4TN7B

Crystal structure of mouse kdm2a-h3k36me-no complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4tn7B00
4QX7B 4QXCB 4TN7B 4QXBB 4QWNB 4QX8B 4QXHB
chains in the Genus database with same CATH superfamily
4ZEYA 3TLUA 3LBXB 2IUBA 4HTEA 2V7IA 5CGMA 5FVLA 2A3DA 5LMUT 2CBIA 2QA7A 4LF8T 3PU3A 4IREA 4DR2T 2A9UA 5LGTB 4UIGA 2WU5A 1US7B 3RC8A 2E5LT 1D0YA 4KMCA 1MNEA 4KHZF 3AA6B 3T8OA 3I0OA 4U7YA 3TLSA 1FIOA 4LF9T 3AEFA 3ZYLA 4AXPA 4DV1T 2LHRA 5LOVE 1XMQT 4OX9T 2XJ7A 1MMNA 3AA1B 4AQYT 3HI2A 2XQ5A 2XQ6A 1DU2A 2J47A 4U3CA 3R84B 2I6HA 2WBLA 1HTJF 1Z8UA 5ABHA 3P4WA 5CA0E 3RYFE 2Q9QB 3ZMZB 5DJQC 5AQLB 5LHIB 3RIUC 2DHRA 4I55E 4AKGA 5L3CB 3QB5K 4MFRA 2NP9A 1BR1A 3ANWA 2AE9A 1HCIA 3CQGB 5IWAT 2HH7A 3RKOA 4NXMT 1E7PA 2LJLA 2WQYA 2SPCA 2BS2A 3ZN1B 3P4RA 4GIWA 2LRKA 3RIAA 3HL6A 4LF7T 3KINB 3A5XA 3PDYA 5FMNA 3P4QA 4NPPA 4PK4A 4JBWF 5L4HA 5LG3A 3L09A 3OKQA 2XM2A 5J2UE 3I9YA 4PK5A 3AB3B 3CQCB 5HEJA 3QB5A 3IA3A 3C64A 3FXEB 2J4GA 2HN1A 5ABFA 4DR5T 5ABEA 2WM9A 2BDEA 3UUNA 5HXCA 4CXWA 3C98B 3AEBA 3E0ZA 1IBMT 1OWAA 3LK3B 2F4VT 4UF0A 2D2SA 4G2AA 5C8YE 2IHR1 1H7CA 3UU3A 4O4IE 2BG9E 2Y48B 2X9HA 4UR9A 4TV9E 5JRCA 5F5WA 4DR3T 2MBGA 2GK9A 4JI5T 4NUVA 2LSIA 3UU5A 4FJOA 3GWHA 4UV8B 2C5JA 1WRDA 3RPUA 1UK5A 2BBJA 4HWIB 1LRZA 4JYAT 3O9XA 1I6ZA 3AE9A 1J5ET 3PJAJ 5TAOA 3ZCIA 2BG9A 4K0KT 3C51A 4TUYE 5DQWA 1T98A 2VL8A 3NKZA 5LBMA 4X62T 3ZJ2A 2RA1A 3LDQB 3QK6A 4COFA 4EXTA 1VCTA 5AQPB 1WYCA 4OHFA 4DIDB 3PTRB 2DNXA 3FZFB 5DQVA 4GKKT 4YSYA 2WWVA 3Q5XA 1ZKEA 2W66A 4TWFA 5LA6E 2DI4A 2EHOA 5JR9B 5L4EA 4A56A 4BJNA 4ZI3C 4AI6A 3EUHA 4YTMA 4CXYA 4O8SA 2HN2A 2C5IT 3ZC0A 2I0MA 5L3FB 2CWYA 1NENA 4U31A 3ZLIA 2VQFT 2V6YB 3E08A 2ODUA 5FL1A 1MIWA 1UCUA 2H88A 3FHNA 3PUAA 1KNZA 5LXTE 2H3RA 2W63A 3ZCJA 4DV7T 2KMFA 4HGAA 4LMJA 4HFIA 4B6XA 5JDNA 4WBNE 5M4YA 3Q2MA 3SFEA 5LHGB 1MMDA 4EZ4A 4YJ2E 3RF1A 1Y64B 5EZYE 2OA5A 2I59A 4JEUB 5LB7B 2WB5A 2UUBT 5KMGP 2DWGA 5E0OA 2VKHA 4PNIA 5AQMB 3DJBA 3H3MA 3ESLA 2LM2A 2B1EA 4YY3T 3MA9A 1HF8A 2JPFA 2NOXA 1BR4A 5AQSB 3I1AA 3AE3A 3MKDA 4IDZA 4O4JE 4IL4A 5FXWA 1OEDC 3EAMA 2XSBA 3F2EA 3PE0A 1YXRA 2X51A 4HFHA 4XBFB 1WLXA 4I0UA 5DABA 3KDSE 1HNWT 4GK5E 4J2CA 3PUZF 4JI2T 2LSGA 2V5DA 4IE4A 5JDHA 5AFUL 5AQFB 2VVNA 3CIRA 5FL0A 2BKPA 3F57A 3SRZA 2D0UA 5J0ZA 2KWIB 4AKHA 4CI2B 3RYCE 4A97A 3V5UA 4CN4A 4QXCB 2VL0A 4MHCA 4LFBT 2DWKA 2WCAA 4BA9A 1HX1B 2EHOD 2XQYA 3EDVA 4IE6A 1WR0A 2UUAT 2WAUA 2BBHA 3KV6A 1X9BA 3N9QA 2XQ7A 3IEEA 2V7LA 3FXDB 4DV5T 2JQHA 2CXDA 2E5VA 1XDPA 4UV9B 3ZSSA 3K3NA 3QOFA 1I94T 4DR6T 2LLYA 4H9RC 2JJ9A 3HR0A 2CHOA 2WU2A 4B3RT 2ZM8A 4Z90A 1B7TA 3AE1A 4JUYA 1YD8G 3BQIA 3LFMA 3PURA 2KT9A 3LBXA 3PU8A 5AQJB 4BAYB 4ZI2D 2XQ8A 5AQKB 2N2NA 2VKOA 4L9IA 2LHNA 2WS3A 5JREA 1T8BA 5KXJA 5L3GB 4QWNB 2OLTA 4OYKA 1XDOA 2X68A 3AE5A 5ETWA 1U5PA 2XM1A 3RGLA 2MTQA 3ETUA 2LSJA 3UU6A 2YINA 4IIJE 2WWUA 3RI5A 2K48A 2M6IA 1QUUA 4PJLA 4ADZA 3L39A 4H9SE 4HFDA 4HE8A 4DO0A 1HR0T 3HKCE 2DCFA 5HEUA 2WZHA 4AQGA 4EYYR 3U3IA 2Q9QA 4OYJA 4E7ZA 1ZP0A 2JMKA 4HFEA 3JCFA 1SUMB 2CWOA 3RYHE 4DVDA 1W9RA 4QKNA 3MXZA 2CLYC 2PFVA 2L8KA 1JNRA 5JDGA 2VURA 2W67A 3NRYA 3WAKA 5HWYA 3N9MA 1HG5A 4IE7A 4EEBA 3T1HT 3EHZA 4DBRA 2FBWA 2XAHB 4HWCA 5J2TE 4M1PA 4PJJA 4LF4T 4A5XA 5HEHA 3UUMA 4YT0A 4QH4A 3LG7A 3AEAA 2J1DG 2WZIA 1IZNB 1SHZC 2G0UA 2UU9T 1HNZT 1T72A 3UFGA 3CMLA 1LKXA 3OBVE 3A8YC 3C4WA 4HWHA 2BG9C 4YXDA 3ZT6A 2XAGB 1NWMX 2BS3A 3UTKA 1NAFA 1OEDB 2VASA 3UQ7A 4WZXA 1N33T 4K0UA 3AE7A 2CPTA 2WDQA 1AJ3A 1QSDA 2FJBA 2VVSA 1MMAA 2XSAA 3OYZA 1IJ6A 5ABGA 1HS7A 1JNZA 4LFCT 5GONE 3ZMVB 4WNKA 2E9XC 2W61A 1UX5A 4JV5T 2X66A 3CX7B 3EI0A 3H37A 4GKJT 5FVKA 2EHOC 5FY1A 4ISTA 3N2KE 1XNQT 3PUGA 4U72A 3O1HA 3I9WA 5EK2A 4U2YA 3HKEE 4X64T 1BR2A 5H6RB 5CB4E 5HXEA 3EDUA 3CWZB 3CX6B 2Q9QD 3JC6D 3RHWA 4ILCA 3ZYKA 3MJXA 4X1IE 4X1YE 4CI3B 4EYUA 1ZV4X 3PUWF 4DMWA 2CXLA 3A7MA 4X66T 4H63H 1HX8A 3HA4A 2UXNB 4HFBA 1Y01A 5LP6E 4XZCA 4PJNA 3K8PC 4C90A 3I0QA 4YFSA 4OFZA 4KI0F 5JDQA 3NWIA 2A2FX 2WDVA 5JR9A 4EB6E 3C4ZA 3JAFA 3KV5A 3PV0F 5HEOA 4DR4T 4ILUA 3RQUA 3N9LA 3N9OA 3TLWA 4MLKA 4L0RA 3FZLB 5CFBA 4CXXA 2JQKA 5FYMA 2V6YA 1LVKA 2YDRA 4XAXB 3JAEA 3DP7A 1N32T 4HN9A 3BQLA 2H89A 2KWHA 3GN5B 5AQIB 3GMIA 4OK0A 3ZMSB 1YQ4A 2YDQA 1WFDA 