4TN7B

Crystal structure of mouse kdm2a-h3k36me-no complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 2A
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4tn7B00
4QWNB 4TN7B 4QX7B 4QXHB 4QX8B 4QXBB 4QXCB
chains in the Genus database with same CATH superfamily
4NPPA 2ACXA 2CEAA 2KWIB 2L9QA 4X65T 3OKQA 5HXHA 2E5VA 2CE7A 4AISA 2JRKA 2VKOA 2X0YA 2CLYB 4WZXA 3RYFE 2YK0A 3SOLA 3KBTA 4ZOLE 1E2AA 5IHYA 3UU4A 4CXWA 3CMLA 5JR9C 4C91A 2J47A 5AQPB 3TLSA 3AE6A 4Q25A 3VHLA 2BKNA 2ZM0A 3D0TA 1OEDA 2XASB 4PAGA 2UU9T 4O4JE 3KBUA 4H9QC 5JRCA 1D1AA 4UR9A 3RC8A 2LLYA 4YSXA 2HN1A 3IA3A 3MZKB 4PJJA 4YSYA 4I4TE 4ZI7E 4X66T 2KMFA 4EAHA 4WBNE 1HR0T 2BKOA 2G0UA 4GIWA 4JEHB 4O8SA 2W2UA 2MBGA 4DV7T 2D0UA 1WLXA 2HN2A 4HWDA 4AKIA 1LVFA 2FJEA 3EABA 1UUSA 3G06A 3AAEB 2WWUA 4DV3T 4UXNB 1KNRA 3RIUA 2C0SA 5AQJB 2IUBA 4BJNA 2ZM8A 3PTRB 1N36T 3FZKB 3MKDA 5HXRA 4YY3T 1D0XA 2LSGA 3C98B 4A97A 4IE5A 4B3ST 2BDEA 2V6YA 3IBPA 5KX5E 2D9DA 5FNVE 3LK3B 3PUQA 3N2OA 2ZM6T 2JQQA 2VWAA 2UUCT 5F8PA 4YT0A 3C51A 4E7SA 5C8YE 3FZHB 2WSSV 2CBIA 3PU8A 5AQIB 3R84B 4ZZCA 2X9XA 2VVSA 4QKNA 4IGUA 4L9IA 4LMKA 3Q5WA 4Z8XA 1GQEA 2FUPA 1JNZA 3MA9A 4YLHA 2A3DA 1MMNA 4IREA 5L4HA 1YQ4A 4GKJT 4H9RC 4LF8T 2GK9A 4DR5T 2RA1A 5LCYA 4H9OC 2J62A 2W67A 3F2EA 2KLQA 3K3QC 2WDRA 5F5WA 3H3MA 4YHHT 5CGMA 1I6ZA 3P50A 1ZHCA 5EK4A 1HG2A 4OYKA 4B3RT 3GN5B 4WYVA 3UU8A 2XZEA 2A2FX 2Q9QB 3ZYKA 2VKJA 4GYSA 4EGWA 1Y64B 3I0OA 3AE8A 3LBXB 3N5LA 3K3NA 4P0BA 4V1Av 5HEHA 4DBQA 4U31A 2AXDS 2DWGA 2BS2A 1WRDA 2F4VT 2C5KT 4HGAA 4U2ZA 2VURA 3L8RA 5AQVB 5FY0A 3UFEA 2DNXA 4ZI2D 1S94A 2W0GA 2XAJB 2PBIA 3GWHA 5H6RB 3Q5EA 4BJMA 2VASA 4PW8A 1FEWA 2XQ3A 2L3LA 4YTPA 2BZBA 2V6YB 3AE2A 2OV9A 3OJAA 3Q5DA 3NKZA 3T1YT 5LNKA 3NVOA 2NOXA 4UV9B 1XMOT 1U4QA 1V9DA 3PURA 5FL0A 3VRAA 4IL4A 3ZYMA 3AEFA 2VQFT 3E08A 1XNQT 4BA9A 1E1HB 1NWMX 5L3FB 4CXYA 3UUXB 2WWVA 4LF7T 2NTXA 3FZFB 2C5IT 4JI6T 3OBVE 3U78A 2YDSA 4DUYT 4ILBA 1L0VA 4GYRA 2ODVA 2V7IA 3RIAA 2K24A 2YINA 2YN6A 2BG9E 3QOFA 4OFZA 3MJXA 3RQWA 5LJNA 1I94T 5HXCA 4EOZB 1FMVA 1MIYA 2FJBA 1CHUA 4IL9A 4OYJA 4UEMA 5JDGA 4DV0T 4DR4T 3VKHA 4AQGA 4U3CA 4YTMA 2MPKA 5JH7E 1MIWA 4H63H 5FL1A 1YKEB 4L0RA 5TAOA 3LSVA 4NXMT 5FKYA 4LF9T 3JADA 3PJAJ 2AE9A 3JC6C 4EEDA 3AEEA 1HG5A 2ZMAA 3TLUA 3ZT5A 5HCJA 5LGNB 2XQYA 1YKHB 1T72A 2RPAA 4ZI2C 3HKBE 5CFBA 4LMLA 5AQMB 4J2CA 4ISTA 5HAXA 3HA4A 3M3ZB 5M4YA 4JI3T 2LSYA 2YEVC 2UUBT 4QH4A 4QH5A 4TNWA 3VR8A 5IUXA 2E9XD 1HFAA 1MMGA 2V26A 2WZHA 3P4WA 2W63A 1Y01A 5ABGA 4DNDA 3GMIA 3LDQB 4QXCB 2C5JA 4KBMB 4WBOA 4YXDA 1QSDA 2IDOB 5AQFB 4B3TT 3PU3A 5CA1E 2E8IA 3FBLA 3FXEB 3ANWA 4UV8B 1G8XA 2NW7A 3QNUA 4IHJE 3ZYLA 4I43B 3T8OA 2V7KA 2ES0A 3P8CD 4OHFA 3AEAA 3ZKRA 3U3IA 3HKEE 3ABVA 2BVMA 4N78D 5ETWA 4I50E 4ANJA 3ZEFB 3H3AA 2A9UA 2UXNB 2X9HA 4L5GA 4UVAB 2I59A 3ZN1B 4JLEA 3A7MA 3FBZA 4DMVA 4DV6T 2LM9A 2JMKA 3AE3A 4DR3T 3KV6A 4M1PA 5LXTE 4LF6T 4X5TA 3PUVF 1M7KA 3PUWF 3J9X1 2KT9A 3RC3A 2WAUA 1MMAA 5HXSA 5HCMA 3VRBA 2VK9A 5J0ZA 3C50A 3TKLB 3SFDA 3UU6A 1EZ3A 1UX4A 1VCSA 2NWBA 1LRZA 4ILUA 4EV6A 4DR2T 3ZSSA 2XQ4A 4CZZB 4X64T 2CXLA 2BBHA 4KMCA 3ETUA 3JC6D 2WB5A 2W4XA 4DV1T 4TN7B 3ZC1A 4A5XA 3FZLB 3BK9A 3AA7B 4QXHB 4YJ3E 3VKGA 3CX8B 3DTOA 3OTOT 4QX8B 4QXBB 1S35A 3AAIA 4EYUA 2E9XC 2JQ9A 2XM1A 4DR6T 3KV9A 2YDRA 4TWFA 5FXXA 5IWAT 4IE0A 2WM9A 4HWHA 2X0HA 1LVKA 4AKGA 3UTKA 1US7B 2FJDA 2QGSA 3BQKA 1YW0A 2PJQA 4QH1A 5DABA 5H6QB 1M62A 4XAXB 3ZMTB 1XNRT 1LKXA 1HS7A 4KX6A 2PTFA 2MTQA 1MIVA 4X1IE 5IYZE 5LBQB 4JI5T 3ZCJA 5ADXL 5JDHA 1FIOA 4LF5T 3PUAA 5ABFB 3HR0A 1KNPA 2LHRA 3AVRA 3KV4A 4PJLA 2XUEA 4BAYB 4YJ2E 3FZMB 3JAEA 3RRCA 1YD8G 4CI2B 3S4UA 3VU7H 1OEDB 2VKDA 5F3JA 2VQET 4JI1T 2LOPA 1ZEEA 2KZ7B 2M67A 2V8SV 1D0YA 2WQYA 4FI5A 4KUMB 3K3OA 1VRBA 2H7OA 2KINB 2XQAA 3PUXF 4ZS3A 4AKLA 4CXXA 5L3BB 1J5WA 2V5DA 4DMWA 2M6BA 3AAAB 2D5UA 2JQKA 4NUVA 5AQQB 3B13A 3DP7A 4UVCB 4KHZF 5EZYE 5J1GA 4A98A 5JDQA 1VOMA 2NR4A 3RPUA 3SFEA 3LK2B 4QX7B 5HEUA 3WAKA 1WFDA 3RKGA 4PK4A 4TV9E 4HWFA 3AE1A 4PK6A 3PV0F 1HX8A 2Q9QD 5L3GB 2B76A 2XAGB 2YKSA 4IE4A 3R6NA 3RKOA 1IAPA 3CIRA 5ABEA 2V7MA 2JPFA 2Y8DA 5GONE 3B57A 4LMJA 3L3PA 4AQYT 3P4PA 2CMRA 5LMNT 4YFSA 2EHOA 4ISSA 2D2SA 5HWXA 4PJMA 2HPJA 3P7IA 2I6HA 2E9XA 4DR1T 4CQIA 4JYAT 2WBLA 