;  2YDS A;  3CML A;  2JQK A;  1T72 A;  1Y64 B;  3KV4 A;  4AXP A;  4DV2 T;  1MMN A;  4G63 A;  5LJM A;  4DV0 T;  1HG2 A;  2BS3 A;  1KNP A;  4ZXL A;  4ISS A;  2DCF A;  2L8K A;  4QXH B;  2XQ5 A;  2UXD T;  1GQE A;  4QWN B;  4JI2 T;  3ZLI A;  2EHO A;  1NWM X;  3RQW A;  3X1D A;  5CJ5 A;  1Y01 A;  1NEK A;  3UUL A;  1N34 T;  4L0R A;  2DNX A;  3RRW A;  2KMF A;  2VK9 A;  2WY2 A;  5IUX A;  3L3P A;  4PNI A;  5AQG B;  4HWI B;  5FMN A;  5L3F B;  4XZC A;  2A3D A;  1BR4 A;  2XHE B;  3FZL B;  3NZQ A;  3AEB A;  1LKX A;  1NAF A;  1ZOY A;  2CLY C;  1MMD A;  3OYZ A;  4IL4 A;  4IT4 A;  4JUY A;  2ZLY A;  4WNK A;  2WMN A;  5FVK A;  3F31 A;  1G73 A;  2YU2 A;  3DTO A;  5EK3 A;  2CRB A;  3W15 B;  3IBP A;  3PUR A;  3UUN A;  2CA5 A;  2LLY A;  1R8I A;  2CHO A;  2YDQ A;  3Q9D A;  3OKQ A;  4NUU A;  4QH5 A;  4QHO A;  2UU9 T;  1X79 A;  2CWY A;  3ZMV B;  4EAH A;  2OA5 A;  4E7S A;  2J62 A;  2NW8 A;  5LNK A;  1JNR A;  1WFD A;  3CIR A;  3O1J A;  4DR3 T;  3ZT6 A;  5J2U E;  3UUM A;  4HFH A;  1UK5 A;  5HXE A;  4CXW A;  4UXN B;  4CQI A;  4JV5 T;  5HEH A;  3U3I A;  3PUY F;  3ZYM A;  4P1N A;  4IST A;  3H37 A;  4CI3 B;  3E08 A;  3PU3 A;  4JBW F;  4DID B;  1I94 T;  2VKH A;  3IEE A;  2BBJ A;  1T7S A;  2V5C A;  4FI5 A;  4YSZ A;  4LFA T;  2WZI A;  3JC6 C;  1HTJ F;  2K9A A;  4H9O C;  5FKY A;  4AKH A;  4I4T E;  2VL0 A;  1WYC A;  4IE5 A;  1IJ5 A;  1D0Z A;  3CVR A;  4CN1 A;  3P4W A;  1FIO A;  2VUR A;  2X68 A;  3CKD A;  1FMV A;  3NBX X;  3NKZ A;  3AED A;  4ADZ A;  1D1A A;  5ABF A;  1MMG A;  4JLE A;  1HNW T;  3M3Z B;  3HKB E;  3QOF A;  3QNU A;  3ETU A;  3RKO A;  1MIV A;  1YKH B;  2J4G A;  5JDM A;  4AKI A;  2L3L A;  2WQY A;  3AE4 A;  3LG7 A;  3AEA A;  2YIN A;  3QB5 K;  4OX9 T;  3SOL A;  4DV5 T;  3C4X A;  2XZE A;  3FB2 A;  3O1I A;  4WW0 A;  2BG9 A;  2LM2 A;  2WAU A;  2LHR A;  3EDV A;  3F57 A;  4TWF A;  4U74 A;  4HFB A;  3UU4 A;  5ABH A;  5AQT B;  3VR8 A;  4UEM A;  2NW7 A;  5CFB A;  4QKN A;  2V8S V;  2KSR A;  2UXN B;  2BKP A;  3AA0 B;  4YJ2 E;  4YTP A;  1S94 A;  4DV3 T;  5F5W A;  2XY8 B;  3ZCJ A;  4OFZ A;  5J0Z A;  1YD8 G;  2XM2 A;  3ZN1 B;  2D5U A;  4BJN A;  1HNZ T;  4JYA T;  4AKG A;  1DU2 