2X9XA 3RQWA 2RPAA 4PJMA 2WY2A 4JI1T 1EZ3A 3J7Yq 4H9PC 4ZS2A 3VRBA 3LJCA 3T1YT 2UXXB 3AE6A 1XWMA 4JI4T 1MIYA 1SE7A 3QNUA 3ZSTA 4TZ4C 1VRBA 2CBJA 3M65A 2CLYB 2K5BB 1E1HB 1UX4A 3LSVA 4YLHA 1ZOYA 4EGWA 4HKAA 3FB2A 3WAJA 2CCQA 2RP4A 4IT4A 4L5GA 2WMNA 3TLTA 4JI8T 5JRCB 1KF6A 2KXPB 4I43B 4X5TA 5KX5E 2L3LA 2B76A 2N1GA 4P09A 3D0TA 2QVAA 1ZHCA 3ABVA 4AKRB 1KEYA 4ANJA 2PBIA 3O4XE 3NRXA 2FJEA 4KHPT 4IDOA 3ZMUB 2XY8B 3L3PA 2C5KT 2KZ7B 4ERRA 4ZXLA 4YJ3E 1N36T 1UURA 2E9XB 3IF8B 1VCSA 2XPKA 1HG2A 4EOZB 3W15B 2UXCT 3UT5E 4TNWA 5JVDE 4JI3T 4QXBB 5L2LA 3VRAA 2VWAA 4GYSA 4MALA 5L3BB 4X1KE 3UUBA 2X67A 3VKGA 3MACA 1W0AA 1J5WA 4PFOA 2W62A 2WDRA 1WCRA 3IBPA 4IGUA 4JI6T 3SWHA 2Y6XA 3AXJB 5F3JA 3KFWX 2X0LB 5FP3A 4U74A 4O2AE 4B3ST 2IIUA 4FI5A 5JH7E 5FY0A 3F31A 4O4LE 2NW8A 3Q9DA 3AEDA 2V5CA 3C50A 2ACXA 1BR0A 2KINB 4F6RC 3UUXB 2LOPA 2XAQB 2QYWA 1S35A 1T7SA 1FMVA 5CJ5A 4LFAT 4U7IA 1ZEEA 3WI3A 2H7OA 2VQET 2MOZA 4ILBA 4HWDA 4YSXA 3SOLA 4CN6A 5J1GA 1D1CA 2CEAA 5HCMA 4JI7T 3JADA 4H63V 2YKSA 2CA5A 2IDOB 3NVOA 5JDMA 4ZOLE 3AAAB 3K1SA 3ZC1A 3EABA 3VR9A 3AECA 4EV6A 2JIWA 4IL9A 1YKEB 3MK7C 2XAJB 4Z8XA 3RRCA 4F8HA 3RKGA 4TNVA 2VB6A 2BKOA 4DV2T 3UQ4A 2V1DB 3AAEB 2MYSA 3K3OA 4KUMB 2LSKA 2VKDA 2BZBA 4GYRA 4TN7B 5AQHB 3KVBA 4JLEA 3SFDA 3QC9A 1VOMA 2M67A 3RYIE 3PUVF 2R6GF 2QRXA 4ZI7E 3RC3A 3OTOT 4C91A 2YN6A 1D1AA 4TWHA 1UUSA 3Q5DA 4I50E 3BQKA 3PUSA 1X79A 2DL1A 3RX6A 4YTNA 3AA7B 4V1Av 2V7KA 1NEKA 2ZM6T 4P0AA 1CHUA 3ZT5A 4LF6T 1W09A 1QLBA 5JR9C 4PW8A 5HCJA 3HKBE 2CHNA 4ZZBA 4UVCB 3VHLA 5KDMC 5HAXA 2OV9A 3B5MA 4YHHT 5FXXA 3UU8A 1FJGT 4ZI3D 5LGUB 5HWXA 4DNDA 3NZQA 2VK9A 4JEHB 5L47A 3RIFA 5LMNT 2BKNA 3Q5WA 4O4HE 1D1BA 2LT3A 4AISA 2FUPA 3OJAA 2YU2A 2YK0A 4TWDA 4EAHA 1XZYA 4QX7B 5FKYA 3ZJ1A 2FJDA 5HEGA 5HXSA 2Y8DA 1IAPA 2ODVA 3ZEFB 3KV9A 2FJAA 3ETVA 3LK2B 2LKHA 1W0BA 4H9OC 4IE0A 2K3WA 2HPLA 3AE4A 3NZPA 5C3JA 4U33A 3KVAA 1KNPA 1FMWA 4X65T 2PJQA 2IC6A 4IDPA 3GA8A 3P4PA 5EK3A 2JRKA 3TKLB 3UULA 3V5SA 3GN5A 2W0GA 5HXRA 1M62A 2LE8A 3O1JA 1E2AA 4AQFA 3U78A 5CA1E 1WR6A 2D0TA 4UVAB 4KP3C 1G8XA 2QGSA 3C4XA 2MPKA 3RLFF 3PUYF 3AA0B 2NTYA 1N34T 5F8PA 4ZI2C 1KK7A 4KX6A 2LSYA 3ONJA 4CZZB 2E8IA 3N5LA 5IYZE 1CUNA 3ZKRA 3ZN0B 4G63A 3N9NA 4LMKA 4EZHA 3AAIA 4NXNT 5FXZA 3N9PA 4Z91A 5JQGE 4DV6T 5FXVA 3VU7H 5LYJE 3FBLA 3ANWB 5C2TA 2W4XA 3CX8B 4JI0T 3PJAA 5FNVE 3ONLC 2KSRA 5EK4A 4HWFA 1XMOT 2LOSA 1J1JA 3MZKB 3P8CD 4PK6A 2M6BA 3AE2A 2XTLA 1R8IA 4GK0E 3HKDE 3NBXX 5LG4A 4DR7T 2VKJA 5JTGA 5BR8T 5AQGB 2V8SV 4WYVA 5ABFB 3RIUA 2NW7A 3DTOA 3AE8A 2XAFB 1M7KA 2LKGA 1SA0E 2E9XA 2X9YA 2CM0A 1D0ZA 2J62A 4UF0B 2IC9A 4NIQA 4EIWA 1YQ3A 2Z6EA 1FEWA 1XNRT 3AEEA 2UXBT 4P0BA 2XHEB 2V7MA 4U2ZA 4ASKA 1O3XA 2PTFA 5AQQB 3N2GE 2E2AA 3P50A 1KFYA 4X20E 2YDSA 4DUZT 2XQ4A 3TLVA 3ZMTB 1MNDA 4DV0T 2MAWA 4DBQA 5HYAA 4O2BE 3VR8A 4YSZA 3UU4A 3PUXF 4IE5A 3QUJA 3LK42 3AXJA 1G73A 4UVBB 2KNDA 1GQEA 4QH1A 5L3EB 2BG9B 4PFPA 2XQ3A 2D9DA 3AVRA 2ZMAA 5H6QB 3L8RA 2V26A 3M3ZB 2BS4A 2C0SA 4IHJE 4DV3T 3J9X1 2K24A 4I4TE 2XASB 1Z0PA 2W00A 2WMOA 4AKIA 3CK6A 5LCYA 3EVYA 4HFCA 2N9DA 4H9NC 4DMVA 3KBUA 5LJMA 4DV4T 4QH5A 3UFEA 3SS1A 1KNRA 1MIVA 4ZS3A 4LF5T 2A72A 2BVLA 2YOEA 1U4QA 4B3MT 4QXHB 3S4UA 2EHOB 2K9AA 2H7VC 3H3AA 4CQIA 4TX5A 4QHOA 4PAGA 2ES0A 3CKDA 3B57A 2XUEA 2KLQA 4IDQA 4WBOA 5AQNB 3VKHA 2JQ9A 5L3DB 2Q9QC 2WSSV 1S94A 2ZM2A 3JC6C 2CRBA 2JQQA 4HEAA 4UXNB 2NW9A 1UGOA 3KBTA 4N78D 4GOUA 4A98A 2NWBA 1D0XA 2LEHA 3ONXA 4EEDA 3P4SA 1WYBA 4QX8B 2V6XA 4LMLA 3AEGA 2PG8A 3FZKB 5IHYA 2LRLA 3AVSA 3RRWA 3ZYMA 2E9XD 4B3TT 2X9WA 3K3QC 3R6NA 4ILAA 3CQXC 3PUQA 1MMGA 2YEVC 4CN1A 1HNXT 2ZM0A 5AQVB 3FZMB 3N2OA 2AXDS 2CMRA 3OVUA 1IBLT 5HXHA 3OYXA 4H9QC 2XQAA 4UELA 1HFAA 5AQTB 3E22E 4P1NA 2CXFA 2HPJA 4TV8E 3FZHB 4MBQA 3FBZA 4WW0A 1IBKT 4AKLA 4ZZCA 5JDLA 2D5UA 5IUXA 3KV4A 3G06A 2DLRA 4CI1B 4DR1T 3RH3A 2CE7A 4ISSA 3O1IA 3BK9A 1OEDE 2V7JA 3IHRA 2XQ9A 4AIUA 5LNKA 5AQOB 2NTXA 1YW0A 2IMLA 2XZEA 1L0VA 4YHJA 2LM9A 1IJ5A 2IAKA 5AQRB 2X0HA 3B13A 5FY7A 4HFVA 3Q5EA 4ZHQE 5ADXL 1LVFA 2IW5B 4YTPA 2ZLYA 2UUCT 1OEDA 2UXDT 2JMHA 4IDNA 2L9QA 5JDFA 4NUUA 2NR4A 2HHHT 2W2UA 5LHHB 4KBMB 2P9BA 4DUYT 4BJMA 2YU1A 5LBQB 4AQFC 2BVMA 2ACZA 2WP9A 4UEMA 2X0YA 3P7IA 5AQUB 1OXZA 5LGNB 1V9DA 3CVRA 5LJNA 5BMVE 4E7SA 3OPCA 3ZT7A 3ZPOA 3X1DA 3CPZA 1YKHB 5A1LA 4Q25A
