4WZXA

Ulk3 regulates cytokinetic abscission by phosphorylating escrt-iii proteins
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
87
structure length
87
Chain Sequence
TSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEYLKEQVKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Serine/threonine-protein kinase ULK3
total genus 38
structure length 87
sequence length 87
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4wzxA01
1WR0A 4U2ZA 4P1NA 5CJ5A 4WZXA 5LB7B 2JQHA 4U31A 4U7IA 2W2UA 4IT4A 2K3WA 2A9UA 2RPAA 4A5XA 2CPTA 5FVLA 4U7YA 3ZT7A 2WY2A 3ZT6A 5FVKA 2V6YA 5CGMA 2V6XA 4U3CA 3EABA 4NIQA 3ZSSA 3ZSTA 2XZEA 4CN6A 3ZT5A 2LRKA 1WFDA 2JQ9A 2CRBA 2LRLA 1WCRA 4U33A 2JQKA 4CN4A 4CN1A 4ZEYA 1YXRA 2MPKA 3K1SA 2WWVA 4U2YA 2DL1A 2V6YB
chains in the Genus database with same CATH superfamily
3GMIA 4DR2T 2DCFA 2VKOA 4P1NA 4ZI3D 4EIWA 4UV9B 1YD8G 5DJQC 5JREA 3LFMA 3E0ZA 3JC6C 4QX7B 3ZCJA 3ZN0B 5F8PA 2PG8A 3FBLA 2V7JA 3ZC1A 4ZHQE 3LG7A 2ZM6T 5L3EB 4U3CA 4LF8T 3DP7A 3HKDE 5C3JA 4OK0A 3OYXA 2CLYC 2WMNA 2XQ7A 2XZEA 3GA8A 3UUBA 1JNZA 2WAUA 3KBTA 5LGNB 4U74A 3QB5K 3ZCIA 4H9SE 3CKDA 4I55E 3ESLA 4O8SA 3RC8A 1ZOYA 2K5BB 2V5CA 1US7B 3MA9A 4FJOA 2KNDA 4PFPA 4NXMT 2JMKA 5TAOA 2OLTA 1ZEEA 1WR6A 4OHFA 4DR6T 3KV6A 2BG9A 4IHJE 2BG9B 2VWAA 5FY1A 3UFGA 1FJGT 1N32T 5KX5E 1X9BA 3MACA 4IE7A 2C5IT 4E7ZA 3JAFA 4JI1T 4JI3T 2IAKA 3AE7A 4P0BA 4Z90A 5AQQB 4HFCA 5CA1E 4PNIA 5LBMA 4AISA 4YT0A 4WBNE 1Y01A 2BS4A 3PDYA 4AKHA 3N5LA 2FJEA 3H3MA 1W9RA 2XQ5A 3OKQA 4QH5A 2VK9A 2VURA 4PFOA 2ODUA 1O3XA 2YDQA 5FY0A 5FXZA 1D0ZA 2XPKA 2I0MA 2MYSA 3IHRA 2EHOB 2A72A 4QXHB 4CXXA 3O9XA 2CBJA 2JPFA 2XSAA 2YK0A 1HCIA 3A7MA 2JQ9A 1QUUA 1MIVA 1WCRA 1IJ6A 2RA1A 1CHUA 3AEAA 2E2AA 5C8YE 5LP6E 5ABEA 1XMOT 2VKHA 1YXRA 2I6HA 2X9YA 5HEHA 2QGSA 3EHZA 5LBQB 4BJNA 5HYAA 4Z8XA 2MOZA 5J0ZA 4BA9A 4AKGA 1HF8A 2XTLA 3I9YA 4O4IE 3AVSA 3ZKRA 2HN2A 4X64T 2V7IA 3OTOT 4DVDA 2E8IA 3AEEA 3CQXC 3KV4A 4PK4A 3U3IA 2QA7A 4CZZB 1YQ3A 4X1IE 3RIUC 4LF6T 3P50A 5HAXA 3ZYMA 3VHLA 5L3BB 2LLYA 1D0XA 2BBJA 2UUAT 4LFBT 5ABGA 3HKCE 4E7SA 5HXEA 5LA6E 2WZIA 3DTOA 1KNRA 4XBFB 4DIDB 2W62A 3N9MA 4H9QC 2IIUA 1E7PA 2YU2A 2IC6A 2QRXA 2J47A 5AQUB 4IIJE 1L0VA 4H9PC 4ISSA 4DV6T 3L8RA 3ONJA 2RP4A 3K3OA 1VCSA 4DUZT 2CRBA 4CN4A 2VASA 3FHNA 3N9NA 3RYCE 3P4SA 2JMHA 1G73A 2WZHA 1J1JA 2MPKA 2ODVA 3P8CD 5AQMB 3KBUA 3P4WA 4UVBB 3UU6A 1HTJF 4GK5E 4L5GA 4KHPT 2CBIA 4XAXB 2JQQA 1UCUA 3AECA 4U2ZA 2A3DA 3CX8B 1W0BA 4YY3T 2KXPB 2CXLA 2W4XA 4JI8T 3T1YT 3KVBA 4K0UA 4JI4T 4HTEA 2D0UA 5AQLB 2YEVC 5JDNA 3RRCA 4DV4T 4U7YA 5HWXA 5L47A 3NRXA 3V5SA 5ADXL 1J5ET 2V6YA 2HH7A 2X9HA 2XQ8A 4LMJA 2IDOB 3Q5DA 4PW8A 5EZYE 5H6QB 5FNVE 4ZI7E 3N9PA 4HFDA 4EGWA 1KF6A 1WRDA 4OYJA 4GIWA 2CXDA 1VCTA 5AFUL 2WP9A 5JDQA 3J7Yq 2V1DB 1LRZA 5A1LA 1HR0T 4JI2T 4DBRA 4M1PA 5L4EA 4TZ4C 2CEAA 2IUBA 3N2KE 3LBXB 4YXDA 4DV2T 2K24A 2KLQA 