4TN7B

Crystal structure of mouse kdm2a-h3k36me-no complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 2A
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4tn7B00
4QXBB 4QWNB 4QXCB 4QX7B 4QXHB 4TN7B 4QX8B
chains in the Genus database with same CATH superfamily
3N2GE 4DIDB 5KDMC 1N34T 3P4SA 1M7KA 1FMVA 3HR0A 1XZYA 4DNDA 4AKLA 2K5BB 4DV6T 4B3TT 5FY7A 1FJGT 1I6ZA 1WCRA 2H7OA 4IE0A 2X0YA 4UR9A 1OEDA 3JAFA 1KFYA 2NR4A 5HXHA 5EK2A 4GOUA 4QXHB 4O2AE 1Y01A 3SOLA 2AE9A 3L09A 4O4IE 3Q5EA 4U7IA 3DP7A 4UV9B 3ZJ1A 4PJJA 5LYJE 1MMAA 2W62A 2XASB 4HFDA 5FY0A 2HPJA 2WMOA 2Q9QA 3AEEA 3OTOT 3ETUA 3CQXC 1XMQT 5E0OA 4LFCT 2BKOA 2CM0A 2WB5A 1IJ5A 4OYJA 4OHFA 4B3RT 2W4XA 3K8PC 4DR6T 4DR7T 2CA5A 3I9WA 5F3JA 1U5PA 1YQ3A 2WAUA 4TNVA 3FZFB 5FXWA 3ESLA 5FMNA 2XUEA 4CN4A 2IC9A 4CI1B 2V6YB 3ANWB 5HEUA 4PAGA 3W15B 3LK2B 2X9YA 3RC8A 2VURA 4IL9A 3TLSA 2LOPA 2XAHB 3FZLB 4OYKA 2KSRA 4C90A 4AQYT 2CWYA 1U4QA 2QRXA 2HHHT 1T98A 2CRBA 2MPKA 4DR3T 4AIUA 3PJAA 1D1CA 1UURA 2CHOA 2LHNA 3QOFA 3RLFF 5LGTB 2V7IA 3E0ZA 2MAWA 2X9XA 5HXRA 5JR9A 2CHNA 3RIUC 3TLTA 3RRCA 5LJMA 2LM9A 2LE8A 2J1DG 2WWUA 2X9WA 2N2NA 2XJ7A 3CVRA 5AQTB 2I0MA 4CN1A 3RYIE 4JI2T 2A72A 3ZSTA 4X5TA 4H9PC 3KBTA 4IT4A 3RHWA 2IMLA 1XWMA 3CWZB 3P8CD 5FY1A 5HEHA 5J1GA 3RGLA 3RIUA 4O4JE 3B5MA 4E7SA 5JQGE 4AXPA 3X1DA 4PFOA 2WCAA 5H6QB 4CI2B 2NOXA 2Q9QB 3T1YT 2F4VT 3IBPA 4AI6A 4LF7T 4KMCA 1V9DA 2CXFA 3CQGB 2H7VC 2VKHA 3UU6A 4LMKA 4ZEYA 2CMRA 3LJCA 5ABFB 5LGUB 4IL4A 1J5WA 2CWOA 5LA6E 2G0UA 2L9QA 2VWAA 1DU2A 3ZYLA 2IC6A 4WYVA 2Y8DA 3LFMA 2P9BA 5KXJA 1HF8A 1HG2A 3MKDA 2QVAA 2NWBA 2M67A 5IUXA 4X65T 3FXDB 3MXZA 3UUXB 2C0SA 3JC6C 5DJQC 4TWDA 2VKJA 2UUAT 3AEFA 3C51A 2MBGA 4O4LE 3ZC0A 4CI3B 2D5UA 2JJ9A 2LEHA 4MFRA 3TLWA 4EZHA 2WS3A 3EUHA 3ZLIA 4ZZBA 2RA1A 5L3FB 2OA5A 1E2AA 2BS4A 2V7LA 3HA4A 4TWFA 4B3ST 4I43B 2YOEA 2H89A 3NVOA 3SFDA 4AQFC 4U7YA 1HCIA 4HWDA 4U72A 3UTKA 1NENA 5JDNA 3FHNA 5EZYE 2HN1A 3ZCJA 1HS7A 2LJLA 2OV9A 4ILCA 2RPAA 2L3LA 4OFZA 2XM1A 4X62T 3UULA 4YJ2E 4H63V 4YHHT 2XAQB 1AJ3A 2YINA 5AQFB 4ZI2D 2BS2A 5JDLA 4NUUA 4YFSA 1HNZT 2XSBA 3AAAB 5J2UE 3PUXF 2L8KA 1IJ6A 2ZLYA 3AE1A 3C50A 3KVBA 3NZPA 3OKQA 4PJNA 4TN7B 4YTMA 5EK3A 3F57A 3UU5A 3VRBA 3ZT7A 1UK5A 3B13A 4DBRA 5CA0E 2DNXA 3T1HT 4X1KE 4HWFA 1N32T 4FJOA 4IDOA 2BG9A 4GK0E 3AE4A 4ISSA 4N78D 4TNWA 4YTNA 5BR8T 1IZNB 4U3CA 3CQCB 4K0KT 3JC6D 5J0ZA 4BA9A 2JPFA 4ZI3C 5HYAA 3AA1B 1IAPA 2XAGB 3NRXA 2FJAA 3ZMSB 4EYYR 3A7MA 1YW0A 4IDNA 4JI1T 4KHZF 4COFA 1W0AA 2ODVA 4IGUA 3AAEB 3BK9A 4DO0A 3K3QC 1WFDA 3F2EA 1HNWT 4HEAA 4QH5A 3J7Yq 2VQFT 2A2FX 4PJLA 5LMUT 2K24A 3OYXA 3QB5K 2DI4A 2KT9A 1MIVA 2V6YA 3ANWA 4AQFA 3UU4A 3VU7H 1UCUA 3EVYA 1FIOA 1MNDA 2EHOC 3CKDA 2LKGA 2VKDA 4FI5A 4P09A 5ADXL 2WP9A 5L47A 1BR0A 5FKYA 3AVRA 3ZEFB 3LDQB 5HEJA 3C64A 3N9LA 4HTEA 4L9IA 4JI6T 2WY2A 1G8XA 2WWVA 5FL1A 2OLTA 3AE8A 5GONE 4EZ4A 4QKNA 4HWHA 2YEVC 4QXBB 3H3MA 3RIFA 3HKEE 3N9MA 4DR5T 2CXDA 4LF4T 3B57A 5TAOA 1JNZA 4JI8T 2XQ5A 3TLUA 4ILAA 4NXMT 2LSYA 3QK6A 4O4HE 4JI5T 3RQWA 4YTPA 1OEDB 1UGOA 3H3AA 3PJAJ 1T8BA 2BBHA 1FEWA 2W0GA 3AXJB 3UQ4A 5LXTE 2JMHA 4AKRB 2KNDA 3GMIA 2QYWA 3MZKB 2LOSA 2KWIB 5JR9C 4A97A 4NXNT 5LHIB 2B76A 4MALA 4WBNE 4J2CA 4JEUB 4H9SE 4ZI7E 1BR1A 3ETVA 4ERRA 5JRCB 4HWIB 4BAYB 5AQMB 1WYBA 2WZHA 2MTQA 4Z91A 4GYSA 3ZYMA 2D0TA 2XSAA 2VQET 3ZCIA 2LSIA 1HNXT 2DWGA 3PUVF 3VKGA 3PE0A 3PUSA 2DWKA 4H9OC 3HI2A 2ZM2A 4HFHA 3HL6A 1E1HB 3A5XA 4U2YA 5JH7E 3PURA 3C98B 4KP3C 3RH3A 3OVUA 3S4UA 4DUZT 2CPTA 2E9XD 4NIQA 4LMJA 4PK4A 5AQRB 3P4RA 2CBJA 5HWYA 2CE7A 5ABGA 5JDHA 4X20E 2XQ7A 4H63H 1J5ET 3ZC1A 5C2TA 3AE9A 4IE6A 2DLRA 4UVBB 4JUYA 3EDVA 3H37A 4UXNB 1QUUA 2JQKA 4EV6A 5LBMA 2BVLA 3FZKB 3K3OA 4QWNB 4A56A 2UUCT 1T72A 2NP9A 2PJQA 3ABVA 2C5JA 3Q5XA 4PJMA 4G63A 3WAJA 1US7B 3AE6A 2CLYB 1MMDA 2HPLA 3I0QA 3FZHB 1SUMB 2HN2A 1HTJF 4IDQA 2NW7A 3ZKRA 4DVDA 3RKGA 4X66T 1LRZA 3E22E 3AEBA 3IEEA 3GWHA 4G2AA 3IF8B 4Z8XA 4ZS2A 3ZN1B 3DTOA 3O4XE 3EAMA 4DV2T 1XMOT 5L3EB 2X0HA 3G06A 5L3GB 3WAKA 5L3DB 3O1HA 5L2LA 1LKXA 2W2UA 4UV8B 2WDVA 3PV0F 3TKLB 3VHLA 4ISTA 3CX8B 1VRBA 3LK3B 3RQUA 4CN6A 3QC9A 3L3PA 5HXEA 2IDOB 4LFAT 2M6IA 4YJ3E 3ZN0B 2D9DA 3ONJA 4M1PA 2WZIA 5IHYA 4ADZA 2ACZA 2X9HA 3AE3A 3AEGA 2WM9A 4Z90A 3V5SA 3MA9A 