4TN7B

Crystal structure of mouse kdm2a-h3k36me-no complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4tn7B00
4QXCB 4QXHB 4QX8B 4QWNB 4QX7B 4QXBB 4TN7B
chains in the Genus database with same CATH superfamily
4KX6A 1W0BA 2QGSA 4KMCA 5H6RB 5EK2A 3HR0A 3F57A 4QX7B 2VKDA 3Q5XA 4PJNA 2WMNA 3L3PA 2V5CA 5LOVE 5FYMA 3U3IA 2LOSA 1T7SA 4HWIB 5AQSB 4ZS3A 4X1KE 4KHPT 4U31A 4HTEA 1LVKA 2VKJA 2B1EA 5JDHA 5FY1A 3AE1A 3Q9DA 2VQFT 4CN4A 2WCAA 2BG9E 4YSYA 2XSAA 4DV3T 1V9DA 1HF8A 3JC6D 1JNRA 3Q5WA 5AQNB 2WWVA 2C5JA 3RKGA 4PNIA 3F2EA 4EAHA 4OFZA 5HXRA 2IUBA 5AQIB 3HKDE 3FZKB 1WR6A 4H9QC 4DV4T 4V1Av 4DMVA 2K24A 3HKBE 3RF1A 3AA6B 4I55E 2UU9T 4JEUB 4HFHA 2VQET 1Y01A 2JPFA 1JNZA 3C98B 3HKCE 4WBNE 1MIWA 2K48A 4DR3T 5FXVA 5LB7B 4JUYA 3DTOA 3RC3A 4AI6A 4CN6A 1MNDA 2CLYC 4WZXA 3PUYF 4IDQA 4ZHQE 5JR9C 5JDQA 4B3RT 2WZIA 2EHOC 5L2LA 4AKLA 4OX9T 3AVSA 4AKHA 3VKHA 4C91A 4JI4T 4UEMA 1IBMT 1N33T 1SUMB 5FXWA 3BQLA 4QX8B 5JR9A 2RPAA 4QH1A 3TKLB 1IBLT 4O4IE 2E2AA 3ONJA 2XQ7A 4IE4A 3VU7H 5A1LA 1OEDE 3ZN0B 2E5LT 5LJMA 1YQ3A 3MKDA 1XZYA 4ZZBA 3D0TA 4IREA 3ZJ2A 3HI2A 4IDNA 4XAXB 3CX6B 3ONXA 2X9WA 3P4RA 4LMKA 2DL1A 3W15B 2NP9A 5JRCA 1UGOA 2WBLA 3LDQB 2FUPA 2ZM8A 3AE2A 2VVSA 3N9NA 3NZPA 3PUSA 5HXEA 2LEHA 2NW9A 4JV5T 2ZLYA 3BQIA 2BVLA 4YHJA 3HKEE 1XDPA 3ZCJA 2ZM0A 4ILUA 5JDFA 4PK6A 3L8RA 5AQKB 1MMGA 3LK42 1XMOT 2CMRA 4YSZA 1HX8A 4IIJE 4ANJA 3LK2B 5JTGA 3ZC1A 3CQCB 4TUYE 3C4WA 2YDRA 4DR2T 3A5XA 5L47A 5LGNB 5AQFB 3ZMZB 2E9XD 5FL1A 2WP9A 2EHOB 3CX8B 3ZCIA 2FJAA 2E8IA 3P4WA 3EABA 5FY0A 4ADZA 5ABFA 3UU6A 2X9HA 1XNRT 2XQ5A 2HPLA 2BG9C 1ZEEA 2WU2A 3GMIA 1IAPA 4YHHT 1HNZT 1ZHCA 2XY8B 1HG5A 3KV9A 4LF4T 2LOPA 4YSXA 2LRLA 3L39A 2V6YB 5F3JA 2JJ9A 4QXHB 2X66A 3P4QA 5HEOA 2NW8A 1N32T 2D2SA 4X64T 3IF8B 3RRCA 4DR7T 1W09A 1D0ZA 5GONE 3K8PC 4PJMA 4H9SE 3G06A 4M1PA 4K0KT 4O4JE 2JRKA 5LHGB 4ZI3C 3N2KE 1M7KA 1SA0E 4OK0A 4UVAB 1YW0A 3OYZA 1BR2A 2XQ8A 4DUYT 4DNDA 5JH7E 4IDZA 4JYAT 2J4GA 4EOZB 5AQOB 1AJ3A 4GOUA 4B3MT 4X20E 2Q9QC 4AISA 3ZMVB 1KNZA 4DO0A 3N9PA 3AAAB 3RRWA 2XAQB 2BZBA 1BR1A 5IHYA 2UXXB 3I0QA 3ZMTB 2L9QA 2UUAT 4UF0A 2QRXA 4DV6T 2X0HA 2Q9QA 2E9XB 4IE6A 1US7B 4AKIA 4WNKA 5ADXL 2C5IT 3EHZA 1QSDA 2BG9B 2UXDT 2V7JA 2DCFA 3HL6A 4H63H 3QC9A 3KDSE 4IGUA 4NIQA 4CI2B 4UV9B 3C51A 4ILAA 5HEHA 2VURA 5L4HA 2LKGA 4P1NA 2JQ9A 3TLTA 2W66A 3EUHA 3K3OA 2DWKA 5AQPB 2AXDS 1CUNA 5FKYA 1HG2A 5HEGA 2V7MA 2CA5A 2KWHA 1OWAA 3IBPA 3PUAA 4IL9A 3FBZA 3FZMB 2I0MA 3JCFA 2CHOA 4QXCB 2WS3A 4TWDA 3PU3A 5L3DB 3R6NA 2IDOB 2CBIA 5F5WA 3UUBA 3ZMSB 4EZHA 3SFEA 3U78A 3FHNA 2LSJA 2KNDA 3BK9A 1MMDA 3VR9A 4GYSA 1E2AA 1HCIA 2Y8DA 3C4XA 3O1JA 3PUVF 3P7IA 2W2UA 3UU5A 1J5WA 4ILBA 4MALA 4MHCA 3UQ4A 1HS7A 4LFAT 1KF6A 1S94A 2XQ6A 4I50E 2CXFA 3CMLA 1OEDB 4CI3B 3N2GE 1MNEA 4WYVA 3WAJA 3LK3B 2X67A 4CXYA 4QH4A 5AQJB 4YFSA 2JIWA 5EZYE 4LF9T 4OYJA 4IL4A 2WWUA 3OKQA 3LBXA 4C90A 1WYBA 3SOLA 3QB5A 5FMNA 1Z8UA 3UULA 2YKSA 2K5BB 3ZSTA 3PJAJ 2LM9A 1O3XA 4P0BA 5LP6E 3GWHA 4AQYT 2XUEA 5CA1E 2X9YA 2BS2A 1S35A 4I43B 2KWIB 1YXRA 4DR5T 3AE9A 5LBQB 4QHOA 3VR8A 1KNRA 3Q5DA 4L5GA 4BA9A 3RYCE 5HXSA 5JVDE 2W4XA 5HXCA 3ZC0A 3C4ZA 3UTKA 1QLBA 3M3ZB 5AQRB 4ASKA 3ESLA 5HAXA 2DNXA 4BJMA 3NRYA 1KEYA 2CPTA 1H7CA 2XM1A 3LJCA 4JLEA 4K0UA 2N9DA 3UT5E 3FZHB 3IA3A 3ETVA 1XDOA 4E7ZA 3LSVA 2YU1A 1IJ5A 3AXJB 2LT3A 2NW7A 2X51A 5HWYA 2H3RA 1J1JA 2FJDA 2FJEA 4IE5A 3NRXA 2QA7A 5ABHA 3VRBA 3NZQA 5C8YE 3MXZA 4EYUA 3EAMA 4O4LE 2B76A 2I59A 4LF5T 3JC6C 3LG7A 3J9X1 1D1BA 3N2OA 3NKZA 5AQQB 1J5ET 2V26A 2BS4A 4DBRA 1UX5A 4TWFA 4PW8A 4GIWA 5BR8T 5J1GA 2VB6A 4ERRA 1NEKA 3S4UA 3LFMA 2WDRA 2KLQA 4TV8E 2WU5A 1R8IA 5LJNA 5EK3A 1T8BA 4JI1T 2VL0A 3Q2MA 1KK7A 3EDVA 4JI2T 3VHLA 1G73A 4JEHB 1FIOA 4ZS2A 1NENA 2EHOD 2A72A 2SPCA 2H7OA 4I4TE 4LFBT 3O1HA 3ZSSA 3PU8A 2YEVC 2CEAA 4UXNB 5L3EB 2V1DB 5HXHA 1MIVA 3O4XE 3RI5A 2UUBT 4NXNT 4CQIA 1I6ZA 2PTFA 5AQVB 4U7IA 3CQGB 2XQYA 4GK0E 2XQ3A 4E7SA 2XHEB 4X65T 3ZKRA 4TZ4C 2ZM6T 4X1YE 4HWFA 2WAUA 2MPKA 2WMOA 4LF8T 1X79A 5LYJE 3UUNA 4DVDA 3I1AA 1T98A 3ZMUB 2G0UA 1FMVA 5LMNT 2FJBA 3P4SA 2ZMAA 3KVBA 3PDYA 1LVFA 2FBWA 3SFDA 3MA9A 3I9WA 4JI5T 1WRDA 3P50A 2W63A 2L3LA 2JMHA 3RIFA 2BBJA 2LKHA 4DV0T 5HWXA 4EIWA 3RYFE 1I94T 3AEEA 3RIAA 3ZT7A 2CLYB 3FBLA 5JR9B 