3H37A 4L0RA 3UTKA 3HI2A 3ETVA 5DABA 2IC9A 5F5WA 4MALA 2AXDS 2X68A 3R84B 2NOXA 5FKYA 2LSKA 3VU7H 4FI5A 4AQGA 5LXTE 5LHGB 4UXNB 2C0SA 2BKPA 1IAPA 2B76A 3FZHB 3JADA 5LYJE 2K3WA 4GKKT 3E08A 3TLUA 4MBQA 4HEAA 4A56A 2A2FX 4WNKA 5JDGA 3L3PA 4MLKA 3UU8A 3UUNA 1YQ4A 3AXJA 3A8YC 2H3RA 2KT9A 3B57A 3J9X1 5CGMA 2VKDA 3NWIA 4CN6A 2NW8A 5JTGA 2LRKA 5IUXA 1MNDA 2VVNA 2NW7A 2Y48B 3C4WA 3UQ4A 5AQRB 3TLTA 1OEDB 2PTFA 2BVLA 3MXZA 2SPCA 4UELA 3RIUA 1BR2A 3L09A 2JIWA 2XAQB 3G06A 4HFBA 2WWVA 2W66A 5LMUT 2WDQA 2WU2A 4HWCA 3RIAA 5HWYA 2BBHA 2VVSA 3PURA 5CB4E 1NAFA 2ACZA 2H7VC 3PUXF 3NZQA 4WZXA 2M6BA 5CA0E 4AKIA 5IYZE 5BMVE 2W2UA 3AEDA 1OXZA 1YKEB 4YTPA 2VQET 1GQEA 5L3DB 3UUMA 4TV8E 5LCYA 3RQUA 5AQKB 3UULA 4A5XA 4KX6A 4GYRA 5ABHA 1LKXA 4ISTA 4IDPA 4ASKA 1SUMB 2R6GF 2XQAA 2N1GA 2ZMAA 3D0TA 3M65A 4NPPA 1S35A 2N9DA 1AJ3A 5JH7E 3B13A 3PU8A 4ZZCA 2EHOA 5M4YA 3AAAB 3AE3A 2D2SA 3ZSTA 5HEJA 1SE7A 4UF0A 1HX8A 1U5PA 2V7MA 4UVCB 5AQVB 3LK2B 2NW9A 3ZYKA 2ZLYA 4ADZA 4B6XA 2UUCT 5FL1A 2YDRA 5EK4A 5KDMC 5AQOB 2V7LA 2XUEA 2VQFT 5LJNA 2BG9C 2V5DA 4U2YA 3PUQA 4Q25A 4CI2B 2X9WA 1E1HB 2X0LB 2LRLA 3DJBA 4I0UA 3RYIE 1KNZA 5LOVE 4DR5T 5LJMA 4QKNA 2X51A 2LSJA 3MJXA 4TWHA 4U31A 2LM9A 4UR9A 2UU9T 4IE5A 1ZV4X 3P7IA 3T8OA 2E5VA 2RPAA 4IE0A 2V8SV 3SFEA 1M62A 2BVMA 2FJBA 1YKHB 2LOSA 5J2TE 4EEDA 2UXXB 4A98A 5LNKA 3C98B 4JYAT 4I50E 4IREA 3LSVA 4AXPA 5AQPB 3FZFB 1WYCA 2YU1A 4CXWA 4JI6T 3EI0A 4H9OC 4UF0B 3V5UA 4IE4A 4U33A 2H89A 3BQLA 3FZMB 3K3NA 3KV5A 3PJAA 2P9BA 1J5WA 3PJAJ 4YFSA 5F3JA 3OPCA 4HFEA 5FXVA 2UXDT 1U4QA 3P4RA 4LMKA 2F4VT 2CCQA 2L9QA 2XM2A 3MKDA 1B7TA 3AE2A 2FBWA 3Q2MA 4PK6A 2E9XB 2WQYA 2X0YA 4NUUA 4OYKA 3TLVA 4DR3T 2VL0A 2KINB 1N33T 4DMWA 1NENA 1IJ5A 1ZP0A 3GN5A 3OJAA 2OA5A 3RIFA 2FJAA 2X9XA 1N34T 4YSZA 3IEEA 4EXTA 1HNXT 2XQ6A 3CWZB 3SRZA 4CI3B 3OVUA 4F6RC 3ZT6A 2G0UA 4BJMA 2D5UA 3W15B 2W61A 4GYSA 4LF4T 1UURA 5L2LA 3F31A 4DV1T 1SA0E 4F8HA 1QSDA 5FL0A 2UXBT 2ZM0A 4QH1A 3PUAA 4UVAB 1UUSA 4DR4T 3ZMUB 2ZM8A 1T98A 4HWDA 4QHOA 4DV7T 5HXRA 2E9XC 4GOUA 3RQWA 5J2UE 2GK9A 5JR9C 2DL1A 4EB6E 5L3GB 3ZN1B 2WWUA 4KBMB 1V9DA 2E9XD 3PU3A 4B3ST 1I94T 4OFZA 4MFRA 2XM1A 3FBZA 4U7IA 4IL9A 2MBGA 4WYVA 4QXBB 1XDOA 1VRBA 3GWHA 4QH4A 3RGLA 2KWIB 3UU4A 1D1AA 1WLXA 4O4HE 3UU3A 4YJ3E 1UK5A 4HKAA 3ABVA 3NRYA 3N9QA 2V6XA 5JDMA 2VB6A 3FZKB 4B3RT 3AE4A 3RYFE 2Q9QA 2YINA 4JUYA 2V26A 1E2AA 3UU5A 3ZT5A 4EZ4A 3ZPOA 3Q5EA 1T8BA 2FUPA 4PJNA 4I43B 2JQKA 4TNVA 4ZZBA 5JR9A 3FB2A 1W09A 4DO0A 5LGUB 3K1SA 1QLBA 2CWYA 5C2TA 1M7KA 3NZPA 2ES0A 2WBLA 2D0TA 3CMLA 2LKGA 3MZKB 4UEMA 2CHOA 2YDSA 1G8XA 2B1EA 3A5XA 5EK3A 3ZYLA 4B3TT 4YHHT 4HGAA 4TWDA 5ABFB 2DHRA 3CX6B 3RKGA 4TWFA 4DMVA 4IDOA 1XWMA 2W63A 5KXJA 3O1JA 4H9NC 2L8KA 3PUSA 5LGTB 5AQHB 3ZMSB 5H6RB 4IGUA 2CPTA 3EVYA 3CVRA 3PV0F 4O2BE 1I6ZA 3LBXA 4TNWA 2PFVA 2UXCT 5FVKA 5HEOA 3C51A 2Q9QB 2XY8B 1Z8UA 3ANWA 3EDUA 1MMNA 3HL6A 4JI0T 5CFBA 