4TN7B

Crystal structure of mouse kdm2a-h3k36me-no complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4tn7B00
4QX7B 4QXBB 4QX8B 4TN7B 4QXHB 4QXCB 4QWNB
chains in the Genus database with same CATH superfamily
4KP3C 4H9RC 2HH7A 3RC3A 2KZ7B 1D0YA 3OVUA 3WAJA 5AQTB 3NKZA 5FY1A 5JTGA 3HKDE 2CHOA 5AQGB 4F6RC 4DR6T 3AA1B 5JH7E 3J9X1 4TX5A 2R6GF 5AQUB 2Y8DA 3H3AA 1SA0E 2HPJA 3U78A 1T8BA 2LSGA 3WAKA 3LK2B 5LGTB 5LGNB 4EEDA 5BMVE 2DLRA 3ZN1B 2YOEA 4TWHA 2Q9QD 5DQVA 1Z8UA 1S35A 1WYCA 2WDVA 2XAJB 5HXRA 4ZZBA 1JNRA 4X20E 4XAXB 2A2FX 2M6BA 2FBWA 2UUBT 1CHUA 1IBKT 2CWYA 3RYCE 5L2LA 4QXCB 3LSVA 1FJGT 4AKRB 2LSIA 2WMNA 4AQGA 1FMWA 2H7OA 4O4HE 2PTFA 2BG9A 5LGUB 2WWVA 2I6HA 2IUBA 4GIWA 3MJXA 1YQ3A 1HNWT 5JDNA 2JRKA 4UEMA 1IBLT 2PFVA 2Q9QA 4YHJA 4DR4T 2YU2A 2DHRA 2LKHA 3IA3A 4K0KT 2XTLA 4QXHB 2VASA 2ACZA 2X9WA 2IAKA 3CQXC 4EGWA 2KWHA 2CBJA 3UUBA 3AECA 2E9XB 4AKGA 1BR0A 2E9XC 2V7KA 1ZEEA 5LXTE 4CI1B 4AKHA 3N9QA 4HKAA 4ILCA 2C5KT 5HAXA 3AVSA 2CBIA 3AE7A 2CCQA 3AEAA 4DIDB 4EV6A 3BK9A 1HG2A 2HHHT 4TZ4C 3A7MA 3AEBA 5HEGA 4ZI2C 2FJBA 1XMQT 2JQKA 2CA5A 4LF6T 3RPUA 2BBHA 4QX7B 3E22E 2OLTA 2J47A 3AEDA 5CGMA 4LFAT 3QB5A 3OYXA 3PJAJ 4AKLA 2CMRA 2XAQB 3L39A 4TNWA 3C64A 3ONJA 2WBLA 2W61A 2NWBA 3MACA 1J5WA 3Q5XA 4AKIA 3UUMA 2K48A 3HL6A 3O1IA 4PNIA 2NOXA 2XPKA 3ZCIA 3NWIA 4H9NC 3ZMVB 2M67A 1UGOA 3TLWA 2IC9A 2DWGA 4BA9A 1MMGA 1MMDA 3B13A 4IE0A 2LRLA 2ZM0A 5LCYA 3RX6A 3UU3A 2ZLYA 3SWHA 4ISSA 2K9AA 2WP9A 2V8SV 2YDRA 3HI2A 2GK9A 5FVLA 1W0BA 1QLBA 1UX4A 4ANJA 5AQLB 5HCMA 3AAAB 1H7CA 5FKYA 2Z6EA 3RC8A 4ERRA 1HCIA 1NEKA 2RPAA 4A56A 1W09A 2V7LA 5HXSA 3KINB 3TKLB 3EABA 5JVDE 3VR9A 2BKPA 2NR4A 2UU9T 5AQHB 2WDQA 3L3PA 3BQIA 3KV9A 4GKJT 3RIFA 3AAIA 1U5PA 5F8PA 4JI3T 2Q9QB 3ZYKA 1XDPA 2HN1A 1XNRT 4EZ4A 4CI3B 2KMFA 3PUQA 4UV9B 1D1CA 3F57A 2BZBA 2DL1A 4X5TA 4BJNA 2UXCT 3K3OA 2ZM6T 3EAMA 5AQQB 2K5BB 2X66A 4IGUA 2V7IA 3L8RA 4L0RA 4ISTA 3LJCA 2K24A 3F2EA 1SHZC 2L8KA 2BVLA 1X9BA 3ANWB 5J2TE 4JYAT 1KEYA 4O2AE 1BR2A 2IMLA 4KI0F 1Y01A 4IL9A 3JAEA 3LK3B 1YQ4A 1XNQT 3P50A 2PG8A 4B3TT 1OEDB 1OEDC 4EOZB 2XQ4A 2A9UA 4HFVA 3PUSA 1D0ZA 4KMCA 2VURA 3A5XA 3PTRB 2E9XD 5JDFA 4B3MT 3IF8B 2WY2A 1I94T 3Q9DA 4DVDA 3FZFB 3DP7A 2WQYA 1M7KA 2XQ5A 5EK4A 2ZM8A 3PUAA 3GN5B 5EK3A 3RI5A 3CQCB 5AQIB 2JQ9A 3RYFE 4NXMT 1G73A 4JEHB 1OEDE 4H9OC 1L0VA 2A3DA 4GKKT 4A98A 4IE7A 3CMLA 3ESLA 5EK2A 2EHOB 4G2AA 2WU5A 3KV4A 2EHOC 4ZI2D 3U3IA 4CZZB 1XMOT 3N2KE 2YKSA 3RHWA 1KNPA 2BS4A 4JI6T 5FNVE 4NUVA 2BS3A 4U31A 2RP4A 5FXZA 3AA7B 3UUXB 3SFDA 4Z91A 3CX6B 1VRBA 4OX9T 2JMHA 2LOSA 3M3ZB 1ZP0A 2E5VA 4H9SE 4ILBA 3N9NA 2CLYC 1SUMB 3N9OA 2E9XA 4DR3T 5CJ5A 5HXHA 2NW7A 3ZSSA 1EZ3A 4LFBT 2KT9A 2QGSA 1HNXT 3RKOA 2V1DB 4CXXA 1N32T 5JR9C 3C51A 2ACXA 4ZXLA 3ZLIA 3KBTA 4JBWF 2KXPB 1E7PA 2D9DA 2DWKA 4ILUA 3CPZA 3Q5DA 4AQYT 2NW8A 2P9BA 1S94A 4PJMA 5FXVA 4HWCA 3NZQA 1DU2A 2E2AA 4QH1A 3KVBA 3UQ7A 4I0UA 4E7SA 4AIUA 2WB5A 4P0BA 2YDQA 3MKDA 3PUXF 1R8IA 2DNXA 4DBRA 4AQFC 3RGLA 4U7YA 3AE9A 5HEUA 4DV4T 4JI2T 5FMNA 4DMWA 3OKQA 3TLTA 2VQFT 2WMOA 4EYUA 2J1DG 3RH3A 2LKGA 4IREA 2CWOA 2OA5A 3OJAA 5LB7B 4OYJA 4DR7T 3FBZA 2UUCT 2E5LT 5LA6E 3O4XE 1D1AA 1NWMX 5LOVE 2WU2A 1HX8A 4DV6T 4Z90A 2KSRA 4PK6A 3B5MA 2UUAT 1CUNA 3CK6A 4UVBB 3N9LA 4COFA 3SFEA 3PV0F 1N34T 2B1EA 4WYVA 2VWAA 3LFMA 4TWDA 4HEAA 4B3RT 5HCJA 2LSKA 2H89A 2XSBA 3PUWF 5IWAT 4QX8B 4BAYB 4JI4T 4H9PC 3ONLC 3ZSTA 2VB6A 4ADZA 3O1JA 3JAFA 2I59A 5ADXL 4P1NA 5HXCA 4HFIA 5A1LA 3GMIA 2XASB 2H7VC 4I43B 4HE8A 3C50A 1XDOA 4C91A 3LK42 3RKGA 5ABHA 1W9RA 1SE7A 2XQAA 5HEOA 3ZT7A 2XHEB 2AE9A 4H63H 3J7Yq 2LT3A 4UXNB 4QHOA 5DJQC 2H3RA 3OBVE 3P8CD 2IW5B 2V26A 5LNKA 5CFBA 3KV5A 3G06A 3ZCJA 5LHGB 4Z8XA 2UXNB 3T1HT 2I0MA 1E2AA 4TNVA 3ZMZB 1WCRA 3PUGA 2BBJA 5L3DB 3ANWA 3EHZA 5AQSB 2IIUA 3QB5K 4Q25A 1UCUA 4DR5T 4GYRA 5AFUL 2EHOD 3MK7C 1Y64B 2AXDS 4U2YA 1BR4A 5DQWA 3RLFF 4GOUA 1OEDA 3LBXA 2WZHA 3JCFA 3RIUC 3HKEE 2H88A 4TV9E 3EDUA 4U7IA 1ZOYA 5JDGA 2X67A 2X0YA 3I0OA 5J1GA 3PU8A 1U4QA 2M6IA 4XBFB 3GN5A 3AE3A 4MLKA 3PJAA 4YSYA 3AE2A 5DABA 4ZS3A 1NAFA 2EHOA 3VR8A 2CPTA 3KBUA 4CN6A 4UVCB 1UX5A 2CE7A 2CHNA 3CQGB 4CI2B 3HR0A 3ONXA 4KHZF 4P09A 4TWFA 3IBPA 4LMKA 1HG5A 1E1HB 3CWZB 4ZI7E 3P4QA 4AI6A 5HEJA 3AE1A 3T8OA 4DO0A 