5L3BB 3GA8A 2V7KA 3RC8A 3OYXA 3P8CD 5FNVE 1HR0T 2X0YA 2M6IA 4BJNA 5ABEA 1OXZA 2NOXA 1YD8G 3RKOA 5KX5E 2HN1A 2MYSA 4EEBA 4YXDA 3SWHA 4DV1T 3BQKA 3ABVA 4P0AA 3ZJ1A 3MACA 3KINB 5L4EA 2KINB 5JRCB 2V8SV 4HE8A 5IWAT 4JI8T 3AEAA 4UV8B 5CGMA 2Y6XA 2UXBT 3OVUA 4O2AE 1E1HB 1Y64B 3A8YC 3GN5B 2YDQA 4F6RC 2YN6A 4FJOA 1YQ4A 3J7Yq 4DR1T 4A5XA 2VASA 4ZI3D 4DV5T 3QB5K 4QWNB 3CWZB 1YKHB 4EZ4A 3MJXA 2MBGA 4X62T 5J2UE 2I6HA 2X68A 5LA6E 2Q9QD 4EGWA 5HEJA 2OA5A 2CWYA 2H7VC 5BMVE 5ABFB 4CN1A 1FEWA 2YINA 2V7IA 4B3TT 2JQKA 2K3WA 2LSYA 4NPPA 4HWDA 5KDMC 4B6XA 2C5KT 3OJAA 3AA7B 1IJ6A 4KP3C 4UVBB 3ZYLA 2IW5B 2ACZA 3E22E 2BBHA 1KNPA 3AEBA 4J2CA 1UUSA 2BS3A 3F31A 1FMWA 1UX4A 2NWBA 2VKHA 5DQWA 5HYAA 2H89A 4CZZB 3ANWB 5DJQC 3OBVE 3UUXB 4HFDA 5LG4A 4NUVA 5L3GB 2BDEA 3FB2A 3PURA 4KUMB 4AXPA 4NXMT 5JDLA 3HA4A 2MAWA 2R6GF 2CXDA 4COFA 3UU8A 1OEDA 2VWAA 3CVRA 4ZXLA 2WSSV 2IAKA 1UK5A 4HWCA 3AECA 1UURA 4YTPA 2Q9QB 3O9XA 3CIRA 4XZCA 4CXWA 2ES0A 2AE9A 3UUMA 4TV9E 4TWHA 1D1AA 3JAFA 1VCSA 3CQXC 2WB5A 2WM9A 5KMGP 3CK6A 3O1IA 3WAKA 4LMLA 3OPCA 1SE7A 2IMLA 1NWMX 3T8OA 1HFAA 3EI0A 3NBXX 4PFPA 5JREA 3E0ZA 5LNKA 1EZ3A 4DMWA 4PJLA 2CWOA 3RIUA 3UFEA 5JDGA 3PUWF 5FXXA 3K3NA 4AKGA 4JI3T 3JADA 5HCJA 2CCQA 1UCUA 2D9DA 3AE4A 2NR4A 4DBQA 4HKAA 2M6BA 4OYKA 3MZKB 4HN9A 2LRKA 4AQGA 4G2AA 4ZI2C 3UU3A 4LF7T 4UELA 1HX1B 1BR0A 2C0SA 4O2BE 4YTMA 4H63V 4IDOA 3AXJA 3RYHE 4OHFA 4H9PC 4TN7B 3KFWX 2YU2A 4U7YA 5CJ5A 5EK4A 4TX5A 5F8PA 2YDSA 2IC6A 4A97A 2VVNA 3AA0B 1YKEB 1LRZA 3PE0A 1BR4A 2XAJB 4MLKA 2DHRA 4EEDA 3P4PA 1N34T 3ONLC 3FXDB 3FZFB 1NAFA 4U2YA 3PUXF 2DI4A 2D5UA 3K3QC 1MMNA 3SS1A 1IBKT 2V6XA 1L0VA 1E7PA 3R84B 2Z6EA 4JI7T 4O4HE 2RP4A 3RYIE 2CE7A 3C64A 3LBXB 3V5SA 5CFBA 4UR9A 2LLYA 5AQUB 4EB6E 2A2FX 3OTOT 3TLWA 3DP7A 1XWMA 1D1CA 2XQ4A 3UFGA 3E08A 3DJBA 4P09A 4WBOA 5LGTB 2LSKA 5LBMA 1WR0A 2XASB 4EV6A 4X5TA 5AFUL 1HTJF 3V5UA 1W9RA 3PUQA 3QK6A 4AKRB 2RA1A 2HHHT 2IHR1 3ZN1B 3VKGA 2D0TA 3A7MA 4L9IA 3N5LA 4BAYB 2J62A 4YJ2E 3RHWA 2WDVA 5LCYA 3PTRB 3RPUA 2XAGB 3AE8A 3N9MA 3N9LA 3M65A 3N9OA 3KV6A 4I0UA 4ZZCA 3AB3B 5LG3A 5JQGE 5JDNA 2OV9A 5LXTE 3SRZA 4A98A 4YTNA 4LFCT 2XZEA 3FZLB 5FP3A 2UXNB 1GQEA 4ZEYA 5FY7A 3TLSA 3KV4A 4DIDB 5LMUT 1KFYA 2W00A 5IYZE 2KT9A 2LE8A 5FL0A 2A3DA 3NVOA 3AAEB 4U33A 2WZHA 3AEDA 1XMQT 4ISSA 2CRBA 4YJ3E 2YK0A 2NTYA 3IEEA 3K1SA 2EHOA 5H6QB 4HFCA 5FVKA 2JQHA 4H9RC 2VL8A 3AE3A 1Z0PA 5AQHB 2M67A 4ZOLE 1CHUA 5AQTB 5C2TA 1VOMA 2E5VA 5KXJA 3JAEA 4KHZF 1LKXA 5AQLB 3H3MA 3N9QA 3IHRA 5LHHB 2V6YA 4KI0F 4ZI7E 4Z90A 4JBWF 2VKOA 3TLVA 2LHRA 2W67A 2KMFA 2J1DG 2K9AA 2N1GA 3GN5A 2CM0A 2ODVA 3B13A 4X66T 2XAHB 4HWHA 4B3ST 4A56A 1HNXT 2XQ9A 3QOFA 4IE7A 2UUCT 4YT0A 4MBQA 3B57A 1X9BA 3I0OA 4DR4T 2BKPA 4ILCA 2XAFB 3H3AA 2NTXA 4UVCB 4U72A 3RGLA 2E9XC 3QNUA 2QYWA 1W0AA 1ZOYA 4PK4A 4TNVA 3WI3A 3VRAA 1QUUA 2D0UA 4GK5E 4CI1B 3B5MA 4DV7T 3FXEB 4WW0A 3CKDA 2WY2A 1FJGT 4HFBA 2F4VT 2IC9A 1T72A 4HGAA 2LM2A 4JI0T 3T1YT 2E9XA 4Z8XA 3AAIA 1G8XA 2W61A 2IIUA 4PFOA 2KSRA 1HNWT 5CA0E 5AQMB 2BG9A 4HFEA 4IDPA 2BKOA 4ISTA 2OLTA 4CXXA 2CBJA 4Q25A 2LJLA 4YY3T 5LGUB 2Y48B 3RH3A 4XBFB 1M62A 2YOEA 3RQWA 4AIUA 3QUJA 2H88A 3ANWA 2A9UA 2HN2A 2PFVA 2JQQA 2PJQA 4AQFC 2ACXA 5JDMA 1WYCA 3KBUA 4DUZT 2LSGA 5C3JA 1ZKEA 3C50A 4GYRA 4UIGA 4AQFA 4LF6T 1WCRA 1IZNB 3MK7C 5ETWA 4LMJA 1B7TA 4QXBB 5FXZA 5J2TE 1ZP0A 1WFDA 1D0YA 1WLXA 3AE6A 2ODUA 4QH5A 3ZYKA 1MIYA 3PUGA 3CX7B 2XJ7A 4PJJA 2CHNA 2X0LB 2XTLA 3AE5A 3UQ7A 1U5PA 4H9OC 2XPKA 3KVAA 3NWIA 2J47A 1OEDC 3ZLIA 4NUUA 3X1DA 2JMKA 5HEUA 3L09A 3KV5A 4IHJE 2MOZA 4DV2T 2HPJA 4U74A 5LHIB 2V5DA 3T1HT 5DQVA 4PK5A 2BKNA 2L8KA 2XSBA 4U2ZA 3ZEFB 3TLUA 1MMAA 4IE0A 4UF0B 2PBIA 5HCMA 1N36T 2XQAA 3RLFF 2VK9A 2WDQA 4KBMB 4O8SA 3PJAA 5L3FB 4FI5A 4H9NC 5FVLA 4PAGA 3H37A 4YLHA 3UU4A 2V7LA 2ZM2A 5AQGB 3KBTA 3Q5EA 3RIUC 4HEAA 5CB4E 4F8HA 5ABGA 2X9XA 2PG8A 4MFRA 5L3CB 1VCTA 2P9BA 2W62A 3AE7A 2WQYA 1ZV4X 2DLRA 2HH7A 3RX6A 2LSIA 2DWGA 3AA1B 3EVYA 5J0ZA 2BVMA 4Z91A 4GKKT 4IT4A 5E0OA 2KZ7B 1U4QA 3CPZA 2XM2A 1SHZC 4N78D 4TNWA 2MTQA 1DU2A 4GKJT 5IUXA 5TAOA 3ZT6A 1D0XA 3ZT5A 2KXPB 4QKNA 4ZI2D 4EXTA 2GK9A 2UXCT 2N2NA 4L0RA 3PUZF 2CXLA 2LHNA 4HFVA 1VRBA 3I9YA 3PV0F 3AEGA 3ETUA 4HFIA 4G63A 4U3CA 4EYYR 1XNQT 3AEFA 5DABA 3RQUA 4JI6T 3EDUA 4X1IE 3ZYMA 2W0GA 2QVAA 4DR6T 3AVRA 3ZPOA 5M4YA