5HWYA 2V5CA 4HE8A 3OVUA 2DLRA 5KMGP 2Y6XA 3M65A 4KHPT 2H88A 2X9WA 3UQ4A 1KF6A 4AQFA 4AI6A 1WR0A 2X51A 4X20E 4IDNA 1B7TA 1MNEA 2XY8B 2EHOC 1BR4A 4O4LE 2LRKA 3ZSTA 4NUUA 4DV4T 1W0AA 4AIUA 3P4RA 3N9MA 2QVAA 4JUYA 5CA0E 4HFCA 3MXZA 2VL8A 4ZEYA 2UXDT 5L2LA 3FXDB 2CWYA 2XTLA 4MALA 4PFOA 3RYIE 5CB4E 2LJLA 4PJNA 4Z91A 1MMDA 3C4XA 5EK3A 1X9BA 1HTJF 3ZLIA 1D1CA 3UU3A 3F31A 2Q9QA 5AQNB 3UFGA 5HEJA 5LHHB 4HFHA 1XDOA 1QLBA 1XWMA 2CXFA 2UXXB 4TV8E 3CQCB 3Q5XA 4UF0B 2CPTA 4H9PC 2XQ8A 1OWAA 1WR6A 3OYZA 3RGLA 4EEBA 3CKDA 4E7ZA 4QHOA 1FMWA 4Z90A 3ZJ2A 1HNWT 2MYSA 4GK0E 2LM2A 4GKKT 1IZNB 2LOSA 4YTNA 2BBJA 2CRBA 2Q9QC 3CWZB 5LOVE 2R6GF 3RH3A 1MNDA 3RIFA 1IBKT 1JNRA 2H7VC 2WDQA 3NZPA 5DQWA 2B1EA 2CM0A 5LG3A 1KNZA 2LE8A 4F8HA 4DV5T 2UXCT 4B3MT 4LFAT 3H37A 4F6RC 5LYJE 1T7SA 3NWIA 4ZI3D 3QK6A 4JI0T 4NXNT 4OX9T 1SE7A 2WY2A 2XSBA 4IT4A 5EK2A 1IBLT 3KDSE 4TWDA 5L3DB 5L3CB 4O4IE 3RI5A 1QUUA 1ZKEA 4YSZA 2EHOB 3AA6B 3BQIA 4QWNB 3PE0A 3AXJA 4TX5A 2KXPB 5AFUL 4EXTA 1WYCA 4OK0A 1OEDC 4EB6E 1W9RA 2IC9A 5LP6E 2ACZA 3B5MA 1ZOYA 3CK6A 3I9YA 4MHCA 4DO0A 5LGUB 3WI3A 5JTGA 2LKHA 5JDLA 2LT3A 3N2KE 2WCAA 2KSRA 3KV5A 3E0ZA 2BVLA 2MOZA 2N1GA 2W00A 3L39A 4PNIA 4EZ4A 5JR9B 3ZCIA 1N32T 1IJ5A 3LFMA 1X79A 3QC9A 2Z6EA 4MFRA 4U7IA 5E0OA 3RRWA 3VR9A 5FYMA 4DBRA 3SS1A 2WP9A 3N9NA 1J5ET 3MACA 2XAFB 1IBMT 2V6XA 3RIUC 2XQ7A 4U2YA 2E9XB 2X9YA 5AQUB 3AVSA 5AQTB 1J1JA 3EI0A 3O4XE 5FVKA 2ZM2A 3KVBA 3UU5A 2CWOA 2WU2A 3ZMZB 3N9OA 4KI0F 5LBMA 1UX5A 5JQGE 2K3WA 4HFDA 5JREA 5JVDE 5AQRB 4O2AE 4WNKA 2IC6A 5C3JA 3PDYA 4JEUB 4FJOA 2XM2A 1H7CA 1NEKA 2NP9A 2IHR1 3O1IA 4GOUA 3CQXC 3ZC0A 2BG9A 3RX6A 2V7JA 2CHNA 3CQGB 5LA6E 1T98A 3O9XA 3ZPOA 5L4EA 2DCFA 5LMUT 4WW0A 2W66A 2PFVA 3JAFA 2M6IA 2HPLA 3AE4A 3CX7B 2X66A 3ONJA 3AB3B 4TZ4C 4AKRB 2LEHA 2NTYA 4PK5A 5J2TE 2K48A 2K5BB 2DL1A 3GA8A 1E7PA 3EUHA 4HWCA 3UULA 5DJQC 1W09A 2X68A 1SA0E 2LSIA 3AE9A 5LB7B 3ONXA 5HEOA 3ZMVB 5AQOB 3AEDA 3N9QA 4O2BE 4ZZBA 1ZV4X 3PUSA 2ZLYA 1WYBA 3AA1B 2XQ9A 2W61A 4TNVA 2OA5A 5LGTB 1YQ3A 5FVLA 5AQSB 4B6XA 5HYAA 5HEGA 3C4ZA 3MK7C 2LSJA 2VL0A 4IDOA 1XMQT 2E5LT 2W62A 3UUMA 3KFWX 3OYXA 2WZIA 4ILCA 5AQHB 4YHJA 5KXJA 2CHOA 5FXWA 3J7Yq 2WMOA 1O3XA 4DR7T 1HNXT 2JIWA 5JR9A 3AA0B 2RP4A 3Q2MA 1FJGT 3IEEA 3FHNA 3OPCA 4HWIB 3CX6B 3N9PA 3AE7A 3KVAA 5KDMC 1KEYA 3EDVA 1OXZA 4H9NC 4KP3C 2IAKA 3JCFA 5C2TA 5FXVA 2OLTA 1UCUA 3A8YC 4I0UA 3RYCE 4UF0A 4X62T 3AXJB 3E22E 3UUNA 4HFIA 3LK42 2P9BA 3ANWB 3ONLC 5HXEA 4ASKA 4H63V 3QUJA 2D0TA 3ZJ1A 2EHOD 4PFPA 2XQ5A 4MBQA 2LKGA 4ADZA 3A5XA 4XZCA 2XAQB 1Z8UA 2BS3A 2XQ6A 3O1HA 1G73A 4ZXLA 3SRZA 4DIDB 2WS3A 2E2AA 4P09A 4HFVA 4DUZT 4IE6A 3X1DA 3EAMA 2VKHA 4CN1A 1HX1B 1KK7A 1W0BA 1BR1A 2HH7A 2LSKA 1HF8A 3F57A 3LJCA 4LFBT 3UUBA 2CBJA 2DWKA 4CI3B 4UELA 5LHGB 2KNDA 1N33T 1BR0A 3L09A 4C90A 3HL6A 3O1JA 2BS4A 2VVNA 3QB5A 2IIUA 4CN4A 1YXRA 5J2UE 5L47A 2UXBT 1DU2A 3K8PC 2J4GA 4IIJE 3PJAA 4HN9A 3LG7A 3LBXA 3W15B 2XPKA 4LF4T 3N9LA 3C64A 3HKCE 4XBFB 2V1DB 4AXPA 5LG4A 3AEBA 2QA7A 3KINB 3Q9DA 4HFEA 2PG8A 3RQUA 3ZN0B 2NW8A 3RYHE 4EYYR 3WAJA 1AJ3A 2H89A 4HKAA 4JI2T 2UUAT 4LFCT 1R8IA 5AQGB 4JI7T 1SUMB 2MAWA 2CCQA 2LRLA 3RF1A 1ZP0A 2CLYC 4AQFC 5FXZA 2IW5B 4UVBB 3I1AA 3I9WA 4ZI3C 1OEDE 3CPZA 3NRXA 2I0MA 1HNZT 1SHZC 2YDQA 3K1SA 3P4SA 1Z0PA 1NENA 4HTEA 3RLFF 1KFYA 1D0ZA 4G63A 2JMHA 2X67A 1BR2A 5AQLB 4EIWA 4H9SE 3ESLA 1T8BA 5LJMA 2V7LA 4ZS2A 2XJ7A 2QYWA 3P4QA 5FMNA 3RHWA 1UURA 4CI1B 1WCRA 4IE7A 2N9DA 1CUNA 4AKHA 3ZT7A 2LHNA 4K0KT 2YU2A 3TLVA 3ETVA 4ILAA 2JQHA 4X1YE 2IMLA 3EDUA 3AECA 4O4HE 2ODUA 3NRYA 4U7YA 4TWHA 4GK5E 5FP3A 3EHZA 4ZHQE 2BG9B 4G2AA 1HCIA 4HFBA 1XDPA 2CXDA 3PUZF 2A72A 2X0LB 2XHEB 3C4WA 3GN5A 3NZQA 4NIQA 1XZYA 3QB5K 5DQVA 4DV2T 5CJ5A 3IF8B 5FY7A 3UQ7A 4U72A 3AE5A 3I0QA 3DJBA 3EVYA 5JDMA 2FBWA 2Y48B 1IJ6A 1UGOA 2J1DG 4TUYE 3ZMSB 4JI4T 5BR8T 1D1BA 4IDPA 4EZHA 3HI2A 3SWHA 4U74A 5LHIB 4JI8T 2WDVA 4P1NA 4IDQA 2FJAA 5ABHA 2H3RA 2XAHB 5A1LA 2WMNA 5BMVE 5JRCB 2DHRA 3UT5E 3FB2A 4UIGA 3TLTA 2SPCA 3PUGA 5AQKB 2QRXA 3AEGA 4DVDA 2YOEA 2K9AA 3CVRA 5JDFA 4K0UA 1VCTA 3V5UA 3T1HT 2BG9C 3TLWA 2HHHT 2NW9A 4IDZA 1NAFA 1U5PA 1UK5A 2XSAA 4X1KE 3BQLA 5ABFA 5L3EB 5FY1A 4U33A 4CN6A 2DI4A 4P0AA 5JDNA 3V5SA 4ERRA 4JV5T 2N2NA 3N2GE 3PUYF 4I55E 2L8KA 1N34T 2YU1A 3HKDE 2CA5A 2BKPA 2JJ9A 3IHRA 4COFA 3NBXX 4JBWF 4A56A 3ZT6A 4HEAA 4MLKA 2WU5A 2KWHA 2VB6A 3ZMUB