chains in the Genus database with same CATH topology
5CA1E 1WR6A 2D0TA 4UVAB 4KP3C 1G8XA 2WAUA 3LBXB 2QGSA 3KV6A 3C4XA 3N9QA 4HTEA 2V7IA 3IEEA 2V7LA 2A3DA 3FXDB 4L5GA 2WMNA 5JRCB 2QA7A 2CXDA 4I43B 2KXPB 3AA0B 2NTYA 5F8PA 4ZI2C 4UV9B 1KK7A 3PU3A 5KX5E 5LGTB 4UIGA 2LSYA 4CZZB 1US7B 2E8IA 3N5LA 3RC8A 2L3LA 5IYZE 2N1GA 1CUNA 3K3NA 4P09A 3D0TA 3ZN0B 1ZHCA 4G63A 3N9NA 4AQFA 4EZHA 1D0YA 3AAIA 4KMCA 1MNEA 3AA6B 3T8OA 5FXZA 3I0OA 3N9PA 4H9RC 1FIOA 2JJ9A 3HR0A 4AKRB 2ZM8A 5JQGE 3ZYLA 4ANJA 4AXPA 1B7TA 2PBIA 3O4XE 2LHRA 4JUYA 3NRXA 1YD8G 3BQIA 3LFMA 5FXVA 3VU7H 3PURA 5LOVE 5LYJE 3FBLA 2KT9A 3LBXA 3PU8A 1MMNA 3AA1B 3ZMUB 3ANWB 3HI2A 3L3PA 3CX8B 4BAYB 4ZI2D 2C5KT 2KZ7B 5FNVE 4ERRA 3R84B 5EK4A 2WBLA 2N2NA 2VKOA 4L9IA 2LOSA 1HTJF 4YJ3E 2LHNA 5JREA 2E9XB 3IF8B 3MZKB 5L3GB 5CA0E 1HG2A 4QWNB 3RYFE 4EOZB 4OYKA 3W15B 3UT5E 2Q9QB 3P8CD 2X68A 4PK6A 5ETWA 3ZMZB 1U5PA 5DJQC 5JVDE 5LHIB 2MTQA 3ETUA 2LSJA 2YINA 4IIJE 2XTLA 4QXBB 2DHRA 5L2LA 2VWAA 2WWUA 4GK0E 4I55E 4AKGA 5L3CB 3HKDE 3NBXX 4GYSA 4MALA 2K48A 5L3BB 4MFRA 4X1KE 1QUUA 4PJLA 2NP9A 1BR1A 3ANWA 5LG4A 4ADZA 2VKJA 2X67A 1HCIA 3VKGA 3CQGB 3MACA 2HH7A 4H9SE 3RKOA 2LJLA 2NW7A 3DTOA 4PFOA 4HE8A 2W62A 2SPCA 3ZN1B 4DO0A 3IBPA 4IGUA 2XAFB 3HKCE 2DCFA 4GIWA 3SWHA 3HL6A 2Y6XA 4AQGA 1SA0E 3A5XA 3KINB 5F3JA 2E9XA 2X9YA 3KFWX 2X0LB 4EYYR 5FP3A 2CM0A 4U74A 3PDYA 4O2AE 1D0ZA 3U3IA 4UF0B 2IC9A 2Q9QA 5FMNA 4OYJA 4E7ZA 4FI5A 4EIWA 2Z6EA 5JH7E 5FY0A 1FEWA 2JMKA 3F31A 4O4LE 2NW8A 3Q9DA 2CWOA 4P0BA 3C50A 2XHEB 3RYHE 4DVDA 2ACXA 4PK4A 4QKNA 3MXZA 2CLYC 2KINB 4F6RC 1BR0A 2V7MA 3UUXB 2LOPA 2PFVA 4ASKA 2XAQB 1O3XA 3L09A 3N2GE 3OKQA 2L8KA 5J2UE 3I9YA 4X20E 4PK5A 3AB3B 1S35A 3CQCB 3ZMTB 5JDGA 1MNDA 3C64A 1FMVA 3FXEB 3NRYA 3WAKA 4DBQA 5HYAA 4O2BE 5HWYA 3N9MA 2WM9A 2BDEA 1HG5A 1ZEEA 4IE7A 3UUNA 4IE5A 3WI3A 3QUJA 3LK42 2H7OA 4DBRA 2XAHB 5HXCA 4CXWA 2MOZA 5J2TE 3C98B 1G73A 4UVBB 3E0ZA 4M1PA 4PJJA 2KNDA 1OWAA 3UUMA 3LK3B 5L3EB 4UF0A 4PFPA 2D2SA 3AVRA 2ZMAA 3LG7A 4G2AA 5H6QB 2J1DG 1IZNB 2V26A 3SOLA 1SHZC 5J1GA 2G0UA 5C8YE 2C0SA 1D1CA 2CEAA 1H7CA 4IHJE 4H63V 3CMLA 2K24A 4O4IE 2CA5A 3J9X1 2Y48B 2X9HA 4I4TE 1LKXA 2XASB 1Z0PA 5JDMA 2W00A 2WMOA 3OBVE 4AKIA 4TV9E 4ZOLE 5JRCA 3AAAB 5LCYA 3C4WA 2MBGA 3ZC1A 2GK9A 3EVYA 2N9DA 4NUVA 4H9NC 2XAGB 2LSIA 4FJOA 3GWHA 4UV8B 1NWMX 4DMVA 2C5JA 1WRDA 3KBUA 5LJMA 3UTKA 1NAFA 3RPUA 1LRZA 3UFEA 1YKEB 3O9XA 3SS1A 3MK7C 2XAJB 2VASA 1MIVA 4Z8XA 2A72A 4ZS3A 3RRCA 2BVLA 2VB6A 1U4QA 4QXHB 5TAOA 3S4UA 3ZCIA 2EHOB 4K0UA 2K9AA 3C51A 2H7VC 3H3AA 4TUYE 1AJ3A 4CQIA 5DQWA 2V1DB 1T98A 3AAEB 2MYSA 4TX5A 1QSDA 2VL8A 3K3OA 4QHOA 4KUMB 4PAGA 5LBMA 2ES0A 3CKDA 1MMAA 3OYZA 2LSKA 3ZJ2A 2VKDA 2RA1A 1IJ6A 3QK6A 3B57A 2BZBA 2XUEA 1HS7A 2KLQA 4EXTA 4GYRA 5GONE 3ZMVB 4TN7B 4WBOA 4WNKA 2E9XC 2W61A 1UX5A 1WYCA 2X66A 3VKHA 3CX7B 4OHFA 5L3DB 3KVBA 2Q9QC 2WSSV 1S94A 2ZM2A 3JC6C 4JLEA 3H37A 2JQQA 3QC9A 4HEAA 1VOMA 4UXNB 2NW9A 2M67A 3PTRB 2DNXA 3RYIE 2EHOC 3KBTA 5FY1A 4N78D 5DQVA 4GOUA 4ISTA 3N2KE 4ZI7E 2NWBA 1D0XA 3PUGA 2LEHA 4U72A 3Q5XA 3O1HA 3RC3A 3ONXA 4C91A 1ZKEA 1D1AA 1WYBA 4QX8B 5LA6E 2DI4A 2EHOA 5JR9B 4I50E 3BQKA 3I9WA 3PUSA 2PG8A 4A56A 5EK2A 5IHYA 3HKEE 3AVSA 3RRWA 1X79A 3ZYMA 1BR2A 3RX6A 5H6RB 4BJNA 4ZI3C 2E9XD 5CB4E 4AI6A 3EUHA 3AA7B 3EDUA 5HXEA 3CWZB 4V1Av 3CX6B 2V7KA 4CXYA 2Q9QD 2X9WA 3JC6D 3K3QC 3R6NA 4O8SA 3ZYKA 3MJXA 2C5IT 3ZC0A 4X1IE 4X1YE 3CQXC 4CI3B 3PUQA 1MMGA 2YEVC 4EYUA 5L3FB 1ZV4X 4P0AA 4DMWA 2CWYA 2CXLA 3ZLIA 2ZM0A 3E08A 5JR9C 2ODUA 4PW8A 4H63H 1MIWA 1UCUA 3HKBE 1HX8A 3HA4A 3N2OA 3FHNA 3PUAA 1KNZA 2UXNB 2CMRA 4UVCB 5LP6E 4XZCA 4PJNA 5LXTE 3K8PC 3VHLA 4C90A 5KDMC 5HAXA 3I0QA 5HXHA 2H3RA 3OYXA 4YFSA 4H9QC 4OFZA 5JDQA 4UELA 2W63A 3ZCJA 1HFAA 2A2FX 5FXXA 5JR9A 4EB6E 4ZI3D 2KMFA 3E22E 4HGAA 3C4ZA 3KV5A 5LGUB 5HWXA 4DNDA 3NZQA 4ILUA 4B6XA 2VK9A 3N9LA 4JEHB 3N9OA 4WBNE 5JDNA 5M4YA 3Q2MA 2CXFA 2HPJA 4TV8E 4MBQA 4MLKA 5LHGB 1MMDA 3FBZA 4L0RA 3Q5WA 4WW0A 4EZ4A 4YJ2E 4AKLA 5JDLA 2D5UA 4O4HE 1Y64B 4CXXA 1D1BA 5EZYE 2OA5A 2LT3A 5FYMA 2I59A 3KV4A 2DLRA 3OJAA 4JEUB 4CI1B 3RH3A 2YU2A 2YK0A 2CE7A 1LVKA 5KMGP 2DWGA 4ISSA 5E0OA 4EAHA 2VKHA 4PNIA 3DJBA 4XAXB 3ESLA 4QX7B 3O1IA 