chains in the Genus database with same CATH topology
3MACA 3KINB 5FY7A 2KINB 5JRCB 2QGSA 4KMCA 5H6RB 1HG2A 3KV4A 4HE8A 5EK2A 3HR0A 4UV8B 3F57A 2Y6XA 4QX7B 2V7MA 4O2AE 2CA5A 2VKDA 3Q5XA 2KWHA 4PJNA 2WMNA 1E1HB 1Y64B 3L3PA 2W00A 1OWAA 3IBPA 2KT9A 3PUAA 5IYZE 2LE8A 3FBZA 3GN5B 4QXCB 5LOVE 2A3DA 5FYMA 4F6RC 3AAEB 3U3IA 4FJOA 3J7Yq 3PU3A 2LOSA 4ISSA 5L3DB 3R6NA 4ZS3A 4YJ3E 2YK0A 2VASA 2NTYA 4ZI3D 4X1KE 5FP3A 4HTEA 4QWNB 3CWZB 3IEEA 3ZMSB 2EHOA 1LVKA 5H6QB 1YKHB 2VKJA 4EZ4A 3MJXA 2B1EA 5JDHA 4H9RC 4EZHA 5FY1A 3U78A 3Q9DA 2MBGA 2VL8A 5J2UE 3FHNA 1Z0PA 2LSJA 2KNDA 3BK9A 2X68A 1MMDA 4GYSA 5LA6E 2M67A 4ZOLE 2Q9QD 2OA5A 1HCIA 2CWYA 2H7VC 2Y8DA 1VOMA 3C4XA 5BMVE 3O1JA 1LKXA 3P7IA 1FEWA 2YINA 1V9DA 2V7IA 3N9QA 3IHRA 2LSYA 1HF8A 3JC6D 4MALA 4MHCA 3Q5WA 5LHHB 1HS7A 4ZI7E 2C5JA 5KDMC 1S94A 4I50E 4B6XA 2C5KT 2VKOA 3OJAA 4PNIA 2CXFA 2LHRA 3AA7B 3F2EA 1IJ6A 2KMFA 3CMLA 4EAHA 4CI3B 4OFZA 2J1DG 4KP3C 5HXRA 4UVBB 2K9AA 3N2GE 1MNEA 2N1GA 3ZYLA 3WAJA 3GN5A 3HKDE 2CM0A 2IW5B 1WR6A 4H9QC 2ODVA 3LK3B 2X67A 4CXYA 4V1Av 3E22E 4DMVA 2K24A 3B13A 3HKBE 2XAHB 4A56A 3AA6B 4YFSA 5EZYE 4OYJA 4I55E 2WWUA 3OKQA 4JEUB 3LBXA 4C90A 4IE7A 4J2CA 1WYBA 3SOLA 2JPFA 5FMNA 3C98B 3F31A 4MBQA 3B57A 3HKCE 1FMWA 1UX4A 2NWBA 3I0OA 2VKHA 3UULA 4WBNE 1MIWA 2K5BB 2K48A 5DQWA 5HYAA 4CZZB 3ANWB 5FXVA 5DJQC 3OBVE 3UUXB 2LM9A 2XAFB 1O3XA 2NTXA 3H3AA 4U72A 4UVCB 4P0BA 5LP6E 5LG4A 3GWHA 2E9XC 4NUVA 4JUYA 5L3GB 3DTOA 2BDEA 3RC3A 2XUEA 4AI6A 3FB2A 5CA1E 2X9YA 4PK4A 3PURA 4KUMB 1S35A 1MNDA 4I43B 4AXPA 2KWIB 3WI3A 2CLYC 1QUUA 2D0UA 4GK5E 4CI1B 4ZHQE 5JR9C 5JDLA 3FXEB 4WW0A 3CKDA 5JDQA 5LBQB 2EHOC 3HA4A 4QHOA 5L2LA 2IC9A 4AKLA 4HGAA 3AVSA 2CXDA 4AKHA 2E9XA 4L5GA 4BA9A 3VKHA 2VWAA 3CVRA 4Z8XA 3AAIA 1G8XA 2W61A 3RYCE 5HXSA 4C91A 2WSSV 2IAKA 4PFOA 4UEMA 5JVDE 5FXWA 5HXCA 2Q9QB 3BQLA 3O9XA 4QX8B 5JR9A 5CA0E 3ZC0A 3C4ZA 4XZCA 4CXWA 3UTKA 3TKLB 4O4IE 2ES0A 4ISTA 4IE4A 3VU7H 4CXXA 5A1LA 2LJLA 3UUMA 4ASKA 3ESLA 5HAXA 3ZN0B 5LGUB 2Y48B 4TV9E 5LJMA 2DNXA 3RH3A 4XBFB 4BJMA 3NRYA 1D1AA 3LJCA 1H7CA 4JLEA 4K0UA 3UT5E 2N9DA 3CQXC 3QUJA 2WM9A 3MKDA 3ANWA 3ETVA 3D0TA 5KMGP 4E7ZA 2PFVA 2YU1A 3ZJ2A 3HI2A 2JQQA 3O1IA 2PJQA 3WAKA 4XAXB 4AQFC 3CX6B 1IJ5A 3ONXA 2LT3A 2NW7A 2ACXA 2X9WA 2X51A 5HWYA 3W15B 5JDMA 2H3RA 1WYCA 1NWMX 2NP9A 5JRCA 3KBUA 2LSGA 2WBLA 3T8OA 4IE5A 1HFAA 2ZM8A 3NRXA 2QA7A 1ZKEA 3NBXX 3N9NA 4PFPA 3NZPA 3NZQA 1CUNA 2LEHA 3PUSA 5HXEA 3C50A 3E0ZA 5JREA 5C8YE 5LNKA 2NW9A 2ZLYA 3MXZA 1EZ3A 3BQIA 2BVLA 4PJLA 2CWOA 4GYRA 4UIGA 3HKEE 4O4LE 4YHJA 4DMWA 3ZCJA 2ZM0A 4EYUA 4ILUA 5JDFA 3UFEA 4AQFA 5JDGA 2I59A 1IZNB 4PK6A 3JC6C 3MK7C 5ETWA 5FXXA 3K3NA 4AKGA 1B7TA 4QXBB 5FXZA 3LG7A 1MMGA 5J2TE 3LK42 3J9X1 1D0YA 1WLXA 1D1BA 2ODUA 2CMRA 3N2OA 1HX8A 1MIYA 3ZYKA 2CCQA 1UCUA 4IIJE 2V26A 3PUGA 3CX7B 4ANJA 4PJJA 3LK2B 4DBQA 2XTLA 2X0LB 3CQCB 4HKAA 3ZC1A 4DBRA 1UX5A 4OYKA 4TUYE 3MZKB 4PW8A 4GIWA 3C4WA 1U5PA 4HN9A 4AQGA 4G2AA 3A5XA 4ZI2C 5J1GA 2VB6A 4ERRA 4H9OC 4UELA 5LGNB 3KVAA 1BR0A 3S4UA 3ZMZB 3LFMA 2C0SA 2KLQA 2E9XD 4TV8E 2EHOB 3CX8B 3ZCIA 2E8IA 4O2BE 5FY0A 5LJNA 3ZLIA 4NUUA 5EK3A 4ADZA 2JMKA 3L09A 4H63V 3RYHE 3KV5A 4IHJE 2MOZA 2X9HA 4OHFA 4H9PC 2HPJA 4U74A 4TN7B 3KFWX 2HPLA 2YU2A 3Q2MA 5LHIB 1KK7A 3EDVA 5EK4A 3VHLA 1G73A 4JEHB 1FIOA 4ZS2A 1ZEEA 2EHOD 5DQVA 3GMIA 1IAPA 2A72A 2SPCA 4TX5A 2H7OA 1ZHCA 4I4TE 2IC6A 5F8PA 3AA0B 1YKEB 4PK5A 3O1HA 1LRZA 3PU8A 1HG5A 3KV9A 2LOPA 2YEVC 3PE0A 1BR4A 2XAJB 4MLKA 2DHRA 2CEAA 2L8KA 4UXNB 5L3EB 2V1DB 5F3JA 3ZEFB 5HXHA 1MMAA 2JJ9A 1MIVA 3O4XE 4IE0A 4UF0B 3FXDB 2PBIA 4QXHB 2X66A 4CQIA 1NAFA 2NW8A 2D2SA 2DI4A 2XQYA 3CQGB 4GK0E 2D5UA 2VK9A 3IF8B 3RRCA 4KBMB 4E7SA 3K3QC 2XHEB 4O8SA 1MMNA 5L3FB 1D0ZA 4FI5A 3SS1A 4H9NC 3K8PC 5GONE 4TZ4C 4PAGA 3R84B 4PJMA 4H9SE 2Z6EA 4X1YE 2WAUA 4M1PA 4O4HE 3H37A 4YLHA 2WMOA 4O4JE 2JRKA 2RP4A 2V7LA 5LHGB 3RYIE 2CE7A 3N2KE 3C64A 1SA0E 4OK0A 4UVAB 2ZM2A 3LBXB 4ZI3C 1YW0A 3KBTA 3V5SA 3OYZA 1BR2A 1X79A 4HEAA 5LYJE 5CB4E 3UUNA 4DVDA 3I1AA 1T98A 2PG8A 2X9XA 3ZMUB 4DNDA 2G0UA 4MFRA 1FMVA 5JH7E 5L3CB 4IDZA 2P9BA 2W62A 4EOZB 1AJ3A 4GOUA 4X20E 4EB6E 2A2FX 1ZV4X 2DLRA 2HH7A 2Q9QC 3RX6A 2ZMAA 3KVBA 2LSIA 2DWGA 3AA1B 