A;  2KWH A;  4YFS A;  3B5M A;  4UEL A;  1J1J A;  4CI2 B;  1X9B A;  3HA4 A;  1HFA A;  2X9H A;  1BR0 A;  4EV6 A;  2XQ6 A;  4ERR A;  2FJA A;  4DND A;  3O4X E;  5ADX L;  5KXJ A;  5HXH A;  2BS2 A;  4EIW A;  4ZI2 D;  3EAB A;  2PTF A;  1NEN A;  3RIA A;  5JDH A;  5LGU B;  2M6B A;  2V1D B;  3AAI A;  3BK9 A;  4HFI A;  1KEY A;  1U4Q A;  2MTQ A;  1LVK A;  3AEF A;  2CEA A;  3ZEF B;  3A7M A;  2IW5 B;  5J2T E;  2A9U A;  3BQK A;  3N9N A;  4HGA A;  4PK4 A;  4G2A A;  1SHZ C;  4IE7 A;  2LSG A;  1QUU A;  3AE9 A;  3AE3 A;  4IDO A;  1J5E T;  3UFE A;  1KK7 A;  4QH1 A;  3AB3 B;  4UV8 B;  3ZJ2 A;  4PK6 A;  4HFC A;  4YLH A;  4B3T T;  1HS7 A;  2BKN A;  4KX6 A;  2XAQ B;  2WSS V;  5L2L A;  4AKL A;  2W4X A;  4GYR A;  2JMH A;  2WU5 A;  4P09 A;  1XNR T;  4O4H E;  4KMC A;  3RQU A;  3U78 A;  4LF9 T;  1M7K A;  2QRX A;  2BBH A;  2DLR A;  5HWY A;  3C50 A;  3VR9 A;  4ZHQ E;  2W62 A;  2IHR 1;  5HCM A;  3ZYK A;  1WLX A;  5DAB A;  5AQL B;  4B3R T;  3Q2M A;  4X64 T;  3PUW F;  3UT5 E;  1IJ6 A;  2WBL A;  2K24 A;  3ZCI A;  5HEJ A;  2KXP B;  4O4L E;  4YY3 T;  3ZJ1 A;  4YSY A;  1HCI A;  4IDP A;  5FL1 A;  3KFW X;  5AQQ B;  2Y48 B;  2X9X A;  4I50 E;  5AQJ B;  1VCS A;  3PDY A;  5LP6 E;  4F6R C;  4M1P A;  3P7I A;  4X1I E;  5LMU T;  3ZMU B;  1KNZ A;  2XJ7 A;  3PUS A;  4AI6 A;  3AE5 A;  3CWZ B;  2KWI B;  4IE4 A;  2G0U A;  5AQH B;  5LHG B;  3Q5D A;  4DR7 T;  5L3G B;  5HAX A;  2M6I A;  3SFD A;  3I9Y A;  3RX6 A;  1OWA A;  2XQ8 A;  4AIS A;  2IAK A;  3RLF F;  1OED B;  4EEB A;  4IGU A;  1VCT A;  3CQG B;  2H89 A;  4HFE A;  4KBM B;  1Z8U A;  5L4H A;  3TLV A;  4LFC T;  3FZM B;  3HI2 A;  3KDS E;  3P4Q A;  3V5S A;  4A98 A;  5LG4 A;  2NP9 A;  5KX5 E;  1OED A;  1CHU A;  1YXR A;  5JRC B;  5FVL A;  3ZC0 A;  5AQO B;  5LHI B;  2JMK A;  3C51 A;  4IIJ E;  1IZN B;  4JI5 T;  3CPZ A;  2E2A A;  2LRL A;  1HR0 T;  5LA6 E;  4OYJ A;  3J7Y q;  2V7M A;  4GOU A;  4X1K E;  4COF A;  3SFE A;  4EZH A;  1V9D A;  3AE2 A;  1XNQ T;  5KMG P;  1BR1 A;  3RIU A;  4LF5 T;  1M62 A;  5C3J A;  3E0Z A;  3TKL B;  4EED A;  3WAK A;  5JRE A;  4EZ4 A;  2LOP A;  1OED C;  2XQ3 A;  3P8C D;  3EDU A;  1WR6 A;  5FXW A;  4DR5 T;  1D0Y A;  3VRA