4WZXA

Ulk3 regulates cytokinetic abscission by phosphorylating escrt-iii proteins
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
87
structure length
87
Chain Sequence
b'TSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEYLKEQVKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase ULK3
publication title ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 38
structure length 87
sequence length 87
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4wzxA01
4IT4A 2LRKA 2DL1A 2LRLA 3ZT7A 2WY2A 2A9UA 3ZT5A 2V6YB 4U7IA 3ZSTA 4ZEYA 4U2YA 1WCRA 3EABA 2WWVA 3ZSSA 5CJ5A 2CRBA 2MPKA 4P1NA 5FVLA 4CN1A 1WFDA 4WZXA 4U7YA 1WR0A 5CGMA 2V6YA 4U33A 1YXRA 3ZT6A 4NIQA 3K1SA 2CPTA 4U31A 2RPAA 4U3CA 5LB7B 2JQHA 2K3WA 2XZEA 5FVKA 2JQKA 2V6XA 4CN6A 4CN4A 4A5XA 2W2UA 4U2ZA 2JQ9A
chains in the Genus database with same CATH superfamily
4TV9E 1B7TA 1BR1A 1IAPA 4TWDA 5ABHA 2XSBA 3AVSA 2UU9T 3KV9A 2ES0A 4YTPA 3BQKA 1J1JA 2XQ8A 2IW5B 2V5CA 2FJDA 5JREA 3RX6A 1XNRT 5FL0A 4DR4T 1R8IA 3EDVA 4YY3T 3M3ZB 4EAHA 2BS4A 3KV4A 4JI8T 4UVBB 3J7Yq 2V8SV 1OXZA 2L3LA 4B3MT 1UURA 2BBHA 1X79A 4IDPA 3QNUA 2YDQA 1D1CA 1LRZA 2PBIA 3WAJA 4MHCA 2K3WA 3UU6A 3NVOA 2E9XC 2QGSA 1DU2A 3RYIE 4KHZF 1ZP0A 3TLUA 3NZQA 3FBZA 4B3RT 2NW8A 3AXJA 2XASB 4UR9A 4E7SA 1XDOA 4GKJT 2YDSA 2IAKA 5JQGE 3GN5A 5JDGA 2D2SA 3E22E 3UQ4A 4C91A 2ODVA 2HHHT 2X51A 5CB4E 4DV1T 1WR6A 5LNKA 4NPPA 2LM2A 2XY8B 5HXCA 1E2AA 3KV5A 2VVNA 3UT5E 4ZS2A 2XAQB 3ZMTB 4TWHA 5FXZA 5DJQC 1D0YA 2YN6A 3SRZA 1XDPA 5AQIB 2B76A 2WDRA 3AE5A 3LBXB 2A72A 2BS3A 3P4SA 2MPKA 3AEBA 1NAFA 5JVDE 3PUYF 3C50A 4HN9A 2W4XA 3CQCB 4KI0F 3B57A 4AIUA 5FVKA 3FZFB 5AQQB 1AJ3A 2VASA 4HWCA 2HN1A 2V7IA 4U2YA 1XWMA 2A2FX 1QSDA 3HKCE 3EHZA 2CRBA 4P1NA 5JDFA 2DCFA 3BQIA 5EK4A 4F8HA 4YXDA 3FBLA 1UUSA 3IA3A 4PJNA 1HG2A 1SA0E 2KINB 3RQWA 3OPCA 4U7YA 5DABA 3ZT6A 4HFDA 4UF0B 4X62T 3ETVA 5KDMC 2X66A 2JQHA 4P0AA 2V7JA 4IDZA 3UUBA 3OVUA 5J1GA 2H3RA 2CCQA 5JDNA 3B5MA 4ZI2C 3JC6D 4EV6A 4EIWA 5CFBA 3RC8A 2WDQA 2W62A 4JI4T 2V26A 5EZYE 3FZHB 4L5GA 3EI0A 2ZM2A 5AQTB 3P50A 2AE9A 4X20E 2LSKA 3A8YC 4UIGA 1D1AA 3I0OA 1NEKA 4O2AE 4TWFA 3UULA 3AE9A 2HPLA 1IZNB 1WRDA 5HEGA 2WB5A 4KMCA 4AQFA 2DI4A 1GQEA 3VRBA 4H9SE 2ACXA 5AQRB 2W61A 2D5UA 2LSGA 3I0QA 4ILCA 2CPTA 2X0HA 5LBMA 3N9QA 3B13A 2BVMA 1YKEB 3VU7H 2I6HA 4WNKA 2KWIB 5C2TA 4OYKA 4DIDB 2FUPA 1W09A 5AQPB 5CA0E 2VURA 1XNQT 4DR1T 3N9OA 1WYCA 4Z90A 5CJ5A 2W00A 5LGNB 4KX6A 4HFHA 3ZYLA 1IJ6A 4QXHB 4TNVA 4HFIA 2OV9A 2QYWA 1SE7A 4F6RC 3C4ZA 4H9NC 4AKGA 1J5WA 2WZHA 3AEAA 3ZT7A 3O1JA 4CXWA 3OYZA 4PK5A 2Q9QD 3TKLB 3NRYA 2CMRA 5J2TE 5L4HA 5LJMA 1E1HB 4WBNE 4B3ST 2DNXA 2XQ9A 4HEAA 3PV0F 3ZPOA 4COFA 2FJEA 4ANJA 1HG5A 2PJQA 4DV5T 1UGOA 4IGUA 2BVLA 5CA1E 2V6YB 2LOSA 4V1Av 2ODUA 3PUZF 2VVSA 4X1YE 2JQQA 4YTNA 2V7KA 3MACA 1HCIA 2JQ9A 3ONJA 4TNWA 1XMQT 3N9PA 1U5PA 1S35A 4N78D 4CXXA 4I55E 3N2OA 