3ZMVB 1KNZA 3DP7A 3EVYA 2BVMA 1D1CA 3PDYA 4DO0A 3N9PA 3E08A 3DJBA 3AAAB 1LVFA 4P09A 5E0OA 4WBOA 3RRWA 2KZ7B 2XAQB 5LGTB 2LSKA 1U4QA 3CPZA 5LBMA 2BZBA 2XASB 3MA9A 1SHZC 1HTJF 5AFUL 1BR1A 3I9WA 5IHYA 2UXXB 3I0QA 1WRDA 3V5UA 3ZMTB 3PUQA 2L9QA 2W63A 3QK6A 4UF0A 4AKRB 2RA1A 4N78D 2L3LA 2MTQA 2JMHA 2Q9QA 2E9XB 4IE6A 3ZN1B 1US7B 4AKIA 5HWXA 4WNKA 4EIWA 5ADXL 3RYFE 5TAOA 3VKGA 1D0XA 2CLYB 3FBLA 2KXPB 4QKNA 4ZI2D 2D0TA 2C5IT 4L9IA 3N5LA 4EXTA 1QSDA 2GK9A 5JR9B 4BAYB 4YJ2E 2V7JA 5L3BB 2N2NA 3GA8A 2DCFA 2CXLA 2LHNA 2V7KA 1VRBA 3HL6A 4HFVA 4L0RA 4H63H 3PTRB 5LCYA 3RC8A 3QC9A 3OYXA 3P8CD 5FNVE 3KDSE 4IGUA 3RPUA 4CI2B 3I9YA 4UV9B 2XAGB 3C51A 4BJNA 3N9MA 3ETUA 3N9LA 3M65A 4G63A 3N9OA 3KV6A 3AB3B 4EYYR 1OXZA 2NOXA 5DABA 1YD8G 5JQGE 3RKOA 5KX5E 5JDNA 2MYSA 5LXTE 3EUHA 3EDUA 3K3OA 4X1IE 3SRZA 3SWHA 3ZYMA 2W0GA 2DWKA 3AVRA 3BQKA 2UXNB 4P0AA 3ZPOA 5M4YA 3ZJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXC B;  4QXH B;  4QX8 B;  4QWN B;  4QX7 B;  4QXB B;  4TN7 B; 
#chains in the Genus database with same CATH topology
 4KX6 A;  1W0B A;  2QGS A;  4KMC A;  5H6R B;  5EK2 A;  3HR0 A;  3F57 A;  4QX7 B;  2VKD A;  3Q5X A;  4PJN A;  2WMN A;  3L3P A;  2V5C A;  5LOV E;  5FYM A;  3U3I A;  2LOS A;  1T7S A;  4HWI B;  5AQS B;  4ZS3 A;  4X1K E;  4KHP T;  4U31 A;  4HTE A;  1LVK A;  2VKJ A;  2B1E A;  5JDH A;  5FY1 A;  3AE1 A;  3Q9D A;  2VQF T;  4CN4 A;  2WCA A;  2BG9 E;  4YSY A;  2XSA A;  4DV3 T;  1V9D A;  1HF8 A;  3JC6 D;  1JNR A;  3Q5W A;  5AQN B;  2WWV A;  2C5J A;  3RKG A;  4PNI A;  3F2E A;  4EAH A;  4OFZ A;  5HXR A;  2IUB A;  5AQI B;  3HKD E;  3FZK B;  1WR6 A;  4H9Q C;  4DV4 T;  4V1A v;  4DMV A;  2K24 A;  3HKB E;  3RF1 A;  3AA6 B;  4I55 E;  2UU9 T;  4JEU B;  4HFH A;  2VQE T;  1Y01 A;  2JPF A;  1JNZ A;  3C98 B;  3HKC E;  4WBN E;  1MIW A;  2K48 A;  4DR3 T;  5FXV A;  5LB7 B;  4JUY A;  3DTO A;  3RC3 A;  4AI6 A;  4CN6 A;  1MND A;  2CLY C;  4WZX A;  3PUY F;  4IDQ A;  4ZHQ E;  5JR9 C;  5JDQ A;  4B3R T;  2WZI A;  2EHO C;  5L2L A;  4AKL A;  4OX9 T;  3AVS A;  4AKH A;  3VKH A;  4C91 A;  4JI4 T;  4UEM A;  1IBM T;  1N33 T;  1SUM B;  5FXW A;  3BQL A;  4QX8 B;  5JR9 A;  2RPA A;  4QH1 A;  3TKL B;  1IBL T;  4O4I E;  2E2A A;  3ONJ A;  2XQ7 A;  4IE4 A;  3VU7 H;  5A1L A;  1OED E;  3ZN0 B;  2E5L T;  5LJM A;  1YQ3 A;  3MKD A;  1XZY A;  4ZZB A;  3D0T A;  4IRE A;  3ZJ2 A;  3HI2 A;  4IDN A;  4XAX B;  3CX6 B;  3ONX A;  2X9W A;  3P4R A;  4LMK A;  2DL1 A;  3W15 B;  2NP9 A;  5JRC A;  1UGO A;  2WBL A;  3LDQ B;  2FUP A;  2ZM8 A;  3AE2 A;  2VVS A;  3N9N A;  3NZP A;  3PUS A;  5HXE A;  2LEH A;  2NW9 A;  4JV5 T;  2ZLY A;  3BQI A;  2BVL A;  4YHJ A;  3HKE E;  1XDP A;  3ZCJ A;  2ZM0 A;  4ILU A;  5JDF A;  4PK6 A;  3L8R A;  5AQK B;  1MMG A;  3LK4 2;  1XMO T;  2CMR A;  4YSZ A;  1HX8 A;  4IIJ E;  4ANJ A;  3LK2 B;  5JTG A;  3ZC1 A;  3CQC B;  4TUY E;  3C4W A;  2YDR A;  4DR2 T;  3A5X A;  5L47 A;  5LGN B;  5AQF B;  3ZMZ B;  2E9X D;  5FL1 A;  2WP9 A;  2EHO B;  3CX8 B;  3ZCI A;  2FJA A;  2E8I A;  3P4W A;  3EAB A;  5FY0 A;  4ADZ A;  5ABF A;  3UU6 A;  2X9H A;  1XNR T;  2XQ5 A;  2HPL A;  2BG9 C;  1ZEE A;  2WU2 A;  3GMI A;  1IAP A;  4YHH T;  1HNZ T;  1ZHC A;  2XY8 B;  1HG5 A;  3KV9 A;  4LF4 T;  2LOP A;  4YSX A;  2LRL A;  3L39 A;  2V6Y B;  5F3J A;  2JJ9 A;  4QXH B;  2X66 A;  3P4Q A;  5HEO A;  2NW8 A;  1N32 T;  2D2S A;  4X64 T;  3IF8 B;  3RRC A;  4DR7 T;  1W09 A;  1D0Z A;  5GON E;  3K8P C;  4PJM A;  4H9S E;  3G06 A;  4M1P A;  4K0K T;  4O4J E;  2JRK A;  5LHG B;  4ZI3 C;  3N2K E;  1M7K A;  1SA0 E;  4OK0 A;  4UVA B;  1YW0 A;  3OYZ A;  1BR2 A;  2XQ8 A;  4DUY T;  4DND A;  5JH7 E;  4IDZ A;  4JYA T;  2J4G A;  4EOZ B;  5AQO B;  1AJ3 A;  4GOU A;  4B3M T;  4X20 E;  2Q9Q C;  4AIS A;  3ZMV B;  1KNZ A;  4DO0 A;  3N9P A;  3AAA B;  3RRW A;  2XAQ B;  2BZB A;  1BR1 A;  5IHY A;  2UXX B;  3I0Q A;  3ZMT B;  2L9Q A;  2UUA T;  4UF0 A;  2QRX A;  4DV6 T;  2X0H A;  2Q9Q A;  2E9X B;  4IE6 A;  1US7 B;  4AKI A;  4WNK A;  5ADX L;  2C5I T;  3EHZ A;  1QSD A;  2BG9 B;  2UXD T;  2V7J A;  2DCF A;  3HL6 A;  4H63 H;  3QC9 A;  3KDS E;  4IGU A;  4NIQ A;  4CI2 B;  4UV9 B;  3C51 A;  4ILA A;  5HEH A;  2VUR A;  5L4H A;  2LKG A;  4P1N A;  2JQ9 A;  3TLT