chains in the Genus database with same CATH topology
2ACXA 2CEAA 2KWIB 2L9QA 3OKQA 2CE7A 2JRKA 2VKOA 2CLYB 3RYFE 2YK0A 3SOLA 3KBTA 4ZOLE 5IHYA 4CXWA 3CMLA 5JR9C 4C91A 3VHLA 2ZM0A 3D0TA 2XASB 4PAGA 4O4JE 3KBUA 4H9QC 1D1AA 3RC8A 4PJJA 3MZKB 4I4TE 4ZI7E 2KMFA 4EAHA 4WBNE 2G0UA 4GIWA 4JEHB 4O8SA 2MBGA 2D0UA 1WLXA 4AKIA 1LVFA 3AAEB 2WWUA 4UXNB 2C0SA 4BJNA 2ZM8A 3PTRB 3MKDA 5HXRA 1D0XA 2LSGA 3C98B 4IE5A 2BDEA 3IBPA 5KX5E 5FNVE 3LK3B 3PUQA 3N2OA 2JQQA 2VWAA 5F8PA 3C51A 4E7SA 5C8YE 3PU8A 2WSSV 3R84B 2X9XA 4Z8XA 4QKNA 4IGUA 4L9IA 3Q5WA 5JH7E 3MA9A 4YLHA 2A3DA 1MMNA 4H9RC 2GK9A 2RA1A 5LCYA 4H9OC 3F2EA 2KLQA 3K3QC 1ZHCA 5EK4A 1HG2A 4OYKA 3GN5B 3ZYKA 2A2FX 2Q9QB 2VKJA 4GYSA 1Y64B 3I0OA 3LBXB 3N5LA 4P0BA 3K3NA 4DBQA 4V1Av 2DWGA 1WRDA 2C5KT 4HGAA 5FY0A 3UFEA 2DNXA 4ZI2D 1S94A 2W0GA 2XAJB 2PBIA 3GWHA 5H6RB 4BJMA 2VASA 4PW8A 1FEWA 2L3LA 2BZBA 3OJAA 5LNKA 2NOXA 4UV9B 1U4QA 1V9DA 3PURA 3ZYMA 3E08A 4BA9A 1E1HB 1NWMX 5L3FB 4CXYA 3UUXB 2NTXA 2C5IT 3OBVE 3U78A 4GYRA 2ODVA 2V7IA 2K24A 2YINA 4OFZA 5LJNA 3MJXA 5HXCA 4EOZB 1FMVA 1MIYA 5JDGA 4OYJA 4UEMA 3VKHA 4AQGA 1MIWA 4H63H 1YKEB 4L0RA 5TAOA 3JC6C 1HG5A 2ZMAA 5LGNB 2XQYA 1YKHB 4ZI2C 3HKBE 5HAXA 4J2CA 4ISTA 3HA4A 5M4YA 2LSYA 2YEVC 2E9XD 1HFAA 1MMGA 2V26A 2W63A 4DNDA 3GMIA 4QXCB 2C5JA 4KBMB 4WBOA 1QSDA 3PU3A 5CA1E 2E8IA 3FBLA 3FXEB 3ANWA 4UV8B 1G8XA 2NW7A 4IHJE 3ZYLA 4I43B 3T8OA 2V7KA 2ES0A 3P8CD 4OHFA 3U3IA 3HKEE 4N78D 2BVMA 3ZEFB 5ETWA 4I50E 4ANJA 3H3AA 2X9HA 2UXNB 4L5GA 3ZN1B 4UVAB 2I59A 1KNZA 4JLEA 3FBZA 4DMVA 2LM9A 2JMKA 3KV6A 4M1PA 5LXTE 3RC3A 3J9X1 2KT9A 2WAUA 1MMAA 5HXSA 2VK9A 3C50A 3TKLB 1EZ3A 1UX4A 2NWBA 1LRZA 4ILUA 4CZZB 2CXLA 4KMCA 3ETUA 3JC6D 4TN7B 3ZC1A 3BK9A 3AA7B 4QXHB 4YJ3E 3VKGA 3CX8B 3DTOA 4QX8B 4QXBB 1S35A 3AAIA 4EYUA 2E9XC 3KV9A 5FXXA 4IE0A 2WM9A 1LVKA 4AKGA 3UTKA 1US7B 2QGSA 3BQKA 1YW0A 2PJQA 5H6QB 5DABA 4XAXB 3ZMTB 1LKXA 1HS7A 5IYZE 2MTQA 1MIVA 4X1IE 5LBQB 3ZCJA 5ADXL 5JDHA 1FIOA 3PUAA 3HR0A 2LHRA 3AVRA 3KV4A 4PJLA 2XUEA 4BAYB 3RRCA 5F3JA 4CI2B 1YD8G 3S4UA 3VU7H 2VKDA 2LOPA 1ZEEA 2KZ7B 2M67A 4YJ2E 1D0YA 4FI5A 4KUMB 3K3OA 1VRBA 2H7OA 2KINB 4ZS3A 4AKLA 4CXXA 5L3BB 4DMWA 3AAAB 2D5UA 4NUVA 5J1GA 3B13A 3DP7A 4UVCB 5EZYE 5JDQA 1VOMA 3RPUA 3LK2B 4QX7B 3WAKA 4PK4A 4TV9E 4PK6A 1HX8A 2Q9QD 5L3GB 4IE4A 2XAGB 3R6NA 3RKOA 1IAPA 2V7MA 2JPFA 2Y8DA 5GONE 3B57A 3L3PA 2CMRA 4YFSA 2EHOA 4ISSA 2D2SA 5HWXA 4PJMA 2HPJA 3P7IA 2E9XA 4CQIA 2WBLA 5HWYA 5KMGP 4HE8A 2DLRA 2Y6XA 3M65A 2X9WA 4AQFA 4X20E 2X51A 1B7TA 1MNEA 2EHOC 1BR4A 4O4LE 4NUUA 5CA0E 3N9MA 4JUYA 3MXZA 2VL8A 5L2LA 3FXDB 2CWYA 2XTLA 4MALA 4PFOA 3RYIE 5CB4E 2LJLA 5EK3A 1MMDA 3C4XA 1HTJF 3ZLIA 1D1CA 3F31A 2Q9QA 5LHHB 2CXFA 2UXXB 4TV8E 4ASKA 3CQCB 3Q5XA 4UF0B 4H9PC 1OWAA 1WR6A 3OYZA 4E7ZA 3CKDA 4QHOA 1FMWA 3ZJ2A 2MYSA 4GK0E 1IZNB 2LOSA 2Q9QC 3CWZB 5LOVE 3RH3A 1MNDA 2H7VC 3NZPA 5DQWA 2B1EA 2CM0A 2LE8A 3H37A 4F6RC 5LYJE 4ZI3D 3QK6A 5EK2A 3KDSE 5L3DB 5L3CB 4O4IE 1QUUA 1ZKEA 2EHOB 3AA6B 3BQIA 4QWNB 3PE0A 4TX5A 2KXPB 5AFUL 4EXTA 1WYCA 4OK0A 4EB6E 2IC9A 5LP6E 3I9YA 4MHCA 5LGUB 4DO0A 3WI3A 5JDLA 2LT3A 3N2KE 3KV5A 4PNIA 3E0ZA 2BVLA 2MOZA 2N1GA 2W00A 4EZ4A 5JR9B 3ZCIA 1IJ5A 3LFMA 1X79A 3QC9A 2Z6EA 4MFRA 5E0OA 3RRWA 5FYMA 4DBRA 3SS1A 3N9NA 3MACA 2XAFB 2E9XB 2X9YA 4AI6A 3AVSA 3O4XE 2ZM2A 3KVBA 2CWOA 3ZMZB 5JQGE 3N9OA 5LBMA 1UX5A 5JREA 5JVDE 4O2AE 4WNKA 2IC6A 3PDYA 4JEUB 4FJOA 1H7CA 2NP9A 3O1IA 4GOUA 3CQXC 3ZC0A 3RX6A 2V7JA 3CQGB 5LA6E 1T98A 3O9XA 3ZPOA 2DCFA 4WW0A 2PFVA 2HPLA 3CX7B 2X66A 3AB3B 4TZ4C 4AKRB 2LEHA 2NTYA 4PK5A 5J2TE 2K48A 2K5BB 3GA8A 3EUHA 3UULA 5DJQC 2X68A 1SA0E 2LSIA 3ZMVB 3ONXA 3N9QA 4O2BE 1ZV4X 3PUSA 2ZLYA 1WYBA 3AA1B 2W61A 5LGTB 2OA5A 4B6XA 5HYAA 3C4ZA 3MK7C 2LSJA 2W62A 3UUMA 3KFWX 3OYXA 4YHJA 3J7Yq 5FXWA 2WMOA 1O3XA 5JR9A 3AA0B 2RP4A 3Q2MA 3IEEA 3FHNA 3CX6B 3N9PA 3KVAA 5KDMC 3EDVA 1OXZA 4H9NC 4KP3C 2IAKA 5FXVA 1UCUA 3RYCE 4UF0A 3E22E 3UUNA 3LK42 2P9BA 3ANWB 5HXEA 4H63V 3QUJA 2D0TA 3ZJ1A 2EHOD 4PFPA 4MBQA 4ADZA 3A5XA 4XZCA 2XAQB 3O1HA 1G73A 3SRZA 4P09A 4HFVA 4IE6A 2VKHA 1KK7A 2HH7A 1BR1A 2LSKA 3LJCA 1HF8A 3F57A 2DWKA 4CI3B 4UELA 5LHGB 2KNDA 1BR0A 3L09A 