3N9MA 4EYYR 4YXDA 2CXLA 3CVRA 1LRZA 5LP6E 5L3EB 3HKCE 3S4UA 2HN2A 4FI5A 2J62A 2W0GA 3RQUA 4L9IA 4OK0A 4WNKA 2NTXA 2V5DA 4PK5A 1LVFA 3P4PA 2JJ9A 5JR9A 2W66A 4YTPA 1VCTA 3CIRA 5JREA 5H6QB 2QVAA 3K3QC 4JI5T 1WRDA 2W00A 5AQKB 2BG9C 2MOZA 2IHR1 4DMVA 1XWMA 5J2UE 5ABFA 2XAFB 2PJQA 4KUMB 5FXXA 2D2SA 3FHNA 2ZM2A 1QUUA 4OFZA 4PW8A 5KDMC 4NIQA 3RIAA 3LG7A 1ZHCA 2V6XA 4X66T 3ABVA 2QYWA 4X64T 2OV9A 5L3FB 5ABEA 4ZS2A 2X0HA 5GONE 3UU4A 4AQFA 4I55E 4X65T 2SPCA 4U74A 5FYMA 2WM9A 3ZEFB 1QSDA 1LVKA 4FJOA 3FBLA 1O3XA 5HWXA 3SS1A 3NRYA 4IE6A 4GK0E 3ZYLA 1J5ET 3EDVA 1MMNA 1MNEA 4GK5E 2XQ9A 4WBNE 3NZPA 3RYHE 2W2UA 4YTNA 4CQIA 3LBXB 4EIWA 4DNDA 2N1GA 5LYJE 4EB6E 2VVSA 4ILAA 4DV0T 1MMAA 3RQWA 3UFEA 4HGAA 4B6XA 4CN1A 4UV8B 2IDOB 3Q5WA 4X62T 2KINB 1HF8A 2KNDA 1N33T 1HNZT 4OYKA 2BVMA 2LEHA 3KVAA 4HFEA 1MIYA 2CM0A 2VVNA 2DI4A 1N36T 3GWHA 4OHFA 3ZN0B 4O8SA 3FXDB 4MFRA 2ZMAA 3Q2MA 3P4RA 4YSZA 3PU3A 3QK6A 1WYBA 2JPFA 2MAWA 5HEHA 4H63V 1IAPA 1OWAA 2ODUA 3N2OA 3ZKRA 4NUUA 5KMGP 4A97A 3VHLA 4HN9A 2YDSA 3QOFA 3AVRA 3AE6A 1W0AA 2J4GA 4QWNB 1KNRA 4HWIB 2CLYB 3OTOT 1WR6A 2B76A 5AQMB 2WZIA 3ZJ2A 2UXDT 4E7ZA 4HFDA 3W15B 4NXNT 5E0OA 3X1DA 1IZNB 4PJJA 5JDLA 1UURA 5JR9B 3DTOA 2PBIA 3I9WA 2LM9A 4UELA 5LJMA 2X68A 3UFGA 2V7JA 1T72A 5BR8T 1YXRA 3JC6C 3ZT6A 5CB4E 2LJLA 3PUVF 4CXWA 1IJ6A 4HFCA 2NTYA 1YD8G 2D5UA 4YSXA 3C98B 3IEEA 5ABFB 3RIUA 1MIVA 1HFAA 3C4WA 3ZMSB 5AQOB 2W62A 3CX8B 2VK9A 3RRCA 2DCFA 2L3LA 3T1YT 1LKXA 3AAEB 2ES0A 4UF0A 2WSSV 2BKOA 3UQ4A 3P4SA 1UUSA 1WLXA 1YW0A 3AB3B 1T7SA 3BQKA 5L3CB 1UK5A 3AA0B 3EVYA 3ZC0A 3TLSA 2Y6XA 1ZKEA 5FVKA 2FUPA 3ZT5A 3N5LA 3HA4A 4JUYA 5LBMA 4DV2T 1HTJF 4DR2T 4WW0A 3SRZA 3PDYA 5H6RB 3AXJB 4PJNA 4O4IE 1V9DA 2CEAA 5FXWA 3NVOA 4IL4A 2LHRA 5L3BB 3D0TA 4LFCT 1WFDA 5JQGE 5LMNT 3K1SA 2W67A 3ZMTB 4O4LE 4ZZCA 4X1IE 3MZKB 1I6ZA 3L09A 4IE4A 3AEFA 2VL8A 2V5CA 5LHIB 4IE5A 3I9YA 4DUYT 4KX6A 3PURA 3ZJ1A 5HXEA 4HWFA 2N2NA 3E0ZA 4H9QC 5F3JA 4IDNA 5FY7A 2LLYA 4LF7T 4QH4A 4O4JE 4MALA 2VKOA 2V6YA 4K0UA 4YHHT 3P7IA 3UU6A 1IJ5A 3M65A 4GYSA 2X9XA 4PFOA 3WI3A 4YLHA 3AE8A 4A5XA 3TLUA 3VU7H 1KFYA 4ZOLE 4DR1T 1MIWA 3NBXX 4QXBB 3P4WA 2FJAA 2YU1A 3ZC1A 5KXJA 1US7B 4LMJA 2WCAA 5FP3A 4JI1T 1KF6A 1D0XA 2Y48B 3PUYF 2JQHA 4JLEA 5IHYA 2MYSA 3Q5EA 4WZXA 3UT5E 5C2TA 1KK7A 5L4EA 3UTKA 5TAOA 1B7TA 4UIGA 4YTMA 3FZMB 3EUHA 3UU5A 5FL0A 3E08A 2XQ7A 4M1PA 5LG3A 4NPPA 3AEEA 2F4VT 5ETWA 4IHJE 4CXYA 2VQET 2CXDA 2RA1A 2KLQA 2W4XA 5CA0E 4I50E 4MHCA 4U2ZA 3H37A 2IC6A 4DV1T 4X1KE 1FIOA 2VKDA 2JQQA 2D0TA 4I4TE 4UF0B 2A72A 1HX1B 4LF9T 1G8XA 4LF8T 4YFSA 2CXFA 4ASKA 3DJBA 5J0ZA 3IHRA 3OPCA 2VL0A 3VRBA 5LHHB 4U33A 3V5UA 4PFPA 3KV6A 2LSJA 4PJLA 2XQ8A 2VKHA 2LHNA 2UXXB 2X9YA 5L47A 4LF4T 4LMLA 3N9PA 4PK4A 3JC6D 3BQLA 2WWUA 3R6NA 2XQ3A 1GQEA 4EZHA 4X1YE 4IT4A 4ZI3C 4YY3T 4QKNA 1BR1A 4EEBA 1X79A 4LF5T 3FZLB 4IDOA 5JDMA 4BJMA 2LE8A 5C8YE 3TLVA 4P0AA 4CN4A 2CRBA 5AQJB 5AQFB 2UXBT 4AXPA 1YKHB 1XZYA 2FJEA 1VCSA 3H3MA 3FB2A 2XJ7A 4QH5A 2XQYA 1JNZA 1MNDA 1AJ3A 2MPKA 4JI8T 4IIJE 1T98A 4PAGA 2G0UA 2V6YB 2BG9B 3AE4A 3UULA 2LRKA 3QC9A 5JRCA 5F5WA 2FJDA 2JIWA 2LM2A 3SOLA 2XSAA 3I1AA 3HKBE 4IDPA 3RRWA 1D1BA 3KDSE 5KX5E 3QNUA 2Q9QC 4UR9A 4G63A 3RF1A 2K3WA 2XAGB 3ZYMA 3K8PC 5FY0A 3LDQB 2X9HA 2NW9A 2YK0A 3I0QA 4TV8E 2BG9E 1WR0A 2W63A 4DV5T 5JDHA 5IYZE 4DV3T 3ZMUB 2XZEA 4YT0A 3A8YC 4C90A 2HPLA 3PE0A 2C5JA 4DV7T 4IDQA 4YJ2E 4TN7B 4JEUB 2XM2A 3O1HA 4N78D 3ETUA 4U3CA 4JV5T 5CA1E 2XY8B 2QRXA 3FZHB 3MXZA 3AXJA 1YKEB 5C3JA 3VRAA 3EI0A 2XM1A 3UU8A 2WAUA 4O2BE 4ZHQE 1M62A 2LSYA 5LG4A 2V7MA 2YEVC 4JI7T 5LJNA 2ODVA 2BDEA 1FMVA 1HS7A 3V5SA 3PUZF 4JI0T 4J2CA 5M4YA 3AE5A 4F8HA 3OYZA 3FZKB 2L9QA 1OXZA 2XAHB 3NRXA 2XUEA 4EXTA 5JDQA 1ZV4X 4XZCA 2YINA 5AQNB 2BKNA 2XQ6A 2VKJA 3RYIE 2D0UA 3O9XA 2LOPA 3FXEB 2C5IT 2BS2A 3MA9A 3K3NA 3C4XA 1J1JA 5AQVB 3UUNA 3VKHA 4EAHA 4V1Av 1FEWA 3VKGA 3CX7B 4WBOA 4HFHA 4TUYE 2E8IA 2C0SA 5AQRB 3GA8A 2NP9A 3JADA 4YJ3E 4HFBA 3ZPOA 5IUXA 3B57A 4MBQA 4AISA 1KNZA 5L4HA 1HR0T 4ZEYA 1VOMA 2QA7A 1NENA 5HWYA 3AA6B 3AEGA 2MBGA 5HYAA 3ETVA 4ZI3D 3N2GE 5JRCB 5LMUT 4DUZT 5FL1A 4KHPT 2JMKA 4HWDA 4IDZA 5L3GB 4B3ST 2MTQA 3C4ZA 2N9DA 4U72A 4UVAB 3F31A 3KFWX 4HTEA 2WS3A 4KBMB 5AQPB 1Z0PA 2KWIB 5ABGA 4DBQA 3QUJA 1IBMT 2X0LB 2WDRA 5LBQB 4HWHA 2YN6A 3CKDA 3R84B 2X51A 5EZYE 4L5GA