2B1EA 3DP7A 3MA9A 3BK9A 3ZJ1A 3U78A 2V7JA 3IHRA 4HN9A 1HF8A 2JPFA 2NOXA 5HXSA 3BQLA 2Y8DA 1BR4A 1IAPA 5LNKA 2ODVA 3ZEFB 2NTXA 1YW0A 2KWHA 3KV9A 3I1AA 3GN5B 3ETVA 3MKDA 4IDZA 4O4JE 3GMIA 4OK0A 3ZMSB 3LK2B 4YHJA 4H9OC 4IE0A 2LM9A 5FXWA 1IJ5A 3F2EA 2HPLA 2IAKA 2X9XA 3PE0A 3B13A 4PJMA 5FY7A 2X51A 4HFVA 4XBFB 3NZPA 1WLXA 5DABA 4ZHQE 5ADXL 1EZ3A 1LVFA 3KDSE 2IW5B 3J7Yq 4H9PC 4ZS2A 4GK5E 3LJCA 4J2CA 2UXXB 2LSGA 2ZLYA 4IE4A 2JMHA 1MIYA 5JDHA 5AFUL 2L9QA 3KVAA 4NUUA 1VRBA 4TZ4C 5JDFA 1FMWA 5LHHB 3M65A 2CLYB 2K5BB 2PJQA 2IC6A 4KBMB 2P9BA 3F57A 1E1HB 3SRZA 2D0UA 2KWIB 1UX4A 2YU1A 4YLHA 5LBQB 4BJMA 4AQFC 4AKHA 2BVMA 4CI2B 3GA8A 3RYCE 3TKLB 5EK3A 2JRKA 3UULA 3V5SA 3GN5A 4HKAA 2W0GA 3V5UA 4UEMA 3P7IA 4QXCB 1OXZA 5HXRA 5LGNB 1V9DA 3CVRA 4MHCA 5LJNA 5BMVE 4E7SA 2DWKA 4BA9A 2LE8A 3O1JA 3ZPOA 3FB2A 3CPZA 1YKHB 3WAJA 2EHOD 2XQYA 5A1LA 2CCQA 2RP4A 3EDVA 4IE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QX7 B;  4QXC B;  4TN7 B;  4QXB B;  4QWN B;  4QX8 B;  4QXH B; 
#chains in the Genus database with same CATH topology
 4ZEY A;  3TLU A;  3LBX B;  2IUB A;  4HTE A;  2V7I A;  5CGM A;  5FVL A;  2A3D A;  5LMU T;  2CBI A;  2QA7 A;  4LF8 T;  3PU3 A;  4IRE A;  4DR2 T;  2A9U A;  5LGT B;  4UIG A;  2WU5 A;  1US7 B;  3RC8 A;  2E5L T;  1D0Y A;  4KMC A;  1MNE A;  4KHZ F;  3AA6 B;  3T8O A;  3I0O A;  4U7Y A;  3TLS A;  1FIO A;  4LF9 T;  3AEF A;  3ZYL A;  4AXP A;  4DV1 T;  2LHR A;  5LOV E;  1XMQ T;  4OX9 T;  2XJ7 A;  1MMN A;  3AA1 B;  4AQY T;  3HI2 A;  2XQ5 A;  2XQ6 A;  1DU2 A;  2J47 A;  4U3C A;  3R84 B;  2I6H A;  2WBL A;  1HTJ F;  1Z8U A;  5ABH A;  3P4W A;  5CA0 E;  3RYF E;  2Q9Q B;  3ZMZ B;  5DJQ C;  5AQL B;  5LHI B;  3RIU C;  2DHR A;  4I55 E;  4AKG A;  5L3C B;  3QB5 K;  4MFR A;  2NP9 A;  1BR1 A;  3ANW A;  2AE9 A;  1HCI A;  3CQG B;  5IWA T;  2HH7 A;  3RKO A;  4NXM T;  1E7P A;  2LJL A;  2WQY A;  2SPC A;  2BS2 A;  3ZN1 B;  3P4R A;  4GIW A;  2LRK A;  3RIA A;  3HL6 A;  4LF7 T;  3KIN B;  3A5X A;  3PDY A;  5FMN A;  3P4Q A;  4NPP A;  4PK4 A;  4JBW F;  5L4H A;  5LG3 A;  3L09 A;  3OKQ A;  2XM2 A;  5J2U E;  3I9Y A;  4PK5 A;  3AB3 B;  3CQC B;  5HEJ A;  3QB5 A;  3IA3 A;  3C64 A;  3FXE B;  2J4G A;  2HN1 A;  5ABF A;  4DR5 T;  5ABE A;  2WM9 A;  2BDE A;  3UUN A;  5HXC A;  4CXW A;  3C98 B;  3AEB A;  3E0Z A;  1IBM T;  1OWA A;  3LK3 B;  2F4V T;  4UF0 A;  2D2S A;  4G2A A;  5C8Y E;  2IHR 1;  1H7C A;  3UU3 A;  4O4I E;  2BG9 E;  2Y48 B;  2X9H A;  4UR9 A;  4TV9 E;  5JRC A;  5F5W A;  4DR3 T;  2MBG A;  2GK9 A;  4JI5 T;  4NUV A;  2LSI A;  3UU5 A;  4FJO A;  3GWH A;  4UV8 B;  2C5J A;  1WRD A;  3RPU A;  1UK5 A;  2BBJ A;  4HWI B;  1LRZ A;  4JYA T;  3O9X A;  1I6Z A;  3AE9 A;  1J5E T;  3PJA J;  5TAO A;  3ZCI A;  2BG9 A;  4K0K T;  3C51 A;  4TUY E;  5DQW A;  1T98 A;  2VL8 A;  3NKZ A;  5LBM A;  4X62 T;  3ZJ2 A;  2RA1 A;  3LDQ B;  3QK6 A;  4COF A;  4EXT A;  1VCT A;  5AQP B;  1WYC A;  4OHF A;  4DID B;  3PTR B;  2DNX A;  3FZF B;  5DQV A;  4GKK T;  4YSY A;  2WWV A;  3Q5X A;  1ZKE A;  2W66 A;  4TWF A;  5LA6 E;  2DI4 A;  2EHO A;  5JR9 B;  5L4E A;  4A56 A;  4BJN A;  4ZI3 C;  4AI6 A;  3EUH A;  4YTM A;  4CXY A;  4O8S A;  2HN2 A;  2C5I T;  3ZC0 A;  2I0M A;  5L3F B;  2CWY A;  1NEN A;  4U31 A;  3ZLI A;  2VQF T;  2V6Y B;  3E08 A;  2ODU A;  5FL1 A;  1MIW A;  1UCU A;  2H88 A;  3FHN A;  3PUA A;  1KNZ A;  5LXT E;  2H3R A;  2W63 A;  3ZCJ A;  4DV7 T;  2KMF A;  4HGA A;  4LMJ A;  4HFI A;  4B6X A;  5JDN A;  4WBN E;  5M4Y A;  3Q2M A;  3SFE A;  5LHG B;  1MMD A;  4EZ4 A;  4YJ2 E;  3RF1 A;  1Y64 B;  5EZY E;  2OA5 A;  2I59 A;  4JEU B;  5LB7 B;  2WB5 A;  2UUB T;  5KMG P;  2DWG A;  5E0O A;  2VKH A;  4PNI A;  5AQM B;  3DJB A;  3H3M A;  3ESL A;  2LM2 A;  2B1E A;  4YY3 T;  3MA9 A;  1HF8 A;  2JPF A;  2NOX A;  1BR4 A;  5AQS B;  3I1A A;  3AE3 A;  3MKD A;  4IDZ A;  4O4J E;  4IL4 A;  5FXW A;  1OED C;  3EAM A;  2XSB A;  3F2E A;  3PE0 A;  1YXR A;  2X51 A;  4HFH A;  4XBF B;  1WLX A;  4I0U A;  5DAB A;  3KDS E;  1HNW T;  4GK5 E;  4J2C A;  3PUZ F;  4JI2 T;  2LSG A;  2V5D A;  4IE4 A;  5JDH A;  5AFU L;  5AQF B;  2VVN A;  3CIR A;  5FL0 A;  2BKP A;  3F57 A;  3SRZ A;  2D0U A;  5J0Z A;  2KWI B;  4AKH A;  4CI2 B;  3RYC E;  4A97 A;  3V5U A;  4CN4 A;  4QXC B;  2VL0 A;  4MHC A;  4LFB T;  2DWK A;  2WCA A;  4BA9 A;  1HX1 B;  2EHO D;  2XQY A;  3EDV A;  4IE6 A;  1WR0 A;  2UUA T;  2WAU A;  2BBH A;  3KV6 A;  1X9B A;  3N9Q A;  2XQ7 A;  3IEE A;  2V7L A;  3FXD B;  4DV5 T;  2JQH A;  2CXD A;  2E5V A;  1XDP A;  4UV9 B;  3ZSS A;  3K3N A;  3QOF A;  1I94 T;  4DR6 T;  2LLY A;  4H9R C;  2JJ9 A;  3HR0 A;  2CHO A;  2WU2 A;  4B3R T;  2ZM8 A;  4Z90 A;  1B7T A;  3AE1 A;  4JUY A;  1YD8 G;  3BQI A;  3LFM A;  3PUR A;  2KT9 A;  3LBX A;  3PU8 A;  5AQJ B;  4BAY B;  4ZI2 D;  2XQ8 A;  5AQK B;  2N2N A;  2VKO A;  4L9I A;  2LHN A;  2WS3 A;  5JRE A;  1T8B A;  5KXJ A;  5L3G B;  4QWN B;  2OLT A;  4OYK A;  1XDO A;  2X68 A;  3AE5 A;  5ETW A;  1U5P A;  2XM1 A;  3RGL A;  2MTQ A;  3ETU A;  2LSJ A;  3UU6 A;  2YIN A;  4IIJ E;  2WWU A;  3RI5 A;  2K48 A;  2M6I A;  1QUU A;  4PJL A;  4ADZ A;  3L39 A;  4H9S E;  4HFD A;  4HE8 A;  4DO0 A;  1HR0 T;  3HKC E;  2DCF A;  5HEU A;  2WZH A;  4AQG A;  4EYY R;  3U3I A;  2Q9Q A;  4OYJ A;  4E7Z A;  1ZP0 A;  2JMK A;  4HFE A;  3JCF A;  1SUM B;  2CWO A;  3RYH E;  4DVD A;  1W9R A;  4QKN A;  3MXZ A;  2CLY C;  2PFV A;  2L8K A;  1JNR A;  5JDG A;  2VUR A;  2W67 A;  3NRY A;  3WAK A;  5HWY A;  3N9M A;  1HG5 A;  4IE7 A;  4EEB A;  3T1H T;  3EHZ A;  4DBR A;  2FBW A;  2XAH B;  4HWC A;  5J2T E;  4M1P A;  4PJJ A;  4LF4 T;  4A5X A;  5HEH A;  3UUM A;  4YT0 A;  4QH4 A;  3LG7 A;  3AEA A;  2J1D G;  2WZI A;  1IZN B;  1SHZ C;  2G0U A;  2UU9 T;  1HNZ T;  1T72 A;  3UFG A;  3CML A;  1LKX A;  3OBV E;  3A8Y C;  3C4W A;  4HWH A;  2BG9 C;  4YXD A;  3ZT6 A;  2XAG B;  1NWM X;  2BS3 A;  3UTK A;  1NAF A;  1OED B;  2VAS A;  3UQ7 A;  4WZX A;  1N33 T;  4K0U A;  3AE7 A;  2CPT A;  2WDQ A;  1AJ3 A;  1QSD A;  2FJB A;  2VVS A;  1MMA A;  2XSA A;  3OYZ A;  1IJ6 A;  5ABG A;  1HS7 A;  1JNZ A;  4LFC T;  5GON E;  3ZMV B;  4WNK A;  2E9X C;  2W61 A;  1UX5 A;  4JV5 T;  2X66 A;  3CX7 B;  3EI0 A;  3H37 A;  4GKJ T;  5FVK A;  2EHO C;  5FY1 A;  4IST A;  3N2K E;  1XNQ T;  3PUG A;  4U72 A;  3O1H A;  3I9W A;  5EK2 A;  4U2Y A;  3HKE E;  4X64 T;  1BR2 A;  5H6R B;  5CB4 E;  5HXE A;  3EDU A;  3CWZ B;  3CX6 B;  2Q9Q D;  3JC6 D;  3RHW A;  4ILC A;  3ZYK A;  3MJX A;  4X1I E;  4X1Y E;  4CI3 B;  4EYU A;  1ZV4 X;  3PUW F;  4DMW A;  2CXL A;  3A7M A;  4X66 T;  4H63 H;  1HX8 A;  3HA4 A;  2UXN B;  4HFB A;  1Y01 A;  5LP6 E;  4XZC A;  4PJN A;  3K8P C;  4C90 A;  3I0Q A;  4YFS A;  4OFZ A;  4KI0 F;  5JDQ A;  3NWI A;  2A2F X;  2WDV A;  5JR9 A;  4EB6 E;  3C4Z A;  3JAF A;  3KV5 A;  3PV0 F;  5HEO A;  4DR4 T;  4ILU A;  3RQU A;  3N9L A;  3N9O A;  3TLW A;  4MLK A;  4L0R A;  3FZL B;  5CFB A;  4CXX A;  2JQK A;  5FYM A;  2V6Y A;  1LVK A;  2YDR A;  4XAX B;  3JAE A;  3DP7 A;  1N32 T;  4HN9 A;  3BQL A;  2H89 A;  2KWH A;  3GN5 B;  5AQI B;  3GMI A;  4OK0 A;  3ZMS B;  1YQ4 A;  2YDQ A;  1WFD A;  2X9X A;  3RQW A;  2RPA A;  4PJM A;  2WY2 A;  4JI1 T;  1EZ3 A;  3J7Y q;  4H9P C;  4ZS2 A;  3VRB A;  3LJC A;  3T1Y T;  2UXX B;  3AE6 A;  1XWM A;  4JI4 T;  1MIY A;  1SE7 A;  3QNU A;  3ZST A;  4TZ4 C;  1VRB A;  2CBJ A;  3M65 A;  2CLY B;  2K5B B;  1E1H B;  1UX4 A;  3LSV A;  4YLH A;  1ZOY A;  4EGW A;  4HKA A;  3FB2 A;  3WAJ A;  2CCQ A;  2RP4 A;  4IT4 A;  4L5G A;  2WMN A;  3TLT A;  4JI8 T;  5JRC B;  1KF6 A;  2KXP B;  4I43 B;  4X5T A;  5KX5 E;  2L3L A;  2B76 A;  2N1G A;  4P09 A;  3D0T A;  2QVA A;  1ZHC A;  3ABV A;  4AKR B;  1KEY A;  4ANJ A;  2PBI A;  3O4X E;  3NRX A;  2FJE A;  4KHP T;  4IDO A;  3ZMU B;  2XY8 B;  3L3P A;  2C5K T;  2KZ7 B;  4ERR A;  4ZXL A;  4YJ3 E;  1N36 T;  1UUR A;  2E9X B;  3IF8 B;  1VCS A;  2XPK A;  1HG2 A;  4EOZ B;  3W15 B;  2UXC T;  3UT5 E;  4TNW A;  5JVD E;  4JI3 T;  4QXB B;  5L2L A;  3VRA A;  2VWA A;  4GYS A;  4MAL A;  5L3B B;  4X1K E;  3UUB A;  2X67 A;  3VKG A;  3MAC A;  1W0A A;  1J5W A;  4PFO A;  2W62 A;  2WDR A;  1WCR A;  3IBP A;  4IGU A;  4JI6 T;  3SWH A;  2Y6X A;  3AXJ B;  5F3J A;  3KFW X;  2X0L B;  5FP3 A;  4U74 A;  4O2A E;  4B3S T;  2IIU A;  4FI5 A;  5JH7 E;  5FY0 A;  3F31 A;  4O4L E;  2NW8 A;  3Q9D A;  3AED A;  2V5C A;  3C50 A;  2ACX A;  1BR0 A;  2KIN B;  4F6R C;  3UUX B;  2LOP A;  2XAQ B;  2QYW A;  1S35 A;  1T7S A;  1FMV A;  5CJ5 A;  4LFA T;  4U7I A;  1ZEE A;  3WI3 