5KMGP 3CIRA 2XQ4A 3AVSA 2Z6EA 3F31A 4HE8A 4IDPA 4CZZB 3SWHA 4KHPT 1WRDA 2QGSA 2X67A 3LG7A 3OYZA 2V8SV 4LF8T 4MLKA 2XQ3A 1VCTA 1OXZA 4I4TE 1OWAA 5JVDE 3UT5E 4F8HA 2KWHA 2VL8A 3WI3A 2ZM8A 2LSKA 2W00A 3AEDA 1MMNA 3ZMVB 2Y48B 4IDZA 4QHOA 4BJNA 5LHHB 1EZ3A 2LRLA 5JTGA 2IAKA 1SA0E 2J62A 4KX6A 1Y64B 2FJEA 5EK4A 5FP3A 4JEHB 5LCYA 3ZPOA 3L8RA 1MIYA 2VL0A 2PBIA 2PG8A 3HKCE 4DR4T 4HFIA 3HKDE 4NPPA 5HEOA 2UXNB 4TV9E 3BQKA 3U3IA 4A98A 4ZZCA 5J2TE 5IWAT 3MACA 2QA7A 5AQNB 3UFGA 1N36T 4EB6E 1QSDA 5ETWA 1IBKT 4ILUA 1KNZA 2WQYA 5HAXA 2E9XC 2I6HA 1WR0A 3I9YA 4HFVA 4H9QC 3FBLA 2VKOA 3JCFA 3CX6B 4GK5E 4UF0B 4XBFB 4IREA 2W66A 2C5IT 2N1GA 4PFPA 4HFEA 4X64T 4P0AA 5ABFA 1XNQT 3AB3B 4JYAT 3FZMB 1UX5A 2YN6A 2NW9A 2NTXA 2KZ7B 4HN9A 5AQHB 4DMVA 5JDMA 5LGNB 2BG9E 5F5WA 3PUAA 3VRAA 3KVAA 1M62A 1SHZC 4EEDA 4DV7T 4DR1T 1HG5A 2Q9QC 3UUMA 4AQGA 4LFBT 2WU2A 3LBXA 4MHCA 4HFBA 3R84B 3P7IA 5AQSB 3K1SA 1WR6A 2FBWA 3R6NA 1G73A 3T8OA 5AQVB 2ZM6T 5HXCA 3PUZF 4UEMA 2J4GA 4WZXA 1IBMT 2D0UA 3GN5A 2YU2A 2K48A 1S35A 2Q9QD 2V1DB 2IW5B 1QLBA 2BS3A 3AAIA 1ZKEA 3PUGA 1KNPA 2VK9A 3KINB 4H9NC 2FUPA 5AQPB 4JI0T 3C4WA 3NKZA 2ACXA 4EYUA 1IBLT 1X79A 3NZQA 1LVKA 2V7MA 2WSSV 1LVFA 2CXLA 2XAJB 4I50E 3N9QA 4QH1A 4BJMA 2ZMAA 2V7JA 2E2AA 3IA3A 3N2KE 3HKBE 4TV8E 5LNKA 1KNRA 2LSJA 5AQLB 5LB7B 5LMNT 4OX9T 4UF0A 5L4EA 1JNRA 3CMLA 4PNIA 3ZT5A 2IUBA 3RYFE 1CHUA 1HX1B 2V5CA 1S94A 3OBVE 5BMVE 4DV4T 1I94T 3ZMZB 4LF6T 1VOMA 2WU5A 2WBLA 4ZS3A 4B3MT 4DR2T 4JV5T 4EOZB 2BG9C 2KMFA 2E5VA 2ES0A 3N2OA 3NRYA 5KX5E 1MNEA 4QX8B 2NTYA 2XPKA 3Q5WA 5CB4E 2D2SA 1KEYA 3QB5A 2JMKA 3Q2MA 2XZEA 4QX7B 2Y6XA 4O2BE 2WDRA 3AE2A 5FVLA 4QH4A 1BR4A 5FL0A 2FJBA 2JQ9A 2XTLA 1OEDC 4TX5A 3N9NA 3RI5A 2DHRA 2LT3A 1D0ZA 5FXVA 5CA1E 5H6RB 2JQQA 2X68A 3O9XA 2VASA 4WBOA 1YXRA 4AKIA 1O3XA 3ONLC 4TWHA 1XDOA 3O1IA 1ZP0A 5AQUB 5F8PA 5HCMA 1OEDE 2CBIA 1CUNA 1D0XA 2XQAA 3I1AA 3IHRA 3KV6A 5AQGB 1ZHCA 1L0VA 2NW8A 4JI3T 2E8IA 4YHJA 2V6XA 3ZYKA 4C91A 4DV0T 5C3JA 2ZM0A 3PU8A 4ASKA 4U33A 1NEKA 2HH7A 2JIWA 3P4WA 5FXXA 3RRWA 4EAHA 2LHRA 1WYCA 3E08A 4UIGA 4DBQA 5LG4A 1HR0T 2M6BA 3P4PA 4OK0A 4GKKT 2MOZA 3D0TA 4ILBA 2W67A 1VCSA 2WDQA 1HX8A 4U2ZA 4UVAB 5AQQB 5FYMA 1KK7A 2VB6A 3KV9A 2C5KT 3LSVA 5JDGA 4E7ZA 1R8IA 3KV5A 2PFVA 2E9XA 3RX6A 3ZMUB 1ZOYA 2YKSA 3PUQA 4EIWA 4YSXA 3VR9A 3VKHA 3EDUA 4AISA 3FXEB 1D1BA 4ZI3D 3EI0A 2XQ8A 1W09A 3BQLA 3JAEA 2RP4A 1SE7A 5AQJB 5JDFA 5L4HA 5M4YA 3C4ZA 2UU9T 3AEAA 3P4QA 5DQVA 4L0RA 4ZXLA 3RPUA 4KUMB 4ANJA 5CFBA 1ZV4X 1YKHB 3UQ7A 4LF9T 2WMNA 1T7SA 2KINB 3EHZA 4B6XA 4GKJT 3NBXX 5LG3A 3PTRB 2UXXB 2MYSA 3N5LA 1KF6A 4LMLA 4Q25A 5LOVE 4EXTA 3KBUA 5LHGB 2LLYA 3PUYF 4DV1T 2YDQA 3ZSSA 2LRKA 2YDSA 4V1Av 3LK42 3M65A 1E7PA 1MIWA 3Q9DA 4HWCA 4IE7A 4YSYA 2KLQA 2BDEA 2LSGA 3RIAA 3AA6B 1H7CA 2CCQA 5HCJA 4ZOLE 4AKHA 5DQWA 3A8YC 2IIUA 4PW8A 2LM2A 5FXZA 2JQHA 3P50A 4I0UA 3QNUA 4IHJE 4IIJE 4NUVA 3ONXA 2N9DA 3SRZA 3ZMTB 4JI4T 2DL1A 3NWIA 1J1JA 3KFWX 1N33T 3RKOA 1YKEB 1D1AA 1NAFA 2V5DA 3L39A 3V5UA 5HWXA 4DUYT 5CJ5A 1UX4A 2EHOA 4DMWA 5C8YE 4CXYA 3CX7B 4UVCB 3DJBA 2XM2A 2YDRA 3PDYA 3QUJA 4H9RC 1UUSA 4JBWF 4L5GA 4X1IE 3U78A 4YSZA 4DV3T 2I59A 2UUBT 4DV5T 1HFAA 5FNVE 3RF1A 3CK6A 3KDSE 2FJDA 4JI7T 2XQ6A 4HGAA 4KI0F 2X51A 4YLHA 4IE5A 1MMGA 2BZBA 3EABA 2V26A 5HEGA 5AQOB 2A3DA 3J9X1 4I55E 2JRKA 1BR2A 2DCFA 2UXBT 3JADA 3Q5DA 2H3RA 3AECA 3SS1A 2V7KA 2YK0A 4GYRA 3RYHE 2KXPB 2A9UA 2YU1A 4TUYE 4YXDA 3MJXA 1NWMX 2BKNA 2EHOD 4TZ4C 5JDQA 3AE7A 4IE4A 5LBQB 3FBZA 2UXCT 1X9BA 4AKGA 2XHEB 5IYZE 3CPZA 5L3BB 4HKAA 1YQ4A 2H88A 4JLEA 3UU3A 4LF5T 1YD8G 3LBXB 2R6GF 3AXJA 3PUWF 3AA7B 4CXWA 5HXSA 4YY3T 2BBJA 5LJNA 4WNKA 4A5XA 4ZHQE 2XAFB 4YT0A 3SFEA 2X0LB 3PU3A 4XAXB 5JRCA 4CXXA 3TLVA 3MK7C 2XQYA 4U74A 3UUNA 3OPCA 4O8SA 5JR9B 1W9RA 1XDPA 3C4XA 2BVMA 5L3CB 2E5LT 2CEAA 1GQEA 4HFCA 3RYCE 1XNRT 2SPCA 1ZEEA 1B7TA 4P0BA 3FB2A 4QXCB 2W61A 3UFEA 4P1NA 2UXDT 1WLXA 3AE5A 4EEBA 2XQ9A 3UUBA 2VVSA 3OJAA 5A1LA 3M3ZB 2X66A 2XY8B 4ZI2C 3GA8A 3KV4A 4GIWA 4PK6A 4F6RC 1W0BA 2LKHA 5JREA 2EHOB 3K3NA 3ZJ2A 3N9OA 4PK5A 4UELA 5AQKB 5AFUL 3AA0B 3GN5B 3I0OA 1Z0PA 4U31A 2E9XB 5DABA 4KBMB 2AXDS 3UU8A 3VR8A 5LP6E 2K9AA 4EGWA 3N9PA 2BKPA 5AQIB 5ABHA 2PTFA 4MBQA 1Z8UA 2W63A 5FVKA 4XZCA 4CQIA 2IHR1 2VVNA 4K0UA 3O1JA 2ODUA 5ABEA 2CLYC 2J47A 1D0YA 2BG9B 2GK9A 3RC3A 3BQIA 4WW0A 3ZT6A 2B1EA 5CGMA 4X1YE 2K3WA 1FMWA