A;  2W66 A;  3EUH A;  3K3O A;  2DWK A;  5AQP B;  2AXD S;  1CUN A;  5FKY A;  1HG2 A;  5HEG A;  2V7M A;  2CA5 A;  2KWH A;  1OWA A;  3IBP A;  3PUA A;  4IL9 A;  3FBZ A;  3FZM B;  2I0M A;  3JCF A;  2CHO A;  4QXC B;  2WS3 A;  4TWD A;  3PU3 A;  5L3D B;  3R6N A;  2IDO B;  2CBI A;  5F5W A;  3UUB A;  3ZMS B;  4EZH A;  3SFE A;  3U78 A;  3FHN A;  2LSJ A;  2KND A;  3BK9 A;  1MMD A;  3VR9 A;  4GYS A;  1E2A A;  1HCI A;  2Y8D A;  3C4X A;  3O1J A;  3PUV F;  3P7I A;  2W2U A;  3UU5 A;  1J5W A;  4ILB A;  4MAL A;  4MHC A;  3UQ4 A;  1HS7 A;  4LFA T;  1KF6 A;  1S94 A;  2XQ6 A;  4I50 E;  2CXF A;  3CML A;  1OED B;  4CI3 B;  3N2G E;  1MNE A;  4WYV A;  3WAJ A;  3LK3 B;  2X67 A;  4CXY A;  4QH4 A;  5AQJ B;  4YFS A;  2JIW A;  5EZY E;  4LF9 T;  4OYJ A;  4IL4 A;  2WWU A;  3OKQ A;  3LBX A;  4C90 A;  1WYB A;  3SOL A;  3QB5 A;  5FMN A;  1Z8U A;  3UUL A;  2YKS A;  2K5B B;  3ZST A;  3PJA J;  2LM9 A;  1O3X A;  4P0B A;  5LP6 E;  3GWH A;  4AQY T;  2XUE A;  5CA1 E;  2X9Y A;  2BS2 A;  1S35 A;  4I43 B;  2KWI B;  1YXR A;  4DR5 T;  3AE9 A;  5LBQ B;  4QHO A;  3VR8 A;  1KNR A;  3Q5D A;  4L5G A;  4BA9 A;  3RYC E;  5HXS A;  5JVD E;  2W4X A;  5HXC A;  3ZC0 A;  3C4Z A;  3UTK A;  1QLB A;  3M3Z B;  5AQR B;  4ASK A;  3ESL A;  5HAX A;  2DNX A;  4BJM A;  3NRY A;  1KEY A;  2CPT A;  1H7C A;  2XM1 A;  3LJC A;  4JLE A;  4K0U A;  2N9D A;  3UT5 E;  3FZH B;  3IA3 A;  3ETV A;  1XDO A;  4E7Z A;  3LSV A;  2YU1 A;  1IJ5 A;  3AXJ B;  2LT3 A;  2NW7 A;  2X51 A;  5HWY A;  2H3R A;  1J1J A;  2FJD A;  2FJE A;  4IE5 A;  3NRX A;  2QA7 A;  5ABH A;  3VRB A;  3NZQ A;  5C8Y E;  3MXZ A;  4EYU A;  3EAM A;  4O4L E;  2B76 A;  2I59 A;  4LF5 T;  3JC6 C;  3LG7 A;  3J9X 1;  1D1B A;  3N2O A;  3NKZ A;  5AQQ B;  1J5E T;  2V26 A;  2BS4 A;  4DBR A;  1UX5 A;  4TWF A;  4PW8 A;  4GIW A;  5BR8 T;  5J1G A;  2VB6 A;  4ERR A;  1NEK A;  3S4U A;  3LFM A;  2WDR A;  2KLQ A;  4TV8 E;  2WU5 A;  1R8I A;  5LJN A;  5EK3 A;  1T8B A;  4JI1 T;  2VL0 A;  3Q2M A;  1KK7 A;  3EDV A;  4JI2 T;  3VHL A;  1G73 A;  4JEH B;  1FIO A;  4ZS2 A;  1NEN A;  2EHO D;  2A72 A;  2SPC A;  2H7O A;  4I4T E;  4LFB T;  3O1H A;  3ZSS A;  3PU8 A;  2YEV C;  2CEA A;  4UXN B;  5L3E B;  2V1D B;  5HXH A;  1MIV A;  3O4X E;  3RI5 A;  2UUB T;  4NXN T;  4CQI A;  1I6Z A;  2PTF A;  5AQV B;  4U7I A;  3CQG B;  2XQY A;  4GK0 E;  2XQ3 A;  4E7S A;  2XHE B;  4X65 T;  3ZKR A;  4TZ4 C;  2ZM6 T;  4X1Y E;  4HWF A;  2WAU A;  2MPK A;  2WMO A;  4LF8 T;  1X79 A;  5LYJ E;  3UUN A;  4DVD A;  3I1A A;  1T98 A;  3ZMU B;  2G0U A;  1FMV A;  5LMN T;  2FJB A;  3P4S A;  2ZMA A;  3KVB A;  3PDY A;  1LVF A;  2FBW A;  3SFD A;  3MA9 A;  3I9W A;  4JI5 T;  1WRD A;  3P50 A;  2W63 A;  2L3L A;  2JMH A;  3RIF A;  2BBJ A;  2LKH A;  4DV0 T;  5HWX A;  4EIW A;  3RYF E;  1I94 T;  3AEE A;  3RIA A;  3ZT7 A;  2CLY B;  3FBL A;  5JR9 B;  5L3B B;  3GA8 A;  2V7K A;  3RC8 A;  3OYX A;  3P8C D;  5FNV E;  1HR0 T;  2X0Y A;  2M6I A;  4BJN A;  5ABE A;  1OXZ A;  2NOX A;  1YD8 G;  3RKO A;  5KX5 E;  2HN1 A;  2MYS A;  4EEB A;  4YXD A;  3SWH A;  4DV1 T;  3BQK A;  3ABV A;  4P0A A;  3ZJ1 A;  3MAC A;  3KIN B;  5L4E A;  2KIN B;  5JRC B;  2V8S V;  4HE8 A;  5IWA T;  4JI8 T;  3AEA A;  4UV8 B;  5CGM A;  2Y6X A;  2UXB T;  3OVU A;  4O2A E;  1E1H B;  1Y64 B;  3A8Y C;  3GN5 B;  2YDQ A;  4F6R C;  2YN6 A;  4FJO A;  1YQ4 A;  3J7Y q;  4DR1 T;  4A5X A;  2VAS A;  4ZI3 D;  4DV5 T;  3QB5 K;  4QWN B;  3CWZ B;  1YKH B;  4EZ4 A;  3MJX A;  2MBG A;  4X62 T;  5J2U E;  2I6H A;  2X68 A;  5LA6 E;  2Q9Q D;  4EGW A;  5HEJ A;  2OA5 A;  2CWY A;  2H7V C;  5BMV E;  5ABF B;  4CN1 A;  1FEW A;  2YIN A;  2V7I A;  4B3T T;  2JQK A;  2K3W A;  2LSY A;  4NPP A;  4HWD A;  5KDM C;  4B6X A;  2C5K T;  3OJA A;  3AA7 B;  1IJ6 A;  4KP3 C;  4UVB B;  3ZYL A;  2IW5 B;  2ACZ A;  3E22 E;  2BBH A;  1KNP A;  3AEB A;  4J2C A;  1UUS A;  2BS3 A;  3F31 A;  1FMW A;  1UX4 A;  2NWB A;  2VKH A;  5DQW A;  5HYA A;  2H89 A;  4CZZ B;  3ANW B;  5DJQ C;  3OBV E;  3UUX B;  4HFD A;  5LG4 A;  4NUV A;  5L3G B;  2BDE A;  3FB2 A;  3PUR A;  4KUM B;  4AXP A;  4NXM T;  5JDL A;  3HA4 A;  2MAW A;  2R6G F;  2CXD A;  4COF A;  3UU8 A;  1OED A;  2VWA A;  3CVR A;  4ZXL A;  2WSS V;  2IAK A;  1UK5 A;  4HWC A;  3AEC A;  1UUR