chains in the Genus database with same CATH topology
4KP3C 4WNKA 4H9RC 3DP7A 2HH7A 5EK4A 3RC3A 2KZ7B 2NTXA 2ZM8A 3GN5B 1D0YA 3PUAA 5EK3A 4PK5A 3CQCB 1LVFA 3WAJA 5FY1A 2JJ9A 5JR9A 3RYFE 1D0XA 2Y48B 3HKDE 1G73A 4JEHB 4H9OC 4JLEA 4F6RC 2A3DA 5IHYA 2MYSA 4IE7A 3UT5E 3AA1B 1KK7A 5JREA 3CMLA 5JH7E 3J9X1 3UTKA 3ESLA 4TX5A 5EK2A 5TAOA 1B7TA 4L9IA 2EHOB 4G2AA 4UIGA 3KV4A 5H6QB 2EHOC 3K3QC 2Y8DA 3EUHA 3H3AA 1SA0E 2HPJA 3U3IA 4ZI2D 3E08A 4CZZB 1WRDA 2W00A 4M1PA 3N2KE 3U78A 5ETWA 5FNVE 4IHJE 4CXYA 2LSGA 3WAKA 2CXDA 2RA1A 3LK2B 2MOZA 5LGTB 2KLQA 5LGNB 4DMVA 5J2UE 5BMVE 4NUVA 2XAFB 2PJQA 4KUMB 5FXXA 2D2SA 2DLRA 5CA0E 2RP4A 4I50E 5FXZA 3FHNA 3ZN1B 2ZM2A 3AA7B 3UUXB 1QUUA 2Q9QD 4MHCA 5DQVA 4OFZA 4PW8A 5KDMC 3H37A 2IC6A 3CX6B 1VRBA 4X1KE 2JMHA 1FIOA 2LOSA 2VKDA 3LG7A 1S35A 1ZHCA 2JQQA 1WYCA 4H9SE 2D0TA 3N9NA 2XAJB 2CLYC 4I4TE 5HXRA 4UF0B 3N9OA 2A72A 2E9XA 4X20E 4XAXB 2A2FX 1G8XA 5L3FB 4ZS2A 5GONE 4YFSA 2CXFA 4AQFA 4I55E 3DJBA 4ASKA 5HXHA 2NW7A 2SPCA 3IHRA 4U74A 5FYMA 2CWYA 2WM9A 1EZ3A 3ZEFB 1QSDA 5LHHB 1LVKA 4FJOA 2KT9A 1O3XA 2QGSA 3FBLA 4PFPA 3V5UA 3KV6A 2LSJA 5HWXA 3RKOA 3RYCE 3SS1A 5L2LA 3NRYA 4PJLA 2VKHA 4QXCB 2LHNA 2V1DB 4IE6A 2UXXB 2X9YA 4GK0E 4CXXA 5JR9C 3C51A 3ZYLA 2ACXA 3N9PA 4AKRB 3EDVA 1MMNA 3ZLIA 4PK4A 2LSIA 2WMNA 3JC6D 4AQGA 3BQLA 2WWUA 1MNEA 3R6NA 1FMWA 3KBTA 2H7OA 4GK5E 4EZHA 2KXPB 4O4HE 2DWKA 4WBNE 3NZPA 4X1YE 3RYHE 5LGUB 4ZI3C 4ILUA 3CPZA 4GIWA 4CQIA 4QKNA 3LBXB 1BR1A 3MJXA 5JDNA 2JRKA 4EIWA 4UEMA 4DNDA 1X79A 2NW8A 2N1GA 2P9BA 5LYJE 2PFVA 1S94A 4EB6E 4PJMA 5FXVA 3NZQA 2Q9QA 4YHJA 1MMAA 2YU2A 2DHRA 5JDMA 3UFEA 3KVBA 2XTLA 4QXHB 2VASA 4BJMA 2LE8A 2X9WA 4HGAA 2IAKA 4B6XA 4E7SA 3CQXC 2KWHA 4UV8B 3Q5WA 5C8YE 2KINB 4P0AA 4P0BA 1HF8A 2KNDA 2E9XB 4AKGA 1BR0A 2E9XC 2V7KA 1ZEEA 3MKDA 5LXTE 4AXPA 4OYKA 2BVMA 4CI1B 2LEHA 3KVAA 4AKHA 2DNXA 1YKHB 3N9QA 4DBRA 4HKAA 4AQFC 1MIYA 2C5KT 3FB2A 2CM0A 5HAXA 3AVSA 2DI4A 3GWHA 2XQYA 4OHFA 5FMNA 4DMWA 3OKQA 2CCQA 1MNDA 1AJ3A 3ZN0B 4O8SA 2WMOA 4EYUA 3FXDB 2J1DG 4IIJE 1T98A 4MFRA 3RH3A 4PAGA 2ZMAA 2CWOA 3BK9A 1HG2A 3Q2MA 3PU3A 2OA5A 3QK6A 4TZ4C 2G0UA 3OJAA 1WYBA 2JPFA 4OYJA 4H63V 1IAPA 1OWAA 2ODUA 3N2OA 4ZI2C 3FBZA 4NUUA 5KMGP 2CA5A 3RPUA 3UULA 3VHLA 4HN9A 3QC9A 5JRCA 4QX7B 5LA6E 3AVRA 3O4XE 3SOLA 1D1AA 3I1AA 1NWMX 4QWNB 3HKBE 3RRWA 1D1BA 3KDSE 3E22E 5LOVE 1HX8A 5KX5E 2CLYB 2Q9QC 4G63A 4PK6A 1WR6A 3ZJ2A 3OYXA 4AKLA 4E7ZA 1CUNA 2XAGB 2CMRA 3ZYMA 4UVBB 3N9LA 3W15B 5E0OA 2XAQB 3K8PC 1IZNB 5EZYE 2B1EA 2VWAA 3LFMA 5FY0A 2X9HA 3C64A 4PJJA 2NW9A 2YK0A 5JDLA 4HEAA 3I0QA 2WBLA 4TV8E 2W61A 2LSKA 2W63A 2NWBA 3DTOA 2PBIA 5JR9B 3MACA 5JDHA 5IYZE 3Q5XA 4AKIA 3UUMA 3I9WA 3ZMUB 2K48A 2LM9A 4QX8B 4UELA 4BAYB 2X68A 5LJMA 3HL6A 2V7JA 3O1IA 4PNIA 4H9PC 4C90A 2NOXA 2HPLA 3ZCIA 3PE0A 4H9NC 2VB6A 4ADZA 3ZMVB 2C5JA 2M67A 3JC6C 3O1JA 2I59A 2IC9A 5CB4E 2DWGA 4BA9A 2LJLA 5ADXL 4YJ2E 1MMGA 1MMDA 3B13A 4IE0A 5HXCA 4CXWA 1IJ6A 2NTYA 5A1LA 1YD8G 2D5UA 3GMIA 4TN7B 4JEUB 3O1HA 3C98B 3IEEA 4N78D 2XASB 2ZM0A 2H7VC 5LCYA 3ETUA 3RX6A 4I43B 1MIVA 1HFAA 4HE8A 3C4WA 3ZMSB 2ZLYA 3C50A 2W62A 3SWHA 5CA1E 4C91A 4ISSA 3CX8B 2VK9A 3LK42 3MXZA 1YKEB 2K9AA 3RRCA 2DCFA 2XHEB 4H63H 3J7Yq 2L3LA 2LT3A 2WAUA 1LKXA 4O2BE 4UXNB 4ZHQE 4QHOA 5DJQC 2LSYA 2H3RA 3AAEB 2ES0A 3OBVE 3P8CD 2IW5B 3HI2A 4UF0A 2V26A 2WSSV 5LG4A 5LNKA 2GK9A 2V7MA 2YEVC 1WLXA 1YW0A 5LJNA 2ODVA 1UX4A 3AB3B 3KV5A 3BQKA 2BDEA 3ZCJA 4ANJA 5L3CB 1FMVA 1HS7A 3V5SA 5LHGB 4Z8XA 2UXNB 3AA0B 3EVYA 3ZMZB 3PUGA 4J2CA 3AAAB 1H7CA 5L3DB 3ANWA 3ZC0A 2Z6EA 5M4YA 2Y6XA 3RC8A 4ERRA 1ZKEA 1UCUA 1HCIA 3OYZA 4GYRA 4A56A 5AFUL 2V7LA 2EHOD 3MK7C 2L9QA 1Y64B 5HXSA 1OXZA 3KINB 3TKLB 2XAHB 3NRXA 5JVDE 2XUEA 4EXTA 5JDQA 1BR4A 1ZV4X 4XZCA 2YINA 3N5LA 5DQWA 3HA4A 3L3PA 4GOUA 4JUYA 3BQIA 3KV9A 2VKJA 5LBMA 3RYIE 3AAIA 2D0UA 1U5PA 1HTJF 5F8PA 3O9XA 2LOPA 2Q9QB 3LBXA 3FXEB 2C5IT 3MA9A 4WW0A 3ZYKA 3HKEE 3SRZA 3K3NA 3PDYA 4TV9E 4EZ4A 3C4XA 3VKHA 3UUNA 5H6RB 4CI3B 2KMFA 4PJNA 3EDUA 3PUQA 4O4IE 1V9DA 2CEAA 4UV9B 1D1CA 5FXWA 5JDGA 3F57A 2BZBA 4EAHA 4V1Av 2LHRA 5L3BB 1FEWA 3D0TA 4BJNA 3VKGA 3CX7B 2X67A 3K3OA 4WBOA 4TUYE 5JQGE 2E8IA 3I0OA 2C0SA 3ZMTB 4O4LE 3PU8A 5J1GA 3GA8A 