chains in the Genus database with same CATH topology
3N2GE 5KDMC 4DNDA 1FMVA 3HR0A 4AKLA 2K5BB 5FY7A 2H7OA 4IE0A 5HXHA 5EK2A 4GOUA 4QXHB 4O2AE 5LG4A 3SOLA 4UV9B 3L09A 4O4IE 5LHIB 5LYJE 3DP7A 3ZJ1A 4PJJA 1MMAA 2W62A 2XASB 5FY0A 2HPJA 2WMOA 2Q9QA 3ETUA 3CQXC 5E0OA 2CM0A 4OYJA 1IJ5A 4OHFA 3K8PC 2CA5A 3I9WA 5F3JA 1U5PA 2WAUA 5FXWA 3ESLA 5FMNA 2XUEA 2IC9A 4CI1B 3ANWB 4PAGA 3W15B 3LK2B 2X9YA 3RC8A 2LOPA 2XAHB 4OYKA 4C90A 2CWYA 1U4QA 1T98A 1D1CA 2LHNA 5LGTB 2V7IA 3E0ZA 2X9XA 5HXRA 5JR9A 3RRCA 5LJMA 2LM9A 2X9WA 2LE8A 2J1DG 2WWUA 2N2NA 3CVRA 3RYIE 2A72A 4H9PC 3KBTA 5FY1A 3CWZB 3P8CD 5J1GA 4O4JE 4E7SA 4AXPA 4PFOA 5H6QB 4CI2B 2NOXA 2Q9QB 4AI6A 3IBPA 4KMCA 1V9DA 2CXFA 3CQGB 2H7VC 2VKHA 5LGUB 2CMRA 3LJCA 2CWOA 5LA6E 2G0UA 2L9QA 2VWAA 3ZYLA 2IC6A 2Y8DA 3LFMA 2P9BA 1HF8A 1HG2A 3MKDA 2NWBA 2M67A 3FXDB 3MXZA 3UUXB 2C0SA 3JC6C 5DJQC 2VKJA 3C51A 2MBGA 4O4LE 3ZC0A 4CI3B 2D5UA 2JJ9A 2LEHA 4MFRA 4EZHA 3EUHA 3ZLIA 5L3FB 2RA1A 2OA5A 2V7LA 3HA4A 4I43B 4AQFC 1HCIA 4U72A 3UTKA 5JDNA 3FHNA 5EZYE 3ZCJA 1HS7A 2LJLA 2L3LA 4OFZA 3UULA 4YJ2E 4H63V 1AJ3A 2XAQB 2YINA 4ZI2D 5JDLA 4NUUA 4YFSA 3AAAB 5J2UE 2L8KA 1IJ6A 2ZLYA 3KVBA 3C50A 3NZPA 3OKQA 4PJNA 4TN7B 4BJMA 5EK3A 3F57A 3B13A 4DBRA 5CA0E 2DNXA 4X1KE 4FJOA 4GK0E 4ISSA 4N78D 1IZNB 3CQCB 3JC6D 4BA9A 2JPFA 4ZI3C 5HYAA 3AA1B 1IAPA 2XAGB 3NRXA 3ZMSB 4EYYR 1YW0A 2ODVA 4IGUA 3AAEB 3BK9A 4DO0A 3K3QC 3F2EA 4HEAA 3J7Yq 2A2FX 4PJLA 2K24A 3OYXA 2DI4A 2KT9A 1MIVA 3ANWA 4AQFA 3VU7H 1UCUA 3EVYA 1FIOA 1MNDA 2EHOC 3CKDA 4FI5A 2VKDA 5ADXL 4P09A 1BR0A 3AVRA 3ZEFB 3C64A 3N9LA 4HTEA 4L9IA 1G8XA 5GONE 4EZ4A 4QKNA 2YEVC 4QXBB 3HKEE 3N9MA 2CXDA 3B57A 5TAOA 2LSYA 3QK6A 4O4HE 3H3AA 2W0GA 1FEWA 5LXTE 2JMHA 4AKRB 2KNDA 3GMIA 3MZKB 2LOSA 2KWIB 5JR9C 4MALA 4WBNE 4J2CA 4JEUB 4H9SE 4ZI7E 1BR1A 3ETVA 4ERRA 5JRCB 4BAYB 1WYBA 2MTQA 4GYSA 3ZYMA 2D0TA 3VKGA 3ZCIA 2LSIA 2DWGA 3PE0A 3PUSA 2DWKA 4H9OC 3HI2A 2ZM2A 3HL6A 1E1HB 3A5XA 5JH7E 3PURA 3C98B 4KP3C 3RH3A 3S4UA 2E9XD 4PK4A 5HWYA 2CE7A 5JDHA 4X20E 4H63H 3ZC1A 4IE6A 2DLRA 4UVBB 4JUYA 3EDVA 3H37A 4UXNB 1QUUA 5LBMA 2BVLA 3K3OA 4A56A 4QWNB 2NP9A 2PJQA 2C5JA 3Q5XA 4PJMA 4G63A 3WAJA 1US7B 3LG7A 2CLYB 1MMDA 2HPLA 3I0QA 1HTJF 2NW7A 4DVDA 1LRZA 3E22E 4ZS2A 3IEEA 3GWHA 4G2AA 3IF8B 4Z8XA 3ZN1B 3DTOA 3O4XE 5L3EB 5L3GB 3WAKA 5L3DB 3O1HA 5L2LA 1LKXA 4UV8B 3TKLB 3VHLA 4ISTA 3CX8B 1VRBA 3LK3B 3QC9A 3L3PA 5HXEA 3ZN0B 4YJ3E 5JQGE 5IHYA 4M1PA 4ADZA 4AKHA 2X9HA 5KMGP 2WM9A 3V5SA 3MA9A 4CZZB 3AVSA 4HE8A 2Z6EA 3F31A 3SWHA 1WRDA 2QGSA 2X67A 3OYZA 4MLKA 1OXZA 4I4TE 1OWAA 5JVDE 3UT5E 2KWHA 2VL8A 3WI3A 2ZM8A 2LSKA 2W00A 3ZMVB 1MMNA 4BJNA 2Y48B 4IDZA 4QHOA 5LHHB 1EZ3A 3O9XA 2IAKA 1SA0E 5LCYA 1Y64B 5EK4A 5FP3A 4JEHB 3ZPOA 1MIYA 2PBIA 2PG8A 3HKCE 3HKDE 2UXNB 4TV9E 3BQKA 3U3IA 5J2TE 3MACA 2QA7A 4EB6E 1QSDA 5ETWA 4ILUA 1KNZA 5HAXA 2E9XC 3I9YA 4HFVA 4UF0B 4H9QC 3FBLA 2VKOA 4GK5E 3CX6B 4XBFB 4PFPA 2C5IT 2N1GA 4P0AA 3AB3B 1UX5A 2NW9A 2NTXA 2KZ7B 4HN9A 4DMVA 5JDMA 5LGNB 3PUAA 3KVAA 1SHZC 1HG5A 2Q9QC 3UUMA 4AQGA 3LBXA 4MHCA 3R84B 3P7IA 1WR6A 3R6NA 1G73A 3T8OA 5HXCA 4UEMA 2D0UA 3GN5A 2YU2A 2K48A 1S35A 2Q9QD 2V1DB 2IW5B 4H9NC 3AAIA 1ZKEA 3PUGA 2VK9A 3KINB 3C4WA 2ACXA 4EYUA 1X79A 3NZQA 1LVKA 2V7MA 2WSSV 1LVFA 2CXLA 2XAJB 4I50E 3N9QA 2ZMAA 2V7JA 3N2KE 3HKBE 4TV8E 5LNKA 2LSJA 4UF0A 4PNIA 3CMLA 3RYFE 3OBVE 1S94A 5BMVE 3ZMZB 1VOMA 4ZS3A 2WBLA 4EOZB 2KMFA 2ES0A 3N2OA 3NRYA 5KX5E 1MNEA 4QX8B 2NTYA 3Q5WA 5CB4E 2D2SA 2JMKA 3Q2MA 4QX7B 2Y6XA 4O2BE 1BR4A 2XTLA 4TX5A 3N9NA 2DHRA 2LT3A 1D0ZA 5FXVA 5CA1E 5H6RB 2JQQA 2X68A 2VASA 4WBOA 4AKIA 1O3XA 5F8PA 3O1IA 1CUNA 1D0XA 3I1AA 3IHRA 3KV6A 1ZHCA 2NW8A 2E8IA 4YHJA 3ZYKA 4C91A 2ZM0A 3PU8A 4ASKA 2HH7A 5FXXA 3RRWA 4EAHA 2LHRA 1WYCA 3E08A 4UIGA 4DBQA 4OK0A 2MOZA 3D0TA 5FYMA 1HX8A 4UVAB 5JDGA 1KK7A 2VB6A 3KV9A 2C5KT 4E7ZA 3KV5A 2PFVA 2E9XA 3RX6A 3ZMUB 4EIWA 3VKHA 3PUQA 3EDUA 3FXEB 1D1BA 4ZI3D 3BQLA 5M4YA 2RP4A 5JDFA 3C4ZA 5DQVA 4L0RA 4ANJA 3RPUA 4KUMB 1ZV4X 1YKHB 2WMNA 2KINB 4B6XA 3NBXX 3PTRB 2UXXB 2MYSA 3N5LA 4EXTA 5LHGB 5LOVE 3KBUA 4V1Av 3LK42 3M65A 1MIWA 3Q9DA 4IE7A 2KLQA 2BDEA 2LSGA 3AA6B 1H7CA 2CCQA 4ZOLE 5DQWA 