3PUAA 3QOFA 2CXDA 5AQKB 3LFMA 2LKHA 3KVAA 3GA8A 1US7B 4IE6A 3UTKA 2YDRA 1FMWA 3C98B 4NUUA 2I0MA 2X9YA 3Q5WA 2DL1A 2Q9QA 3A5XA 1ZHCA 3AA7B 1M62A 5JRCA 2E8IA 4DBQA 1Y01A 5LB7B 3UQ7A 5L2LA 3SFEA 2XQ3A 3CK6A 4P0BA 2ACZA 1FIOA 4IL4A 4UELA 1QLBA 4EYUA 5AQLB 3UU5A 4IIJE 4ISSA 2W0GA 1YQ4A 4ZOLE 3P8CD 4KBMB 5BR8T 2LHRA 4LF7T 2FJAA 4U7IA 1HNXT 5C3JA 3IHRA 2XUEA 2C5KT 3AAAB 3N2KE 3ZN1B 3CKDA 4GK5E 2J4GA 1OWAA 5AQHB 3FHNA 4ISTA 4DMWA 3E08A 4H9PC 3LK3B 2K5BB 5ETWA 5AQVB 3ZJ1A 2HH7A 4PJMA 2VKJA 3AEGA 2K24A 4IE4A 2VWAA 4WBOA 1T72A 3OJAA 1NWMX 4YLHA 2G0UA 2D9DA 4LFCT 2C5IT 3P4RA 2KT9A 2J62A 5DQWA 4IHJE 2IDOB 3O1HA 2D0UA 3ZC0A 4A98A 4CN6A 2KWHA 3L8RA 4H9RC 3HKDE 5LBQB 2LM9A 2LLYA 2QA7A 4JI2T 3TLSA 5J2UE 3CPZA 3PUQA 3VR9A 3I9YA 2WCAA 1S94A 3HL6A 4HFBA 3UU3A 3PUXF 2NW9A 4DBRA 4O4HE 1J5ET 2YOEA 3DJBA 5JH7E 2KLQA 3AVRA 3H3MA 4ZEYA 3SS1A 3C51A 2UXDT 3G06A 5AQJB 5KXJA 2CEAA 4YSXA 4Z91A 3GMIA 3CWZB 4GKKT 2DWGA 1ZEEA 2V7MA 2VL0A 4K0UA 2XM2A 4DV4T 3JAEA 5C8YE 2W67A 5FY1A 2XPKA 1IBMT 3N9MA 5HEOA 3FZMB 4EZHA 4QWNB 2IIUA 4GIWA 5H6RB 2L9QA 4A97A 3ZMSB 2J47A 5ABFA 2P9BA 4CXYA 2E9XD 2VK9A 4HKAA 3IEEA 3ONXA 4DR2T 2XM1A 1BR0A 2LSYA 2KSRA 4HFCA 4YT0A 3EVYA 1MIVA 2VB6A 1MMNA 4LMKA 2MBGA 3RLFF 3UFGA 3ZEFB 1I6ZA 4XBFB 3RRWA 3JCFA 2IMLA 3V5UA 3WAKA 1M7KA 3M65A 3L09A 3T1HT 4PFPA 2DHRA 3MZKB 1G73A 2E5LT 1NENA 2IC6A 4U31A 1KEYA 2XAFB 3OBVE 3ZYMA 5HCMA 3AE2A 3ETUA 2WMOA 3RKGA 4NUVA 1N34T 3ZKRA 1WCRA 2E9XA 4ZI7E 3D0TA 4AQFC 2CHNA 5LGUB 4YHHT 3RIFA 1WLXA 5BMVE 5AQUB 5JDMA 3CX7B 2V6XA 4AXPA 4EOZB 3A7MA 4DR3T 2YU1A 3R6NA 5LCYA 4MFRA 2CLYC 5JR9A 2KNDA 4JI0T 2UUCT 2WBLA 2BG9A 4ZZCA 4DV7T 3CIRA 3JC6C 3R84B 2W2UA 4HWHA 1O3XA 4IDQA 1D0XA 5HWYA 2CA5A 3DP7A 4BAYB 1VCTA 2WDVA 2ZM6T 3FXEB 4TV8E 3RQUA 2CLYB 2LEHA 3LBXA 5JDQA 2B1EA 2RP4A 3RRCA 2LHNA 4U74A 3UU8A 1FEWA 5AQSB 4GOUA 4QXCB 2X68A 5ADXL 1MIYA 2IC9A 3I1AA 4BJNA 4DV0T 3ANWA 4O4JE 5IYZE 5LA6E 4DR5T 4B3TT 2OLTA 1L0VA 5IUXA 2XHEB 4ZZBA 4I4TE 2BKOA 1HNZT 4EZ4A 1CUNA 4PW8A 3RYCE 3K3OA 1KF6A 4DUZT 3PJAA 3RPUA 2QRXA 2PTFA 3O1IA 3EAMA 3RKOA 4ASKA 5H6QB 3SFDA 1JNZA 3F57A 1KFYA 2Y6XA 4ZI3D 5L3CB 4P09A 2CXLA 3ZC1A 5FXWA 3DTOA 4G2AA 2OA5A 5HWXA 4HTEA 1UK5A 4K0KT 4DNDA 3ESLA 4AQGA 4EEBA 4TX5A 5ABGA 4DV6T 1ZV4X 4OHFA 5E0OA 2C0SA 4X66T 2BBJA 2MTQA 2WAUA 3ZLIA 4YJ3E 4AKHA 4JLEA 3AE4A 3N9NA 2CWYA 2LKGA 2Q9QC 3RF1A 3IF8B 3ZYKA 3CQXC 4EEDA 3PUSA 4PFOA 3UFEA 4I0UA 1W0AA 2HPJA 3ZMVB 2H7OA 4KP3C 5JDLA 5L3DB 3HA4A 3P4WA 4JI7T 2EHOD 3CVRA 4I43B 2Y8DA 3N9LA 4X1KE 2Q9QB 5DQVA 1HF8A 5JRCB 1OEDA 5AQMB 1BR4A 5LMNT 3WI3A 1HX1B 4M1PA 2Z6EA 5FNVE 2X9WA 3VRAA 3AA1B 4U3CA 3F2EA 3T8OA 2JMHA 3N2GE 5AQGB 2X9HA 1XZYA 3PURA 1HX8A 4X5TA 4EB6E 2NTYA 5LG4A 4MBQA 5HXHA 3EDUA 4DVDA 4JI3T 1CHUA 4X65T 5IWAT 1D1BA 3O9XA 1H7CA 1ZOYA 3KVBA 4A56A 2WSSV 2LRLA 3NZPA 1MMDA 4CQIA 2X67A 3TLVA 1UX5A 5GONE 3V5SA 2EHOA 2LOPA 2XQ6A 3BK9A 4JEUB 4G63A 