4C90A 3HL6A 3O1JA 5JRCA 5J2UE 3K8PC 4IIJE 4HN9A 3LG7A 3LBXA 3W15B 3N9LA 3C64A 3HKCE 4XBFB 2V1DB 4AXPA 5LG4A 2QA7A 3KINB 3Q9DA 3ZN0B 2PG8A 3WAJA 4EYYR 2NW8A 3RYHE 1AJ3A 4HKAA 2CCQA 2CLYC 4AQFC 5FXZA 2IW5B 4UVBB 3I1AA 3I9WA 4ZI3C 3CPZA 3NRXA 1SHZC 4HTEA 1Z0PA 1D0ZA 4G63A 2JMHA 2X67A 1BR2A 4EIWA 4H9SE 3ESLA 5LJMA 2V7LA 4ZS2A 5FMNA 4CI1B 4IE7A 2N9DA 1CUNA 4AKHA 2LHNA 2YU2A 3ETVA 4X1YE 3EDUA 4O4HE 2ODUA 3NRYA 4GK5E 5FP3A 4ZHQE 4G2AA 1HCIA 2CXDA 2A72A 3GN5A 2X0LB 2XHEB 3C4WA 3NZQA 5DQVA 5HXHA 3IF8B 5FY7A 4U72A 3I0QA 5JDMA 3DJBA 3EVYA 2Y48B 1IJ6A 4TUYE 2J1DG 3ZMSB 1D1BA 4EZHA 3HI2A 3SWHA 4U74A 5LHIB 2H3RA 2XAHB 5A1LA 2WMNA 5BMVE 5JRCB 2DHRA 3UT5E 3FB2A 4UIGA 2SPCA 3PUGA 4DVDA 3V5UA 2K9AA 3CVRA 5JDFA 4K0UA 2NW9A 4IDZA 1NAFA 1U5PA 4X1KE 3BQLA 5L3EB 5FY1A 2DI4A 4P0AA 5JDNA 3V5SA 4ERRA 2N2NA 3N2GE 4I55E 2L8KA 2YU1A 3HKDE 2CA5A 3IHRA 2JJ9A 3NBXX 4A56A 4HEAA 4MLKA 4PJNA 2KWHA 2VB6A 3ZMUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWN B;  4TN7 B;  4QX7 B;  4QXH B;  4QX8 B;  4QXB B;  4QXC B; 
#chains in the Genus database with same CATH topology
 4NPP A;  2ACX A;  2CEA A;  2KWI B;  2L9Q A;  4X65 T;  3OKQ A;  5HXH A;  2E5V A;  2CE7 A;  4AIS A;  2JRK A;  2VKO A;  2X0Y A;  2CLY B;  4WZX A;  3RYF E;  2YK0 A;  3SOL A;  3KBT A;  4ZOL E;  1E2A A;  5IHY A;  3UU4 A;  4CXW A;  3CML A;  5JR9 C;  4C91 A;  2J47 A;  5AQP B;  3TLS A;  3AE6 A;  4Q25 A;  3VHL A;  2BKN A;  2ZM0 A;  3D0T A;  1OED A;  2XAS B;  4PAG A;  2UU9 T;  4O4J E;  3KBU A;  4H9Q C;  5JRC A;  1D1A A;  4UR9 A;  3RC8 A;  2LLY A;  4YSX A;  2HN1 A;  3IA3 A;  3MZK B;  4PJJ A;  4YSY A;  4I4T E;  4ZI7 E;  4X66 T;  2KMF A;  4EAH A;  4WBN E;  1HR0 T;  2BKO A;  2G0U A;  4GIW A;  4JEH B;  4O8S A;  2W2U A;  2MBG A;  4DV7 T;  2D0U A;  1WLX A;  2HN2 A;  4HWD A;  4AKI A;  1LVF A;  2FJE A;  3EAB A;  1UUS A;  3G06 A;  3AAE B;  2WWU A;  4DV3 T;  4UXN B;  1KNR A;  3RIU A;  2C0S A;  5AQJ B;  2IUB A;  4BJN A;  2ZM8 A;  3PTR B;  1N36 T;  3FZK B;  3MKD A;  5HXR A;  4YY3 T;  1D0X A;  2LSG A;  3C98 B;  4A97 A;  4IE5 A;  4B3S T;  2BDE A;  2V6Y A;  3IBP A;  5KX5 E;  2D9D A;  5FNV E;  3LK3 B;  3PUQ A;  3N2O A;  2ZM6 T;  2JQQ A;  2VWA A;  2UUC T;  5F8P A;  4YT0 A;  3C51 A;  4E7S A;  5C8Y E;  3FZH B;  2WSS V;  2CBI A;  3PU8 A;  5AQI B;  3R84 B;  4ZZC A;  2X9X A;  2VVS A;  4QKN A;  4IGU A;  4L9I A;  4LMK A;  3Q5W A;  4Z8X A;  1GQE A;  2FUP A;  1JNZ A;  3MA9 A;  4YLH A;  2A3D A;  1MMN A;  4IRE A;  5L4H A;  1YQ4 A;  4GKJ T;  4H9R C;  4LF8 T;  2GK9 A;  4DR5 T;  2RA1 A;  5LCY A;  4H9O C;  2J62 A;  2W67 A;  3F2E A;  2KLQ A;  3K3Q C;  2WDR A;  5F5W A;  3H3M A;  4YHH T;  5CGM A;  1I6Z A;  3P50 A;  1ZHC A;  5EK4 A;  1HG2 A;  4OYK A;  4B3R T;  3GN5 B;  4WYV A;  3UU8 A;  2XZE A;  2A2F X;  2Q9Q B;  3ZYK A;  2VKJ A;  4GYS A;  4EGW A;  1Y64 B;  3I0O A;  3AE8 A;  3LBX B;  3N5L A;  3K3N A;  4P0B A;  4V1A v;  5HEH A;  4DBQ A;  4U31 A;  2AXD S;  2DWG A;  2BS2 A;  1WRD A;  2F4V T;  2C5K T;  4HGA A;  4U2Z A;  2VUR A;  3L8R A;  5AQV B;  5FY0 A;  3UFE A;  2DNX A;  4ZI2 D;  1S94 A;  2W0G A;  2XAJ B;  2PBI A;  3GWH A;  5H6R B;  3Q5E A;  4BJM A;  2VAS A;  4PW8 A;  1FEW A;  2XQ3 A;  2L3L A;  4YTP A;  2BZB A;  2V6Y B;  3AE2 A;  2OV9 A;  3OJA A;  3Q5D A;  3NKZ A;  3T1Y T;  5LNK A;  3NVO A;  2NOX A;  4UV9 B;  1XMO T;  1U4Q A;  1V9D A;  3PUR A;  5FL0 A;  3VRA A;  4IL4 A;  3ZYM A;  3AEF A;  2VQF T;  3E08 A;  1XNQ T;  4BA9 A;  1E1H B;  1NWM X;  5L3F B;  4CXY A;  3UUX B;  2WWV A;  4LF7 T;  2NTX A;  3FZF B;  2C5I T;  4JI6 T;  3OBV E;  3U78 A;  2YDS A;  4DUY T;  4ILB A;  1L0V A;  4GYR A;  2ODV A;  2V7I A;  3RIA A;  2K24 A;  2YIN A;  2YN6 A;  2BG9 E;  3QOF A;  4OFZ A;  3MJX A;  3RQW A;  5LJN A;  1I94 T;  5HXC A;  4EOZ B;  1FMV A;  1MIY A;  2FJB A;  1CHU A;  4IL9 A;  4OYJ A;  4UEM A;  5JDG A;  4DV0 T;  4DR4 T;  3VKH A;  4AQG A;  4U3C A;  4YTM A;  2MPK A;  5JH7 E;  1MIW A;  4H63 H;  5FL1 A;  1YKE B;  4L0R A;  5TAO A;  3LSV A;  4NXM T;  5FKY A;  4LF9 T;  3JAD A;  3PJA J;  2AE9 A;  3JC6 C;  4EED A;  3AEE A;  1HG5 A;  2ZMA A;  3TLU A;  3ZT5 A;  5HCJ A;  5LGN B;  2XQY A;  1YKH B;  1T72 A;  2RPA A;  4ZI2 C;  3HKB E;  5CFB A;  4LML A;  5AQM B;  4J2C A;  4IST A;  5HAX