A;  4YTP A;  2Q9Q B;  3O9X A;  3CIR A;  4XZC A;  4CXW A;  2ES0 A;  2AE9 A;  3UUM A;  4TV9 E;  4TWH A;  1D1A A;  3JAF A;  1VCS A;  3CQX C;  2WB5 A;  2WM9 A;  5KMG P;  3CK6 A;  3O1I A;  3WAK A;  4LML A;  3OPC A;  1SE7 A;  2IML A;  1NWM X;  3T8O A;  1HFA A;  3EI0 A;  3NBX X;  4PFP A;  5JRE A;  3E0Z A;  5LNK A;  1EZ3 A;  4DMW A;  4PJL A;  2CWO A;  3RIU A;  3UFE A;  5JDG A;  3PUW F;  5FXX A;  3K3N A;  4AKG A;  4JI3 T;  3JAD A;  5HCJ A;  2CCQ A;  1UCU A;  2D9D A;  3AE4 A;  2NR4 A;  4DBQ A;  4HKA A;  2M6B A;  4OYK A;  3MZK B;  4HN9 A;  2LRK A;  4AQG A;  4G2A A;  4ZI2 C;  3UU3 A;  4LF7 T;  4UEL A;  1HX1 B;  1BR0 A;  2C0S A;  4O2B E;  4YTM A;  4H63 V;  4IDO A;  3AXJ A;  3RYH E;  4OHF A;  4H9P C;  4TN7 B;  3KFW X;  2YU2 A;  4U7Y A;  5CJ5 A;  5EK4 A;  4TX5 A;  5F8P A;  2YDS A;  2IC6 A;  4A97 A;  2VVN A;  3AA0 B;  1YKE B;  1LRZ A;  3PE0 A;  1BR4 A;  2XAJ B;  4MLK A;  2DHR A;  4EED A;  3P4P A;  1N34 T;  3ONL C;  3FXD B;  3FZF B;  1NAF A;  4U2Y A;  3PUX F;  2DI4 A;  2D5U A;  3K3Q C;  1MMN A;  3SS1 A;  1IBK T;  2V6X A;  1L0V A;  1E7P A;  3R84 B;  2Z6E A;  4JI7 T;  4O4H E;  2RP4 A;  3RYI E;  2CE7 A;  3C64 A;  3LBX B;  3V5S A;  5CFB A;  4UR9 A;  2LLY A;  5AQU B;  4EB6 E;  2A2F X;  3OTO T;  3TLW A;  3DP7 A;  1XWM A;  1D1C A;  2XQ4 A;  3UFG A;  3E08 A;  3DJB A;  4P09 A;  4WBO A;  5LGT B;  2LSK A;  5LBM A;  1WR0 A;  2XAS B;  4EV6 A;  4X5T A;  5AFU L;  1HTJ F;  3V5U A;  1W9R A;  3PUQ A;  3QK6 A;  4AKR B;  2RA1 A;  2HHH T;  2IHR 1;  3ZN1 B;  3VKG A;  2D0T A;  3A7M A;  4L9I A;  3N5L A;  4BAY B;  2J62 A;  4YJ2 E;  3RHW A;  2WDV A;  5LCY A;  3PTR B;  3RPU A;  2XAG B;  3AE8 A;  3N9M A;  3N9L A;  3M65 A;  3N9O A;  3KV6 A;  4I0U A;  4ZZC A;  3AB3 B;  5LG3 A;  5JQG E;  5JDN A;  2OV9 A;  5LXT E;  3SRZ A;  4A98 A;  4YTN A;  4LFC T;  2XZE A;  3FZL B;  5FP3 A;  2UXN B;  1GQE A;  4ZEY A;  5FY7 A;  3TLS A;  3KV4 A;  4DID B;  5LMU T;  1KFY A;  2W00 A;  5IYZ E;  2KT9 A;  2LE8 A;  5FL0 A;  2A3D A;  3NVO A;  3AAE B;  4U33 A;  2WZH A;  3AED A;  1XMQ T;  4ISS A;  2CRB A;  4YJ3 E;  2YK0 A;  2NTY A;  3IEE A;  3K1S A;  2EHO A;  5H6Q B;  4HFC A;  5FVK A;  2JQH A;  4H9R C;  2VL8 A;  3AE3 A;  1Z0P A;  5AQH B;  2M67 A;  4ZOL E;  1CHU A;  5AQT B;  5C2T A;  1VOM A;  2E5V A;  5KXJ A;  3JAE A;  4KHZ F;  1LKX A;  5AQL B;  3H3M A;  3N9Q A;  3IHR A;  5LHH B;  2V6Y A;  4KI0 F;  4ZI7 E;  4Z90 A;  4JBW F;  2VKO A;  3TLV A;  2LHR A;  2W67 A;  2KMF A;  2J1D G;  2K9A A;  2N1G A;  3GN5 A;  2CM0 A;  2ODV A;  3B13 A;  4X66 T;  2XAH B;  4HWH A;  4B3S T;  4A56 A;  1HNX T;  2XQ9 A;  3QOF A;  4IE7 A;  2UUC T;  4YT0 A;  4MBQ A;  3B57 A;  1X9B A;  3I0O A;  4DR4 T;  2BKP A;  4ILC A;  2XAF B;  3H3A A;  2NTX A;  4UVC B;  4U72 A;  3RGL A;  2E9X C;  3QNU A;  2QYW A;  1W0A A;  1ZOY A;  4PK4 A;  4TNV A;  3WI3 A;  3VRA A;  1QUU A;  2D0U A;  4GK5 E;  4CI1 B;  3B5M A;  4DV7 T;  3FXE B;  4WW0 A;  3CKD A;  2WY2 A;  1FJG T;  4HFB A;  2F4V T;  2IC9 A;  1T72 A;  4HGA A;  2LM2 A;  4JI0 T;  3T1Y T;  2E9X A;  4Z8X A;  3AAI A;  1G8X A;  2W61 A;  2IIU A;  4PFO A;  2KSR A;  1HNW T;  5CA0 E;  5AQM B;  2BG9 A;  4HFE A;  4IDP A;  2BKO A;  4IST A;  2OLT A;  4CXX A;  2CBJ A;  4Q25 A;  2LJL A;  4YY3 T;  5LGU B;  2Y48 B;  3RH3 A;  4XBF B;  1M62 A;  2YOE A;  3RQW A;  4AIU A;  3QUJ A;  2H88 A;  3ANW A;  2A9U A;  2HN2 A;  2PFV A;  2JQQ A;  2PJQ A;  4AQF C;  2ACX A;  5JDM A;  1WYC A;  3KBU A;  4DUZ T;  2LSG A;  5C3J A;  1ZKE A;  3C50 A;  4GYR A;  4UIG A;  4AQF A;  4LF6 T;  1WCR A;  1IZN B;  3MK7 C;  5ETW A;  4LMJ A;  1B7T A;  4QXB B;  5FXZ A;  5J2T E;  1ZP0 A;  1WFD A;  1D0Y A;  1WLX A;  3AE6 A;  2ODU A;  4QH5 A;  3ZYK A;  1MIY A;  3PUG A;  3CX7 B;  2XJ7 A;  4PJJ A;  2CHN A;  2X0L B;  2XTL A;  3AE5 A;  3UQ7 A;  1U5P A;  4H9O C;  2XPK A;  3KVA A;  3NWI A;  2J47 A;  1OED C;  3ZLI A;  4NUU A;  3X1D A;  2JMK A;  5HEU A;  3L09 A;  3KV5 A;  4IHJ E;  2MOZ A;  4DV2 T;  2HPJ A;  4U74 A;  5LHI B;  2V5D A;  3T1H T;  5DQV A;  4PK5 A;  2BKN A;  2L8K A;  2XSB A;  4U2Z A;  3ZEF B;  3TLU A;  1MMA A;  4IE0 A;  4UF0 B;  2PBI A;  5HCM A;  1N36 T;  2XQA A;  3RLF F;  2VK9 A;  2WDQ A;  4KBM B;  4O8S A;  3PJA A;  5L3F B;  4FI5 A;  4H9N C;  5FVL A;  