4LF6T 2XQYA 5A1LA 3SOLA 2MYSA 3ZT5A 2CWOA 4OK0A 4JI6T 1KNRA 4GK0E 3F31A 3K3NA 3PU8A 1U4QA 1SUMB 3W15B 4O8SA 3RH3A 3AE1A 1HNWT 4CZZB 3P4QA 3C4XA 2VQFT 4JI1T 2XQ5A 1LVKA 2A3DA 2KXPB 5JTGA 1T98A 1Z8UA 4U33A 5KMGP 1JNRA 4AKIA 1VCSA 1YD8G 1N33T 4J2CA 4DMVA 3TLTA 1FJGT 3AEDA 3GWHA 1WFDA 1VOMA 4WZXA 2GK9A 1N36T 3LDQB 5J0ZA 2HN2A 3P7IA 3LK2B 1MNDA 4ERRA 1HR0T 4BJMA 4ILUA 4QH5A 5FMNA 2JMKA 2I59A 3UUXB 2JIWA 2ZM0A 2X9XA 2CHOA 3H3AA 4PJLA 1LKXA 3ZCJA 3FZKB 2L8KA 3MK7C 2H89A 4O4LE 3AXJB 2W66A 3ONLC 4QX7B 2CE7A 3AAEB 5ABFB 3NRXA 3AEEA 4LFBT 4FJOA 2QVAA 5HCJA 1YXRA 2UXBT 2K9AA 5L3EB 3GN5B 2RPAA 1MIWA 4OYJA 4HWIB 2YU2A 3MA9A 5FP3A 2BDEA 2WQYA 5LYJE 2IUBA 5HEHA 2JRKA 2H88A 3ZMUB 3PDYA 1W9RA 1Y64B 5HXRA 5HXSA 4ZHQE 1I94T 4PAGA 2UUBT 1G8XA 2CBJA 3OYXA 1OEDE 4YFSA 3ZSSA 2YINA 5AFUL 1YKHB 4DUYT 4OX9T 4ILAA 3EABA 2PG8A 5F8PA 3KBTA 3QB5A 4EGWA 1MNEA 3QK6A 3N5LA 2MAWA 3RIUA 2ZM8A 5FY0A 4TZ4C 5HAXA 3RC3A 4LF4T 1YQ3A 2CBIA 2Y48B 1IBLT 3ZCIA 1T7SA 3LK42 3PE0A 2WZIA 2E9XB 2WMNA 2UUAT 1EZ3A 4DR6T 2LRKA 4PK4A 5JR9C 4LMLA 3OKQA 2YEVC 2BG9C 3KV6A 4AISA 4ZXLA 2UXXB 3EUHA 4H63V 5LGTB 3UUNA 2V1DB 3HKEE 2BS2A 2PFVA 4A5XA 3LSVA 4IDNA 4NXNT 1KNZA 4IE7A 1UCUA 3QC9A 5JR9B 2VKOA 2AXDS 2LT3A 2M6BA 3PUWF 2FJBA 4QXBB 4KUMB 2BG9B 5LHIB 3AE7A 3I9WA 3AE6A 5CGMA 1BR2A 1MMGA 4JYAT 4YJ2E 2JPFA 3PUGA 2NR4A 4UVAB 5AQOB 4ZS3A 4IE0A 3X1DA 5HEJA 3PUVF 4L0RA 3SWHA 3KFWX 3UUMA 5L47A 4ILBA 4B6XA 2BKPA 1D0ZA 1XMOT 5ABEA 3Q9DA 4PNIA 4XZCA 2R6GF 3ANWB 4LFAT 2KMFA 4IL9A 4ADZA 4OFZA 5KX5E 3K8PC 3MJXA 4L9IA 1WR0A 1LVFA 3H37A 3TLWA 5JDHA 3VKGA 3AEFA 5FXVA 2E2AA 4IE5A 3QUJA 2XTLA 4JUYA 2NW7A 4U72A 3T1YT 2H7VC 2YKSA 3IBPA 2J1DG 4H63H 5FXXA 2KZ7B 5L3FB 3Q5DA 2NOXA 3Q2MA 2XQ4A 3OTOT 5F3JA 4QX8B 4CN4A 3RGLA 4DV2T 5FYMA 3HKBE 2XAJB 3Q5XA 3U3IA 3JADA 2M67A 2WU5A 2NP9A 4EXTA 5FVLA 4ZI2D 5HXEA 4YSYA 2VKDA 5L4EA 1KK7A 3CX8B 3QB5K 3E0ZA 3S4UA 5LG3A 2XJ7A 3KBUA 3JAFA 4IT4A 2A9UA 5LMUT 3CX6B 4CI3B 3RHWA 3L3PA 3RYHE 2X0LB 3KINB 4ZI3C 3L39A 2N2NA 4GYSA 3U78A 4QH1A 3AECA 1OEDC 3K1SA 4X64T 2D0TA 1IJ5A 3FB2A 4DV3T 5L3GB 2ZLYA 4UF0A 4PJJA 4JBWF 2FBWA 3ZMZB 3BQLA 2WU2A 4IREA 1QUUA 4UV9B 3NWIA 2M6IA 2E5VA 1IBKT 3RI5A 2CXFA 3PU3A 2LSIA 5HYAA 1OEDB 3HI2A 4U2ZA 2K48A 4FI5A 2LE8A 2WM9A 3RIAA 4O2BE 2BKNA 3RYFE 3ZJ2A 3FZLB 2W63A 3NKZA 4TN7B 5FY7A 4QHOA 2VQET 2XZEA 2WWUA 4X1IE 1VRBA 5LJNA 3ZSTA 3AA0B 1WYBA 2EHOC 1KNPA 2NTXA 5F5WA 5M4YA 4QKNA 4UV8B 3PJAJ 2X0YA 4C90A 4AKLA 3VHLA 3ZN0B 3AB3B 2UXCT 4JI5T 3HR0A 1FMVA 5L3BB 2N9DA 2YK0A 2EHOB 4UVCB 4GYRA 4BA9A 3P4PA 3AA6B 4H9OC 3LJCA 4HFVA 3CMLA 1N32T 2ZMAA 2DWKA 2BZBA 2WS3A 4PK6A 2XAHB 2NWBA 4LF8T 3MXZA 4XAXB 4CI1B 2N1GA 3UU4A 4MLKA 3PTRB 2WP9A 1ZKEA 4CI2B 3VKHA 4UEMA 3VR8A 4AQYT 3J9X1 4YTMA 2XSAA 4HGAA 3K3QC 1E7PA 3C64A 1Z0PA 2VL8A 4HFEA 2LJLA 2UXNB 2VKHA 5LHGB 3KDSE 5EK2A 1V9DA 4JEHB 2V7LA 5LXTE 5LOVE 1UX4A 3FXDB 4NIQA 5EK3A 2BG9E 3C4WA 3Q5EA 