5FXZA 4PW8A 3SRZA 4IHJE 4NUVA 4IIJE 3ZMTB 3ONXA 2N9DA 3KFWX 3RKOA 1YKEB 1D1AA 1NAFA 5HWXA 3V5UA 1UX4A 2EHOA 4DMWA 5C8YE 4CXYA 3CX7B 4UVCB 3DJBA 3QUJA 3PDYA 4L5GA 4H9RC 3U78A 4X1IE 2I59A 1HFAA 5FNVE 3KDSE 4HGAA 4YLHA 2X51A 4IE5A 1MMGA 2BZBA 2V26A 2A3DA 3J9X1 4I55E 2JRKA 1BR2A 2DCFA 2H3RA 3SS1A 2V7KA 2YK0A 4GYRA 3RYHE 2KXPB 2YU1A 4TUYE 3MJXA 1NWMX 2EHOD 4TZ4C 5JDQA 4IE4A 5LBQB 3FBZA 4AKGA 2XHEB 5IYZE 3CPZA 5L3BB 4HKAA 4JLEA 1YD8G 3LBXB 3AA7B 4CXWA 5HXSA 5LJNA 4WNKA 4ZHQE 2XAFB 5JRCA 2X0LB 3PU3A 4XAXB 4CXXA 3UUNA 3MK7C 2XQYA 4U74A 4O8SA 5JR9B 3C4XA 2BVMA 5L3CB 2CEAA 3RYCE 2SPCA 1ZEEA 1B7TA 4P0BA 3FB2A 4QXCB 2W61A 3UFEA 1WLXA 3OJAA 5A1LA 2X66A 4ZI2C 3GA8A 3KV4A 4GIWA 4PK6A 4F6RC 5JREA 2EHOB 3K3NA 3ZJ2A 3N9OA 4PK5A 4UELA 5AFUL 3GN5B 3I0OA 1Z0PA 2E9XB 5DABA 4KBMB 5LP6E 2K9AA 3N9PA 4MBQA 4CQIA 2W63A 4XZCA 4K0UA 3O1JA 2ODUA 2CLYC 1D0YA 2GK9A 3RC3A 3BQIA 4WW0A 2B1EA 4X1YE 3AA0B 1FMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXB B;  4QWN B;  4QXC B;  4QX7 B;  4QXH B;  4TN7 B;  4QX8 B; 
#chains in the Genus database with same CATH topology
 3N2G E;  4DID B;  5KDM C;  1N34 T;  3P4S A;  1M7K A;  1FMV A;  3HR0 A;  1XZY A;  4DND A;  4AKL A;  2K5B B;  4DV6 T;  4B3T T;  5FY7 A;  1FJG T;  1I6Z A;  1WCR A;  2H7O A;  4IE0 A;  2X0Y A;  4UR9 A;  1OED A;  3JAF A;  1KFY A;  2NR4 A;  5HXH A;  5EK2 A;  4GOU A;  4QXH B;  4O2A E;  1Y01 A;  3SOL A;  2AE9 A;  3L09 A;  4O4I E;  3Q5E A;  4U7I A;  3DP7 A;  4UV9 B;  3ZJ1 A;  4PJJ A;  5LYJ E;  1MMA A;  2W62 A;  2XAS B;  4HFD A;  5FY0 A;  2HPJ A;  2WMO A;  2Q9Q A;  3AEE A;  3OTO T;  3ETU A;  3CQX C;  1XMQ T;  5E0O A;  4LFC T;  2BKO A;  2CM0 A;  2WB5 A;  1IJ5 A;  4OYJ A;  4OHF A;  4B3R T;  2W4X A;  3K8P C;  4DR6 T;  4DR7 T;  2CA5 A;  3I9W A;  5F3J A;  1U5P A;  1YQ3 A;  2WAU A;  4TNV A;  3FZF B;  5FXW A;  3ESL A;  5FMN A;  2XUE A;  4CN4 A;  2IC9 A;  4CI1 B;  2V6Y B;  3ANW B;  5HEU A;  4PAG A;  3W15 B;  3LK2 B;  2X9Y A;  3RC8 A;  2VUR A;  4IL9 A;  3TLS A;  2LOP A;  2XAH B;  3FZL B;  4OYK A;  2KSR A;  4C90 A;  4AQY T;  2CWY A;  1U4Q A;  2QRX A;  2HHH T;  1T98 A;  2CRB A;  2MPK A;  4DR3 T;  4AIU A;  3PJA A;  1D1C A;  1UUR A;  2CHO A;  2LHN A;  3QOF A;  3RLF F;  5LGT B;  2V7I A;  3E0Z A;  2MAW A;  2X9X A;  5HXR A;  5JR9 A;  2CHN A;  3RIU C;  3TLT A;  3RRC A;  5LJM A;  2LM9 A;  2LE8 A;  2J1D G;  2WWU A;  2X9W A;  2N2N A;  2XJ7 A;  3CVR A;  5AQT B;  2I0M A;  4CN1 A;  3RYI E;  4JI2 T;  2A72 A;  3ZST A;  4X5T A;  4H9P C;  3KBT A;  4IT4 A;  3RHW A;  2IML A;  1XWM A;  3CWZ B;  3P8C D;  5FY1 A;  5HEH A;  5J1G A;  3RGL A;  3RIU A;  4O4J E;  3B5M A;  4E7S A;  5JQG E;  4AXP A;  3X1D A;  4PFO A;  2WCA A;  5H6Q B;  4CI2 B;  2NOX A;  2Q9Q B;  3T1Y T;  2F4V T;  3IBP A;  4AI6 A;  4LF7 T;  4KMC A;  1V9D A;  2CXF A;  3CQG B;  2H7V C;  2VKH A;  3UU6 A;  4LMK A;  4ZEY A;  2CMR A;  3LJC A;  5ABF B;  5LGU B;  4IL4 A;  1J5W A;  2CWO A;  5LA6 E;  2G0U A;  2L9Q A;  2VWA A;  1DU2 A;  3ZYL A;  2IC6 A;  4WYV A;  2Y8D A;  3LFM A;  2P9B A;  5KXJ A;  1HF8 A;  1HG2 A;  3MKD A;  2QVA A;  2NWB A;  2M67 A;  5IUX A;  4X65 T;  3FXD B;  3MXZ A;  3UUX B;  2C0S A;  3JC6 C;  5DJQ C;  4TWD A;  2VKJ A;  2UUA T;  3AEF A;  3C51 A;  2MBG A;  4O4L E;  3ZC0 A;  4CI3 B;  2D5U A;  2JJ9 A;  2LEH A;  4MFR A;  3TLW A;  4EZH A;  2WS3 A;  3EUH A;  3ZLI A;  4ZZB A;  2RA1 A;  5L3F B;  2OA5 A;  1E2A A;  2BS4 A;  2V7L A;  3HA4 A;  4TWF A;  4B3S T;  4I43 B;  2YOE A;  2H89 A;  3NVO A;  3SFD A;  4AQF C;  4U7Y A;  1HCI A;  4HWD A;  4U72 A;  3UTK A;  1NEN A;  5JDN A;  3FHN A;  5EZY E;  2HN1 A;  3ZCJ A;  1HS7 A;  2LJL A;  2OV9 A;  4ILC A;  2RPA A;  2L3L A;  4OFZ A;  2XM1 A;  4X62 T;  3UUL A;  4YJ2 E;  4H63 V;  4YHH T;  2XAQ B;  1AJ3 A;  2YIN A;  5AQF B;  4ZI2 D;  2BS2 A;  5JDL A;  4NUU A;  4YFS A;  1HNZ T;  2XSB A;  3AAA B;  5J2U E;  3PUX F;  2L8K A;  1IJ6 A;  2ZLY A;  3AE1 A;  3C50 A;  3KVB A;  3NZP A;  3OKQ A;  4PJN A;  4TN7 B;  4YTM A;  5EK3 A;  3F57 A;  3UU5 A;  3VRB A;  3ZT7 A;  1UK5 A;  3B13 A;  4DBR A;  5CA0 E;  2DNX A;  3T1H T;  4X1K E;  4HWF A;  1N32 T;  4FJO A;  4IDO A;  2BG9 A;  4GK0 E;  3AE4 A;  4ISS A;  4N78 D;  4TNW A;  4YTN A;  5BR8 T;  1IZN B;  4U3C A;  3CQC B;  4K0K