4PAG A;  3H37 A;  4YLH A;  3UU4 A;  2V7L A;  2ZM2 A;  5AQG B;  3KBT A;  3Q5E A;  3RIU C;  4HEA A;  5CB4 E;  4F8H A;  5ABG A;  2X9X A;  2PG8 A;  4MFR A;  5L3C B;  1VCT A;  2P9B A;  2W62 A;  3AE7 A;  2WQY A;  1ZV4 X;  2DLR A;  2HH7 A;  3RX6 A;  2LSI A;  2DWG A;  3AA1 B;  3EVY A;  5J0Z A;  2BVM A;  4Z91 A;  4GKK T;  4IT4 A;  5E0O A;  2KZ7 B;  1U4Q A;  3CPZ A;  2XM2 A;  1SHZ C;  4N78 D;  4TNW A;  2MTQ A;  1DU2 A;  4GKJ T;  5IUX A;  5TAO A;  3ZT6 A;  1D0X A;  3ZT5 A;  2KXP B;  4QKN A;  4ZI2 D;  4EXT A;  2GK9 A;  2UXC T;  2N2N A;  4L0R A;  3PUZ F;  2CXL A;  2LHN A;  4HFV A;  1VRB A;  3I9Y A;  3PV0 F;  3AEG A;  3ETU A;  4HFI A;  4G63 A;  4U3C A;  4EYY R;  1XNQ T;  3AEF A;  5DAB A;  3RQU A;  4JI6 T;  3EDU A;  4X1I E;  3ZYM A;  2W0G A;  2QVA A;  4DR6 T;  3AVR A;  3ZPO A;  5M4Y A; 
#chains in the Genus database with same CATH homology
 3MAC A;  3KIN B;  5FY7 A;  2KIN B;  5JRC B;  2QGS A;  4KMC A;  5H6R B;  1HG2 A;  3KV4 A;  4HE8 A;  5EK2 A;  3HR0 A;  4UV8 B;  3F57 A;  2Y6X A;  4QX7 B;  2V7M A;  4O2A E;  2CA5 A;  2VKD A;  3Q5X A;  2KWH A;  4PJN A;  2WMN A;  1E1H B;  1Y64 B;  3L3P A;  2W00 A;  1OWA A;  3IBP A;  2KT9 A;  3PUA A;  5IYZ E;  2LE8 A;  3FBZ A;  3GN5 B;  4QXC B;  5LOV E;  2A3D A;  5FYM A;  4F6R C;  3AAE B;  3U3I A;  4FJO A;  3J7Y q;  3PU3 A;  2LOS A;  4ISS A;  5L3D B;  3R6N A;  4ZS3 A;  4YJ3 E;  2YK0 A;  2VAS A;  2NTY A;  4ZI3 D;  4X1K E;  5FP3 A;  4HTE A;  4QWN B;  3CWZ B;  3IEE A;  3ZMS B;  2EHO A;  1LVK A;  5H6Q B;  1YKH B;  2VKJ A;  4EZ4 A;  3MJX A;  2B1E A;  5JDH A;  4H9R C;  4EZH A;  5FY1 A;  3U78 A;  3Q9D A;  2MBG A;  2VL8 A;  5J2U E;  3FHN A;  1Z0P A;  2LSJ A;  2KND A;  3BK9 A;  2X68 A;  1MMD A;  4GYS A;  5LA6 E;  2M67 A;  4ZOL E;  2Q9Q D;  2OA5 A;  1HCI A;  2CWY A;  2H7V C;  2Y8D A;  1VOM A;  3C4X A;  5BMV E;  3O1J A;  1LKX A;  3P7I A;  1FEW A;  2YIN A;  1V9D A;  2V7I A;  3N9Q A;  3IHR A;  2LSY A;  1HF8 A;  3JC6 D;  4MAL A;  4MHC A;  3Q5W A;  5LHH B;  1HS7 A;  4ZI7 E;  2C5J A;  5KDM C;  1S94 A;  4I50 E;  4B6X A;  2C5K T;  2VKO A;  3OJA A;  4PNI A;  2CXF A;  2LHR A;  3AA7 B;  3F2E A;  1IJ6 A;  2KMF A;  3CML A;  4EAH A;  4CI3 B;  4OFZ A;  2J1D G;  4KP3 C;  5HXR A;  4UVB B;  2K9A A;  3N2G E;  1MNE A;  2N1G A;  3ZYL A;  3WAJ A;  3GN5 A;  3HKD E;  2CM0 A;  2IW5 B;  1WR6 A;  4H9Q C;  2ODV A;  3LK3 B;  2X67 A;  4CXY A;  4V1A v;  3E22 E;  4DMV A;  2K24 A;  3B13 A;  3HKB E;  2XAH B;  4A56 A;  3AA6 B;  4YFS A;  5EZY E;  4OYJ A;  4I55 E;  2WWU A;  3OKQ A;  4JEU B;  3LBX A;  4C90 A;  4IE7 A;  4J2C A;  1WYB A;  3SOL A;  2JPF A;  5FMN A;  3C98 B;  3F31 A;  4MBQ A;  3B57 A;  3HKC E;  1FMW A;  1UX4 A;  2NWB A;  3I0O A;  2VKH A;  3UUL A;  4WBN E;  1MIW A;  2K5B B;  2K48 A;  5DQW A;  5HYA A;  4CZZ B;  3ANW B;  5FXV A;  5DJQ C;  3OBV E;  3UUX B;  2LM9 A;  2XAF B;  1O3X A;  2NTX A;  3H3A A;  4U72 A;  4UVC B;  4P0B A;  5LP6 E;  5LG4 A;  3GWH A;  2E9X C;  4NUV A;  4JUY A;  5L3G B;  3DTO A;  2BDE A;  3RC3 A;  2XUE A;  4AI6 A;  3FB2 A;  5CA1 E;  2X9Y A;  4PK4 A;  3PUR A;  4KUM B;  1S35 A;  1MND A;  4I43 B;  4AXP A;  2KWI B;  3WI3 A;  2CLY C;  1QUU A;  2D0U A;  4GK5 E;  4CI1 B;  4ZHQ E;  5JR9 C;  5JDL A;  3FXE B;  4WW0 A;  3CKD A;  5JDQ A;  5LBQ B;  2EHO C;  3HA4 A;  4QHO A;  5L2L A;  2IC9 A;  4AKL A;  4HGA A;  3AVS A;  2CXD A;  4AKH A;  2E9X A;  4L5G A;  4BA9 A;  3VKH A;  2VWA A;  3CVR A;  4Z8X A;  3AAI A;  1G8X A;  2W61 A;  3RYC E;  5HXS A;  4C91 A;  2WSS V;  2IAK A;  4PFO A;  4UEM A;  5JVD E;  5FXW A;  5HXC A;  2Q9Q B;  3BQL A;  3O9X A;  4QX8 B;  5JR9 A;  5CA0 E;  3ZC0 A;  3C4Z A;  4XZC A;  4CXW A;  3UTK A;  3TKL B;  4O4I E;  2ES0 A;  4IST A;  4IE4 A;  3VU7 H;  4CXX A;  5A1L A;  2LJL A;  3UUM A;  4ASK A;  3ESL A;  5HAX A;  3ZN0 B;  5LGU B;  2Y48 B;  4TV9 E;  5LJM A;  2DNX A;  3RH3 A;  4XBF B;  4BJM A;  3NRY A;  1D1A A;  3LJC A;  1H7C A;  4JLE A;  4K0U A;  3UT5 E;  2N9D A;  3CQX C;  3QUJ A;  2WM9 A;  3MKD A;  3ANW A;  3ETV A;  3D0T A;  5KMG P;  4E7Z A;  2PFV A;  2YU1 A;  3ZJ2 A;  3HI2 A;  2JQQ A;  3O1I A;  2PJQ A;  3WAK A;  4XAX B;  4AQF C;  3CX6 B;  1IJ5 A;  3ONX A;  2LT3 A;  2NW7 A;  2ACX A;  2X9W A;  2X51 A;  5HWY A;  3W15 B;  5JDM A;  2H3R