2MOZA 2JJ9A 2C5JA 2WWVA 2V5DA 5IHYA 3AE3A 2V6YA 4MALA 4QH4A 1HFAA 4AKRB 1X9BA 2JQKA 4LMJA 4NXMT 2SPCA 2WY2A 3CQGB 4O4IE 3O4XE 3ABVA 3AAIA 4HWFA 3LG7A 3MKDA 1SHZC 4YHJA 1YW0A 4E7ZA 1HS7A 5TAOA 5LHHB 2IHR1 4I50E 4AI6A 4Q25A 5HEUA 4WW0A 4YSZA 5AQNB 1W0BA 4Z8XA 5FL1A 5AQFB 2XAGB 4H9QC 3NBXX 4JV5T 1MMAA 4IDOA 5LP6E 4WYVA 3AE8A 2LSJA 2XQAA 5FKYA 4UXNB 2DLRA 2CM0A 4LF9T 4TUYE 2RA1A 4KHPT 1T8BA 4CN1A 4DO0A 4HE8A 4EYYR 4DR7T 2XQ7A 3RIUC 4HWDA 1HTJF 2F4VT 4LF5T
chains in the Genus database with same CATH topology
4IT4A 2LRKA 2DL1A 2LRLA 3ZT7A 2WY2A 2A9UA 3ZT5A 2V6YB 4U7IA 3ZSTA 4ZEYA 4U2YA 1WCRA 3EABA 2WWVA 3ZSSA 5CJ5A 2CRBA 2MPKA 4P1NA 5FVLA 4CN1A 1WFDA 4WZXA 4U7YA 1WR0A 5CGMA 2V6YA 4U33A 1YXRA 3ZT6A 4NIQA 3K1SA 2CPTA 4U31A 2RPAA 4U3CA 5LB7B 2JQHA 2K3WA 2XZEA 5FVKA 2JQKA 2V6XA 4CN6A 4CN4A 4A5XA 2W2UA 4U2ZA 2JQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT4 A;  2LRK A;  2DL1 A;  2LRL A;  3ZT7 A;  2WY2 A;  2A9U A;  3ZT5 A;  2V6Y B;  4U7I A;  3ZST A;  4ZEY A;  4U2Y A;  1WCR A;  3EAB A;  2WWV A;  3ZSS A;  5CJ5 A;  2CRB A;  2MPK A;  4P1N A;  5FVL A;  4CN1 A;  1WFD A;  4WZX A;  4U7Y A;  1WR0 A;  5CGM A;  2V6Y A;  4U33 A;  1YXR A;  3ZT6 A;  4NIQ A;  3K1S A;  2CPT A;  4U31 A;  2RPA A;  4U3C A;  5LB7 B;  2JQH A;  2K3W A;  2XZE A;  5FVK A;  2JQK A;  2V6X A;  4CN6 A;  4CN4 A;  4A5X A;  2W2U A;  4U2Z A;  2JQ9 A; 
#chains in the Genus database with same CATH topology
 4TV9 E;  1B7T A;  1BR1 A;  1IAP A;  4TWD A;  5ABH A;  2XSB A;  3AVS A;  2UU9 T;  3KV9 A;  2ES0 A;  4YTP A;  3BQK A;  1J1J A;  2XQ8 A;  2IW5 B;  2V5C A;  2FJD A;  5JRE A;  3RX6 A;  1XNR T;  5FL0 A;  4DR4 T;  1R8I A;  3EDV A;  4YY3 T;  3M3Z B;  4EAH A;  2BS4 A;  3KV4 A;  4JI8 T;  4UVB B;  3J7Y q;  2V8S V;  1OXZ A;  2L3L A;  4B3M T;  1UUR A;  2BBH A;  1X79 A;  4IDP A;  3QNU A;  2YDQ A;  1D1C A;  1LRZ A;  2PBI A;  3WAJ A;  4MHC A;  2K3W A;  3UU6 A;  3NVO A;  2E9X C;  2QGS A;  1DU2 A;  3RYI E;  4KHZ F;  1ZP0 A;  3TLU A;  3NZQ A;  3FBZ A;  4B3R T;  2NW8 A;  3AXJ A;  2XAS B;  4UR9 A;  4E7S A;  1XDO A;  4GKJ T;  2YDS A;  2IAK A;  5JQG E;  3GN5 A;  5JDG A;  2D2S A;  3E22 E;  3UQ4 A;  4C91 A;  2ODV A;  2HHH T;  2X51 A;  5CB4 E;  4DV1 T;  1WR6 A;  5LNK A;  4NPP A;  2LM2 A;  2XY8 B;  5HXC A;  1E2A A;  3KV5 A;  2VVN A;  3UT5 E;  4ZS2 A;  2XAQ B;  3ZMT B;  4TWH A;  5FXZ A;  5DJQ C;  1D0Y A;  2YN6 A;  3SRZ A;  1XDP A;  5AQI B;  2B76 A;  2WDR A;  3AE5 A;  3LBX B;  2A72 A;  2BS3 A;  3P4S A;  2MPK A;  3AEB A;  1NAF A;  5JVD E;  3PUY F;  3C50 A;  4HN9 A;  2W4X A;  3CQC B;  4KI0 F;  3B57 A;  4AIU A;  5FVK A;  3FZF B;  5AQQ B;  1AJ3 A;  2VAS A;  4HWC A;  2HN1 A;  2V7I A;  4U2Y A;  1XWM A;  2A2F X;  1QSD A;  3HKC E;  3EHZ A;  2CRB A;  4P1N A;  5JDF A;  2DCF A;  3BQI A;  5EK4 A;  4F8H A;  4YXD A;  3FBL A;  1UUS A;  3IA3 A;  4PJN A;  1HG2 A;  1SA0 E;  2KIN B;  3RQW