T;  3JC6 D;  5J0Z A;  4BA9 A;  2JPF A;  4ZI3 C;  5HYA A;  3AA1 B;  1IAP A;  2XAG B;  3NRX A;  2FJA A;  3ZMS B;  4EYY R;  3A7M A;  1YW0 A;  4IDN A;  4JI1 T;  4KHZ F;  4COF A;  1W0A A;  2ODV A;  4IGU A;  3AAE B;  3BK9 A;  4DO0 A;  3K3Q C;  1WFD A;  3F2E A;  1HNW T;  4HEA A;  4QH5 A;  3J7Y q;  2VQF T;  2A2F X;  4PJL A;  5LMU T;  2K24 A;  3OYX A;  3QB5 K;  2DI4 A;  2KT9 A;  1MIV A;  2V6Y A;  3ANW A;  4AQF A;  3UU4 A;  3VU7 H;  1UCU A;  3EVY A;  1FIO A;  1MND A;  2EHO C;  3CKD A;  2LKG A;  2VKD A;  4FI5 A;  4P09 A;  5ADX L;  2WP9 A;  5L47 A;  1BR0 A;  5FKY A;  3AVR A;  3ZEF B;  3LDQ B;  5HEJ A;  3C64 A;  3N9L A;  4HTE A;  4L9I A;  4JI6 T;  2WY2 A;  1G8X A;  2WWV A;  5FL1 A;  2OLT A;  3AE8 A;  5GON E;  4EZ4 A;  4QKN A;  4HWH A;  2YEV C;  4QXB B;  3H3M A;  3RIF A;  3HKE E;  3N9M A;  4DR5 T;  2CXD A;  4LF4 T;  3B57 A;  5TAO A;  1JNZ A;  4JI8 T;  2XQ5 A;  3TLU A;  4ILA A;  4NXM T;  2LSY A;  3QK6 A;  4O4H E;  4JI5 T;  3RQW A;  4YTP A;  1OED B;  1UGO A;  3H3A A;  3PJA J;  1T8B A;  2BBH A;  1FEW A;  2W0G A;  3AXJ B;  3UQ4 A;  5LXT E;  2JMH A;  4AKR B;  2KND A;  3GMI A;  2QYW A;  3MZK B;  2LOS A;  2KWI B;  5JR9 C;  4A97 A;  4NXN T;  5LHI B;  2B76 A;  4MAL A;  4WBN E;  4J2C A;  4JEU B;  4H9S E;  4ZI7 E;  1BR1 A;  3ETV A;  4ERR A;  5JRC B;  4HWI B;  4BAY B;  5AQM B;  1WYB A;  2WZH A;  2MTQ A;  4Z91 A;  4GYS A;  3ZYM A;  2D0T A;  2XSA A;  2VQE T;  3ZCI A;  2LSI A;  1HNX T;  2DWG A;  3PUV F;  3VKG A;  3PE0 A;  3PUS A;  2DWK A;  4H9O C;  3HI2 A;  2ZM2 A;  4HFH A;  3HL6 A;  1E1H B;  3A5X A;  4U2Y A;  5JH7 E;  3PUR A;  3C98 B;  4KP3 C;  3RH3 A;  3OVU A;  3S4U A;  4DUZ T;  2CPT A;  2E9X D;  4NIQ A;  4LMJ A;  4PK4 A;  5AQR B;  3P4R A;  2CBJ A;  5HWY A;  2CE7 A;  5ABG A;  5JDH A;  4X20 E;  2XQ7 A;  4H63 H;  1J5E T;  3ZC1 A;  5C2T A;  3AE9 A;  4IE6 A;  2DLR A;  4UVB B;  4JUY A;  3EDV A;  3H37 A;  4UXN B;  1QUU A;  2JQK A;  4EV6 A;  5LBM A;  2BVL A;  3FZK B;  3K3O A;  4QWN B;  4A56 A;  2UUC T;  1T72 A;  2NP9 A;  2PJQ A;  3ABV A;  2C5J A;  3Q5X A;  4PJM A;  4G63 A;  3WAJ A;  1US7 B;  3AE6 A;  2CLY B;  1MMD A;  2HPL A;  3I0Q A;  3FZH B;  1SUM B;  2HN2 A;  1HTJ F;  4IDQ A;  2NW7 A;  3ZKR A;  4DVD A;  3RKG A;  4X66 T;  1LRZ A;  3E22 E;  3AEB A;  3IEE A;  3GWH A;  4G2A A;  3IF8 B;  4Z8X A;  4ZS2 A;  3ZN1 B;  3DTO A;  3O4X E;  3EAM A;  4DV2 T;  1XMO T;  5L3E B;  2X0H A;  3G06 A;  5L3G B;  3WAK A;  5L3D B;  3O1H A;  5L2L A;  1LKX A;  2W2U A;  4UV8 B;  2WDV A;  3PV0 F;  3TKL B;  3VHL A;  4IST A;  3CX8 B;  1VRB A;  3LK3 B;  3RQU A;  4CN6 A;  3QC9 A;  3L3P A;  5HXE A;  2IDO B;  4LFA T;  2M6I A;  4YJ3 E;  3ZN0 B;  2D9D A;  3ONJ A;  4M1P A;  2WZI A;  5IHY A;  4ADZ A;  2ACZ A;  2X9H A;  3AE3 A;  3AEG A;  2WM9 A;  4Z90 A;  3V5S A;  3MA9 A;  5KMG P;  3CIR A;  2XQ4 A;  3AVS A;  2Z6E A;  3F31 A;  4HE8 A;  4IDP A;  4CZZ B;  3SWH A;  4KHP T;  1WRD A;  2QGS A;  2X67 A;  3LG7 A;  3OYZ A;  2V8S V;  4LF8 T;  4MLK A;  2XQ3 A;  1VCT A;  1OXZ A;  4I4T E;  1OWA A;  5JVD E;  3UT5 E;  4F8H A;  2KWH A;  2VL8 A;  3WI3 A;  2ZM8 A;  2LSK A;  2W00 A;  3AED A;  1MMN A;  3ZMV B;  2Y48 B;  4IDZ A;  4QHO A;  4BJN A;  5LHH B;  1EZ3 A;  2LRL A;  5JTG A;  2IAK A;  1SA0 E;  2J62 A;  4KX6 A;  1Y64 B;  2FJE A;  5EK4 A;  5FP3 A;  4JEH B;  5LCY A;  3ZPO A;  3L8R A;  1MIY A;  2VL0 A;  2PBI A;  2PG8 A;  3HKC E;  4DR4 T;  4HFI A;  3HKD E;  4NPP A;  5HEO A;  2UXN B;  4TV9 E;  3BQK A;  3U3I A;  4A98 A;  4ZZC A;  5J2T E;  5IWA T;  3MAC A;  2QA7 A;  5AQN B;  3UFG A;  1N36 T;  4EB6 E;  1QSD A;  5ETW A;  1IBK T;  4ILU A;  1KNZ A;  2WQY A;  5HAX A;  2E9X C;  2I6H A;  1WR0 A;  3I9Y A;  4HFV A;  4H9Q C;  3FBL A;  2VKO A;  3JCF A;  3CX6 B;  4GK5 E;  4UF0 B;  4XBF B;  4IRE A;  2W66 A;  2C5I T;  2N1G A;  4PFP A;  4HFE A;  4X64 T;  4P0A A;  5ABF A;  1XNQ T;  3AB3 B;  4JYA T;  3FZM B;  1UX5 A;  2YN6 A;  2NW9 A;  2NTX A;  2KZ7 B;  4HN9 A;  5AQH B;  4DMV A;  5JDM A;  5LGN B;  2BG9 E;  5F5W A;  3PUA A;  3VRA A;  3KVA A;  1M62 A;  1SHZ C;  4EED A;  4DV7 T;  4DR1 T;  1HG5 A;  2Q9Q C;  3UUM A;  4AQG A;  4LFB T;  2WU2 A;  3LBX A;  4MHC A;  4HFB A;  3R84 B;  3P7I A;  5AQS B;  3K1S A;  1WR6 A;  2FBW A;  3R6N A;  1G73 A;  3T8O A;  5AQV B;  2ZM6 T;  5HXC A;  3PUZ F;  4UEM A;  2J4G A;  4WZX A;  1IBM T;  2D0U A;  3GN5 A;  2YU2 A;  2K48 A;  1S35 A;  2Q9Q D;  2V1D B;  2IW5 B;  1QLB A;  2BS3 A;  3AAI A;  1ZKE A;  3PUG A;  1KNP A;  2VK9 A;  3KIN B;  4H9N C;  2FUP A;  5AQP B;  4JI0 T;  3C4W A;  3NKZ A;  2ACX A;  4EYU A;  1IBL T;  1X79 A;  3NZQ A;  1LVK A;  2V7M A;  2WSS V;  1LVF A;  2CXL A;  2XAJ B;  4I50 E;  3N9Q A;  4QH1 A;  4BJM A;  2ZMA A;  2V7J A;  2E2A A;  3IA3 A;  3N2K E;  3HKB E;  4TV8 E;  5LNK A;  1KNR A;  2LSJ A;  5AQL B;  5LB7 B;  5LMN T;  4OX9 T;  4UF0 A;  5L4E A;  1JNR A;  3CML A;  4PNI A;  3ZT5 A;  2IUB A;  3RYF E;  1CHU A;  1HX1 B;  2V5C A;  1S94 A;  3OBV E;  5BMV E;  4DV4 T;  1I94 T;  3ZMZ B;  4LF6 T;  1VOM A;  2WU5 A;  2WBL A;  4ZS3 A;  4B3M T;  4DR2 T;  4JV5 T;  4EOZ B;  2BG9 C;  2KMF A;  2E5V A;  2ES0 A;  3N2O A;  3NRY A;  5KX5 E;  1MNE A;  4QX8 B;  2NTY A;  2XPK A;  3Q5W A;  5CB4 E;  2D2S A;  1KEY A;  3QB5 A;  2JMK A;  3Q2M A;  2XZE A;  4QX7 B;  2Y6X A;  4O2B E;  2WDR A;  3AE2 A;  5FVL A;  4QH4 A;  1BR4 A;  5FL0 A;  2FJB A;  2JQ9 A;  2XTL A;  1OED C;  4TX5 A;  3N9N A;  3RI5 A;  2DHR A;  2LT3 A;  1D0Z A;  5FXV A;  5CA1 E;  5H6R B;  2JQQ A;  2X68 A;  3O9X A;  2VAS A;  4WBO A;  1YXR A;  4AKI A;  1O3X A;  3ONL C;  4TWH A;  1XDO A;  3O1I A;  1ZP0 A;  5AQU B;  5F8P A;  5HCM A;  1OED E;  2CBI A;  1CUN A;  1D0X A;  2XQA A;  3I1A A;  3IHR A;  3KV6 A;  5AQG B;  1ZHC A;  1L0V A;  2NW8 A;  4JI3 T;  2E8I A;  4YHJ A;  2V6X A;  3ZYK A;  4C91 A;  4DV0 T;  5C3J A;  2ZM0 A;  3PU8 A;  4ASK A;  4U33 A;  1NEK A;  2HH7 A;  2JIW A;  3P4W A;  5FXX A;  3RRW A;  4EAH A;  2LHR A;  1WYC A;  3E08 A;  4UIG A;  4DBQ A;  5LG4 A;  1HR0 T;  2M6B A;  3P4P A;  4OK0 A;  4GKK T;  2MOZ A;  3D0T A;  4ILB A;  2W67 A;  1VCS A;  2WDQ A;  1HX8 A;  4U2Z A;  4UVA B;  5AQQ B;  5FYM A;  1KK7 A;  2VB6 A;  3KV9 A;  2C5K T;  3LSV A;  5JDG A;  4E7Z A;  1R8I A;  3KV5 A;  2PFV A;  2E9X A;  3RX6 A;  3ZMU B;  1ZOY A;  2YKS A;  3PUQ A;  4EIW A;  4YSX A;  3VR9 A;  3VKH A;  3EDU A;  4AIS A;  3FXE B;  1D1B A;  4ZI3 D;  3EI0 A;  2XQ8 A;  1W09 A;  3BQL A;  3JAE A;  2RP4 A;  1SE7 A;  5AQJ B;  5JDF A;  5L4H A;  5M4Y A;  3C4Z A;  2UU9 T;  3AEA A;  3P4Q A;  5DQV A;  4L0R A;  4ZXL A;  3RPU A;  4KUM B;  4ANJ A;  5CFB A;  1ZV4 X;  1YKH B;  3UQ7 A;  4LF9 T;  2WMN A;  1T7S A;  2KIN B;  3EHZ A;  4B6X A;  4GKJ T;  3NBX X;  5LG3 A;  3PTR B;  2UXX B;  2MYS A;  3N5L A;  1KF6 A;  4LML A;  4Q25 A;  5LOV E;  4EXT A;  3KBU A;  5LHG B;  2LLY A;  3PUY F;  4DV1 T;  2YDQ A;  3ZSS A;  2LRK A;  2YDS A;  4V1A v;  3LK4 2;  3M65 A;  1E7P A;  1MIW A;  3Q9D A;  4HWC A;  4IE7 A;  4YSY A;  2KLQ A;  2BDE A;  2LSG A;  3RIA A;  3AA6 B;  1H7C A;  2CCQ A;  5HCJ A;  4ZOL E;  4AKH A;  5DQW A;  3A8Y C;  2IIU A;  4PW8 A;  2LM2 A;  5FXZ A;  2JQH A;  3P50 A;  4I0U A;  3QNU A;  4IHJ E;  4IIJ E;  4NUV A;  3ONX A;  2N9D A;  3SRZ A;  3ZMT B;  4JI4 T;  2DL1 A;  3NWI A;  1J1J A;  3KFW X;  1N33 T;  3RKO A;  1YKE B;  1D1A A;  1NAF A;  2V5D A;  3L39 A;  3V5U A;  5HWX A;  4DUY T;  5CJ5 A;  1UX4 A;  2EHO A;  4DMW A;  5C8Y E;  4CXY A;  3CX7 B;  4UVC B;  3DJB A;  2XM2 A;  2YDR A;  3PDY A;  3QUJ A;  4H9R C;  1UUS A;  4JBW F;  4L5G A;  4X1I E;  3U78 A;  4YSZ A;  4DV3 T;  2I59 A;  2UUB T;  4DV5 T;  1HFA A;  5FNV E;  3RF1 A;  3CK6 A;  3KDS E;  2FJD A;  4JI7 T;  2XQ6 A;  4HGA A;  4KI0 F;  2X51 A;  4YLH A;  4IE5 A;  1MMG A;  2BZB A;  3EAB A;  2V26 A;  5HEG A;  5AQO B;  2A3D A;  3J9X 1;  4I55 E;  2JRK A;  1BR2 A;  2DCF A;  2UXB T;  3JAD A;  3Q5D A;  2H3R A;  3AEC A;  3SS1 A;  2V7K A;  2YK0 A;  4GYR A;  3RYH E;  2KXP B;  2A9U A;  2YU1 A;  4TUY E;  4YXD A;  3MJX A;  1NWM X;  2BKN A;  2EHO D;  4TZ4 C;  5JDQ A;  3AE7 A;  4IE4 A;  5LBQ B;  3FBZ A;  2UXC T;  1X9B A;  4AKG A;  2XHE B;  5IYZ E;  3CPZ A;  5L3B B;  4HKA A;  1YQ4 A;  2H88 A;  4JLE A;  3UU3 A;  4LF5 T;  1YD8 G;  3LBX B;  2R6G F;  3AXJ A;  3PUW F;  3AA7 B;  4CXW A;  5HXS A;  4YY3 T;  2BBJ A;  5LJN A;  4WNK A;  4A5X A;  4ZHQ E;  2XAF B;  4YT0 A;  3SFE A;  2X0L B;  3PU3 A;  4XAX B;  5JRC A;  4CXX A;  3TLV A;  3MK7 C;  2XQY A;  4U74 A;  3UUN A;  3OPC A;  4O8S A;  5JR9 B;  1W9R A;  1XDP A;  3C4X A;  2BVM A;  5L3C B;  2E5L