5AQSB 3I0QA 5FXXA 3SFDA 4AIUA 3KDSE 2CXFA 1OEDA 4TUYE 3LK3B 4V1Av 4XZCA 5IWAT 4X66T 5HEUA 4LF5T 4WBOA 2WB5A 3AEGA 2HHHT 1XMQT 2I59A 2DWKA 1KEYA 5JDFA 1SHZC 2WSSV 3AE9A 4GK0E 3QOFA 4KMCA 3WAKA 1FEWA 2W67A 2V7KA 1OEDE 1LVKA 3AXJB 4EYUA 3RHWA 3LK42 4DR1T 3RRWA 3UT5E 4IL4A 4HWFA 1IBLT 3HR0A 4JEHB 2LEHA 5AQFB 1MIWA 2QVAA 4EOZB 4DUYT 2K9AA 2CLYB 1LVFA 3N2GE 3RX6A 3EUHA 1S94A 2LSIA 3QC9A 4HFIA 4HWHA 2BS3A 5FP3A 4AKLA 4YJ2E 2XQ4A 4QX8B 4AQYT 4DV5T 3I9WA 2XAHB 1T72A 1D1BA 2JRKA 1HG5A 2NTYA 3C64A 3Q9DA 2DWGA 4DR7T 1FIOA 4YHJA 2NP9A 4IDQA 2IW5B 1JNRA 2YN6A 3VRAA 3AA0B 1MIYA 2WDVA 2MAWA 2WM9A 3PUWF 4O4JE 5AQGB 2M6IA 4EYYR 2ZM2A 1T7SA 3ETUA 4CXYA 4CN1A 4KUMB 4K0KT 2LE8A 1XZYA 2WS3A 2DLRA 3KV9A 2NR4A 4NUVA 3PUGA 5FMNA 2UUBT 1MMAA 2BKOA 2DI4A 4X65T 5L4HA 4DNDA 4JV5T 3P4PA 1UGOA 3F2EA 4YSYA 2D9DA 3P4QA 3KINB 4QWNB 5DQVA 3ZMVB 2HN1A 2JJ9A 1EZ3A 4YTMA 5JVDE 2M67A 3LDQB 3B5MA 1OEDC 3QUJA 2Y8DA 2OV9A 4HE8A 4HFHA 2JQHA 3ZJ2A 2NWBA 3PE0A 2NTXA 4X62T 4CQIA 1YW0A 3GN5B 5HXSA 3H3AA 4O2AE 4EEBA 1IBKT 3VKGA 1W0AA 3C50A 5FVLA 1BR0A 2LSGA 3NKZA 2XASB 2C5JA 4MHCA 1XNRT 3AE6A 2LHNA 1DU2A 2J1DG 5JRCB 2XQ3A 4A97A 4ANJA 4DV3T 1MNEA 3RYHE 4YTNA 1MMGA 2KZ7B 3CX7B 2LT3A 2N2NA 4KI0F 4PJJA 5HCMA 4ZI2C 4X1KE 4ERRA 4PK5A 4ZOLE 2LHRA 3FZLB 5IHYA 3AEBA 4DBQA 1HS7A 2IMLA 2BG9E 1H7CA 2CA5A 3TLSA 1CUNA 4ZI2D 3JAEA 3UFEA 3ZMZB 3UQ7A 4YSXA 1KNPA 4P0AA 3AA1B 3ZEFB 3I1AA 4KP3C 4UV8B 1X79A 4Z91A 2L3LA 2Q9QD 3ONLC 1D0YA 4O4LE 4TN7B 5HEGA 3QNUA 2BDEA 5CJ5A 3AVRA 3N9OA 3RKOA 5L3FB 2YOEA 4JBWF 5DQWA 3PUVF 2BS2A 4IT4A 4X5TA 4KHZF 3SWHA 4ZI3C 2A9UA 3ONXA 3Q5WA 3JC6D 3QB5A 2WY2A 5AQJB 4ZXLA 3NVOA 5ETWA 5JDHA 3T1HT 4H63H 2UXNB 4X1YE 2WMOA 3ANWB 4IE6A 4JI5T 4YLHA 2W00A 3RI5A 3R6NA 4NXNT 3F57A 4COFA 4JI7T 2DNXA 2VKJA 3AA6B 1XDPA 4EAHA 3FXDB 5LG4A 2EHOC 3E22E 1BR4A 2W0GA 2YKSA 3L39A 3SOLA 4ZEYA 5FYMA 5LHIB 2XJ7A 4LFAT 2LM2A 3RLFF 4ILUA 2X0HA 3AE5A 4TX5A 2XSBA 4LFCT 2EHOD 2CHNA 2WCAA 1MMDA 2XAJB 4ILCA 3RC3A 5ABFA 1Z0PA 3VR9A 4G2AA 3K8PC 3AAEB 2AE9A 4WW0A 5LB7B 4JLEA 3HKEE 3O1IA 1VOMA 2PJQA 4G63A 2Z6EA 2C5KT 4CI1B 5L3CB 2FJDA 2VL8A 3HA4A 5J1GA 3ZT7A 2BKNA 3WI3A 4HWIB 1HNZT 3I0OA 3TLWA 4C91A 1D1CA 2X66A 3O4XE 3ZSSA 3RPUA 1OWAA 1WFDA 3K3QC 4H9RC 1KK7A 1ZHCA 4J2CA 4JEUB 4LF7T 5JQGE 2J4GA 3CIRA 4LMLA 4AI6A 3KVAA 3OYZA 1HX1B 3RH3A 2KSRA 2CWOA 4L9IA 1UX4A 4B3MT 4ILAA 3N2OA 3PUYF 3C4ZA 3CK6A 1HFAA 4AQFC 5BR8T 5LMNT 3PTRB 3AA7B 3RF1A 4HN9A 3HKBE 1WYBA 5LG3A 5JRCA 4OX9T 3AB3B 4N78D 2Y6XA 2X67A 3AE1A 3BK9A 2ACXA 3CQGB 4X20E 3UUXB 4EV6A 5KMGP 2XQ9A 4BAYB 2IHR1 5JR9B 3VKHA 1NEKA 4PJMA 2HPLA 3S4UA 2WU5A 1FMWA 4IDNA 4HFVA 2HPJA 4NIQA 2LSYA 3M3ZB 3WAJA 4I4TE 1IBMT 3ZLIA 2KWHA 3EAMA 1XNQT 5LHHB 2CM0A 3C4XA 2KMFA 2WDRA 1FMVA 3LJCA 5E0OA 4PJLA 4UIGA 4DV0T 5AQTB 3PUZF 2CMRA 2LJLA 2LOPA 3NBXX 2CE7A 4GKJT 3TKLB 3CQCB 3IBPA 4P09A 5FY7A 4EZHA 2E5LT 2BZBA 2MTQA 2K48A 4TV9E 