A;  3OPC A;  4U7Y A;  5DAB A;  3ZT6 A;  4HFD A;  4UF0 B;  4X62 T;  3ETV A;  5KDM C;  2X66 A;  2JQH A;  4P0A A;  2V7J A;  4IDZ A;  3UUB A;  3OVU A;  5J1G A;  2H3R A;  2CCQ A;  5JDN A;  3B5M A;  4ZI2 C;  3JC6 D;  4EV6 A;  4EIW A;  5CFB A;  3RC8 A;  2WDQ A;  2W62 A;  4JI4 T;  2V26 A;  5EZY E;  3FZH B;  4L5G A;  3EI0 A;  2ZM2 A;  5AQT B;  3P50 A;  2AE9 A;  4X20 E;  2LSK A;  3A8Y C;  4UIG A;  1D1A A;  3I0O A;  1NEK A;  4O2A E;  4TWF A;  3UUL A;  3AE9 A;  2HPL A;  1IZN B;  1WRD A;  5HEG A;  2WB5 A;  4KMC A;  4AQF A;  2DI4 A;  1GQE A;  3VRB A;  4H9S E;  2ACX A;  5AQR B;  2W61 A;  2D5U A;  2LSG A;  3I0Q A;  4ILC A;  2CPT A;  2X0H A;  5LBM A;  3N9Q A;  3B13 A;  2BVM A;  1YKE B;  3VU7 H;  2I6H A;  4WNK A;  2KWI B;  5C2T A;  4OYK A;  4DID B;  2FUP A;  1W09 A;  5AQP B;  5CA0 E;  2VUR A;  1XNQ T;  4DR1 T;  3N9O A;  1WYC A;  4Z90 A;  5CJ5 A;  2W00 A;  5LGN B;  4KX6 A;  4HFH A;  3ZYL A;  1IJ6 A;  4QXH B;  4TNV A;  4HFI A;  2OV9 A;  2QYW A;  1SE7 A;  4F6R C;  3C4Z A;  4H9N C;  4AKG A;  1J5W A;  2WZH A;  3AEA A;  3ZT7 A;  3O1J A;  4CXW A;  3OYZ A;  4PK5 A;  2Q9Q D;  3TKL B;  3NRY A;  2CMR A;  5J2T E;  5L4H A;  5LJM A;  1E1H B;  4WBN E;  4B3S T;  2DNX A;  2XQ9 A;  4HEA A;  3PV0 F;  3ZPO A;  4COF A;  2FJE A;  4ANJ A;  1HG5 A;  2PJQ A;  4DV5 T;  1UGO A;  4IGU A;  2BVL A;  5CA1 E;  2V6Y B;  2LOS A;  4V1A v;  2ODU A;  3PUZ F;  2VVS A;  4X1Y E;  2JQQ A;  4YTN A;  2V7K A;  3MAC A;  1HCI A;  2JQ9 A;  3ONJ A;  4TNW A;  1XMQ T;  3N9P A;  1U5P A;  1S35 A;  4N78 D;  4CXX A;  4I55 E;  3N2O A;  3PUA A;  3QOF A;  2CXD A;  5AQK B;  3LFM A;  2LKH A;  3KVA A;  3GA8 A;  1US7 B;  4IE6 A;  3UTK A;  2YDR A;  1FMW A;  3C98 B;  4NUU A;  2I0M A;  2X9Y A;  3Q5W A;  2DL1 A;  2Q9Q A;  3A5X A;  1ZHC A;  3AA7 B;  1M62 A;  5JRC A;  2E8I A;  4DBQ A;  1Y01 A;  5LB7 B;  3UQ7 A;  5L2L A;  3SFE A;  2XQ3 A;  3CK6 A;  4P0B A;  2ACZ A;  1FIO A;  4IL4 A;  4UEL A;  1QLB A;  4EYU A;  5AQL B;  3UU5 A;  4IIJ E;  4ISS A;  2W0G A;  1YQ4 A;  4ZOL E;  3P8C D;  4KBM B;  5BR8 T;  2LHR A;  4LF7 T;  2FJA A;  4U7I A;  1HNX T;  5C3J A;  3IHR A;  2XUE A;  2C5K T;  3AAA B;  3N2K E;  3ZN1 B;  3CKD A;  4GK5 E;  2J4G A;  1OWA A;  5AQH B;  3FHN A;  4IST A;  4DMW A;  3E08 A;  4H9P C;  3LK3 B;  2K5B B;  5ETW A;  5AQV B;  3ZJ1 A;  2HH7 A;  4PJM A;  2VKJ A;  3AEG A;  2K24 A;  4IE4 A;  2VWA A;  4WBO A;  1T72 A;  3OJA A;  1NWM X;  4YLH A;  2G0U A;  2D9D A;  4LFC T;  2C5I T;  3P4R A;  2KT9 A;  2J62 A;  5DQW A;  4IHJ E;  2IDO B;  3O1H A;  2D0U A;  3ZC0 A;  4A98 A;  4CN6 A;  2KWH A;  3L8R A;  4H9R C;  3HKD E;  5LBQ B;  2LM9 A;  2LLY A;  2QA7 A;  4JI2 T;  3TLS A;  5J2U E;  3CPZ A;  3PUQ A;  3VR9 A;  3I9Y A;  2WCA A;  1S94 A;  3HL6 A;  4HFB A;  3UU3 A;  3PUX F;  2NW9 A;  4DBR A;  4O4H E;  1J5E T;  2YOE A;  3DJB A;  5JH7 E;  2KLQ A;  3AVR A;  3H3M A;  4ZEY A;  3SS1 A;  3C51 A;  2UXD