T;  2CEA A;  1GQE A;  4HFC A;  3RYC E;  1XNR T;  2SPC A;  1ZEE A;  1B7T A;  4P0B A;  3FB2 A;  4QXC B;  2W61 A;  3UFE A;  4P1N A;  2UXD T;  1WLX A;  3AE5 A;  4EEB A;  2XQ9 A;  3UUB A;  2VVS A;  3OJA A;  5A1L A;  3M3Z B;  2X66 A;  2XY8 B;  4ZI2 C;  3GA8 A;  3KV4 A;  4GIW A;  4PK6 A;  4F6R C;  1W0B A;  2LKH A;  5JRE A;  2EHO B;  3K3N A;  3ZJ2 A;  3N9O A;  4PK5 A;  4UEL A;  5AQK B;  5AFU L;  3AA0 B;  3GN5 B;  3I0O A;  1Z0P A;  4U31 A;  2E9X B;  5DAB A;  4KBM B;  2AXD S;  3UU8 A;  3VR8 A;  5LP6 E;  2K9A A;  4EGW A;  3N9P A;  2BKP A;  5AQI B;  5ABH A;  2PTF A;  4MBQ A;  1Z8U A;  2W63 A;  5FVK A;  4XZC A;  4CQI A;  2IHR 1;  2VVN A;  4K0U A;  3O1J A;  2ODU A;  5ABE A;  2CLY C;  2J47 A;  1D0Y A;  2BG9 B;  2GK9 A;  3RC3 A;  3BQI A;  4WW0 A;  3ZT6 A;  2B1E A;  5CGM A;  4X1Y E;  2K3W A;  1FMW A; 
#chains in the Genus database with same CATH homology
 3N2G E;  5KDM C;  4DND A;  1FMV A;  3HR0 A;  4AKL A;  2K5B B;  5FY7 A;  2H7O A;  4IE0 A;  5HXH A;  5EK2 A;  4GOU A;  4QXH B;  4O2A E;  5LG4 A;  3SOL A;  4UV9 B;  3L09 A;  4O4I E;  5LHI B;  5LYJ E;  3DP7 A;  3ZJ1 A;  4PJJ A;  1MMA A;  2W62 A;  2XAS B;  5FY0 A;  2HPJ A;  2WMO A;  2Q9Q A;  3ETU A;  3CQX C;  5E0O A;  2CM0 A;  4OYJ A;  1IJ5 A;  4OHF A;  3K8P C;  2CA5 A;  3I9W A;  5F3J A;  1U5P A;  2WAU A;  5FXW A;  3ESL A;  5FMN A;  2XUE A;  2IC9 A;  4CI1 B;  3ANW B;  4PAG A;  3W15 B;  3LK2 B;  2X9Y A;  3RC8 A;  2LOP A;  2XAH B;  4OYK A;  4C90 A;  2CWY A;  1U4Q A;  1T98 A;  1D1C A;  2LHN A;  5LGT B;  2V7I A;  3E0Z A;  2X9X A;  5HXR A;  5JR9 A;  3RRC A;  5LJM A;  2LM9 A;  2X9W A;  2LE8 A;  2J1D G;  2WWU A;  2N2N A;  3CVR A;  3RYI E;  2A72 A;  4H9P C;  3KBT A;  5FY1 A;  3CWZ B;  3P8C D;  5J1G A;  4O4J E;  4E7S A;  4AXP A;  4PFO A;  5H6Q B;  4CI2 B;  2NOX A;  2Q9Q B;  4AI6 A;  3IBP A;  4KMC A;  1V9D A;  2CXF A;  3CQG B;  2H7V C;  2VKH A;  5LGU B;  2CMR A;  3LJC A;  2CWO A;  5LA6 E;  2G0U A;  2L9Q A;  2VWA A;  3ZYL A;  2IC6 A;  2Y8D A;  3LFM A;  2P9B A;  1HF8 A;  1HG2 A;  3MKD A;  2NWB A;  2M67 A;  3FXD B;  3MXZ A;  3UUX B;  2C0S A;  3JC6 C;  5DJQ C;  2VKJ A;  3C51 A;  2MBG A;  4O4L E;  3ZC0 A;  4CI3 B;  2D5U A;  2JJ9 A;  2LEH A;  4MFR A;  4EZH A;  3EUH A;  3ZLI A;  5L3F B;  2RA1 A;  2OA5 A;  2V7L A;  3HA4 A;  4I43 B;  4AQF C;  1HCI A;  4U72 A;  3UTK A;  5JDN A;  3FHN A;  5EZY E;  3ZCJ A;  1HS7 A;  2LJL A;  2L3L A;  4OFZ A;  3UUL A;  4YJ2 E;  4H63 V;  1AJ3 A;  2XAQ B;  2YIN A;  4ZI2 D;  5JDL A;  4NUU A;  4YFS A;  3AAA B;  5J2U E;  2L8K A;  1IJ6 A;  2ZLY A;  3KVB A;  3C50 A;  3NZP A;  3OKQ A;  4PJN A;  4TN7 B;  4BJM A;  5EK3 A;  3F57 A;  3B13 A;  4DBR A;  5CA0 E;  2DNX A;  4X1K E;  4FJO A;  4GK0 E;  4ISS A;  4N78 D;  1IZN B;  3CQC B;  3JC6 D;  4BA9 A;  2JPF A;  4ZI3 C;  5HYA A;  3AA1 B;  1IAP A;  2XAG B;  3NRX A;  3ZMS B;  4EYY R;  1YW0 A;  2ODV A;  4IGU A;  3AAE B;  3BK9 A;  4DO0 A;  3K3Q C;  3F2E A;  4HEA A;  3J7Y q;  2A2F X;  4PJL A;  2K24 A;  3OYX A;  2DI4 A;  2KT9 A;  1MIV A;  3ANW A;  4AQF A;  3VU7 H;  1UCU A;  3EVY A;  1FIO A;  1MND A;  2EHO C;  3CKD A;  4FI5 A;  2VKD A;  5ADX L;  4P09 A;  1BR0 A;  3AVR A;  3ZEF B;  3C64 A;  3N9L A;  4HTE A;  4L9I A;  1G8X A;  5GON E;  4EZ4 A;  4QKN A;  2YEV C;  4QXB B;  3HKE E;  3N9M A;  2CXD A;  3B57 A;  5TAO A;  2LSY A;  3QK6 A;  4O4H E;  3H3A A;  2W0G A;  1FEW A;  5LXT E;  2JMH A;  4AKR B;  2KND A;  3GMI A;  3MZK B;  2LOS A;  2KWI B;  5JR9 C;  4MAL A;  4WBN E;  4J2C A;  4JEU B;  4H9S E;  4ZI7 E;  1BR1 A;  3ETV A;  4ERR A;  5JRC B;  4BAY B;  1WYB A;  2MTQ A;  4GYS A;  3ZYM A;  2D0T A;  3VKG A;  3ZCI A;  2LSI A;  2DWG A;  3PE0 A;  3PUS A;  2DWK A;  4H9O C;  3HI2 A;  2ZM2 A;  3HL6 A;  1E1H B;  3A5X A;  5JH7 E;  3PUR A;  3C98 B;  4KP3 C;  3RH3 A;  3S4U A;  2E9X D;  4PK4 A;  5HWY A;  2CE7 A;  5JDH A;  4X20 E;  4H63 H;  3ZC1 A;  4IE6 A;  2DLR A;  4UVB B;  4JUY A;  3EDV A;  3H37 A;  4UXN B;  1QUU A;  5LBM A;  2BVL A;  3K3O A;  4A56 A;  4QWN B;  2NP9 A;  2PJQ A;  2C5J A;  3Q5X A;  4PJM A;  4G63 A;  3WAJ A;  1US7 B;  3LG7 A;  2CLY B;  1MMD A;  2HPL A;  3I0Q A;  1HTJ F;  2NW7 A;  4DVD A;  1LRZ A;  3E22 E;  4ZS2 A;  3IEE A;  3GWH A;  4G2A A;  3IF8 B;  4Z8X A;  3ZN1 B;  3DTO A;  