A;  3HA4 A;  3M3Z B;  5M4Y A;  4JI3 T;  2LSY A;  2YEV C;  2UUB T;  4QH4 A;  4QH5 A;  4TNW A;  3VR8 A;  5IUX A;  2E9X D;  1HFA A;  1MMG A;  2V26 A;  2WZH A;  3P4W A;  2W63 A;  1Y01 A;  5ABG A;  4DND A;  3GMI A;  3LDQ B;  4QXC B;  2C5J A;  4KBM B;  4WBO A;  4YXD A;  1QSD A;  2IDO B;  5AQF B;  4B3T T;  3PU3 A;  5CA1 E;  2E8I A;  3FBL A;  3FXE B;  3ANW A;  4UV8 B;  1G8X A;  2NW7 A;  3QNU A;  4IHJ E;  3ZYL A;  4I43 B;  3T8O A;  2V7K A;  2ES0 A;  3P8C D;  4OHF A;  3AEA A;  3ZKR A;  3U3I A;  3HKE E;  3ABV A;  2BVM A;  4N78 D;  5ETW A;  4I50 E;  4ANJ A;  3ZEF B;  3H3A A;  2A9U A;  2UXN B;  2X9H A;  4L5G A;  4UVA B;  2I59 A;  3ZN1 B;  4JLE A;  3A7M A;  3FBZ A;  4DMV A;  4DV6 T;  2LM9 A;  2JMK A;  3AE3 A;  4DR3 T;  3KV6 A;  4M1P A;  5LXT E;  4LF6 T;  4X5T A;  3PUV F;  1M7K A;  3PUW F;  3J9X 1;  2KT9 A;  3RC3 A;  2WAU A;  1MMA A;  5HXS A;  5HCM A;  3VRB A;  2VK9 A;  5J0Z A;  3C50 A;  3TKL B;  3SFD A;  3UU6 A;  1EZ3 A;  1UX4 A;  1VCS A;  2NWB A;  1LRZ A;  4ILU A;  4EV6 A;  4DR2 T;  3ZSS A;  2XQ4 A;  4CZZ B;  4X64 T;  2CXL A;  2BBH A;  4KMC A;  3ETU A;  3JC6 D;  2WB5 A;  2W4X A;  4DV1 T;  4TN7 B;  3ZC1 A;  4A5X A;  3FZL B;  3BK9 A;  3AA7 B;  4QXH B;  4YJ3 E;  3VKG A;  3CX8 B;  3DTO A;  3OTO T;  4QX8 B;  4QXB B;  1S35 A;  3AAI A;  4EYU A;  2E9X C;  2JQ9 A;  2XM1 A;  4DR6 T;  3KV9 A;  2YDR A;  4TWF A;  5FXX A;  5IWA T;  4IE0 A;  2WM9 A;  4HWH A;  2X0H A;  1LVK A;  4AKG A;  3UTK A;  1US7 B;  2FJD A;  2QGS A;  3BQK A;  1YW0 A;  2PJQ A;  4QH1 A;  5DAB A;  5H6Q B;  1M62 A;  4XAX B;  3ZMT B;  1XNR T;  1LKX A;  1HS7 A;  4KX6 A;  2PTF A;  2MTQ A;  1MIV A;  4X1I E;  5IYZ E;  5LBQ B;  4JI5 T;  3ZCJ A;  5ADX L;  5JDH A;  1FIO A;  4LF5 T;  3PUA A;  5ABF B;  3HR0 A;  1KNP A;  2LHR A;  3AVR A;  3KV4 A;  4PJL A;  2XUE A;  4BAY B;  4YJ2 E;  3FZM B;  3JAE A;  3RRC A;  1YD8 G;  4CI2 B;  3S4U A;  3VU7 H;  1OED B;  2VKD A;  5F3J A;  2VQE T;  4JI1 T;  2LOP A;  1ZEE A;  2KZ7 B;  2M67 A;  2V8S V;  1D0Y A;  2WQY A;  4FI5 A;  4KUM B;  3K3O A;  1VRB A;  2H7O A;  2KIN B;  2XQA A;  3PUX F;  4ZS3 A;  4AKL A;  4CXX A;  5L3B B;  1J5W A;  2V5D A;  4DMW A;  2M6B A;  3AAA B;  2D5U A;  2JQK A;  4NUV A;  5AQQ B;  3B13 A;  3DP7 A;  4UVC B;  4KHZ F;  5EZY E;  5J1G A;  4A98 A;  5JDQ A;  1VOM A;  2NR4 A;  3RPU A;  3SFE A;  3LK2 B;  4QX7 B;  5HEU A;  3WAK A;  1WFD A;  3RKG A;  4PK4 A;  4TV9 E;  4HWF A;  3AE1 A;  4PK6 A;  3PV0 F;  1HX8 A;  2Q9Q D;  5L3G B;  2B76 A;  2XAG B;  2YKS A;  4IE4 A;  3R6N A;  3RKO A;  1IAP A;  3CIR A;  5ABE A;  2V7M A;  2JPF A;  2Y8D A;  5GON E;  3B57 A;  4LMJ A;  3L3P A;  4AQY T;  3P4P A;  2CMR A;  5LMN T;  4YFS A;  2EHO A;  4ISS A;  2D2S A;  5HWX A;  4PJM A;  2HPJ A;  3P7I A;  2I6H A;  2E9X A;  4DR1 T;  4CQI A;  4JYA T;  2WBL A;  5HWY A;  2V5C A;  4HE8 A;  3OVU A;  2DLR A;  5KMG P;  2Y6X A;  3M65 A;  4KHP T;  2H88 A;  2X9W A;  3UQ4 A;  1KF6 A;  4AQF A;  4AI6 A;  1WR0 A;  2X51 A;  4X20 E;  4IDN A;  1B7T A;  1MNE A;  2XY8 B;  2EHO C;  1BR4 A;  4O4L E;  2LRK A;  3ZST A;  4NUU A;  4DV4 T;  1W0A A;  4AIU A;  3P4R A;  3N9M A;  2QVA A;  4JUY A;  5CA0 E;  4HFC A;  3MXZ A;  2VL8 A;  4ZEY A;  2UXD T;  5L2L A;  3FXD B;  2CWY A;  2XTL A;  4MAL A;  4PFO A;  3RYI E;  5CB4 E;  2LJL A;  4PJN A;  4Z91 A;  1MMD A;  3C4X A;  5EK3 A;  1X9B A;  1HTJ F;  3ZLI A;  1D1C A;  3UU3 A;  3F31 A;  2Q9Q A;  5AQN B;  3UFG A;  5HEJ A;  5LHH B;  4HFH A;  1XDO A;  1QLB A;  1XWM A;  2CXF A;  2UXX B;  4TV8 E;  3CQC B;  3Q5X A;  4UF0 B;  2CPT A;  4H9P C;  2XQ8 A;  1OWA A;  1WR6 A;  3OYZ A;  3RGL A;  4EEB A;  3CKD A;  4E7Z A;  4QHO A;  1FMW A;  4Z90 A;  3ZJ2 A;  1HNW T;  2MYS A;  4GK0 E;  2LM2 A;  4GKK T;  1IZN B;  2LOS A;  4YTN A;  2BBJ A;  2CRB A;  2Q9Q C;  3CWZ B;  5LOV E;  2R6G F;  3RH3 A;  1MND A;  3RIF A;  1IBK T;  1JNR A;  2H7V C;  2WDQ A;  3NZP A;  5DQW A;  2B1E A;  2CM0 A;  5LG3 A;  1KNZ A;  2LE8 A;  4F8H A;  4DV5 T;  2UXC T;  4B3M T;  4LFA T;  3H37 A;  4F6R C;  5LYJ E;  1T7S A;  3NWI A;  4ZI3 D;  3QK6 A;  4JI0 T;  4NXN T;  4OX9 T;  1SE7 A;  2WY2 A;  2XSB A;  4IT4 A;  5EK2 A;  1IBL T;  3KDS E;  4TWD A;  5L3D B;  5L3C B;  4O4I E;  3RI5 A;  1QUU A;  1ZKE A;  4YSZ A;  2EHO B;  3AA6 B;  3BQI A;  