A;  2H7O A;  2VQE T;  2MOZ A;  4ILB A;  4HWD A;  4YSX A;  3SOL A;  4CN6 A;  5J1G A;  1D1C A;  2CEA A;  5HCM A;  4JI7 T;  3JAD A;  4H63 V;  2YKS A;  2CA5 A;  2IDO B;  3NVO A;  5JDM A;  4ZOL E;  3AAA B;  3K1S A;  3ZC1 A;  3EAB A;  3VR9 A;  3AEC A;  4EV6 A;  2JIW A;  4IL9 A;  1YKE B;  3MK7 C;  2XAJ B;  4Z8X A;  3RRC A;  4F8H A;  3RKG A;  4TNV A;  2VB6 A;  2BKO A;  4DV2 T;  3UQ4 A;  2V1D B;  3AAE B;  2MYS A;  3K3O A;  4KUM B;  2LSK A;  2VKD A;  2BZB A;  4GYR A;  4TN7 B;  5AQH B;  3KVB A;  4JLE A;  3SFD A;  3QC9 A;  1VOM A;  2M67 A;  3RYI E;  3PUV F;  2R6G F;  2QRX A;  4ZI7 E;  3RC3 A;  3OTO T;  4C91 A;  2YN6 A;  1D1A A;  4TWH A;  1UUS A;  3Q5D A;  4I50 E;  3BQK A;  3PUS A;  1X79 A;  2DL1 A;  3RX6 A;  4YTN A;  3AA7 B;  4V1A v;  2V7K A;  1NEK A;  2ZM6 T;  4P0A A;  1CHU A;  3ZT5 A;  4LF6 T;  1W09 A;  1QLB A;  5JR9 C;  4PW8 A;  5HCJ A;  3HKB E;  2CHN A;  4ZZB A;  4UVC B;  3VHL A;  5KDM C;  5HAX A;  2OV9 A;  3B5M A;  4YHH T;  5FXX A;  3UU8 A;  1FJG T;  4ZI3 D;  5LGU B;  5HWX A;  4DND A;  3NZQ A;  2VK9 A;  4JEH B;  5L47 A;  3RIF A;  5LMN T;  2BKN A;  3Q5W A;  4O4H E;  1D1B A;  2LT3 A;  4AIS A;  2FUP A;  3OJA A;  2YU2 A;  2YK0 A;  4TWD A;  4EAH A;  1XZY A;  4QX7 B;  5FKY A;  3ZJ1 A;  2FJD A;  5HEG A;  5HXS A;  2Y8D A;  1IAP A;  2ODV A;  3ZEF B;  3KV9 A;  2FJA A;  3ETV A;  3LK2 B;  2LKH A;  1W0B A;  4H9O C;  4IE0 A;  2K3W A;  2HPL A;  3AE4 A;  3NZP A;  5C3J A;  4U33 A;  3KVA A;  1KNP A;  1FMW A;  4X65 T;  2PJQ A;  2IC6 A;  4IDP A;  3GA8 A;  3P4P A;  5EK3 A;  2JRK A;  3TKL B;  3UUL A;  3V5S A;  3GN5 A;  2W0G A;  5HXR A;  1M62 A;  2LE8 A;  3O1J A;  1E2A A;  4AQF A;  3U78 A;  5CA1 E;  1WR6 A;  2D0T A;  4UVA B;  4KP3 C;  1G8X A;  2QGS A;  3C4X A;  2MPK A;  3RLF F;  3PUY F;  3AA0 B;  2NTY A;  1N34 T;  5F8P A;  4ZI2 C;  1KK7 A;  4KX6 A;  2LSY A;  3ONJ A;  4CZZ B;  2E8I A;  3N5L A;  5IYZ E;  1CUN A;  3ZKR A;  3ZN0 B;  4G63 A;  3N9N A;  4LMK A;  4EZH A;  3AAI A;  4NXN T;  5FXZ A;  3N9P A;  4Z91 A;  5JQG E;  4DV6 T;  5FXV A;  3VU7 H;  5LYJ E;  3FBL A;  3ANW B;  5C2T A;  2W4X A;  3CX8 B;  4JI0 T;  3PJA A;  5FNV E;  3ONL C;  2KSR A;  5EK4 A;  4HWF A;  1XMO T;  2LOS A;  1J1J A;  3MZK B;  3P8C D;  4PK6 A;  2M6B A;  3AE2 A;  2XTL A;  1R8I A;  4GK0 E;  3HKD E;  3NBX X;  5LG4 A;  4DR7 T;  2VKJ A;  5JTG A;  5BR8 T;  5AQG B;  2V8S V;  4WYV A;  5ABF B;  3RIU A;  2NW7 A;  3DTO A;  3AE8 A;  2XAF B;  1M7K A;  2LKG A;  1SA0 E;  2E9X A;  2X9Y A;  2CM0 A;  1D0Z A;  2J62 A;  4UF0 B;  2IC9 A;  4NIQ A;  4EIW A;  1YQ3 A;  2Z6E A;  1FEW A;  1XNR T;  3AEE A;  2UXB T;  4P0B A;  2XHE B;  2V7M A;  4U2Z A;  4ASK A;  1O3X A;  2PTF A;  5AQQ B;  3N2G E;  2E2A A;  3P50 A;  1KFY A;  4X20 E;  2YDS A;  4DUZ T;  2XQ4 A;  3TLV A;  3ZMT B;  1MND A;  4DV0 T;  2MAW A;  4DBQ A;  5HYA A;  4O2B E;  3VR8 A;  4YSZ A;  3UU4 A;  3PUX F;  4IE5 A;  3QUJ A;  3LK4 2;  3AXJ A;  1G73 A;  4UVB B;  2KND A;  1GQE A;  4QH1 A;  5L3E B;  2BG9 B;  4PFP A;  2XQ3 A;  2D9D A;  3AVR A;  2ZMA A;  5H6Q B;  3L8R A;  2V26 A;  3M3Z B;  2BS4 A;  2C0S A;  4IHJ E;  4DV3 T;  3J9X 1;  2K24 A;  4I4T E;  2XAS B;  1Z0P A;  2W00 A;  2WMO A;  4AKI A;  3CK6 A;  5LCY A;  3EVY A;  4HFC A;  2N9D A;  4H9N C;  4DMV A;  3KBU A;  5LJM A;  4DV4 T;  4QH5 A;  3UFE A;  3SS1 A;  1KNR A;  1MIV A;  4ZS3 A;  4LF5 T;  2A72 A;  2BVL A;  2YOE A;  1U4Q A;  4B3M T;  4QXH B;  3S4U A;  2EHO B;  2K9A A;  2H7V C;  3H3A A;  4CQI A;  4TX5 A;  4QHO A;  4PAG A;  2ES0 A;  3CKD A;  3B57 A;  2XUE A;  2KLQ A;  4IDQ A;  4WBO A;  5AQN B;  3VKH A;  2JQ9 A;  5L3D B;  2Q9Q C;  2WSS V;  1S94 A;  2ZM2 A;  3JC6 C;  2CRB A;  2JQQ A;  4HEA A;  4UXN B;  2NW9 A;  1UGO A;  3KBT A;  4N78 D;  4GOU A;  4A98 A;  2NWB A;  1D0X A;  2LEH A;  3ONX A;  4EED A;  3P4S A;  1WYB A;  4QX8 B;  2V6X A;  4LML A;  3AEG A;  2PG8 A;  3FZK B;  5IHY A;  2LRL A;  3AVS A;  3RRW A;  3ZYM A;  2E9X D;  4B3T T;  2X9W A;  3K3Q C;  3R6N A;  4ILA A;  3CQX C;  3PUQ A;  1MMG A;  2YEV C;  4CN1 A;  1HNX T;  2ZM0 A;  5AQV B;  3FZM B;  3N2O A;  2AXD S;  2CMR A;  3OVU A;  1IBL T;  5HXH A;  3OYX A;  4H9Q C;  2XQA A;  4UEL A;  1HFA A;  5AQT B;  3E22 E;  4P1N A;  2CXF A;  2HPJ A;  4TV8 E;  3FZH B;  4MBQ A;  