2E9XA 4ZS2A 1HNWT 2LKHA 1WR0A 3N9LA 1HG2A 2H88A 4AKRB 2XAFB 3BQKA 4ZS3A 1R8IA 4AQFA 3VR8A 3IF8B 1BR1A 1Y64B 1IZNB 2PBIA 3IA3A 3FXEB 4LF9T 3ZC0A 3U78A 2XQYA 3O1HA 2QYWA 5GONE 3ZJ1A 2XAGB 5JDLA 3KFWX 5FXWA 3EABA 3EDVA 3AE8A 2XHEB 3QK6A 5AQIB 3OBVE 3SS1A 3CPZA 2H7OA 2J62A 1NWMX 3Q5XA 5EK2A 3BQIA 5HXHA 4PAGA 1ZKEA 5HCJA 3AAIA 3MK7C 3JCFA 4U72A 3VRBA 4IDZA 4QXCB 4H63V 3AEFA 1UX5A 2Q9QC 5AQNB 3ZMTB 5HXCA 4ILBA 1N36T 4C90A 3X1DA 1KFYA 2V6YB
chains in the Genus database with same CATH topology
1WR0A 4U2ZA 4P1NA 5CJ5A 4WZXA 5LB7B 2JQHA 4U31A 4U7IA 2W2UA 4IT4A 2K3WA 2A9UA 2RPAA 4A5XA 2CPTA 5FVLA 4U7YA 3ZT7A 2WY2A 3ZT6A 5FVKA 2V6YA 5CGMA 2V6XA 4U3CA 3EABA 4NIQA 3ZSSA 3ZSTA 2XZEA 4CN6A 3ZT5A 2LRKA 1WFDA 2JQ9A 2CRBA 2LRLA 1WCRA 4U33A 2JQKA 4CN4A 4CN1A 4ZEYA 1YXRA 2MPKA 3K1SA 2WWVA 4U2YA 2DL1A 2V6YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR0 A;  4U2Z A;  4P1N A;  5CJ5 A;  4WZX A;  5LB7 B;  2JQH A;  4U31 A;  4U7I A;  2W2U A;  4IT4 A;  2K3W A;  2A9U A;  2RPA A;  4A5X A;  2CPT A;  5FVL A;  4U7Y A;  3ZT7 A;  2WY2 A;  3ZT6 A;  5FVK A;  2V6Y A;  5CGM A;  2V6X A;  4U3C A;  3EAB A;  4NIQ A;  3ZSS A;  3ZST A;  2XZE A;  4CN6 A;  3ZT5 A;  2LRK A;  1WFD A;  2JQ9 A;  2CRB A;  2LRL A;  1WCR A;  4U33 A;  2JQK A;  4CN4 A;  4CN1 A;  4ZEY A;  1YXR A;  2MPK A;  3K1S A;  2WWV A;  4U2Y A;  2DL1 A;  2V6Y B; 
#chains in the Genus database with same CATH topology
 3GMI A;  4DR2 T;  2DCF A;  2VKO A;  4P1N A;  4ZI3 D;  4EIW A;  4UV9 B;  1YD8 G;  5DJQ C;  5JRE A;  3LFM A;  3E0Z A;  3JC6 C;  4QX7 B;  3ZCJ A;  3ZN0 B;  5F8P A;  2PG8 A;  3FBL A;  2V7J A;  3ZC1 A;  4ZHQ E;  3LG7 A;  2ZM6 T;  5L3E B;  4U3C A;  4LF8 T;  3DP7 A;  3HKD E;  5C3J A;  4OK0 A;  3OYX A;  2CLY C;  2WMN A;  2XQ7 A;  2XZE A;  3GA8 A;  3UUB A;  1JNZ A;  2WAU A;  3KBT A;  5LGN B;  4U74 A;  3QB5 K;  3ZCI A;  4H9S E;  3CKD A;  4I55 E;  3ESL A;  4O8S A;  3RC8 A;  1ZOY A;  2K5B B;  2V5C A;  1US7 B;  3MA9 A;  4FJO A;  2KND A;  4PFP A;  4NXM T;  2JMK A;  5TAO A;  2OLT A;  1ZEE A;  1WR6 A;  4OHF A;  4DR6 T;  3KV6 A;  2BG9 A;  4IHJ E;  2BG9 B;  2VWA A;  5FY1 A;  3UFG A;  1FJG T;  1N32 T;  5KX5 E;  1X9B A;  3MAC A;  4IE7 A;  2C5I T;  4E7Z A;  3JAF A;  4JI1 T;  4JI3 T;  2IAK A;  3AE7 A;  4P0B A;  4Z90 A;  5AQQ B;  4HFC A;  5CA1 E;  4PNI A;  5LBM A;  4AIS A;  4YT0 A;  4WBN E;  1Y01 A;  2BS4 A;  3PDY A;  4AKH A;  3N5L A;  2FJE A;  3H3M A;  1W9R A;  2XQ5 A;  3OKQ A;  4QH5 A;  2VK9 A;  2VUR A;  4PFO A;  2ODU A;  1O3X A;  2YDQ A;  5FY0 A;  5FXZ A;  1D0Z A;  2XPK A;  2I0M A;  2MYS A;  3IHR A;  2EHO B;  2A72 A;  4QXH B;  4CXX A;  3O9X A;  2CBJ A;  2JPF A;  2XSA A;  2YK0 A;  1HCI A;  3A7M A;  2JQ9 A;  1QUU A;  1MIV A;  1WCR A;  1IJ6 A;  2RA1 A;  1CHU A;  3AEA A;  2E2A A;  5C8Y E;  5LP6 E;  5ABE A;  1XMO T;  2VKH A;  1YXR A;  2I6H A;  2X9Y A;  5HEH A;  2QGS A;  3EHZ A;  5LBQ B;  4BJN A;  5HYA A;  4Z8X A;  2MOZ A;  5J0Z A;  4BA9 A;  4AKG A;  1HF8 A;  2XTL A;  3I9Y A;  4O4I E;  3AVS A;  3ZKR A;  2HN2 A;  4X64 T;  2V7I A;  3OTO T;  4DVD A;  2E8I A;  3AEE A;  3CQX C;  3KV4 A;  4PK4 A;  3U3I A;  2QA7 A;  4CZZ B;  1YQ3 A;  4X1I E;  3RIU C;  4LF6 T;  3P50 A;  5HAX A;  3ZYM A;  3VHL A;  5L3B B;  2LLY A;  1D0X A;  2BBJ A;  2UUA T;  4LFB T;  5ABG A;  3HKC E;  4E7S A;  5HXE A;  5LA6 E;  2WZI A;  3DTO A;  1KNR A;  4XBF B;  4DID B;  2W62 A;  3N9M A;  4H9Q C;  2IIU A;  1E7P A;  2YU2 A;  2IC6 A;  2QRX A;  2J47 A;  5AQU B;  4IIJ E;  1L0V A;  4H9P C;  4ISS A;  4DV6 T;  3L8R A;  3ONJ A;  2RP4 A;  3K3O A;  1VCS A;  4DUZ T;  2CRB A;  4CN4 A;  2VAS A;  3FHN A;  3N9N A;  3RYC E;  3P4S A;  2JMH A;  1G73 A;  2WZH A;  1J1J A;  2MPK A;  2ODV A;  3P8C D;  5AQM B;  3KBU A;  3P4W A;  4UVB B;  3UU6 A;  1HTJ F;  4GK5 E;  4L5G A;  4KHP T;  2CBI A;  4XAX B;  2JQQ A;  1UCU A;  3AEC A;  4U2Z A;  2A3D A;  3CX8 B;  1W0B A;  4YY3 T;  2KXP B;  2CXL A;  2W4X A;  4JI8 T;  3T1Y T;  3KVB A;  4K0U A;  4JI4 T;  4HTE A;  2D0U A;  5AQL B;  2YEV C;  5JDN A;  3RRC A;  4DV4 T;  4U7Y A;  5HWX A;  5L47 A;  3NRX A;  3V5S A;  5ADX L;  1J5E T;  2V6Y A;  2HH7 A;  2X9H A;  2XQ8 A;  4LMJ A;  2IDO B;  3Q5D A;  4PW8 A;  5EZY E;  5H6Q B;  5FNV E;  4ZI7 E;  3N9P A;  4HFD A;  4EGW A;  1KF6 A;  1WRD A;  4OYJ A;  4GIW A;  2CXD A;  1VCT A;  5AFU L;  2WP9 A;  5JDQ A;  3J7Y q;  2V1D B;  1LRZ A;  5A1L A;  1HR0 T;  4JI2 T;  4DBR A;  4M1P A;  5L4E A;  4TZ4 C;  2CEA A;  2IUB A;  3N2K E;  3LBX B;  4YXD A;  4DV2 T;  2K24 A;  2KLQ A;  3H37 A;  4L0R A;  3UTK A;  3HI2 A;  3ETV A;  5DAB A;  2IC9 A;  5F5W A;  4MAL A;  2AXD S;  2X68 A;  3R84 B;  2NOX A;  5FKY A;  2LSK A;  3VU7 H;  4FI5 A;  4AQG A;  5LXT E;  5LHG B;  4UXN B;  2C0S A;  2BKP A;  1IAP A;  2B76 A;  3FZH B;  3JAD A;  5LYJ E;  2K3W A;  4GKK T;  3E08 A;  3TLU A;  4MBQ A;  4HEA A;  4A56 A;  2A2F X;  4WNK A;  5JDG A;  3L3P A;  4MLK A;  3UU8 A;  3UUN A;  1YQ4 A;  3AXJ A;  3A8Y C;  2H3R A;  2KT9 A;  3B57 A;  3J9X 1;  5CGM A;  2VKD A;  3NWI A;  4CN6 A;  2NW8 A;  5JTG A;  2LRK A;  5IUX A;  1MND A;  2VVN A;  2NW7 A;  2Y48 B;  3C4W A;  3UQ4 A;  5AQR B;  3TLT A;  1OED B;  2PTF A;  2BVL A;  3MXZ A;  2SPC A;  4UEL A;  3RIU A;  1BR2 A;  3L09 A;  2JIW A;  2XAQ B;  3G06 A;  4HFB A;  2WWV A;  2W66 A;  5LMU T;  2WDQ A;  2WU2 A;  4HWC A;  3RIA A;  5HWY A;  2BBH A;  2VVS A;  3PUR A;  5CB4 E;  1NAF A;  2ACZ A;  2H7V C;  3PUX F;  3NZQ A;  4WZX A;  2M6B A;  5CA0 E;  4AKI A;  5IYZ E;  5BMV E;  2W2U A;  3AED A;  1OXZ A;  1YKE B;  4YTP A;  2VQE T;  1GQE A;  5L3D B;  3UUM A;  4TV8 E;  5LCY A;  3RQU A;  5AQK B;  3UUL A;  4A5X A;  4KX6 A;  4GYR A;  5ABH A;  1LKX A;  4IST A;  4IDP A;  4ASK A;  1SUM B;  2R6G F;  2XQA A;  2N1G A;  2ZMA A;  3D0T A;  3M65 A;  4NPP A;  1S35 A;  2N9D A;  1AJ3 A;  5JH7 E;  3B13 