4QWN B;  3PE0 A;  3AXJ A;  4TX5 A;  2KXP B;  5AFU L;  4EXT A;  1WYC A;  4OK0 A;  1OED C;  4EB6 E;  1W9R A;  2IC9 A;  5LP6 E;  2ACZ A;  3B5M A;  1ZOY A;  3CK6 A;  3I9Y A;  4MHC A;  4DO0 A;  5LGU B;  3WI3 A;  5JTG A;  2LKH A;  5JDL A;  2LT3 A;  3N2K E;  2WCA A;  2KSR A;  3KV5 A;  3E0Z A;  2BVL A;  2MOZ A;  2N1G A;  2W00 A;  3L39 A;  4PNI A;  4EZ4 A;  5JR9 B;  3ZCI A;  1N32 T;  1IJ5 A;  3LFM A;  1X79 A;  3QC9 A;  2Z6E A;  4MFR A;  4U7I A;  5E0O A;  3RRW A;  3VR9 A;  5FYM A;  4DBR A;  3SS1 A;  2WP9 A;  3N9N A;  1J5E T;  3MAC A;  2XAF B;  1IBM T;  2V6X A;  3RIU C;  2XQ7 A;  4U2Y A;  2E9X B;  2X9Y A;  5AQU B;  3AVS A;  5AQT B;  1J1J A;  3EI0 A;  3O4X E;  5FVK A;  2ZM2 A;  3KVB A;  3UU5 A;  2CWO A;  2WU2 A;  3ZMZ B;  3N9O A;  4KI0 F;  5LBM A;  1UX5 A;  5JQG E;  2K3W A;  4HFD A;  5JRE A;  5JVD E;  5AQR B;  4O2A E;  4WNK A;  2IC6 A;  5C3J A;  3PDY A;  4JEU B;  4FJO A;  2XM2 A;  1H7C A;  1NEK A;  2NP9 A;  2IHR 1;  3O1I A;  4GOU A;  3CQX C;  3ZC0 A;  2BG9 A;  3RX6 A;  2V7J A;  2CHN A;  3CQG B;  5LA6 E;  1T98 A;  3O9X A;  3ZPO A;  5L4E A;  2DCF A;  5LMU T;  4WW0 A;  2W66 A;  2PFV A;  3JAF A;  2M6I A;  2HPL A;  3AE4 A;  3CX7 B;  2X66 A;  3ONJ A;  3AB3 B;  4TZ4 C;  4AKR B;  2LEH A;  2NTY A;  4PK5 A;  5J2T E;  2K48 A;  2K5B B;  2DL1 A;  3GA8 A;  1E7P A;  3EUH A;  4HWC A;  3UUL A;  5DJQ C;  1W09 A;  2X68 A;  1SA0 E;  2LSI A;  3AE9 A;  5LB7 B;  3ONX A;  5HEO A;  3ZMV B;  5AQO B;  3AED A;  3N9Q A;  4O2B E;  4ZZB A;  1ZV4 X;  3PUS A;  2ZLY A;  1WYB A;  3AA1 B;  2XQ9 A;  2W61 A;  4TNV A;  2OA5 A;  5LGT B;  1YQ3 A;  5FVL A;  5AQS B;  4B6X A;  5HYA A;  5HEG A;  3C4Z A;  3MK7 C;  2LSJ A;  2VL0 A;  4IDO A;  1XMQ T;  2E5L T;  2W62 A;  3UUM A;  3KFW X;  3OYX A;  2WZI A;  4ILC A;  5AQH B;  4YHJ A;  5KXJ A;  2CHO A;  5FXW A;  3J7Y q;  2WMO A;  1O3X A;  4DR7 T;  1HNX T;  2JIW A;  5JR9 A;  3AA0 B;  2RP4 A;  3Q2M A;  1FJG T;  3IEE A;  3FHN A;  3OPC A;  4HWI B;  3CX6 B;  3N9P A;  3AE7 A;  3KVA A;  5KDM C;  1KEY A;  3EDV A;  1OXZ A;  4H9N C;  4KP3 C;  2IAK A;  3JCF A;  5C2T A;  5FXV A;  2OLT A;  1UCU A;  3A8Y C;  4I0U A;  3RYC E;  4UF0 A;  4X62 T;  3AXJ B;  3E22 E;  3UUN A;  4HFI A;  3LK4 2;  2P9B A;  3ANW B;  3ONL C;  5HXE A;  4ASK A;  4H63 V;  3QUJ A;  2D0T A;  3ZJ1 A;  2EHO D;  4PFP A;  2XQ5 A;  4MBQ A;  2LKG A;  4ADZ A;  3A5X A;  4XZC A;  2XAQ B;  1Z8U A;  2BS3 A;  2XQ6 A;  3O1H A;  1G73 A;  4ZXL A;  3SRZ A;  4DID B;  2WS3 A;  2E2A A;  4P09 A;  4HFV A;  4DUZ T;  4IE6 A;  3X1D A;  3EAM A;  2VKH A;  4CN1 A;  1HX1 B;  1KK7 A;  1W0B A;  1BR1 A;  2HH7 A;  2LSK A;  1HF8 A;  3F57 A;  3LJC A;  4LFB T;  3UUB A;  2CBJ A;  2DWK A;  4CI3 B;  4UEL A;  5LHG B;  2KND A;  1N33 T;  1BR0 A;  3L09 A;  4C90 A;  3HL6 A;  3O1J A;  2BS4 A;  2VVN A;  3QB5 A;  2IIU A;  4CN4 A;  1YXR A;  5J2U E;  5L47 A;  2UXB T;  1DU2 A;  3K8P C;  2J4G A;  4IIJ E;  3PJA A;  4HN9 A;  3LG7 A;  3LBX A;  3W15 B;  2XPK A;  4LF4 T;  3N9L A;  3C64 A;  3HKC E;  4XBF B;  2V1D B;  4AXP A;  5LG4 A;  3AEB A;  2QA7 A;  3KIN B;  3Q9D A;  4HFE A;  2PG8 A;  3RQU A;  3ZN0 B;  2NW8 A;  3RYH E;  4EYY R;  3WAJ A;  1AJ3 A;  2H89 A;  4HKA A;  4JI2 T;  2UUA T;  4LFC T;  1R8I A;  5AQG B;  4JI7 T;  1SUM B;  2MAW A;  2CCQ A;  2LRL A;  3RF1 A;  1ZP0 A;  2CLY C;  4AQF C;  5FXZ A;  2IW5 B;  4UVB B;  3I1A A;  3I9W A;  4ZI3 C;  1OED E;  3CPZ A;  3NRX A;  2I0M A;  1HNZ T;  1SHZ C;  2YDQ A;  3K1S A;  3P4S A;  1Z0P A;  1NEN A;  4HTE A;  3RLF F;  1KFY A;  1D0Z A;  4G63 A;  2JMH A;  2X67 A;  1BR2 A;  5AQL B;  4EIW A;  4H9S E;  3ESL A;  1T8B A;  5LJM A;  2V7L A;  4ZS2 A;  2XJ7 A;  2QYW A;  3P4Q A;  5FMN A;  3RHW A;  1UUR A;  4CI1 B;  1WCR A;  4IE7 A;  2N9D A;  1CUN A;  4AKH A;  3ZT7 A;  2LHN A;  4K0K T;  2YU2 A;  3TLV A;  3ETV A;  4ILA A;  2JQH A;  4X1Y E;  2IML A;  3EDU A;  3AEC A;  4O4H E;  2ODU A;  3NRY A;  4U7Y A;  4TWH A;  4GK5 E;  5FP3 A;  3EHZ A;  4ZHQ E;  2BG9 B;  4G2A A;  1HCI A;  4HFB A;  1XDP A;  2CXD A;  3PUZ F;  2A72 A;  2X0L B;  2XHE B;  3C4W A;  3GN5 A;  3NZQ A;  4NIQ A;  1XZY A;  3QB5 K;  5DQV A;  4DV2 T;  5CJ5 A;  3IF8 B;  5FY7 A;  3UQ7 A;  4U72 A;  3AE5 A;  3I0Q A;  3DJB A;  3EVY A;  5JDM A;  2FBW A;  2Y48 B;  1IJ6 A;  1UGO