2NP9A 3MZKB 1U4QA 2K5BB 4X1IE 2X66A 4YJ3E 3L09A 4IGUA 2V7IA 4L0RA 4XBFB 4ISTA 3LJCA 3ZPOA 3GN5A 4IE4A 2VL8A 2K24A 4MLKA 5LHIB 3F2EA 4IE5A 3I9YA 3B57A 4MBQA 1SHZC 2L8KA 3PURA 2BVLA 1KNZA 3ZJ1A 5HXEA 2N2NA 1VOMA 3ANWB 3E0ZA 4H9QC 5F3JA 5J2TE 2QA7A 5HWYA 5FY7A 3AA6B 5DABA 4ZS3A 1NAFA 2EHOA 4O2AE 1BR2A 2MBGA 5HYAA 3ETVA 3KBUA 4O4JE 4UVCB 1UX5A 2CE7A 4MALA 4ZI3D 3N2GE 2VKOA 3LK3B 5JRCB 3CQGB 4K0UA 4CI2B 3HR0A 3ONXA 3P7IA 4P09A 1IJ5A 2PG8A 3IBPA 3M65A 4GYSA 2X9XA 2JMKA 4PFOA 3WI3A 4YLHA 1HG5A 1E1HB 3VU7H 3CWZB 4ZI7E 4EOZB 4IDZA 5L3GB 4ZOLE 4AI6A 4HFVA 3PUSA 1D0ZA 1MIWA 3NBXX 2MTQA 4KMCA 4QXBB 3T8OA 2YU1A 3C4ZA 4DO0A 3A5XA 3N9MA 3ZC1A 4EYYR 3PTRB 2N9DA 4U72A 2CXLA 4UVAB 3F31A 3CVRA 3KFWX 4HTEA 1LRZA 2E9XD 4KBMB 5JDFA 1Z0PA 2KWIB 3HKCE 4DBQA 3QUJA 1US7B 5L3EB 5LP6E 2X0LB 5LBQB 3IF8B 3S4UA 5FP3A 3CKDA 4FI5A 3R84B 2X51A 3Q9DA 2W0GA 4OK0A 4L5GA 4DVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QX7 B;  4QXB B;  4QX8 B;  4TN7 B;  4QXH B;  4QXC B;  4QWN B; 
#chains in the Genus database with same CATH topology
 4KP3 C;  4H9R C;  2HH7 A;  3RC3 A;  2KZ7 B;  1D0Y A;  3OVU A;  3WAJ A;  5AQT B;  3NKZ A;  5FY1 A;  5JTG A;  3HKD E;  2CHO A;  5AQG B;  4F6R C;  4DR6 T;  3AA1 B;  5JH7 E;  3J9X 1;  4TX5 A;  2R6G F;  5AQU B;  2Y8D A;  3H3A A;  1SA0 E;  2HPJ A;  3U78 A;  1T8B A;  2LSG A;  3WAK A;  3LK2 B;  5LGT B;  5LGN B;  4EED A;  5BMV E;  2DLR A;  3ZN1 B;  2YOE A;  4TWH A;  2Q9Q D;  5DQV A;  1Z8U A;  1S35 A;  1WYC A;  2WDV A;  2XAJ B;  5HXR A;  4ZZB A;  1JNR A;  4X20 E;  4XAX B;  2A2F X;  2M6B A;  2FBW A;  2UUB T;  1CHU A;  1IBK T;  2CWY A;  3RYC E;  5L2L A;  4QXC B;  3LSV A;  1FJG T;  4AKR B;  2LSI A;  2WMN A;  4AQG A;  1FMW A;  2H7O A;  4O4H E;  2PTF A;  2BG9 A;  5LGU B;  2WWV A;  2I6H A;  2IUB A;  4GIW A;  3MJX A;  1YQ3 A;  1HNW T;  5JDN A;  2JRK A;  4UEM A;  1IBL T;  2PFV A;  2Q9Q A;  4YHJ A;  4DR4 T;  2YU2 A;  2DHR A;  2LKH A;  3IA3 A;  4K0K T;  2XTL A;  4QXH B;  2VAS A;  2ACZ A;  2X9W A;  2IAK A;  3CQX C;  4EGW A;  2KWH A;  2CBJ A;  3UUB A;  3AEC A;  2E9X B;  4AKG A;  1BR0 A;  2E9X C;  2V7K A;  1ZEE A;  5LXT E;  4CI1 B;  4AKH A;  3N9Q A;  4HKA A;  4ILC A;  2C5K T;  5HAX A;  3AVS A;  2CBI A;  3AE7 A;  2CCQ A;  3AEA A;  4DID B;  4EV6 A;  3BK9 A;  1HG2 A;  2HHH T;  4TZ4 C;  3A7M A;  3AEB A;  5HEG A;  4ZI2 C;  2FJB A;  1XMQ T;  2JQK A;  2CA5 A;  4LF6 T;  3RPU A;  2BBH A;  4QX7 B;  3E22 E;  2OLT A;  2J47 A;  3AED A;  5CGM A;  4LFA T;  3QB5 A;  3OYX A;  3PJA J;  4AKL A;  2CMR A;  2XAQ B;  3L39 A;  4TNW A;  3C64 A;  3ONJ A;  2WBL A;  2W61 A;  2NWB A;  3MAC A;  1J5W A;  3Q5X A;  4AKI A;  3UUM A;  2K48 A;  3HL6 A;  3O1I A;  4PNI A;  2NOX A;  2XPK A;  3ZCI A;  3NWI A;  4H9N C;  3ZMV B;  2M67 A;  1UGO A;  3TLW A;  2IC9 A;  2DWG A;  4BA9 A;  1MMG A;  1MMD A;  3B13 A;  4IE0 A;  2LRL A;  2ZM0 A;  5LCY A;  3RX6 A;  3UU3 A;  2ZLY A;  3SWH A;  4ISS A;  2K9A A;  2WP9 A;  2V8S V;  2YDR A;  3HI2 A;  2GK9 A;  5FVL A;  1W0B A;  1QLB A;  1UX4 A;  4ANJ A;  5AQL B;  5HCM A;  3AAA B;  1H7C A;  5FKY A;  2Z6E A;  3RC8 A;  4ERR A;  1HCI A;  1NEK A;  2RPA A;  4A56 A;  1W09 A;  2V7L A;  5HXS A;  3KIN B;  3TKL B;  3EAB A;  5JVD E;  3VR9 A;  2BKP A;  2NR4 A;  2UU9 T;  5AQH B;  2WDQ A;  3L3P A;  3BQI A;  3KV9 A;  4GKJ T;  3RIF A;  3AAI A;  1U5P A;  5F8P A;  4JI3 T;  2Q9Q B;  3ZYK A;  1XDP A;  2HN1 A;  1XNR T;  4EZ4 A;  4CI3 B;  2KMF A;  3PUQ A;  4UV9 B;  1D1C A;  3F57 A;  2BZB A;  2DL1 A;  4X5T A;  4BJN A;  2UXC T;  3K3O A;  2ZM6 T;  3EAM A;  5AQQ B;  2K5B B;  2X66 A;  4IGU A;  2V7I A;  3L8R A;  4L0R A;  4IST A;  3LJC A;  2K24 A;  3F2E A;  1SHZ C;  2L8K A;  2BVL A;  1X9B A;  3ANW B;  5J2T E;  4JYA T;  1KEY A;  4O2A E;  1BR2 A;  2IML A;  4KI0 F;  1Y01 A;  4IL9 A;  3JAE A;  3LK3 B;  1YQ4 A;  1XNQ T;  3P50 A;  2PG8 A;  4B3T T;  1OED B;  1OED C;  4EOZ B;  2XQ4 A;  2A9U A;  4HFV A;  3PUS A;  1D0Z A;  4KMC A;  2VUR A;  3A5X A;  3PTR B;  2E9X D;  5JDF A;  4B3M T;  3IF8 B;  2WY2 A;  1I94 T;  3Q9D A;  4DVD A;  3FZF B;  3DP7 A;  2WQY A;  1M7K A;  2XQ5 A;  5EK4 A;  2ZM8 A;  3PUA A;  3GN5 B;  5EK3 A;  3RI5 A;  3CQC B;  5AQI B;  2JQ9 A;  3RYF E;  4NXM T;  1G73 A;  4JEH B;  1OED E;  4H9O