A;  3PU8 A;  4ZZC A;  2EHO A;  5M4Y A;  3AAA B;  3AE3 A;  2D2S A;  3ZST A;  5HEJ A;  1SE7 A;  4UF0 A;  1HX8 A;  1U5P A;  2V7M A;  4UVC B;  5AQV B;  3LK2 B;  2NW9 A;  3ZYK A;  2ZLY A;  4ADZ A;  4B6X A;  2UUC T;  5FL1 A;  2YDR A;  5EK4 A;  5KDM C;  5AQO B;  2V7L A;  2XUE A;  2VQF T;  5LJN A;  2BG9 C;  2V5D A;  4U2Y A;  3PUQ A;  4Q25 A;  4CI2 B;  2X9W A;  1E1H B;  2X0L B;  2LRL A;  3DJB A;  4I0U A;  3RYI E;  1KNZ A;  5LOV E;  4DR5 T;  5LJM A;  4QKN A;  2X51 A;  2LSJ A;  3MJX A;  4TWH A;  4U31 A;  2LM9 A;  4UR9 A;  2UU9 T;  4IE5 A;  1ZV4 X;  3P7I A;  3T8O A;  2E5V A;  2RPA A;  4IE0 A;  2V8S V;  3SFE A;  1M62 A;  2BVM A;  2FJB A;  1YKH B;  2LOS A;  5J2T E;  4EED A;  2UXX B;  4A98 A;  5LNK A;  3C98 B;  4JYA T;  4I50 E;  4IRE A;  3LSV A;  4AXP A;  5AQP B;  3FZF B;  1WYC A;  2YU1 A;  4CXW A;  4JI6 T;  3EI0 A;  4H9O C;  4UF0 B;  3V5U A;  4IE4 A;  4U33 A;  2H89 A;  3BQL A;  3FZM B;  3K3N A;  3KV5 A;  3PJA A;  2P9B A;  1J5W A;  3PJA J;  4YFS A;  5F3J A;  3OPC A;  4HFE A;  5FXV A;  2UXD T;  1U4Q A;  3P4R A;  4LMK A;  2F4V T;  2CCQ A;  2L9Q A;  2XM2 A;  3MKD A;  1B7T A;  3AE2 A;  2FBW A;  3Q2M A;  4PK6 A;  2E9X B;  2WQY A;  2X0Y A;  4NUU A;  4OYK A;  3TLV A;  4DR3 T;  2VL0 A;  2KIN B;  1N33 T;  4DMW A;  1NEN A;  1IJ5 A;  1ZP0 A;  3GN5 A;  3OJA A;  2OA5 A;  3RIF A;  2FJA A;  2X9X A;  1N34 T;  4YSZ A;  3IEE A;  4EXT A;  1HNX T;  2XQ6 A;  3CWZ B;  3SRZ A;  4CI3 B;  3OVU A;  4F6R C;  3ZT6 A;  2G0U A;  4BJM A;  2D5U A;  3W15 B;  2W61 A;  4GYS A;  4LF4 T;  1UUR A;  5L2L A;  3F31 A;  4DV1 T;  1SA0 E;  4F8H A;  1QSD A;  5FL0 A;  2UXB T;  2ZM0 A;  4QH1 A;  3PUA A;  4UVA B;  1UUS A;  4DR4 T;  3ZMU B;  2ZM8 A;  1T98 A;  4HWD A;  4QHO A;  4DV7 T;  5HXR A;  2E9X C;  4GOU A;  3RQW A;  5J2U E;  2GK9 A;  5JR9 C;  2DL1 A;  4EB6 E;  5L3G B;  3ZN1 B;  2WWU A;  4KBM B;  1V9D A;  2E9X D;  3PU3 A;  4B3S T;  1I94 T;  4OFZ A;  4MFR A;  2XM1 A;  3FBZ A;  4U7I A;  4IL9 A;  2MBG A;  4WYV A;  4QXB B;  1XDO A;  1VRB A;  3GWH A;  4QH4 A;  3RGL A;  2KWI B;  3UU4 A;  1D1A A;  1WLX A;  4O4H E;  3UU3 A;  4YJ3 E;  1UK5 A;  4HKA A;  3ABV A;  3NRY A;  3N9Q A;  2V6X A;  5JDM A;  2VB6 A;  3FZK B;  4B3R T;  3AE4 A;  3RYF E;  2Q9Q A;  2YIN A;  4JUY A;  2V26 A;  1E2A A;  3UU5 A;  3ZT5 A;  4EZ4 A;  3ZPO A;  3Q5E A;  1T8B A;  2FUP A;  4PJN A;  4I43 B;  2JQK A;  4TNV A;  4ZZB A;  5JR9 A;  3FB2 A;  1W09 A;  4DO0 A;  5LGU B;  3K1S A;  1QLB A;  2CWY A;  5C2T A;  1M7K A;  3NZP A;  2ES0 A;  2WBL A;  2D0T A;  3CML A;  2LKG A;  3MZK B;  4UEM A;  2CHO A;  2YDS A;  1G8X A;  2B1E A;  3A5X A;  5EK3 A;  3ZYL A;  4B3T T;  4YHH T;  4HGA A;  4TWD A;  5ABF B;  2DHR A;  3CX6 B;  3RKG A;  4TWF A;  4DMV A;  4IDO A;  1XWM A;  2W63 A;  5KXJ A;  3O1J A;  4H9N C;  2L8K A;  3PUS A;  5LGT B;  5AQH B;  3ZMS B;  5H6R B;  4IGU A;  2CPT A;  3EVY A;  3CVR A;  3PV0 F;  4O2B E;  