3FBZ A;  4WW0 A;  1IBK T;  4AKL A;  4ZZC A;  5JDL A;  2D5U A;  5IUX A;  3KV4 A;  3G06 A;  2DLR A;  4CI1 B;  4DR1 T;  3RH3 A;  2CE7 A;  4ISS A;  3O1I A;  3BK9 A;  1OED E;  2V7J A;  3IHR A;  2XQ9 A;  4AIU A;  5LNK A;  5AQO B;  2NTX A;  1YW0 A;  2IML A;  2XZE A;  1L0V A;  4YHJ A;  2LM9 A;  1IJ5 A;  2IAK A;  5AQR B;  2X0H A;  3B13 A;  5FY7 A;  4HFV A;  3Q5E A;  4ZHQ E;  5ADX L;  1LVF A;  2IW5 B;  4YTP A;  2ZLY A;  2UUC T;  1OED A;  2UXD T;  2JMH A;  4IDN A;  2L9Q A;  5JDF A;  4NUU A;  2NR4 A;  2HHH T;  2W2U A;  5LHH B;  4KBM B;  2P9B A;  4DUY T;  4BJM A;  2YU1 A;  5LBQ B;  4AQF C;  2BVM A;  2ACZ A;  2WP9 A;  4UEM A;  2X0Y A;  3P7I A;  5AQU B;  1OXZ A;  5LGN B;  1V9D A;  3CVR A;  5LJN A;  5BMV E;  4E7S A;  3OPC A;  3ZT7 A;  3ZPO A;  3X1D A;  3CPZ A;  1YKH B;  5A1L A;  4Q25 A; 
#chains in the Genus database with same CATH homology
 5CA1 E;  1WR6 A;  2D0T A;  4UVA B;  4KP3 C;  1G8X A;  2WAU A;  3LBX B;  2QGS A;  3KV6 A;  3C4X A;  3N9Q A;  4HTE A;  2V7I A;  3IEE A;  2V7L A;  2A3D A;  3FXD B;  4L5G A;  2WMN A;  5JRC B;  2QA7 A;  2CXD A;  4I43 B;  2KXP B;  3AA0 B;  2NTY A;  5F8P A;  4ZI2 C;  4UV9 B;  1KK7 A;  3PU3 A;  5KX5 E;  5LGT B;  4UIG A;  2LSY A;  4CZZ B;  1US7 B;  2E8I A;  3N5L A;  3RC8 A;  2L3L A;  5IYZ E;  2N1G A;  1CUN A;  3K3N A;  4P09 A;  3D0T A;  3ZN0 B;  1ZHC A;  4G63 A;  3N9N A;  4AQF A;  4EZH A;  1D0Y A;  3AAI A;  4KMC A;  1MNE A;  3AA6 B;  3T8O A;  5FXZ A;  3I0O A;  3N9P A;  4H9R C;  1FIO A;  2JJ9 A;  3HR0 A;  4AKR B;  2ZM8 A;  5JQG E;  3ZYL A;  4ANJ A;  4AXP A;  1B7T A;  2PBI A;  3O4X E;  2LHR A;  4JUY A;  3NRX A;  1YD8 G;  3BQI A;  3LFM A;  5FXV A;  3VU7 H;  3PUR A;  5LOV E;  5LYJ E;  3FBL A;  2KT9 A;  3LBX A;  3PU8 A;  1MMN A;  3AA1 B;  3ZMU B;  3ANW B;  3HI2 A;  3L3P A;  3CX8 B;  4BAY B;  4ZI2 D;  2C5K T;  2KZ7 B;  5FNV E;  4ERR A;  3R84 B;  5EK4 A;  2WBL A;  2N2N A;  2VKO A;  4L9I A;  2LOS A;  1HTJ F;  4YJ3 E;  2LHN A;  5JRE A;  2E9X B;  3IF8 B;  3MZK B;  5L3G B;  5CA0 E;  1HG2 A;  4QWN B;  3RYF E;  4EOZ B;  4OYK A;  3W15 B;  3UT5 E;  2Q9Q B;  3P8C D;  2X68 A;  4PK6 A;  5ETW A;  3ZMZ B;  1U5P A;  5DJQ C;  5JVD E;  5LHI B;  2MTQ A;  3ETU A;  2LSJ A;  2YIN A;  4IIJ E;  2XTL A;  4QXB B;  2DHR A;  5L2L A;  2VWA A;  2WWU A;  4GK0 E;  4I55 E;  4AKG A;  5L3C B;  3HKD E;  3NBX X;  4GYS A;  4MAL A;  2K48 A;  5L3B B;  4MFR A;  4X1K E;  1QUU A;  4PJL A;  2NP9 A;  1BR1 A;  3ANW A;  5LG4 A;  4ADZ A;  2VKJ A;  2X67 A;  1HCI A;  3VKG A;  3CQG B;  3MAC A;  2HH7 A;  4H9S E;  3RKO A;  2LJL A;  2NW7 A;  3DTO A;  4PFO A;  4HE8 A;  2W62 A;  2SPC A;  3ZN1 B;  4DO0 A;  3IBP A;  4IGU A;  2XAF B;  3HKC E;  2DCF A;  4GIW A;  3SWH A;  3HL6 A;  2Y6X A;  4AQG A;  1SA0 E;  3A5X A;  3KIN B;  5F3J A;  2E9X A;  2X9Y A;  3KFW X;  2X0L B;  4EYY R;  5FP3 A;  2CM0 A;  4U74 A;  3PDY A;  4O2A E;  1D0Z A;  3U3I A;  4UF0 B;  2IC9 A;  2Q9Q A;  5FMN A;  4OYJ A;  4E7Z A;  4FI5 A;  4EIW A;  2Z6E A;  5JH7 E;  5FY0 A;  1FEW A;  2JMK A;  3F31 A;  4O4L E;  2NW8 A;  3Q9D A;  2CWO A;  4P0B A;  3C50 A;  2XHE B;  3RYH E;  4DVD A;  2ACX A;  4PK4 A;  4QKN A;  3MXZ A;  2CLY C;  2KIN B;  4F6R C;  1BR0 A;  2V7M A;  3UUX B;  2LOP A;  2PFV A;  4ASK A;  2XAQ B;  1O3X A;  3L09 A;  3N2G E;  3OKQ A;  2L8K A;  5J2U E;  3I9Y A;  4X20 E;  4PK5 A;  3AB3 B;  1S35 A;  3CQC B;  3ZMT B;  5JDG A;  1MND A;  3C64 A;  1FMV A;  3FXE B;  3NRY A;  3WAK A;  4DBQ A;  5HYA A;  4O2B E;  5HWY A;  3N9M A;  2WM9 A;  2BDE A;  1HG5 A;  1ZEE A;  4IE7 A;  3UUN A;  4IE5 A;  3WI3 A;  3QUJ A;  3LK4 2;  2H7O A;  4DBR A;  2XAH B;  5HXC A;  4CXW A;  2MOZ A;  5J2T E;  3C98 B;  1G73 A;  4UVB B;  3E0Z A;  4M1P A;  4PJJ A;  2KND A;  1OWA A;  3UUM A;  3LK3 B;  5L3E B;  4UF0 A;  4PFP A;  2D2S A;  3AVR A;  2ZMA A;  3LG7 A;  4G2A A;  5H6Q B;  2J1D G;  1IZN B;  2V26 A;  3SOL A;  1SHZ C;  5J1G A;  2G0U A;  5C8Y E;  2C0S A;  1D1C A;  2CEA A;  1H7C A;  4IHJ E;  4H63 V;  3CML A;  2K24 A;  4O4I E;  2CA5 A;  3J9X 1;  2Y48 B;  2X9H A;  4I4T E;  1LKX A;  2XAS B;  1Z0P A;  5JDM A;  2W00 A;  2WMO A;  3OBV E;  4AKI A;  4TV9 E;  4ZOL E;  5JRC A;  3AAA B;  5LCY A;  3C4W A;  2MBG A;  3ZC1 A;  2GK9 A;  3EVY A;  2N9D A;  4NUV A;  4H9N