T;  3G06 A;  5AQJ B;  5KXJ A;  2CEA A;  4YSX A;  4Z91 A;  3GMI A;  3CWZ B;  4GKK T;  2DWG A;  1ZEE A;  2V7M A;  2VL0 A;  4K0U A;  2XM2 A;  4DV4 T;  3JAE A;  5C8Y E;  2W67 A;  5FY1 A;  2XPK A;  1IBM T;  3N9M A;  5HEO A;  3FZM B;  4EZH A;  4QWN B;  2IIU A;  4GIW A;  5H6R B;  2L9Q A;  4A97 A;  3ZMS B;  2J47 A;  5ABF A;  2P9B A;  4CXY A;  2E9X D;  2VK9 A;  4HKA A;  3IEE A;  3ONX A;  4DR2 T;  2XM1 A;  1BR0 A;  2LSY A;  2KSR A;  4HFC A;  4YT0 A;  3EVY A;  1MIV A;  2VB6 A;  1MMN A;  4LMK A;  2MBG A;  3RLF F;  3UFG A;  3ZEF B;  1I6Z A;  4XBF B;  3RRW A;  3JCF A;  2IML A;  3V5U A;  3WAK A;  1M7K A;  3M65 A;  3L09 A;  3T1H T;  4PFP A;  2DHR A;  3MZK B;  1G73 A;  2E5L T;  1NEN A;  2IC6 A;  4U31 A;  1KEY A;  2XAF B;  3OBV E;  3ZYM A;  5HCM A;  3AE2 A;  3ETU A;  2WMO A;  3RKG A;  4NUV A;  1N34 T;  3ZKR A;  1WCR A;  2E9X A;  4ZI7 E;  3D0T A;  4AQF C;  2CHN A;  5LGU B;  4YHH T;  3RIF A;  1WLX A;  5BMV E;  5AQU B;  5JDM A;  3CX7 B;  2V6X A;  4AXP A;  4EOZ B;  3A7M A;  4DR3 T;  2YU1 A;  3R6N A;  5LCY A;  4MFR A;  2CLY C;  5JR9 A;  2KND A;  4JI0 T;  2UUC T;  2WBL A;  2BG9 A;  4ZZC A;  4DV7 T;  3CIR A;  3JC6 C;  3R84 B;  2W2U A;  4HWH A;  1O3X A;  4IDQ A;  1D0X A;  5HWY A;  2CA5 A;  3DP7 A;  4BAY B;  1VCT A;  2WDV A;  2ZM6 T;  3FXE B;  4TV8 E;  3RQU A;  2CLY B;  2LEH A;  3LBX A;  5JDQ A;  2B1E A;  2RP4 A;  3RRC A;  2LHN A;  4U74 A;  3UU8 A;  1FEW A;  5AQS B;  4GOU A;  4QXC B;  2X68 A;  5ADX L;  1MIY A;  2IC9 A;  3I1A A;  4BJN A;  4DV0 T;  3ANW A;  4O4J E;  5IYZ E;  5LA6 E;  4DR5 T;  4B3T T;  2OLT A;  1L0V A;  5IUX A;  2XHE B;  4ZZB A;  4I4T E;  2BKO A;  1HNZ T;  4EZ4 A;  1CUN A;  4PW8 A;  3RYC E;  3K3O A;  1KF6 A;  4DUZ T;  3PJA A;  3RPU A;  2QRX A;  2PTF A;  3O1I A;  3EAM A;  3RKO A;  4ASK A;  5H6Q B;  3SFD A;  1JNZ A;  3F57 A;  1KFY A;  2Y6X A;  4ZI3 D;  5L3C B;  4P09 A;  2CXL A;  3ZC1 A;  5FXW A;  3DTO A;  4G2A A;  2OA5 A;  5HWX A;  4HTE A;  1UK5 A;  4K0K T;  4DND A;  3ESL A;  4AQG A;  4EEB A;  4TX5 A;  5ABG A;  4DV6 T;  1ZV4 X;  4OHF A;  5E0O A;  2C0S A;  4X66 T;  2BBJ A;  2MTQ A;  2WAU A;  3ZLI A;  4YJ3 E;  4AKH A;  4JLE A;  3AE4 A;  3N9N A;  2CWY A;  2LKG A;  2Q9Q C;  3RF1 A;  3IF8 B;  3ZYK A;  3CQX C;  4EED A;  3PUS A;  4PFO A;  3UFE A;  4I0U A;  1W0A A;  2HPJ A;  3ZMV B;  2H7O A;  4KP3 C;  5JDL A;  5L3D B;  3HA4 A;  3P4W A;  4JI7 T;  2EHO D;  3CVR A;  4I43 B;  2Y8D A;  3N9L A;  4X1K E;  2Q9Q B;  5DQV A;  1HF8 A;  5JRC B;  1OED A;  5AQM B;  1BR4 A;  5LMN T;  3WI3 A;  1HX1 B;  4M1P A;  2Z6E A;  5FNV E;  2X9W A;  3VRA A;  3AA1 B;  4U3C A;  3F2E A;  3T8O A;  2JMH A;  3N2G E;  5AQG B;  2X9H A;  1XZY A;  3PUR A;  1HX8 A;  4X5T A;  4EB6 E;  2NTY A;  5LG4 A;  4MBQ A;  5HXH A;  3EDU A;  4DVD A;  4JI3 T;  1CHU A;  4X65 T;  5IWA T;  1D1B A;  3O9X A;  1H7C A;  1ZOY A;  3KVB A;  4A56 A;  2WSS V;  2LRL A;  3NZP A;  