1I6Z A;  3LBX A;  4TNW A;  2PFV A;  2UXC T;  5FVK A;  5HEO A;  3C51 A;  2Q9Q B;  2XY8 B;  1Z8U A;  3ANW A;  3EDU A;  1MMN A;  3HL6 A;  4JI0 T;  5CFB A;  5AQS B;  3I0Q A;  5FXX A;  3SFD A;  4AIU A;  3KDS E;  2CXF A;  1OED A;  4TUY E;  3LK3 B;  4V1A v;  4XZC A;  5IWA T;  4X66 T;  5HEU A;  4LF5 T;  4WBO A;  2WB5 A;  3AEG A;  2HHH T;  1XMQ T;  2I59 A;  2DWK A;  1KEY A;  5JDF A;  1SHZ C;  2WSS V;  3AE9 A;  4GK0 E;  3QOF A;  4KMC A;  3WAK A;  1FEW A;  2W67 A;  2V7K A;  1OED E;  1LVK A;  3AXJ B;  4EYU A;  3RHW A;  3LK4 2;  4DR1 T;  3RRW A;  3UT5 E;  4IL4 A;  4HWF A;  1IBL T;  3HR0 A;  4JEH B;  2LEH A;  5AQF B;  1MIW A;  2QVA A;  4EOZ B;  4DUY T;  2K9A A;  2CLY B;  1LVF A;  3N2G E;  3RX6 A;  3EUH A;  1S94 A;  2LSI A;  3QC9 A;  4HFI A;  4HWH A;  2BS3 A;  5FP3 A;  4AKL A;  4YJ2 E;  2XQ4 A;  4QX8 B;  4AQY T;  4DV5 T;  3I9W A;  2XAH B;  1T72 A;  1D1B A;  2JRK A;  1HG5 A;  2NTY A;  3C64 A;  3Q9D A;  2DWG A;  4DR7 T;  1FIO A;  4YHJ A;  2NP9 A;  4IDQ A;  2IW5 B;  1JNR A;  2YN6 A;  3VRA A;  3AA0 B;  1MIY A;  2WDV A;  2MAW A;  2WM9 A;  3PUW F;  4O4J E;  5AQG B;  2M6I A;  4EYY R;  2ZM2 A;  1T7S A;  3ETU A;  4CXY A;  4CN1 A;  4KUM B;  4K0K T;  2LE8 A;  1XZY A;  2WS3 A;  2DLR A;  3KV9 A;  2NR4 A;  4NUV A;  3PUG A;  5FMN A;  2UUB T;  1MMA A;  2BKO A;  2DI4 A;  4X65 T;  5L4H A;  4DND A;  4JV5 T;  3P4P A;  1UGO A;  3F2E A;  4YSY A;  2D9D A;  3P4Q A;  3KIN B;  4QWN B;  5DQV A;  3ZMV B;  2HN1 A;  2JJ9 A;  1EZ3 A;  4YTM A;  5JVD E;  2M67 A;  3LDQ B;  3B5M A;  1OED C;  3QUJ A;  2Y8D A;  2OV9 A;  4HE8 A;  4HFH A;  2JQH A;  3ZJ2 A;  2NWB A;  3PE0 A;  2NTX A;  4X62 T;  4CQI A;  1YW0 A;  3GN5 B;  5HXS A;  3H3A A;  4O2A E;  4EEB A;  1IBK T;  3VKG A;  1W0A A;  3C50 A;  5FVL A;  1BR0 A;  2LSG A;  3NKZ A;  2XAS B;  2C5J A;  4MHC A;  1XNR T;  3AE6 A;  2LHN A;  1DU2 A;  2J1D G;  5JRC B;  2XQ3 A;  4A97 A;  4ANJ A;  4DV3 T;  1MNE A;  3RYH E;  4YTN A;  1MMG A;  2KZ7 B;  3CX7 B;  2LT3 A;  2N2N A;  4KI0 F;  4PJJ A;  5HCM A;  4ZI2 C;  4X1K E;  4ERR A;  4PK5 A;  4ZOL E;  2LHR A;  3FZL B;  5IHY A;  3AEB A;  4DBQ A;  1HS7 A;  2IML A;  2BG9 E;  1H7C A;  2CA5 A;  3TLS A;  1CUN A;  4ZI2 D;  3JAE A;  3UFE A;  3ZMZ B;  3UQ7 A;  4YSX A;  1KNP A;  4P0A A;  3AA1 B;  3ZEF B;  3I1A A;  4KP3 C;  4UV8 B;  1X79 A;  4Z91 A;  2L3L A;  2Q9Q D;  3ONL C;  1D0Y A;  4O4L E;  4TN7 B;  5HEG A;  3QNU A;  2BDE A;  5CJ5 A;  3AVR A;  3N9O A;  3RKO A;  5L3F B;  2YOE A;  4JBW F;  5DQW A;  3PUV F;  2BS2 A;  4IT4 A;  4X5T A;  4KHZ F;  3SWH A;  4ZI3 C;  2A9U A;  3ONX A;  3Q5W A;  3JC6 D;  3QB5 A;  2WY2 A;  5AQJ B;  4ZXL A;  3NVO A;  5ETW A;  5JDH A;  3T1H T;  4H63 H;  2UXN B;  4X1Y E;  2WMO A;  3ANW B;  4IE6 A;  4JI5 T;  4YLH A;  2W00 A;  3RI5 A;  3R6N A;  4NXN T;  3F57 A;  4COF A;  4JI7 T;  2DNX A;  2VKJ A;  3AA6 B;  1XDP A;  4EAH A;  3FXD B;  5LG4 A;  2EHO C;  3E22 