A;  4GIW A;  4OHF A;  3RRC A;  2E9X D;  4ILU A;  1UX4 A;  4OK0 A;  4I43 B;  4YHH T;  4CXX A;  3UFG A;  2ZM2 A;  1IBK T;  5LGN B;  5L3B B;  5JDG A;  2ZM6 T;  3N9Q A;  3N2G E;  5KDM C;  1US7 B;  3LK4 2;  2N9D A;  4I0U A;  4PJM A;  2CXD A;  2K5B B;  2FBW A;  2KZ7 B;  3C98 B;  5J1G A;  2JQH A;  2I6H A;  5H6R B;  4JEH B;  2NW9 A;  5CGM A;  2GK9 A;  4CN6 A;  2C5J A;  4HKA A;  5L47 A;  2BVL A;  2YEV C;  3PUQ A;  4OYK A;  4LF7 T;  3ANW B;  3HKD E;  5JR9 A;  2KT9 A;  2E9X C;  3QK6 A;  4ANJ A;  4IL9 A;  4C90 A;  4X66 T;  2AE9 A;  4DUY T;  4U3C A;  1G8X A;  5L4E A;  3OYX A;  4JI4 T;  2BKO A;  2XUE A;  4ILA A;  4X65 T;  4BA9 A;  3NWI A;  5AQN B;  5LB7 B;  2UXB T;  1Z0P A;  2Y6X A;  2YOE A;  4HE8 A;  2WCA A;  4PFP A;  4TN7 B;  3PUG A;  2V5D A;  3HL6 A;  3I1A A;  2JQQ A;  4ZI7 E;  2ACX A;  5DQW A;  5AQU B;  4O2A E;  5HYA A;  2XTL A;  2DHR A;  1WYB A;  2VB6 A;  3AA1 B;  3K1S A;  3ONJ A;  1XZY A;  3VU7 H;  2YKS A;  5JVD E;  3UU3 A;  2Z6E A;  5JDN A;  3RC8 A;  4TWH A;  4X62 T;  3VKG A;  5E0O A;  4EGW A;  2X0Y A;  4EB6 E;  3NRX A;  2LT3 A;  2WDQ A;  3A8Y C;  2L9Q A;  5F3J A;  3OPC A;  2R6G F;  4A5X A;  4L9I A;  1WRD A;  4LML A;  1CUN A;  3EVY A;  3FXD B;  3VHL A;  3ZMT B;  4LF6 T;  1LRZ A;  1AJ3 A;  4U7Y A;  4DBQ A;  2KIN B;  4IDZ A;  3AE7 A;  1HX1 B;  5FXX A;  3N9M A;  4ZZB A;  3SS1 A;  3ESL A;  2X0H A;  2XPK A;  5HCJ A;  2BVM A;  1QLB A;  2DL1 A;  2JPF A;  5FYM A;  3RC3 A;  3JAF A;  3EAM A;  2ZM0 A;  4ILC A;  4A97 A;  3FBZ A;  3RYC E;  3FBL A;  4AQY T;  2H3R A;  3UQ4 A;  2LRK A;  4O8S A;  2W0G A; 
#chains in the Genus database with same CATH homology
 2CRB A;  1YXR A;  3EAB A;  2WWV A;  5FVL A;  2RPA A;  3K1S A;  3ZT7 A;  2JQ9 A;  2LRL A;  2JQK A;  2W2U A;  2A9U A;  1WFD A;  3ZSS A;  2JQH A;  2MPK A;  4U7I A;  3ZT6 A;  4A5X A;  5CGM A;  2XZE A;  4CN4 A;  4U33 A;  4U7Y A;  4NIQ A;  4CN6 A;  4U2Y A;  3ZT5 A;  5CJ5 A;  2V6X A;  4U31 A;  4P1N A;  4ZEY A;  3ZST A;  2K3W A;  4U3C A;  2WY2 A;  1WCR A;  2CPT A;  2V6Y A;  2V6Y B;  5LB7 B;  2DL1 A;  4WZX A;  4IT4 A;  4CN1 A;  5FVK A;  4U2Z A;  2LRK A;  1WR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...