C;  1L0V A;  2A3D A;  4GKK T;  4A98 A;  4IE7 A;  3CML A;  3ESL A;  5EK2 A;  2EHO B;  4G2A A;  2WU5 A;  3KV4 A;  2EHO C;  4ZI2 D;  3U3I A;  4CZZ B;  1XMO T;  3N2K E;  2YKS A;  3RHW A;  1KNP A;  2BS4 A;  4JI6 T;  5FNV E;  4NUV A;  2BS3 A;  4U31 A;  2RP4 A;  5FXZ A;  3AA7 B;  3UUX B;  3SFD A;  4Z91 A;  3CX6 B;  1VRB A;  4OX9 T;  2JMH A;  2LOS A;  3M3Z B;  1ZP0 A;  2E5V A;  4H9S E;  4ILB A;  3N9N A;  2CLY C;  1SUM B;  3N9O A;  2E9X A;  4DR3 T;  5CJ5 A;  5HXH A;  2NW7 A;  3ZSS A;  1EZ3 A;  4LFB T;  2KT9 A;  2QGS A;  1HNX T;  3RKO A;  2V1D B;  4CXX A;  1N32 T;  5JR9 C;  3C51 A;  2ACX A;  4ZXL A;  3ZLI A;  3KBT A;  4JBW F;  2KXP B;  1E7P A;  2D9D A;  2DWK A;  4ILU A;  3CPZ A;  3Q5D A;  4AQY T;  2NW8 A;  2P9B A;  1S94 A;  4PJM A;  5FXV A;  4HWC A;  3NZQ A;  1DU2 A;  2E2A A;  4QH1 A;  3KVB A;  3UQ7 A;  4I0U A;  4E7S A;  4AIU A;  2WB5 A;  4P0B A;  2YDQ A;  3MKD A;  3PUX F;  1R8I A;  2DNX A;  4DBR A;  4AQF C;  3RGL A;  4U7Y A;  3AE9 A;  5HEU A;  4DV4 T;  4JI2 T;  5FMN A;  4DMW A;  3OKQ A;  3TLT A;  2VQF T;  2WMO A;  4EYU A;  2J1D G;  3RH3 A;  2LKG A;  4IRE A;  2CWO A;  2OA5 A;  3OJA A;  5LB7 B;  4OYJ A;  4DR7 T;  3FBZ A;  2UUC T;  2E5L T;  5LA6 E;  3O4X E;  1D1A A;  1NWM X;  5LOV E;  2WU2 A;  1HX8 A;  4DV6 T;  4Z90 A;  2KSR A;  4PK6 A;  3B5M A;  2UUA T;  1CUN A;  3CK6 A;  4UVB B;  3N9L A;  4COF A;  3SFE A;  3PV0 F;  1N34 T;  2B1E A;  4WYV A;  2VWA A;  3LFM A;  4TWD A;  4HEA A;  4B3R T;  5HCJ A;  2LSK A;  2H89 A;  2XSB A;  3PUW F;  5IWA T;  4QX8 B;  4BAY B;  4JI4 T;  4H9P C;  3ONL C;  3ZST A;  2VB6 A;  4ADZ A;  3O1J A;  3JAF A;  2I59 A;  5ADX L;  4P1N A;  5HXC A;  4HFI A;  5A1L A;  3GMI A;  2XAS B;  2H7V C;  4I43 B;  4HE8 A;  3C50 A;  1XDO A;  4C91 A;  3LK4 2;  3RKG A;  5ABH A;  1W9R A;  1SE7 A;  2XQA A;  5HEO A;  3ZT7 A;  2XHE B;  2AE9 A;  4H63 H;  3J7Y q;  2LT3 A;  4UXN B;  4QHO A;  5DJQ C;  2H3R A;  3OBV E;  3P8C D;  2IW5 B;  2V26 A;  5LNK A;  5CFB A;  3KV5 A;  3G06 A;  3ZCJ A;  5LHG B;  4Z8X A;  2UXN B;  3T1H T;  2I0M A;  1E2A A;  4TNV A;  3ZMZ B;  1WCR A;  3PUG A;  2BBJ A;  5L3D B;  3ANW A;  3EHZ A;  5AQS B;  2IIU A;  3QB5 K;  4Q25 A;  1UCU A;  4DR5 T;  4GYR A;  5AFU L;  2EHO D;  3MK7 C;  1Y64 B;  2AXD S;  4U2Y A;  1BR4 A;  5DQW A;  3RLF F;  4GOU A;  1OED A;  3LBX A;  2WZH A;  3JCF A;  3RIU C;  3HKE E;  2H88 A;  4TV9 E;  3EDU A;  4U7I A;  1ZOY A;  5JDG A;  2X67 A;  2X0Y A;  3I0O A;  5J1G A;  3PU8 A;  1U4Q A;  2M6I A;  4XBF B;  3GN5 A;  3AE3 A;  4MLK A;  3PJA A;  4YSY A;  3AE2 A;  5DAB A;  4ZS3 A;  1NAF A;  2EHO A;  3VR8 A;  2CPT A;  3KBU A;  4CN6 A;  4UVC B;  1UX5 A;  2CE7 A;  2CHN A;  3CQG B;  4CI2 B;  3HR0 A;  3ONX A;  4KHZ F;  4P09 A;  4TWF A;  3IBP A;  4LMK A;  1HG5 A;  1E1H B;  3CWZ B;  4ZI7 E;  3P4Q A;  4AI6 A;  5HEJ A;  3AE1 A;  3T8O A;  4DO0 A;  3N9M A;  4EYY R;  4YXD A;  2CXL A;  3CVR A;  1LRZ A;  5LP6 E;  5L3E B;  3HKC E;  3S4U A;  2HN2 A;  4FI5 A;  2J62 A;  2W0G A;  3RQU A;  4L9I A;  4OK0 A;  4WNK A;  2NTX A;  2V5D A;  4PK5 A;  1LVF A;  3P4P A;  2JJ9 A;  5JR9 A;  2W66 A;  4YTP A;  1VCT A;  3CIR A;  5JRE A;  5H6Q B;  2QVA A;  3K3Q C;  4JI5 T;  1WRD A;  2W00 A;  5AQK B;  2BG9 C;  2MOZ A;  2IHR 1;  4DMV A;  1XWM A;  5J2U E;  5ABF A;  2XAF B;  2PJQ A;  4KUM B;  5FXX A;  2D2S A;  3FHN A;  2ZM2 A;  1QUU A;  4OFZ A;  4PW8 A;  5KDM C;  4NIQ A;  3RIA A;  3LG7 A;  1ZHC A;  2V6X A;  4X66 T;  3ABV A;  2QYW A;  4X64 T;  2OV9 A;  5L3F B;  5ABE A;  4ZS2 A;  2X0H A;  5GON E;  3UU4 A;  4AQF A;  4I55 E;  4X65 T;  2SPC A;  4U74 A;  5FYM A;  2WM9 A;  3ZEF B;  1QSD A;  1LVK A;  4FJO A;  3FBL A;  1O3X A;  5HWX A;  3SS1 A;  3NRY A;  4IE6 A;  4GK0 E;  3ZYL A;  1J5E T;  3EDV A;  1MMN A;  1MNE A;  4GK5 E;  2XQ9 A;  4WBN E;  3NZP A;  3RYH E;  2W2U A;  4YTN A;  4CQI A;  3LBX B;  4EIW A;  4DND A;  2N1G A;  5LYJ E;  4EB6 E;  2VVS A;  4ILA A;  4DV0 T;  1MMA A;  3RQW A;  3UFE A;  4HGA A;  4B6X A;  4CN1 A;  4UV8 B;  2IDO B;  3Q5W A;  4X62 T;  2KIN B;  1HF8 A;  2KND A;  1N33 T;  1HNZ T;  4OYK A;  2BVM A;  2LEH A;  3KVA A;  4HFE A;  1MIY A;  2CM0 A;  2VVN A;  2DI4 A;  1N36 T;  3GWH A;  4OHF A;  3ZN0 B;  4O8S A;  3FXD B;  4MFR A;  2ZMA A;  3Q2M A;  3P4R A;  4YSZ A;  3PU3 A;  3QK6 A;  1WYB A;  2JPF A;  2MAW A;  5HEH A;  4H63 V;  1IAP A;  1OWA A;  2ODU A;  3N2O A;  3ZKR A;  4NUU A;  5KMG P;  4A97 A;  3VHL A;  4HN9 A;  2YDS A;  3QOF A;  3AVR A;  3AE6 A;  1W0A A;  2J4G A;  4QWN B;  1KNR A;  4HWI B;  2CLY B;  3OTO T;  1WR6 A;  2B76 A;  5AQM B;  2WZI A;  3ZJ2 A;  2UXD T;  4E7Z A;  4HFD A;  3W15 B;  4NXN T;  5E0O A;  3X1D A;  1IZN B;  4PJJ A;  5JDL A;  1UUR A;  5JR9 B;  3DTO A;  2PBI A;  3I9W A;  2LM9 A;  4UEL A;  5LJM A;  2X68 A;  3UFG A;  2V7J A;  1T72 A;  5BR8 T;  1YXR A;  3JC6 C;  3ZT6 A;  5CB4 E;  2LJL A;  3PUV F;  4CXW A;  1IJ6 A;  4HFC A;  2NTY A;  1YD8 G;  2D5U A;  4YSX A;  3C98 B;  3IEE A;  5ABF B;  3RIU A;  1MIV A;  1HFA A;  3C4W A;  3ZMS B;  5AQO B;  2W62 A;  3CX8 B;  2VK9 A;  3RRC A;  2DCF A;  2L3L A;  3T1Y T;  1LKX A;  3AAE B;  2ES0 A;  4UF0 A;  2WSS V;  2BKO A;  3UQ4 A;  3P4S A;  1UUS A;  1WLX A;  1YW0 A;  3AB3 B;  1T7S A;  3BQK A;  5L3C B;  1UK5 A;  3AA0 B;  3EVY A;  3ZC0 A;  3TLS A;  2Y6X A;  1ZKE A;  5FVK A;  2FUP A;  3ZT5 A;  3N5L A;  3HA4 A;  4JUY A;  5LBM A;  4DV2 T;  1HTJ F;  4DR2 T;  4WW0 A;  3SRZ A;  3PDY A;  5H6R B;  3AXJ B;  4PJN A;  4O4I E;  1V9D A;  2CEA A;  5FXW A;  3NVO A;  4IL4 A;  2LHR A;  5L3B B;  3D0T A;  4LFC T;  1WFD A;  5JQG E;  5LMN T;  3K1S A;  2W67 A;  3ZMT B;  4O4L E;  4ZZC A;  4X1I E;  3MZK B;  1I6Z A;  3L09 A;  4IE4 A;  3AEF A;  2VL8 A;  2V5C A;  5LHI B;  4IE5 A;  3I9Y A;  4DUY T;  4KX6 A;  3PUR A;  3ZJ1 A;  5HXE A;  4HWF A;  2N2N A;  3E0Z A;  4H9Q C;  5F3J A;  4IDN A;  5FY7 A;  2LLY A;  4LF7 T;  4QH4 A;  4O4J E;  4MAL A;  2VKO A;  2V6Y A;  4K0U A;  4YHH T;  3P7I A;  3UU6 A;  1IJ5 A;  3M65 A;  4GYS A;  2X9X A;  4PFO A;  3WI3 A;  4YLH A;  3AE8 A;  4A5X A;  3TLU A;  3VU7 H;  1KFY A;  4ZOL E;  4DR1 T;  1MIW A;  3NBX X;  4QXB B;  3P4W A;  2FJA A;  2YU1 A;  3ZC1 A;  5KXJ A;  1US7 B;  4LMJ A;  2WCA A;  5FP3 A;  4JI1 T;  1KF6 A;  1D0X A;  2Y48 B;  3PUY F;  2JQH A;  4JLE A;  5IHY A;  2MYS A;  3Q5E A;  4WZX A;  3UT5 E;  5C2T A;  1KK7 A;  5L4E A;  3UTK A;  5TAO A;  1B7T A;  4UIG A;  4YTM A;  3FZM B;  3EUH A;  3UU5 A;  5FL0 A;  3E08 A;  2XQ7 A;  4M1P A;  5LG3 A;  4NPP A;  3AEE A;  2F4V T;  5ETW A;  4IHJ E;  4CXY A;  2VQE T;  2CXD A;  2RA1 A;  2KLQ A;  2W4X A;  5CA0 E;  4I50 E;  4MHC A;  4U2Z A;  3H37 A;  2IC6 A;  4DV1 T;  4X1K E;  1FIO A;  2VKD A;  2JQQ A;  2D0T A;  4I4T E;  4UF0 B;  2A72 A;  1HX1 B;  4LF9 T;  1G8X A;  4LF8 T;  4YFS A;  2CXF A;  4ASK A;  3DJB A;  5J0Z A;  3IHR A;  3OPC A;  2VL0 A;  3VRB A;  5LHH B;  4U33 A;  3V5U A;  4PFP A;  3KV6 A;  2LSJ A;  4PJL A;  2XQ8 A;  2VKH A;  2LHN A;  2UXX B;  2X9Y A;  5L47 A;  4LF4 T;  4LML A;  3N9P A;  4PK4 A;  3JC6 D;  3BQL A;  2WWU A;  3R6N A;  2XQ3 A;  1GQE A;  4EZH A;  4X1Y E;  4IT4 A;  4ZI3 C;  4YY3 T;  4QKN A;  1BR1 A;  4EEB A;  1X79 A;  4LF5 T;  3FZL B;  4IDO A;  5JDM A;  4BJM A;  2LE8 A;  5C8Y E;  3TLV A;  4P0A A;  4CN4 A;  2CRB A;  5AQJ B;  5AQF B;  2UXB T;  4AXP A;  1YKH B;  1XZY A;  2FJE A;  1VCS A;  3H3M A;  3FB2 A;  2XJ7 A;  4QH5 A;  2XQY A;  1JNZ A;  1MND A;  1AJ3 A;  2MPK A;  4JI8 T;  4IIJ E;  1T98 A;  4PAG A;  2G0U A;  2V6Y B;  2BG9 B;  3AE4 A;  3UUL A;  2LRK A;  3QC9 A;  5JRC A;  5F5W A;  2FJD A;  2JIW A;  2LM2 A;  3SOL A;  2XSA A;  3I1A A;  3HKB E;  4IDP A;  3RRW A;  1D1B A;  3KDS E;  5KX5 E;  3QNU A;  2Q9Q C;  4UR9 A;  4G63 A;  3RF1 A;  2K3W A;  2XAG B;  3ZYM A;  3K8P C;  5FY0 A;  3LDQ B;  2X9H A;  2NW9 A;  2YK0 A;  3I0Q A;  4TV8 E;  2BG9 E;  1WR0 A;  2W63 A;  4DV5 T;  5JDH A;  5IYZ E;  4DV3 T;  3ZMU B;  2XZE A;  4YT0 A;  3A8Y C;  4C90 A;  2HPL A;  3PE0 A;  2C5J A;  4DV7 T;  4IDQ A;  4YJ2 E;  4TN7 B;  4JEU B;  2XM2 A;  3O1H A;  4N78 D;  3ETU A;  4U3C A;  4JV5 T;  5CA1 E;  2XY8 B;  2QRX A;  3FZH B;  3MXZ A;  3AXJ A;  1YKE B;  5C3J A;  3VRA A;  3EI0 A;  2XM1 A;  3UU8 A;  2WAU A;  4O2B E;  4ZHQ E;  1M62 A;  2LSY A;  5LG4 A;  2V7M A;  2YEV C;  4JI7 T;  5LJN A;  2ODV A;  2BDE A;  1FMV A;  1HS7 A;  3V5S A;  3PUZ F;  4JI0 T;  4J2C A;  5M4Y A;  3AE5 A;  4F8H A;  3OYZ A;  3FZK B;  2L9Q A;  1OXZ A;  2XAH B;  3NRX A;  2XUE A;  4EXT A;  5JDQ A;  1ZV4 X;  4XZC A;  2YIN A;  5AQN B;  2BKN A;  2XQ6 A;  2VKJ A;  