A;  2J1D G;  4TUY E;  3ZMS B;  4JI4 T;  5BR8 T;  1D1B A;  4IDP A;  4EZH A;  3HI2 A;  3SWH A;  4U74 A;  5LHI B;  4JI8 T;  2WDV A;  4P1N A;  4IDQ A;  2FJA A;  5ABH A;  2H3R A;  2XAH B;  5A1L A;  2WMN A;  5BMV E;  5JRC B;  2DHR A;  3UT5 E;  3FB2 A;  4UIG A;  3TLT A;  2SPC A;  3PUG A;  5AQK B;  2QRX A;  3AEG A;  4DVD A;  2YOE A;  2K9A A;  3CVR A;  5JDF A;  4K0U A;  1VCT A;  3V5U A;  3T1H T;  2BG9 C;  3TLW A;  2HHH T;  2NW9 A;  4IDZ A;  1NAF A;  1U5P A;  1UK5 A;  2XSA A;  4X1K E;  3BQL A;  5ABF A;  5L3E B;  5FY1 A;  4U33 A;  4CN6 A;  2DI4 A;  4P0A A;  5JDN A;  3V5S A;  4ERR A;  4JV5 T;  2N2N A;  3N2G E;  3PUY F;  4I55 E;  2L8K A;  1N34 T;  2YU1 A;  3HKD E;  2CA5 A;  2BKP A;  2JJ9 A;  3IHR A;  4COF A;  3NBX X;  4JBW F;  4A56 A;  3ZT6 A;  4HEA A;  4MLK A;  2WU5 A;  2KWH A;  2VB6 A;  3ZMU B; 
#chains in the Genus database with same CATH homology
 2ACX A;  2CEA A;  2KWI B;  2L9Q A;  3OKQ A;  2CE7 A;  2JRK A;  2VKO A;  2CLY B;  3RYF E;  2YK0 A;  3SOL A;  3KBT A;  4ZOL E;  5IHY A;  4CXW A;  3CML A;  5JR9 C;  4C91 A;  3VHL A;  2ZM0 A;  3D0T A;  2XAS B;  4PAG A;  4O4J E;  3KBU A;  4H9Q C;  1D1A A;  3RC8 A;  4PJJ A;  3MZK B;  4I4T E;  4ZI7 E;  2KMF A;  4EAH A;  4WBN E;  2G0U A;  4GIW A;  4JEH B;  4O8S A;  2MBG A;  2D0U A;  1WLX A;  4AKI A;  1LVF A;  3AAE B;  2WWU A;  4UXN B;  2C0S A;  4BJN A;  2ZM8 A;  3PTR B;  3MKD A;  5HXR A;  1D0X A;  2LSG A;  3C98 B;  4IE5 A;  2BDE A;  3IBP A;  5KX5 E;  5FNV E;  3LK3 B;  3PUQ A;  3N2O A;  2JQQ A;  2VWA A;  5F8P A;  3C51 A;  4E7S A;  5C8Y E;  3PU8 A;  2WSS V;  3R84 B;  2X9X A;  4Z8X A;  4QKN A;  4IGU A;  4L9I A;  3Q5W A;  5JH7 E;  3MA9 A;  4YLH A;  2A3D A;  1MMN A;  4H9R C;  2GK9 A;  2RA1 A;  5LCY A;  4H9O C;  3F2E A;  2KLQ A;  3K3Q C;  1ZHC A;  5EK4 A;  1HG2 A;  4OYK A;  3GN5 B;  3ZYK A;  2A2F X;  2Q9Q B;  2VKJ A;  4GYS A;  1Y64 B;  3I0O A;  3LBX B;  3N5L A;  4P0B A;  3K3N A;  4DBQ A;  4V1A v;  2DWG A;  1WRD A;  2C5K T;  4HGA A;  5FY0 A;  3UFE A;  2DNX A;  4ZI2 D;  1S94 A;  2W0G A;  2XAJ B;  2PBI A;  3GWH A;  5H6R B;  4BJM A;  2VAS A;  4PW8 A;  1FEW A;  2L3L A;  2BZB A;  3OJA A;  5LNK A;  2NOX A;  4UV9 B;  1U4Q A;  1V9D A;  3PUR A;  3ZYM A;  3E08 A;  4BA9 A;  1E1H B;  1NWM X;  5L3F B;  4CXY A;  3UUX B;  2NTX A;  2C5I T;  3OBV E;  3U78 A;  4GYR A;  2ODV A;  2V7I A;  2K24 A;  2YIN A;  4OFZ A;  5LJN A;  3MJX A;  5HXC A;  4EOZ B;  1FMV A;  1MIY A;  5JDG A;  4OYJ A;  4UEM A;  3VKH A;  4AQG A;  1MIW A;  4H63 H;  1YKE B;  4L0R A;  5TAO A;  3JC6 C;  1HG5 A;  2ZMA A;  5LGN B;  2XQY A;  1YKH B;  4ZI2 C;  3HKB E;  5HAX A;  4J2C A;  4IST A;  3HA4 A;  5M4Y A;  2LSY A;  2YEV C;  2E9X D;  1HFA A;  1MMG A;  2V26 A;  2W63 A;  4DND A;  3GMI A;  4QXC B;  2C5J A;  4KBM B;  4WBO A;  1QSD A;  3PU3 A;  5CA1 E;  2E8I A;  3FBL A;  3FXE B;  3ANW A;  4UV8 B;  1G8X A;  2NW7 A;  4IHJ E;  3ZYL A;  4I43 B;  3T8O A;  2V7K A;  2ES0 A;  3P8C D;  4OHF A;  3U3I A;  3HKE E;  4N78 D;  2BVM A;  3ZEF B;  5ETW A;  4I50 E;  4ANJ A;  3H3A A;  2X9H A;  2UXN B;  4L5G A;  3ZN1 B;  4UVA B;  2I59 A;  1KNZ A;  4JLE A;  3FBZ A;  4DMV A;  2LM9 A;  2JMK A;  3KV6 A;  4M1P A;  5LXT E;  3RC3 A;  3J9X 1;  2KT9 A;  2WAU A;  1MMA A;  5HXS A;  2VK9 A;  3C50 A;  3TKL B;  1EZ3 A;  1UX4 A;  2NWB A;  1LRZ A;  4ILU A;  4CZZ B;  2CXL A;  4KMC A;  3ETU A;  3JC6 D;  4TN7 B;  3ZC1 A;  3BK9 A;  3AA7 B;  4QXH B;  4YJ3 E;  3VKG A;  3CX8 B;  3DTO A;  4QX8 B;  4QXB B;  1S35 A;  3AAI A;  4EYU A;  2E9X C;  3KV9 A;  5FXX A;  4IE0 A;  2WM9 A;  1LVK A;  4AKG A;  3UTK A;  1US7 B;  2QGS A;  3BQK A;  1YW0 A;  2PJQ A;  5H6Q B;  5DAB A;  4XAX B;  3ZMT B;  1LKX A;  1HS7 A;  5IYZ E;  2MTQ A;  1MIV A;  4X1I E;  5LBQ B;  3ZCJ A;  5ADX L;  5JDH A;  1FIO A;  3PUA A;  3HR0 A;  2LHR A;  3AVR A;  3KV4 A;  4PJL A;  2XUE A;  4BAY B;  3RRC A;  5F3J A;  4CI2 B;  1YD8 G;  3S4U A;  3VU7 H;  2VKD A;  2LOP A;  1ZEE A;  2KZ7 B;  2M67 A;  4YJ2 E;  1D0Y A;  4FI5 A;  4KUM B;  3K3O A;  1VRB A;  2H7O A;  2KIN B;  4ZS3 A;  4AKL A;  4CXX A;  5L3B B;  4DMW A;  3AAA B;  2D5U A;  4NUV A;  5J1G A;  3B13 A;  3DP7 A;  4UVC B;  5EZY E;  5JDQ A;  1VOM A;  3RPU A;  3LK2 B;  4QX7 B;  3WAK A;  4PK4 A;  4TV9 E;  4PK6 A;  1HX8 A;  