A;  1WYC A;  1NWM X;  2NP9 A;  5JRC A;  3KBU A;  2LSG A;  2WBL A;  3T8O A;  4IE5 A;  1HFA A;  2ZM8 A;  3NRX A;  2QA7 A;  1ZKE A;  3NBX X;  3N9N A;  4PFP A;  3NZP A;  3NZQ A;  1CUN A;  2LEH A;  3PUS A;  5HXE A;  3C50 A;  3E0Z A;  5JRE A;  5C8Y E;  5LNK A;  2NW9 A;  2ZLY A;  3MXZ A;  1EZ3 A;  3BQI A;  2BVL A;  4PJL A;  2CWO A;  4GYR A;  4UIG A;  3HKE E;  4O4L E;  4YHJ A;  4DMW A;  3ZCJ A;  2ZM0 A;  4EYU A;  4ILU A;  5JDF A;  3UFE A;  4AQF A;  5JDG A;  2I59 A;  1IZN B;  4PK6 A;  3JC6 C;  3MK7 C;  5ETW A;  5FXX A;  3K3N A;  4AKG A;  1B7T A;  4QXB B;  5FXZ A;  3LG7 A;  1MMG A;  5J2T E;  3LK4 2;  3J9X 1;  1D0Y A;  1WLX A;  1D1B A;  2ODU A;  2CMR A;  3N2O A;  1HX8 A;  1MIY A;  3ZYK A;  2CCQ A;  1UCU A;  4IIJ E;  2V26 A;  3PUG A;  3CX7 B;  4ANJ A;  4PJJ A;  3LK2 B;  4DBQ A;  2XTL A;  2X0L B;  3CQC B;  4HKA A;  3ZC1 A;  4DBR A;  1UX5 A;  4OYK A;  4TUY E;  3MZK B;  4PW8 A;  4GIW A;  3C4W A;  1U5P A;  4HN9 A;  4AQG A;  4G2A A;  3A5X A;  4ZI2 C;  5J1G A;  2VB6 A;  4ERR A;  4H9O C;  4UEL A;  5LGN B;  3KVA A;  1BR0 A;  3S4U A;  3ZMZ B;  3LFM A;  2C0S A;  2KLQ A;  2E9X D;  4TV8 E;  2EHO B;  3CX8 B;  3ZCI A;  2E8I A;  4O2B E;  5FY0 A;  5LJN A;  3ZLI A;  4NUU A;  5EK3 A;  4ADZ A;  2JMK A;  3L09 A;  4H63 V;  3RYH E;  3KV5 A;  4IHJ E;  2MOZ A;  2X9H A;  4OHF A;  4H9P C;  2HPJ A;  4U74 A;  4TN7 B;  3KFW X;  2HPL A;  2YU2 A;  3Q2M A;  5LHI B;  1KK7 A;  3EDV A;  5EK4 A;  3VHL A;  1G73 A;  4JEH B;  1FIO A;  4ZS2 A;  1ZEE A;  2EHO D;  5DQV A;  3GMI A;  1IAP A;  2A72 A;  2SPC A;  4TX5 A;  2H7O A;  1ZHC A;  4I4T E;  2IC6 A;  5F8P A;  3AA0 B;  1YKE B;  4PK5 A;  3O1H A;  1LRZ A;  3PU8 A;  1HG5 A;  3KV9 A;  2LOP A;  2YEV C;  3PE0 A;  1BR4 A;  2XAJ B;  4MLK A;  2DHR A;  2CEA A;  2L8K A;  4UXN B;  5L3E B;  2V1D B;  5F3J A;  3ZEF B;  5HXH A;  1MMA A;  2JJ9 A;  1MIV A;  3O4X E;  4IE0 A;  4UF0 B;  3FXD B;  2PBI A;  4QXH B;  2X66 A;  4CQI A;  1NAF A;  2NW8 A;  2D2S A;  2DI4 A;  2XQY A;  3CQG B;  4GK0 E;  2D5U A;  2VK9 A;  3IF8 B;  3RRC A;  4KBM B;  4E7S A;  3K3Q C;  2XHE B;  4O8S A;  1MMN A;  5L3F B;  1D0Z A;  4FI5 A;  3SS1 A;  4H9N C;  3K8P C;  5GON E;  4TZ4 C;  4PAG A;  3R84 B;  4PJM A;  4H9S E;  2Z6E A;  4X1Y E;  2WAU A;  4M1P A;  4O4H E;  3H37 A;  4YLH A;  2WMO A;  4O4J E;  2JRK A;  2RP4 A;  2V7L A;  5LHG B;  3RYI E;  2CE7 A;  3N2K E;  3C64 A;  1SA0 E;  4OK0 A;  4UVA B;  2ZM2 A;  3LBX B;  4ZI3 C;  1YW0 A;  3KBT A;  3V5S A;  3OYZ A;  1BR2 A;  1X79 A;  4HEA A;  5LYJ E;  5CB4 E;  3UUN A;  4DVD A;  3I1A A;  1T98 A;  2PG8 A;  2X9X A;  3ZMU B;  4DND A;  2G0U A;  4MFR A;  1FMV A;  5JH7 E;  5L3C B;  4IDZ A;  2P9B A;  2W62 A;  4EOZ B;  1AJ3 A;  4GOU A;  4X20 E;  4EB6 E;  2A2F X;  1ZV4 X;  2DLR A;  2HH7 A;  2Q9Q C;  3RX6 A;  2ZMA A;  3KVB A;  2LSI A;  2DWG A;  3AA1 B;  3ZMV B;  1KNZ A;  3DP7 A;  3EVY A;  2BVM A;  1D1C A;  3PDY A;  4DO0 A;  3N9P A;  3E08 A;  3DJB A;  3AAA B;  1LVF A;  4P09 A;  5E0O A;  4WBO A;  3RRW A;  2KZ7 B;  2XAQ B;  5LGT B;  2LSK A;  1U4Q A;  3CPZ A;  5LBM A;  2BZB A;  2XAS B;  3MA9 A;  1SHZ C;  1HTJ F;  5AFU L;  1BR1 A;  3I9W A;  5IHY A;  2UXX B;  3I0Q A;  1WRD A;  3V5U A;  3ZMT B;  3PUQ A;  2L9Q A;  2W63 A;  3QK6 A;  4UF0 A;  4AKR B;  2RA1 A;  4N78 D;  2L3L A;  2MTQ A;  2JMH A;  2Q9Q A;  2E9X B;  4IE6 A;  3ZN1 B;  1US7 B;  4AKI A;  5HWX A;  4WNK A;  4EIW A;  5ADX L;  3RYF E;  5TAO A;  3VKG A;  1D0X A;  2CLY B;  3FBL A;  2KXP B;  4QKN A;  4ZI2 D;  2D0T A;  2C5I T;  4L9I A;  3N5L A;  4EXT A;  1QSD A;  2GK9 A;  5JR9 B;  4BAY B;  4YJ2 E;  2V7J A;  5L3B B;  2N2N A;  3GA8 A;  2DCF A;  2CXL A;  2LHN A;  2V7K A;  1VRB A;  3HL6 A;  4HFV A;  4L0R A;  4H63 H;  3PTR B;  5LCY A;  3RC8 A;  3QC9 A;  3OYX A;  3P8C D;  5FNV E;  3KDS E;  4IGU A;  3RPU A;  4CI2 B;  3I9Y A;  4UV9 B;  2XAG B;  3C51 A;  4BJN A;  3N9M A;  3ETU A;  3N9L A;  3M65 A;  4G63 A;  3N9O A;  3KV6 A;  3AB3 B;  4EYY R;  1OXZ A;  2NOX A;  5DAB A;  1YD8 G;  5JQG E;  3RKO A;  5KX5 E;  5JDN A;  2MYS A;  5LXT E;  3EUH A;  3EDU A;  3K3O A;  4X1I E;  3SRZ A;  3SWH A;  3ZYM A;  2W0G A;  2DWK A;  3AVR A;  3BQK A;  2UXN B;  4P0A A;  3ZPO A;  5M4Y A;  3ZJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...