3RYI E;  2D0U A;  3O9X A;  2LOP A;  3FXE B;  2C5I T;  2BS2 A;  3MA9 A;  3K3N A;  3C4X A;  1J1J A;  5AQV B;  3UUN A;  3VKH A;  4EAH A;  4V1A v;  1FEW A;  3VKG A;  3CX7 B;  4WBO A;  4HFH A;  4TUY E;  2E8I A;  2C0S A;  5AQR B;  3GA8 A;  2NP9 A;  3JAD A;  4YJ3 E;  4HFB A;  3ZPO A;  5IUX A;  3B57 A;  4MBQ A;  4AIS A;  1KNZ A;  5L4H A;  1HR0 T;  4ZEY A;  1VOM A;  2QA7 A;  1NEN A;  5HWY A;  3AA6 B;  3AEG A;  2MBG A;  5HYA A;  3ETV A;  4ZI3 D;  3N2G E;  5JRC B;  5LMU T;  4DUZ T;  5FL1 A;  4KHP T;  2JMK A;  4HWD A;  4IDZ A;  5L3G B;  4B3S T;  2MTQ A;  3C4Z A;  2N9D A;  4U72 A;  4UVA B;  3F31 A;  3KFW X;  4HTE A;  2WS3 A;  4KBM B;  5AQP B;  1Z0P A;  2KWI B;  5ABG A;  4DBQ A;  3QUJ A;  1IBM T;  2X0L B;  2WDR A;  5LBQ B;  4HWH A;  2YN6 A;  3CKD A;  3R84 B;  2X51 A;  5EZY E;  4L5G A; 
#chains in the Genus database with same CATH homology
 4KP3 C;  4WNK A;  4H9R C;  3DP7 A;  2HH7 A;  5EK4 A;  3RC3 A;  2KZ7 B;  2NTX A;  2ZM8 A;  3GN5 B;  1D0Y A;  3PUA A;  5EK3 A;  4PK5 A;  3CQC B;  1LVF A;  3WAJ A;  5FY1 A;  2JJ9 A;  5JR9 A;  3RYF E;  1D0X A;  2Y48 B;  3HKD E;  1G73 A;  4JEH B;  4H9O C;  4JLE A;  4F6R C;  2A3D A;  5IHY A;  2MYS A;  4IE7 A;  3UT5 E;  3AA1 B;  1KK7 A;  5JRE A;  3CML A;  5JH7 E;  3J9X 1;  3UTK A;  3ESL A;  4TX5 A;  5EK2 A;  5TAO A;  1B7T A;  4L9I A;  2EHO B;  4G2A A;  4UIG A;  3KV4 A;  5H6Q B;  2EHO C;  3K3Q C;  2Y8D A;  3EUH A;  3H3A A;  1SA0 E;  2HPJ A;  3U3I A;  4ZI2 D;  3E08 A;  4CZZ B;  1WRD A;  2W00 A;  4M1P A;  3N2K E;  3U78 A;  5ETW A;  5FNV E;  4IHJ E;  4CXY A;  2LSG A;  3WAK A;  2CXD A;  2RA1 A;  3LK2 B;  2MOZ A;  5LGT B;  2KLQ A;  5LGN B;  4DMV A;  5J2U E;  5BMV E;  4NUV A;  2XAF B;  2PJQ A;  4KUM B;  5FXX A;  2D2S A;  2DLR A;  5CA0 E;  2RP4 A;  4I50 E;  5FXZ A;  3FHN A;  3ZN1 B;  2ZM2 A;  3AA7 B;  3UUX B;  1QUU A;  2Q9Q D;  4MHC A;  5DQV A;  4OFZ A;  4PW8 A;  5KDM C;  3H37 A;  2IC6 A;  3CX6 B;  1VRB A;  4X1K E;  2JMH A;  1FIO A;  2LOS A;  2VKD A;  3LG7 A;  1S35 A;  1ZHC A;  2JQQ A;  1WYC A;  4H9S E;  2D0T A;  3N9N A;  2XAJ B;  2CLY C;  4I4T E;  5HXR A;  4UF0 B;  3N9O A;  2A72 A;  2E9X A;  4X20 E;  4XAX B;  2A2F X;  1G8X A;  5L3F B;  4ZS2 A;  5GON E;  4YFS A;  2CXF A;  4AQF A;  4I55 E;  3DJB A;  4ASK A;  5HXH A;  2NW7 A;  2SPC A;  3IHR A;  4U74 A;  5FYM A;  2CWY A;  2WM9 A;  1EZ3 A;  3ZEF B;  1QSD A;  5LHH B;  1LVK A;  4FJO A;  2KT9 A;  1O3X A;  2QGS A;  3FBL A;  4PFP A;  3V5U A;  3KV6 A;  2LSJ A;  5HWX A;  3RKO A;  3RYC E;  3SS1 A;  5L2L A;  3NRY A;  4PJL A;  2VKH A;  4QXC B;  2LHN A;  2V1D B;  4IE6 A;  2UXX B;  2X9Y A;  4GK0 E;  4CXX A;  5JR9 C;  3C51 A;  3ZYL A;  2ACX A;  3N9P A;  4AKR B;  3EDV A;  1MMN A;  3ZLI A;  4PK4 A;  2LSI A;  2WMN A;  3JC6 D;  4AQG A;  3BQL A;  2WWU A;  1MNE A;  3R6N A;  1FMW A;  3KBT A;  2H7O A;  4GK5 E;  4EZH A;  2KXP B;  4O4H E;  2DWK A;  4WBN E;  3NZP A;  4X1Y E;  3RYH E;  5LGU B;  4ZI3 C;  4ILU A;  3CPZ A;  4GIW A;  4CQI A;  4QKN A;  3LBX B;  1BR1 A;  3MJX A;  5JDN A;  2JRK A;  4EIW A;  4UEM A;  4DND A;  1X79 A;  2NW8 A;  2N1G A;  2P9B A;  5LYJ E;  2PFV A;  1S94 A;  4EB6 E;  4PJM A;  5FXV A;  3NZQ A;  2Q9Q A;  4YHJ A;  1MMA A;  2YU2 A;  2DHR A;  5JDM A;  3UFE A;  3KVB A;  2XTL A;  4QXH B;  2VAS A;  4BJM A;  2LE8 A;  2X9W A;  4HGA A;  2IAK A;  4B6X A;  4E7S A;  3CQX C;  2KWH A;  4UV8 B;  3Q5W A;  5C8Y E;  2KIN B;  4P0A A;  4P0B A;  1HF8 A;  2KND A;  2E9X B;  4AKG A;  1BR0 A;  2E9X C;  2V7K A;  1ZEE A;  3MKD A;  5LXT E;  4AXP A;  4OYK A;  2BVM A;  4CI1 B;  2LEH A;  3KVA A;  4AKH A;  2DNX A;  1YKH B;  3N9Q A;  4DBR A;  4HKA A;  4AQF C;  1MIY A;  2C5K T;  3FB2 A;  2CM0 A;  5HAX A;  3AVS A;  2DI4 A;  3GWH A;  2XQY A;  4OHF A;  5FMN A;  4DMW A;  3OKQ A;  2CCQ A;  1MND A;  1AJ3 A;  3ZN0 B;  4O8S A;  2WMO A;  4EYU A;  3FXD B;  2J1D G;  4IIJ E;  1T98 A;  4MFR A;  3RH3 A;  4PAG A;  2ZMA A;  2CWO A;  3BK9 A;  1HG2 A;  3Q2M A;  3PU3 A;  2OA5 A;  3QK6 A;  4TZ4 C;  2G0U A;  3OJA A;  1WYB A;  2JPF A;  4OYJ A;  4H63 V;  1IAP A;  1OWA A;  2ODU A;  3N2O A;  4ZI2 C;  3FBZ A;  4NUU A;  5KMG P;  2CA5 A;  3RPU A;  3UUL A;  3VHL A;  4HN9 A;  3QC9 A;  5JRC A;  4QX7 B;  5LA6 E;  3AVR A;  3O4X E;  3SOL A;  1D1A