E;  1BR4 A;  2W0G A;  2YKS A;  3L39 A;  3SOL A;  4ZEY A;  5FYM A;  5LHI B;  2XJ7 A;  4LFA T;  2LM2 A;  3RLF F;  4ILU A;  2X0H A;  3AE5 A;  4TX5 A;  2XSB A;  4LFC T;  2EHO D;  2CHN A;  2WCA A;  1MMD A;  2XAJ B;  4ILC A;  3RC3 A;  5ABF A;  1Z0P A;  3VR9 A;  4G2A A;  3K8P C;  3AAE B;  2AE9 A;  4WW0 A;  5LB7 B;  4JLE A;  3HKE E;  3O1I A;  1VOM A;  2PJQ A;  4G63 A;  2Z6E A;  2C5K T;  4CI1 B;  5L3C B;  2FJD A;  2VL8 A;  3HA4 A;  5J1G A;  3ZT7 A;  2BKN A;  3WI3 A;  4HWI B;  1HNZ T;  3I0O A;  3TLW A;  4C91 A;  1D1C A;  2X66 A;  3O4X E;  3ZSS A;  3RPU A;  1OWA A;  1WFD A;  3K3Q C;  4H9R C;  1KK7 A;  1ZHC A;  4J2C A;  4JEU B;  4LF7 T;  5JQG E;  2J4G A;  3CIR A;  4LML A;  4AI6 A;  3KVA A;  3OYZ A;  1HX1 B;  3RH3 A;  2KSR A;  2CWO A;  4L9I A;  1UX4 A;  4B3M T;  4ILA A;  3N2O A;  3PUY F;  3C4Z A;  3CK6 A;  1HFA A;  4AQF C;  5BR8 T;  5LMN T;  3PTR B;  3AA7 B;  3RF1 A;  4HN9 A;  3HKB E;  1WYB A;  5LG3 A;  5JRC A;  4OX9 T;  3AB3 B;  4N78 D;  2Y6X A;  2X67 A;  3AE1 A;  3BK9 A;  2ACX A;  3CQG B;  4X20 E;  3UUX B;  4EV6 A;  5KMG P;  2XQ9 A;  4BAY B;  2IHR 1;  5JR9 B;  3VKH A;  1NEK A;  4PJM A;  2HPL A;  3S4U A;  2WU5 A;  1FMW A;  4IDN A;  4HFV A;  2HPJ A;  4NIQ A;  2LSY A;  3M3Z B;  3WAJ A;  4I4T E;  1IBM T;  3ZLI A;  2KWH A;  3EAM A;  1XNQ T;  5LHH B;  2CM0 A;  3C4X A;  2KMF A;  2WDR A;  1FMV A;  3LJC A;  5E0O A;  4PJL A;  4UIG A;  4DV0 T;  5AQT B;  3PUZ F;  2CMR A;  2LJL A;  2LOP A;  3NBX X;  2CE7 A;  4GKJ T;  3TKL B;  3CQC B;  3IBP A;  4P09 A;  5FY7 A;  4EZH A;  2E5L T;  2BZB A;  2MTQ A;  2K48 A;  4TV9 E;  2E9X A;  4ZS2 A;  1HNW T;  2LKH A;  1WR0 A;  3N9L A;  1HG2 A;  2H88 A;  4AKR B;  2XAF B;  3BQK A;  4ZS3 A;  1R8I A;  4AQF A;  3VR8 A;  3IF8 B;  1BR1 A;  1Y64 B;  1IZN B;  2PBI A;  3IA3 A;  3FXE B;  4LF9 T;  3ZC0 A;  3U78 A;  2XQY A;  3O1H A;  2QYW A;  5GON E;  3ZJ1 A;  2XAG B;  5JDL A;  3KFW X;  5FXW A;  3EAB A;  3EDV A;  3AE8 A;  2XHE B;  3QK6 A;  5AQI B;  3OBV E;  3SS1 A;  3CPZ A;  2H7O A;  2J62 A;  1NWM X;  3Q5X A;  5EK2 A;  3BQI A;  5HXH A;  4PAG A;  1ZKE A;  5HCJ A;  3AAI A;  3MK7 C;  3JCF A;  4U72 A;  3VRB A;  4IDZ A;  4QXC B;  4H63 V;  3AEF A;  1UX5 A;  2Q9Q C;  5AQN B;  3ZMT B;  5HXC A;  4ILB A;  1N36 T;  4C90 A;  3X1D A;  1KFY A;  2V6Y B; 
#chains in the Genus database with same CATH homology
 1WR0 A;  4U2Z A;  4P1N A;  5CJ5 A;  4WZX A;  5LB7 B;  2JQH A;  4U31 A;  4U7I A;  2W2U A;  4IT4 A;  2K3W A;  2A9U A;  2RPA A;  4A5X A;  2CPT A;  5FVL A;  4U7Y A;  3ZT7 A;  2WY2 A;  3ZT6 A;  5FVK A;  2V6Y A;  5CGM A;  2V6X A;  4U3C A;  3EAB A;  4NIQ A;  3ZSS A;  3ZST A;  2XZE A;  4CN6 A;  3ZT5 A;  2LRK A;  1WFD A;  2JQ9 A;  2CRB A;  2LRL A;  1WCR A;  4U33 A;  2JQK A;  4CN4 A;  4CN1 A;  4ZEY A;  1YXR A;  2MPK A;  3K1S A;  2WWV A;  4U2Y A;  2DL1 A;  2V6Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...