1MMD A;  4CQI A;  2X67 A;  3TLV A;  1UX5 A;  5GON E;  3V5S A;  2EHO A;  2LOP A;  2XQ6 A;  3BK9 A;  4JEU B;  4G63 A;  4LF6 T;  2XQY A;  5A1L A;  3SOL A;  2MYS A;  3ZT5 A;  2CWO A;  4OK0 A;  4JI6 T;  1KNR A;  4GK0 E;  3F31 A;  3K3N A;  3PU8 A;  1U4Q A;  1SUM B;  3W15 B;  4O8S A;  3RH3 A;  3AE1 A;  1HNW T;  4CZZ B;  3P4Q A;  3C4X A;  2VQF T;  4JI1 T;  2XQ5 A;  1LVK A;  2A3D A;  2KXP B;  5JTG A;  1T98 A;  1Z8U A;  4U33 A;  5KMG P;  1JNR A;  4AKI A;  1VCS A;  1YD8 G;  1N33 T;  4J2C A;  4DMV A;  3TLT A;  1FJG T;  3AED A;  3GWH A;  1WFD A;  1VOM A;  4WZX A;  2GK9 A;  1N36 T;  3LDQ B;  5J0Z A;  2HN2 A;  3P7I A;  3LK2 B;  1MND A;  4ERR A;  1HR0 T;  4BJM A;  4ILU A;  4QH5 A;  5FMN A;  2JMK A;  2I59 A;  3UUX B;  2JIW A;  2ZM0 A;  2X9X A;  2CHO A;  3H3A A;  4PJL A;  1LKX A;  3ZCJ A;  3FZK B;  2L8K A;  3MK7 C;  2H89 A;  4O4L E;  3AXJ B;  2W66 A;  3ONL C;  4QX7 B;  2CE7 A;  3AAE B;  5ABF B;  3NRX A;  3AEE A;  4LFB T;  4FJO A;  2QVA A;  5HCJ A;  1YXR A;  2UXB T;  2K9A A;  5L3E B;  3GN5 B;  2RPA A;  1MIW A;  4OYJ A;  4HWI B;  2YU2 A;  3MA9 A;  5FP3 A;  2BDE A;  2WQY A;  5LYJ E;  2IUB A;  5HEH A;  2JRK A;  2H88 A;  3ZMU B;  3PDY A;  1W9R A;  1Y64 B;  5HXR A;  5HXS A;  4ZHQ E;  1I94 T;  4PAG A;  2UUB T;  1G8X A;  2CBJ A;  3OYX A;  1OED E;  4YFS A;  3ZSS A;  2YIN A;  5AFU L;  1YKH B;  4DUY T;  4OX9 T;  4ILA A;  3EAB A;  2PG8 A;  5F8P A;  3KBT A;  3QB5 A;  4EGW A;  1MNE A;  3QK6 A;  3N5L A;  2MAW A;  3RIU A;  2ZM8 A;  5FY0 A;  4TZ4 C;  5HAX A;  3RC3 A;  4LF4 T;  1YQ3 A;  2CBI A;  2Y48 B;  1IBL T;  3ZCI A;  1T7S A;  3LK4 2;  3PE0 A;  2WZI A;  2E9X B;  2WMN A;  2UUA T;  1EZ3 A;  4DR6 T;  2LRK A;  4PK4 A;  5JR9 C;  4LML A;  3OKQ A;  2YEV C;  2BG9 C;  3KV6 A;  4AIS A;  4ZXL A;  2UXX B;  3EUH A;  4H63 V;  5LGT B;  3UUN A;  2V1D B;  3HKE E;  2BS2 A;  2PFV A;  4A5X A;  3LSV A;  4IDN A;  4NXN T;  1KNZ A;  4IE7 A;  1UCU A;  3QC9 A;  5JR9 B;  2VKO A;  2AXD S;  2LT3 A;  2M6B A;  3PUW F;  2FJB A;  4QXB B;  4KUM B;  2BG9 B;  5LHI B;  3AE7 A;  3I9W A;  3AE6 A;  5CGM A;  1BR2 A;  1MMG A;  4JYA T;  4YJ2 E;  2JPF A;  3PUG A;  2NR4 A;  4UVA B;  5AQO B;  4ZS3 A;  4IE0 A;  3X1D A;  5HEJ A;  3PUV F;  4L0R A;  3SWH A;  3KFW X;  3UUM A;  5L47 A;  4ILB A;  4B6X A;  2BKP A;  1D0Z A;  1XMO T;  5ABE A;  3Q9D A;  4PNI A;  4XZC A;  2R6G F;  3ANW B;  4LFA T;  2KMF A;  4IL9 A;  4ADZ A;  4OFZ A;  5KX5 E;  3K8P C;  3MJX A;  4L9I A;  1WR0 A;  1LVF A;  3H37 A;  3TLW A;  5JDH A;  3VKG A;  3AEF A;  5FXV A;  2E2A A;  4IE5 A;  3QUJ A;  2XTL A;  4JUY A;  2NW7 A;  4U72 A;  3T1Y T;  2H7V C;  2YKS A;  3IBP A;  2J1D G;  4H63 H;  5FXX A;  2KZ7 B;  5L3F B;  3Q5D A;  2NOX A;  3Q2M A;  2XQ4 A;  3OTO T;  5F3J A;  4QX8 B;  4CN4 A;  3RGL A;  4DV2 T;  5FYM A;  3HKB E;  2XAJ B;  3Q5X A;  3U3I A;  3JAD A;  2M67 A;  2WU5 A;  2NP9 A;  4EXT A;  5FVL A;  4ZI2 D;  5HXE A;  