A;  3I1A A;  1NWM X;  4QWN B;  3HKB E;  3RRW A;  1D1B A;  3KDS E;  3E22 E;  5LOV E;  1HX8 A;  5KX5 E;  2CLY B;  2Q9Q C;  4G63 A;  4PK6 A;  1WR6 A;  3ZJ2 A;  3OYX A;  4AKL A;  4E7Z A;  1CUN A;  2XAG B;  2CMR A;  3ZYM A;  4UVB B;  3N9L A;  3W15 B;  5E0O A;  2XAQ B;  3K8P C;  1IZN B;  5EZY E;  2B1E A;  2VWA A;  3LFM A;  5FY0 A;  2X9H A;  3C64 A;  4PJJ A;  2NW9 A;  2YK0 A;  5JDL A;  4HEA A;  3I0Q A;  2WBL A;  4TV8 E;  2W61 A;  2LSK A;  2W63 A;  2NWB A;  3DTO A;  2PBI A;  5JR9 B;  3MAC A;  5JDH A;  5IYZ E;  3Q5X A;  4AKI A;  3UUM A;  3I9W A;  3ZMU B;  2K48 A;  2LM9 A;  4QX8 B;  4UEL A;  4BAY B;  2X68 A;  5LJM A;  3HL6 A;  2V7J A;  3O1I A;  4PNI A;  4H9P C;  4C90 A;  2NOX A;  2HPL A;  3ZCI A;  3PE0 A;  4H9N C;  2VB6 A;  4ADZ A;  3ZMV B;  2C5J A;  2M67 A;  3JC6 C;  3O1J A;  2I59 A;  2IC9 A;  5CB4 E;  2DWG A;  4BA9 A;  2LJL A;  5ADX L;  4YJ2 E;  1MMG A;  1MMD A;  3B13 A;  4IE0 A;  5HXC A;  4CXW A;  1IJ6 A;  2NTY A;  5A1L A;  1YD8 G;  2D5U A;  3GMI A;  4TN7 B;  4JEU B;  3O1H A;  3C98 B;  3IEE A;  4N78 D;  2XAS B;  2ZM0 A;  2H7V C;  5LCY A;  3ETU A;  3RX6 A;  4I43 B;  1MIV A;  1HFA A;  4HE8 A;  3C4W A;  3ZMS B;  2ZLY A;  3C50 A;  2W62 A;  3SWH A;  5CA1 E;  4C91 A;  4ISS A;  3CX8 B;  2VK9 A;  3LK4 2;  3MXZ A;  1YKE B;  2K9A A;  3RRC A;  2DCF A;  2XHE B;  4H63 H;  3J7Y q;  2L3L A;  2LT3 A;  2WAU A;  1LKX A;  4O2B E;  4UXN B;  4ZHQ E;  4QHO A;  5DJQ C;  2LSY A;  2H3R A;  3AAE B;  2ES0 A;  3OBV E;  3P8C D;  2IW5 B;  3HI2 A;  4UF0 A;  2V26 A;  2WSS V;  5LG4 A;  5LNK A;  2GK9 A;  2V7M A;  2YEV C;  1WLX A;  1YW0 A;  5LJN A;  2ODV A;  1UX4 A;  3AB3 B;  3KV5 A;  3BQK A;  2BDE A;  3ZCJ A;  4ANJ A;  5L3C B;  1FMV A;  1HS7 A;  3V5S A;  5LHG B;  4Z8X A;  2UXN B;  3AA0 B;  3EVY A;  3ZMZ B;  3PUG A;  4J2C A;  3AAA B;  1H7C A;  5L3D B;  3ANW A;  3ZC0 A;  2Z6E A;  5M4Y A;  2Y6X A;  3RC8 A;  4ERR A;  1ZKE A;  1UCU A;  1HCI A;  3OYZ A;  4GYR A;  4A56 A;  5AFU L;  2V7L A;  2EHO D;  3MK7 C;  2L9Q A;  1Y64 B;  5HXS A;  1OXZ A;  3KIN B;  3TKL B;  2XAH B;  3NRX A;  5JVD E;  2XUE A;  4EXT A;  5JDQ A;  1BR4 A;  1ZV4 X;  4XZC A;  2YIN A;  3N5L A;  5DQW A;  3HA4 A;  3L3P A;  4GOU A;  4JUY A;  3BQI A;  3KV9 A;  2VKJ A;  5LBM A;  3RYI E;  3AAI A;  2D0U A;  1U5P A;  1HTJ F;  5F8P A;  3O9X A;  2LOP A;  2Q9Q B;  3LBX A;  3FXE B;  2C5I T;  3MA9 A;  4WW0 A;  3ZYK A;  3HKE E;  3SRZ A;  3K3N A;  3PDY A;  4TV9 E;  4EZ4 A;  3C4X A;  3VKH A;  3UUN A;  5H6R B;  4CI3 B;  2KMF A;  4PJN A;  3EDU A;  3PUQ A;  4O4I E;  1V9D A;  2CEA A;  4UV9 B;  1D1C A;  5FXW A;  5JDG A;  3F57 A;  2BZB A;  4EAH A;  4V1A v;  2LHR A;  5L3B B;  1FEW A;  3D0T A;  4BJN A;  3VKG A;  3CX7 B;  2X67 A;  3K3O A;  4WBO A;  4TUY E;  5JQG E;  2E8I A;  3I0O A;  2C0S A;  3ZMT B;  4O4L E;  3PU8 A;  5J1G A;  3GA8 A;  2NP9 A;  3MZK B;  1U4Q A;  2K5B B;  4X1I E;  2X66 A;  4YJ3 E;  3L09 A;  4IGU A;  2V7I A;  4L0R A;  4XBF B;  4IST A;  3LJC A;  3ZPO A;  3GN5 A;  4IE4 A;  2VL8 A;  2K24 A;  4MLK A;  5LHI B;  3F2E A;  4IE5 A;  3I9Y A;  3B57 A;  4MBQ A;  1SHZ C;  2L8K A;  3PUR A;  2BVL A;  1KNZ A;  3ZJ1 A;  5HXE A;  2N2N A;  1VOM A;  3ANW B;  3E0Z A;  4H9Q C;  5F3J A;  5J2T E;  2QA7 A;  5HWY A;  5FY7 A;  3AA6 B;  5DAB A;  4ZS3 A;  1NAF A;  2EHO A;  4O2A E;  1BR2 A;  2MBG A;  5HYA A;  3ETV A;  3KBU A;  4O4J E;  4UVC B;  1UX5 A;  2CE7 A;  4MAL A;  4ZI3 D;  3N2G E;  2VKO A;  3LK3 B;  5JRC B;  3CQG B;  4K0U A;  4CI2 B;  3HR0 A;  3ONX A;  3P7I A;  4P09 A;  1IJ5 A;  2PG8 A;  3IBP A;  3M65 A;  4GYS A;  2X9X A;  2JMK A;  4PFO A;  3WI3 A;  4YLH A;  1HG5 A;  1E1H B;  3VU7 H;  3CWZ B;  4ZI7 E;  4EOZ B;  4IDZ A;  5L3G B;  4ZOL E;  4AI6 A;  4HFV A;  3PUS A;  1D0Z A;  1MIW A;  3NBX X;  2MTQ A;  4KMC A;  4QXB B;  3T8O A;  2YU1 A;  3C4Z A;  4DO0 A;  3A5X A;  3N9M A;  3ZC1 A;  4EYY R;  3PTR B;  2N9D A;  4U72 A;  2CXL A;  4UVA B;  3F31 A;  3CVR A;  3KFW X;  4HTE A;  1LRZ A;  2E9X D;  4KBM B;  5JDF A;  1Z0P A;  2KWI B;  3HKC E;  4DBQ A;  3QUJ A;  1US7 B;  5L3E B;  5LP6 E;  2X0L B;  5LBQ B;  3IF8 B;  3S4U A;  5FP3 A;  3CKD A;  4FI5 A;  3R84 B;  2X51 A;  3Q9D A;  2W0G A;  4OK0 A;  4L5G A;  4DVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...