C;  2XAG B;  2LSI A;  4FJO A;  3GWH A;  4UV8 B;  1NWM X;  4DMV A;  2C5J A;  1WRD A;  3KBU A;  5LJM A;  3UTK A;  1NAF A;  3RPU A;  1LRZ A;  3UFE A;  1YKE B;  3O9X A;  3SS1 A;  3MK7 C;  2XAJ B;  2VAS A;  1MIV A;  4Z8X A;  2A72 A;  4ZS3 A;  3RRC A;  2BVL A;  2VB6 A;  1U4Q A;  4QXH B;  5TAO A;  3S4U A;  3ZCI A;  2EHO B;  4K0U A;  2K9A A;  3C51 A;  2H7V C;  3H3A A;  4TUY E;  1AJ3 A;  4CQI A;  5DQW A;  2V1D B;  1T98 A;  3AAE B;  2MYS A;  4TX5 A;  1QSD A;  2VL8 A;  3K3O A;  4QHO A;  4KUM B;  4PAG A;  5LBM A;  2ES0 A;  3CKD A;  1MMA A;  3OYZ A;  2LSK A;  3ZJ2 A;  2VKD A;  2RA1 A;  1IJ6 A;  3QK6 A;  3B57 A;  2BZB A;  2XUE A;  1HS7 A;  2KLQ A;  4EXT A;  4GYR A;  5GON E;  3ZMV B;  4TN7 B;  4WBO A;  4WNK A;  2E9X C;  2W61 A;  1UX5 A;  1WYC A;  2X66 A;  3VKH A;  3CX7 B;  4OHF A;  5L3D B;  3KVB A;  2Q9Q C;  2WSS V;  1S94 A;  2ZM2 A;  3JC6 C;  4JLE A;  3H37 A;  2JQQ A;  3QC9 A;  4HEA A;  1VOM A;  4UXN B;  2NW9 A;  2M67 A;  3PTR B;  2DNX A;  3RYI E;  2EHO C;  3KBT A;  5FY1 A;  4N78 D;  5DQV A;  4GOU A;  4IST A;  3N2K E;  4ZI7 E;  2NWB A;  1D0X A;  3PUG A;  2LEH A;  4U72 A;  3Q5X A;  3O1H A;  3RC3 A;  3ONX A;  4C91 A;  1ZKE A;  1D1A A;  1WYB A;  4QX8 B;  5LA6 E;  2DI4 A;  2EHO A;  5JR9 B;  4I50 E;  3BQK A;  3I9W A;  3PUS A;  2PG8 A;  4A56 A;  5EK2 A;  5IHY A;  3HKE E;  3AVS A;  3RRW A;  1X79 A;  3ZYM A;  1BR2 A;  3RX6 A;  5H6R B;  4BJN A;  4ZI3 C;  2E9X D;  5CB4 E;  4AI6 A;  3EUH A;  3AA7 B;  3EDU A;  5HXE A;  3CWZ B;  4V1A v;  3CX6 B;  2V7K A;  4CXY A;  2Q9Q D;  2X9W A;  3JC6 D;  3K3Q C;  3R6N A;  4O8S A;  3ZYK A;  3MJX A;  2C5I T;  3ZC0 A;  4X1I E;  4X1Y E;  3CQX C;  4CI3 B;  3PUQ A;  1MMG A;  2YEV C;  4EYU A;  5L3F B;  1ZV4 X;  4P0A A;  4DMW A;  2CWY A;  2CXL A;  3ZLI A;  2ZM0 A;  3E08 A;  5JR9 C;  2ODU A;  4PW8 A;  4H63 H;  1MIW A;  1UCU A;  3HKB E;  1HX8 A;  3HA4 A;  3N2O A;  3FHN A;  3PUA A;  1KNZ A;  2UXN B;  2CMR A;  4UVC B;  5LP6 E;  4XZC A;  4PJN A;  5LXT E;  3K8P C;  3VHL A;  4C90 A;  5KDM C;  5HAX A;  3I0Q A;  5HXH A;  2H3R A;  3OYX A;  4YFS A;  4H9Q C;  4OFZ A;  5JDQ A;  4UEL A;  2W63 A;  3ZCJ A;  1HFA A;  2A2F X;  5FXX A;  5JR9 A;  4EB6 E;  4ZI3 D;  2KMF A;  3E22 E;  4HGA A;  3C4Z A;  3KV5 A;  5LGU B;  5HWX A;  4DND A;  3NZQ A;  4ILU A;  4B6X A;  2VK9 A;  3N9L A;  4JEH B;  3N9O A;  4WBN E;  5JDN A;  5M4Y A;  3Q2M A;  2CXF A;  2HPJ A;  4TV8 E;  4MBQ A;  4MLK A;  5LHG B;  1MMD A;  3FBZ A;  4L0R A;  3Q5W A;  4WW0 A;  4EZ4 A;  4YJ2 E;  4AKL A;  5JDL A;  2D5U A;  4O4H E;  1Y64 B;  4CXX A;  1D1B A;  5EZY E;  2OA5 A;  2LT3 A;  5FYM A;  2I59 A;  3KV4 A;  2DLR A;  3OJA A;  4JEU B;  4CI1 B;  3RH3 A;  2YU2 A;  2YK0 A;  2CE7 A;  1LVK A;  5KMG P;  2DWG A;  4ISS A;  5E0O A;  4EAH A;  2VKH A;  4PNI A;  3DJB A;  4XAX B;  3ESL A;  4QX7 B;  3O1I A;  2B1E A;  3DP7 A;  3MA9 A;  3BK9 A;  3ZJ1 A;  3U78 A;  2V7J A;  3IHR A;  4HN9 A;  1HF8 A;  2JPF A;  2NOX A;  5HXS A;  3BQL A;  2Y8D A;  1BR4 A;  1IAP A;  5LNK A;  2ODV A;  3ZEF B;  2NTX A;  1YW0 A;  2KWH A;  3KV9 A;  3I1A A;  3GN5 B;  3ETV A;  3MKD A;  4IDZ A;  4O4J E;  3GMI A;  4OK0 A;  3ZMS B;  3LK2 B;  4YHJ A;  4H9O C;  4IE0 A;  2LM9 A;  5FXW A;  1IJ5 A;  3F2E A;  2HPL A;  2IAK A;  2X9X A;  3PE0 A;  3B13 A;  4PJM A;  5FY7 A;  2X51 A;  4HFV A;  4XBF B;  3NZP A;  1WLX A;  5DAB A;  4ZHQ E;  5ADX L;  1EZ3 A;  1LVF A;  3KDS E;  2IW5 B;  3J7Y q;  4H9P C;  4ZS2 A;  4GK5 E;  3LJC A;  4J2C A;  2UXX B;  2LSG A;  2ZLY A;  4IE4 A;  2JMH A;  1MIY A;  5JDH A;  5AFU L;  2L9Q A;  3KVA A;  4NUU A;  1VRB A;  4TZ4 C;  5JDF A;  1FMW A;  5LHH B;  3M65 A;  2CLY B;  2K5B B;  2PJQ A;  2IC6 A;  4KBM B;  2P9B A;  3F57 A;  1E1H B;  3SRZ A;  2D0U A;  2KWI B;  1UX4 A;  2YU1 A;  4YLH A;  5LBQ B;  4BJM A;  4AQF C;  4AKH A;  2BVM A;  4CI2 B;  3GA8 A;  3RYC E;  3TKL B;  5EK3 A;  2JRK A;  3UUL A;  3V5S A;  3GN5 A;  4HKA A;  2W0G A;  3V5U A;  4UEM A;  3P7I A;  4QXC B;  1OXZ A;  5HXR A;  5LGN B;  1V9D A;  3CVR A;  4MHC A;  5LJN A;  5BMV E;  4E7S A;  2DWK A;  4BA9 A;  2LE8 A;  3O1J A;  3ZPO A;  3FB2 A;  3CPZ A;  1YKH B;  3WAJ A;  2EHO D;  2XQY A;  5A1L A;  2CCQ A;  2RP4 A;  3EDV A;  4IE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...