2Q9Q D;  5L3G B;  4IE4 A;  2XAG B;  3R6N A;  3RKO A;  1IAP A;  2V7M A;  2JPF A;  2Y8D A;  5GON E;  3B57 A;  3L3P A;  2CMR A;  4YFS A;  2EHO A;  4ISS A;  2D2S A;  5HWX A;  4PJM A;  2HPJ A;  3P7I A;  2E9X A;  4CQI A;  2WBL A;  5HWY A;  5KMG P;  4HE8 A;  2DLR A;  2Y6X A;  3M65 A;  2X9W A;  4AQF A;  4X20 E;  2X51 A;  1B7T A;  1MNE A;  2EHO C;  1BR4 A;  4O4L E;  4NUU A;  5CA0 E;  3N9M A;  4JUY A;  3MXZ A;  2VL8 A;  5L2L A;  3FXD B;  2CWY A;  2XTL A;  4MAL A;  4PFO A;  3RYI E;  5CB4 E;  2LJL A;  5EK3 A;  1MMD A;  3C4X A;  1HTJ F;  3ZLI A;  1D1C A;  3F31 A;  2Q9Q A;  5LHH B;  2CXF A;  2UXX B;  4TV8 E;  4ASK A;  3CQC B;  3Q5X A;  4UF0 B;  4H9P C;  1OWA A;  1WR6 A;  3OYZ A;  4E7Z A;  3CKD A;  4QHO A;  1FMW A;  3ZJ2 A;  2MYS A;  4GK0 E;  1IZN B;  2LOS A;  2Q9Q C;  3CWZ B;  5LOV E;  3RH3 A;  1MND A;  2H7V C;  3NZP A;  5DQW A;  2B1E A;  2CM0 A;  2LE8 A;  3H37 A;  4F6R C;  5LYJ E;  4ZI3 D;  3QK6 A;  5EK2 A;  3KDS E;  5L3D B;  5L3C B;  4O4I E;  1QUU A;  1ZKE A;  2EHO B;  3AA6 B;  3BQI A;  4QWN B;  3PE0 A;  4TX5 A;  2KXP B;  5AFU L;  4EXT A;  1WYC A;  4OK0 A;  4EB6 E;  2IC9 A;  5LP6 E;  3I9Y A;  4MHC A;  5LGU B;  4DO0 A;  3WI3 A;  5JDL A;  2LT3 A;  3N2K E;  3KV5 A;  4PNI A;  3E0Z A;  2BVL A;  2MOZ A;  2N1G A;  2W00 A;  4EZ4 A;  5JR9 B;  3ZCI A;  1IJ5 A;  3LFM A;  1X79 A;  3QC9 A;  2Z6E A;  4MFR A;  5E0O A;  3RRW A;  5FYM A;  4DBR A;  3SS1 A;  3N9N A;  3MAC A;  2XAF B;  2E9X B;  2X9Y A;  4AI6 A;  3AVS A;  3O4X E;  2ZM2 A;  3KVB A;  2CWO A;  3ZMZ B;  5JQG E;  3N9O A;  5LBM A;  1UX5 A;  5JRE A;  5JVD E;  4O2A E;  4WNK A;  2IC6 A;  3PDY A;  4JEU B;  4FJO A;  1H7C A;  2NP9 A;  3O1I A;  4GOU A;  3CQX C;  3ZC0 A;  3RX6 A;  2V7J A;  3CQG B;  5LA6 E;  1T98 A;  3O9X A;  3ZPO A;  2DCF A;  4WW0 A;  2PFV A;  2HPL A;  3CX7 B;  2X66 A;  3AB3 B;  4TZ4 C;  4AKR B;  2LEH A;  2NTY A;  4PK5 A;  5J2T E;  2K48 A;  2K5B B;  3GA8 A;  3EUH A;  3UUL A;  5DJQ C;  2X68 A;  1SA0 E;  2LSI A;  3ZMV B;  3ONX A;  3N9Q A;  4O2B E;  1ZV4 X;  3PUS A;  2ZLY A;  1WYB A;  3AA1 B;  2W61 A;  5LGT B;  2OA5 A;  4B6X A;  5HYA A;  3C4Z A;  3MK7 C;  2LSJ A;  2W62 A;  3UUM A;  3KFW X;  3OYX A;  4YHJ A;  3J7Y q;  5FXW A;  2WMO A;  1O3X A;  5JR9 A;  3AA0 B;  2RP4 A;  3Q2M A;  3IEE A;  3FHN A;  3CX6 B;  3N9P A;  3KVA A;  5KDM C;  3EDV A;  1OXZ A;  4H9N C;  4KP3 C;  2IAK A;  5FXV A;  1UCU A;  3RYC E;  4UF0 A;  3E22 E;  3UUN A;  3LK4 2;  2P9B A;  3ANW B;  5HXE A;  4H63 V;  3QUJ A;  2D0T A;  3ZJ1 A;  2EHO D;  4PFP A;  4MBQ A;  4ADZ A;  3A5X A;  4XZC A;  2XAQ B;  3O1H A;  1G73 A;  3SRZ A;  4P09 A;  4HFV A;  4IE6 A;  2VKH A;  1KK7 A;  2HH7 A;  1BR1 A;  2LSK A;  3LJC A;  1HF8 A;  3F57 A;  2DWK A;  4CI3 B;  4UEL A;  5LHG B;  2KND A;  1BR0 A;  3L09 A;  4C90 A;  3HL6 A;  3O1J A;  5JRC A;  5J2U E;  3K8P C;  4IIJ E;  4HN9 A;  3LG7 A;  3LBX A;  3W15 B;  3N9L A;  3C64 A;  3HKC E;  4XBF B;  2V1D B;  4AXP A;  5LG4 A;  2QA7 A;  3KIN B;  3Q9D A;  3ZN0 B;  2PG8 A;  3WAJ A;  4EYY R;  2NW8 A;  3RYH E;  1AJ3 A;  4HKA A;  2CCQ A;  2CLY C;  4AQF C;  5FXZ A;  2IW5 B;  4UVB B;  3I1A A;  3I9W A;  4ZI3 C;  3CPZ A;  3NRX A;  1SHZ C;  4HTE A;  1Z0P A;  1D0Z A;  4G63 A;  2JMH A;  2X67 A;  1BR2 A;  4EIW A;  4H9S E;  3ESL A;  5LJM A;  2V7L A;  4ZS2 A;  5FMN A;  4CI1 B;  4IE7 A;  2N9D A;  1CUN A;  4AKH A;  2LHN A;  2YU2 A;  3ETV A;  4X1Y E;  3EDU A;  4O4H E;  2ODU A;  3NRY A;  4GK5 E;  5FP3 A;  4ZHQ E;  4G2A A;  1HCI A;  2CXD A;  2A72 A;  3GN5 A;  2X0L B;  2XHE B;  3C4W A;  3NZQ A;  5DQV A;  5HXH A;  3IF8 B;  5FY7 A;  4U72 A;  3I0Q A;  5JDM A;  3DJB A;  3EVY A;  2Y48 B;  1IJ6 A;  4TUY E;  2J1D G;  3ZMS B;  1D1B A;  4EZH A;  3HI2 A;  3SWH A;  4U74 A;  5LHI B;  2H3R A;  2XAH B;  5A1L A;  2WMN A;  5BMV E;  5JRC B;  2DHR A;  3UT5 E;  3FB2 A;  4UIG A;  2SPC A;  3PUG A;  4DVD A;  3V5U A;  2K9A A;  3CVR A;  5JDF A;  4K0U A;  2NW9 A;  4IDZ A;  1NAF A;  1U5P A;  4X1K E;  3BQL A;  5L3E B;  5FY1 A;  2DI4 A;  4P0A A;  5JDN A;  3V5S A;  4ERR A;  2N2N A;  3N2G E;  4I55 E;  2L8K A;  2YU1 A;  3HKD E;  2CA5 A;  3IHR A;  2JJ9 A;  3NBX X;  4A56 A;  4HEA A;  4MLK A;  4PJN A;  2KWH A;  2VB6 A;  3ZMU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...