3O4X E;  5L3E B;  5L3G B;  3WAK A;  5L3D B;  3O1H A;  5L2L A;  1LKX A;  4UV8 B;  3TKL B;  3VHL A;  4IST A;  3CX8 B;  1VRB A;  3LK3 B;  3QC9 A;  3L3P A;  5HXE A;  3ZN0 B;  4YJ3 E;  5JQG E;  5IHY A;  4M1P A;  4ADZ A;  4AKH A;  2X9H A;  5KMG P;  2WM9 A;  3V5S A;  3MA9 A;  4CZZ B;  3AVS A;  4HE8 A;  2Z6E A;  3F31 A;  3SWH A;  1WRD A;  2QGS A;  2X67 A;  3OYZ A;  4MLK A;  1OXZ A;  4I4T E;  1OWA A;  5JVD E;  3UT5 E;  2KWH A;  2VL8 A;  3WI3 A;  2ZM8 A;  2LSK A;  2W00 A;  3ZMV B;  1MMN A;  4BJN A;  2Y48 B;  4IDZ A;  4QHO A;  5LHH B;  1EZ3 A;  3O9X A;  2IAK A;  1SA0 E;  5LCY A;  1Y64 B;  5EK4 A;  5FP3 A;  4JEH B;  3ZPO A;  1MIY A;  2PBI A;  2PG8 A;  3HKC E;  3HKD E;  2UXN B;  4TV9 E;  3BQK A;  3U3I A;  5J2T E;  3MAC A;  2QA7 A;  4EB6 E;  1QSD A;  5ETW A;  4ILU A;  1KNZ A;  5HAX A;  2E9X C;  3I9Y A;  4HFV A;  4UF0 B;  4H9Q C;  3FBL A;  2VKO A;  4GK5 E;  3CX6 B;  4XBF B;  4PFP A;  2C5I T;  2N1G A;  4P0A A;  3AB3 B;  1UX5 A;  2NW9 A;  2NTX A;  2KZ7 B;  4HN9 A;  4DMV A;  5JDM A;  5LGN B;  3PUA A;  3KVA A;  1SHZ C;  1HG5 A;  2Q9Q C;  3UUM A;  4AQG A;  3LBX A;  4MHC A;  3R84 B;  3P7I A;  1WR6 A;  3R6N A;  1G73 A;  3T8O A;  5HXC A;  4UEM A;  2D0U A;  3GN5 A;  2YU2 A;  2K48 A;  1S35 A;  2Q9Q D;  2V1D B;  2IW5 B;  4H9N C;  3AAI A;  1ZKE A;  3PUG A;  2VK9 A;  3KIN B;  3C4W A;  2ACX A;  4EYU A;  1X79 A;  3NZQ A;  1LVK A;  2V7M A;  2WSS V;  1LVF A;  2CXL A;  2XAJ B;  4I50 E;  3N9Q A;  2ZMA A;  2V7J A;  3N2K E;  3HKB E;  4TV8 E;  5LNK A;  2LSJ A;  4UF0 A;  4PNI A;  3CML A;  3RYF E;  3OBV E;  1S94 A;  5BMV E;  3ZMZ B;  1VOM A;  4ZS3 A;  2WBL A;  4EOZ B;  2KMF A;  2ES0 A;  3N2O A;  3NRY A;  5KX5 E;  1MNE A;  4QX8 B;  2NTY A;  3Q5W A;  5CB4 E;  2D2S A;  2JMK A;  3Q2M A;  4QX7 B;  2Y6X A;  4O2B E;  1BR4 A;  2XTL A;  4TX5 A;  3N9N A;  2DHR A;  2LT3 A;  1D0Z A;  5FXV A;  5CA1 E;  5H6R B;  2JQQ A;  2X68 A;  2VAS A;  4WBO A;  4AKI A;  1O3X A;  5F8P A;  3O1I A;  1CUN A;  1D0X A;  3I1A A;  3IHR A;  3KV6 A;  1ZHC A;  2NW8 A;  2E8I A;  4YHJ A;  3ZYK A;  4C91 A;  2ZM0 A;  3PU8 A;  4ASK A;  2HH7 A;  5FXX A;  3RRW A;  4EAH A;  2LHR A;  1WYC A;  3E08 A;  4UIG A;  4DBQ A;  4OK0 A;  2MOZ A;  3D0T A;  5FYM A;  1HX8 A;  4UVA B;  5JDG A;  1KK7 A;  2VB6 A;  3KV9 A;  2C5K T;  4E7Z A;  3KV5 A;  2PFV A;  2E9X A;  3RX6 A;  3ZMU B;  4EIW A;  3VKH A;  3PUQ A;  3EDU A;  3FXE B;  1D1B A;  4ZI3 D;  3BQL A;  5M4Y A;  2RP4 A;  5JDF A;  3C4Z A;  5DQV A;  4L0R A;  4ANJ A;  3RPU A;  4KUM B;  1ZV4 X;  1YKH B;  2WMN A;  2KIN B;  4B6X A;  3NBX X;  3PTR B;  2UXX B;  2MYS A;  3N5L A;  4EXT A;  5LHG B;  5LOV E;  3KBU A;  4V1A v;  3LK4 2;  3M65 A;  1MIW A;  3Q9D A;  4IE7 A;  2KLQ A;  2BDE A;  2LSG A;  3AA6 B;  1H7C A;  2CCQ A;  4ZOL E;  5DQW A;  5FXZ A;  4PW8 A;  3SRZ A;  4IHJ E;  4NUV A;  4IIJ E;  3ZMT B;  3ONX A;  2N9D A;  3KFW X;  3RKO A;  1YKE B;  1D1A A;  1NAF A;  5HWX A;  3V5U A;  1UX4 A;  2EHO A;  4DMW A;  5C8Y E;  4CXY A;  3CX7 B;  4UVC B;  3DJB A;  3QUJ A;  3PDY A;  4L5G A;  4H9R C;  3U78 A;  4X1I E;  2I59 A;  1HFA A;  5FNV E;  3KDS E;  4HGA A;  4YLH A;  2X51 A;  4IE5 A;  1MMG A;  2BZB A;  2V26 A;  2A3D A;  3J9X 1;  4I55 E;  2JRK A;  1BR2 A;  2DCF A;  2H3R A;  3SS1 A;  2V7K A;  2YK0 A;  4GYR A;  3RYH E;  2KXP B;  2YU1 A;  4TUY E;  3MJX A;  1NWM X;  2EHO D;  4TZ4 C;  5JDQ A;  4IE4 A;  5LBQ B;  3FBZ A;  4AKG A;  2XHE B;  5IYZ E;  3CPZ A;  5L3B B;  4HKA A;  4JLE A;  1YD8 G;  3LBX B;  3AA7 B;  4CXW A;  5HXS A;  5LJN A;  4WNK A;  4ZHQ E;  2XAF B;  5JRC A;  2X0L B;  3PU3 A;  4XAX B;  4CXX A;  3UUN A;  3MK7 C;  2XQY A;  4U74 A;  4O8S A;  5JR9 B;  3C4X A;  2BVM A;  5L3C B;  2CEA A;  3RYC E;  2SPC A;  1ZEE A;  1B7T A;  4P0B A;  3FB2 A;  4QXC B;  2W61 A;  3UFE A;  1WLX A;  3OJA A;  5A1L A;  2X66 A;  4ZI2 C;  3GA8 A;  3KV4 A;  4GIW A;  4PK6 A;  4F6R C;  5JRE A;  2EHO B;  3K3N A;  3ZJ2 A;  3N9O A;  4PK5 A;  4UEL A;  5AFU L;  3GN5 B;  3I0O A;  1Z0P A;  2E9X B;  5DAB A;  4KBM B;  5LP6 E;  2K9A A;  3N9P A;  4MBQ A;  4CQI A;  2W63 A;  4XZC A;  4K0U A;  3O1J A;  2ODU A;  2CLY C;  1D0Y A;  2GK9 A;  3RC3 A;  3BQI A;  4WW0 A;  2B1E A;  4X1Y E;  3AA0 B;  1FMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...