4YSY A;  2VKD A;  5L4E A;  1KK7 A;  3CX8 B;  3QB5 K;  3E0Z A;  3S4U A;  5LG3 A;  2XJ7 A;  3KBU A;  3JAF A;  4IT4 A;  2A9U A;  5LMU T;  3CX6 B;  4CI3 B;  3RHW A;  3L3P A;  3RYH E;  2X0L B;  3KIN B;  4ZI3 C;  3L39 A;  2N2N A;  4GYS A;  3U78 A;  4QH1 A;  3AEC A;  1OED C;  3K1S A;  4X64 T;  2D0T A;  1IJ5 A;  3FB2 A;  4DV3 T;  5L3G B;  2ZLY A;  4UF0 A;  4PJJ A;  4JBW F;  2FBW A;  3ZMZ B;  3BQL A;  2WU2 A;  4IRE A;  1QUU A;  4UV9 B;  3NWI A;  2M6I A;  2E5V A;  1IBK T;  3RI5 A;  2CXF A;  3PU3 A;  2LSI A;  5HYA A;  1OED B;  3HI2 A;  4U2Z A;  2K48 A;  4FI5 A;  2LE8 A;  2WM9 A;  3RIA A;  4O2B E;  2BKN A;  3RYF E;  3ZJ2 A;  3FZL B;  2W63 A;  3NKZ A;  4TN7 B;  5FY7 A;  4QHO A;  2VQE T;  2XZE A;  2WWU A;  4X1I E;  1VRB A;  5LJN A;  3ZST A;  3AA0 B;  1WYB A;  2EHO C;  1KNP A;  2NTX A;  5F5W A;  5M4Y A;  4QKN A;  4UV8 B;  3PJA J;  2X0Y A;  4C90 A;  4AKL A;  3VHL A;  3ZN0 B;  3AB3 B;  2UXC T;  4JI5 T;  3HR0 A;  1FMV A;  5L3B B;  2N9D A;  2YK0 A;  2EHO B;  4UVC B;  4GYR A;  4BA9 A;  3P4P A;  3AA6 B;  4H9O C;  3LJC A;  4HFV A;  3CML A;  1N32 T;  2ZMA A;  2DWK A;  2BZB A;  2WS3 A;  4PK6 A;  2XAH B;  2NWB A;  4LF8 T;  3MXZ A;  4XAX B;  4CI1 B;  2N1G A;  3UU4 A;  4MLK A;  3PTR B;  2WP9 A;  1ZKE A;  4CI2 B;  3VKH A;  4UEM A;  3VR8 A;  4AQY T;  3J9X 1;  4YTM A;  2XSA A;  4HGA A;  3K3Q C;  1E7P A;  3C64 A;  1Z0P A;  2VL8 A;  4HFE A;  2LJL A;  2UXN B;  2VKH A;  5LHG B;  3KDS E;  5EK2 A;  1V9D A;  4JEH B;  2V7L A;  5LXT E;  5LOV E;  1UX4 A;  3FXD B;  4NIQ A;  5EK3 A;  2BG9 E;  3C4W A;  3Q5E A;  2MOZ A;  2JJ9 A;  2C5J A;  2WWV A;  2V5D A;  5IHY A;  3AE3 A;  2V6Y A;  4MAL A;  4QH4 A;  1HFA A;  4AKR B;  1X9B A;  2JQK A;  4LMJ A;  4NXM T;  2SPC A;  2WY2 A;  3CQG B;  4O4I E;  3O4X E;  3ABV A;  3AAI A;  4HWF A;  3LG7 A;  3MKD A;  1SHZ C;  4YHJ A;  1YW0 A;  4E7Z A;  1HS7 A;  5TAO A;  5LHH B;  2IHR 1;  4I50 E;  4AI6 A;  4Q25 A;  5HEU A;  4WW0 A;  4YSZ A;  5AQN B;  1W0B A;  4Z8X A;  5FL1 A;  5AQF B;  2XAG B;  4H9Q C;  3NBX X;  4JV5 T;  1MMA A;  4IDO A;  5LP6 E;  4WYV A;  3AE8 A;  2LSJ A;  2XQA A;  5FKY A;  4UXN B;  2DLR A;  2CM0 A;  4LF9 T;  4TUY E;  2RA1 A;  4KHP T;  1T8B A;  4CN1 A;  4DO0 A;  4HE8 A;  4EYY R;  4DR7 T;  2XQ7 A;  3RIU C;  4HWD A;  1HTJ F;  2F4V T;  4LF5 T; 
#chains in the Genus database with same CATH homology
 4IT4 A;  2LRK A;  2DL1 A;  2LRL A;  3ZT7 A;  2WY2 A;  2A9U A;  3ZT5 A;  2V6Y B;  4U7I A;  3ZST A;  4ZEY A;  4U2Y A;  1WCR A;  3EAB A;  2WWV A;  3ZSS A;  5CJ5 A;  2CRB A;  2MPK A;  4P1N A;  5FVL A;  4CN1 A;  1WFD A;  4WZX A;  4U7Y A;  1WR0 A;  5CGM A;  2V6Y A;  4U33 A;  1YXR A;  3ZT6 A;  4NIQ A;  3K1S A;  2CPT A;  4U31 A;  2RPA A;  4U3C A;  5LB7 B;  2JQH A;  2K3W A;  2XZE A;  5FVK A;  2JQK A;  2V6X A;  4CN6 A;  4CN4 A;  4A5X A;  2W2U A;  4U2Z A;  2JQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...