2DNXA

Solution structure of rsgi ruh-063, an n-terminal domain of syntaxin 12 from human cdna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
130
structure length
130
Chain Sequence
GSSGSSGQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Syntaxin-12
publication title Solution structure of RSGI RUH-063, an N-terminal domain of Syntaxin 12 from human cDNA
rcsb
source organism Homo sapiens
total genus 46
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dnxA00
5M4YA 4JEHB 1BR0A 1FIOA 1G73A 1S94A 2XHEB 1FEWA 3C98B 4TX5A 5LG4A 1HS7A 4JEUB 3LG7A 2DNXA 1EZ3A
chains in the Genus database with same CATH superfamily
4IHJE 5AQSB 4EZ4A 3ZC0A 2VK9A 4YXDA 4G2AA 4B3MT 5J0ZA 4X65T 2LSYA 4LFCT 4IE5A 3AEBA 4LF5T 3V5UA 1X9BA 2FJBA 3UUXB 3ANWA 1MMDA 4OHFA 4JI4T 3GN5A 3JC6D 2W63A 4DUZT 3SRZA 3ETUA 3RYIE 3I1AA 2JQKA 4IDZA 4U31A 3ZC1A 1FMWA 4IIJE 3IBPA 1XMOT 2XM1A 3V5SA 2H7VC 3CX6B 3WAKA 2MPKA 4PW8A 4ZEYA 2XSBA 3RRCA 2XQYA 2IW5B 3F31A 2M6IA 2K48A 3OTOT 3E08A 2WBLA 3KV9A 2YINA 4LMJA 1IBLT 2MTQA 3N5LA 1J5WA 5AFUL 3HKDE 2LKHA 2LHNA 5AQJB 1WFDA 2BG9B 3G06A 3QC9A 4EB6E 4ZI2C 3Q5EA 2BS3A 2GK9A 5AQOB 4YSYA 1YQ4A 3CQXC 4DR7T 3RH3A 2R6GF 4ZI2D 2NTXA 3LFMA 3VHLA 2BVMA 3RI5A 2KWHA 3I9YA 4DMVA 4DR4T 2I6HA 3NRYA 3UU4A 4JEHB 2K3WA 5ABFB 5LB7B 3KFWX 5KMGP 4X5TA 5KXJA 4JLEA 1J1JA 1LKXA 2XHEB 3FB2A 2VVSA 3MJXA 2BS4A 1VCTA 3UU3A 2PG8A 2LKGA 2H88A 5CGMA 4EAHA 3ZLIA 3EAMA 3TLTA 1ZOYA 4PK5A 2DI4A 4UV8B 2V6YB 2V7JA 5JQGE 4AKIA 1T98A 3ZMSB 3N9QA 1Y64B 3LBXA 2UUCT 3JADA 4ZI7E 4DV0T 4QH4A 5LGUB 2VKHA 4UF0A 4Z91A 1US7B 4TZ4C 2WP9A 2CLYB 4ZS3A 2BKPA 3QB5A 5FL1A 4TUYE 1QUUA 2HH7A 1FEWA 4H9RC 2RA1A 3UTKA 3MACA 5LXTE 2DHRA 3BK9A 3KVBA 4PJLA 3AEEA 5KX5E 5L3DB 1QSDA 1BR4A 4GKKT 1MNEA 2L3LA 5CA0E 4GYRA 2W67A 5AQGB 4AQYT 4LMLA 1MIWA 5CJ5A 4TX5A 5AQKB 2IIUA 3AB3B 2OLTA 4G63A 3AEFA 1N32T 4LF6T 1ZEEA 2I0MA 3OPCA 2N2NA 5LA6E 4A5XA 4AXPA 4CXWA 4HFEA 4IGUA 2Y6XA 3ZYLA 3ONLC 2J47A 2AXDS 2CBJA 3CWZB 3AXJB 3HI2A 1W09A 2XAHB 2CMRA 4NPPA 4CI1B 2IAKA 2K24A 5L47A 4UELA 4EIWA 5ADXL 5LGNB 4P0BA 3Q5WA 4AQGA 4DR1T 3RC8A 5EK3A 3N2GE 1OEDE 3T1YT 3EVYA 1O3XA 3K8PC 3RIAA 4BJMA 5JDGA 4DR2T 3AE9A 3NZPA 3ZSSA 4AKHA 4EEBA 3P50A 4WYVA 3LK42 3WI3A 4HFCA 3CPZA 1M62A 3ZMTB 2ACZA 2CRBA 4HEAA 3HKBE 5AQPB 2V7IA 2MYSA 4NUUA 4OX9T 3EDUA 4XAXB 3K3OA 3ONJA 4X62T 5AQQB 1NEKA 3RPUA 4C90A 3FBLA 2X68A 2XQ3A 5JR9B 4ZI3C 2A2FX 3VKGA 5JDFA 3KBTA 2PBIA 2JIWA 2VASA 2UUBT 4ILUA 2UU9T 4H9NC 3C4WA 1E7PA 5LMUT 4CQIA 4PFPA 2XY8B 3O4XE 5F8PA 1HS7A 2XASB 4GOUA 4Z8XA 2LM2A 5LGTB 2G0UA 3U78A 3LK3B 2JRKA 3IEEA 5L4HA 2Q9QB 4HFHA 5CFBA 4IL9A 3LJCA 2VURA 3L3PA 4PJMA 3S4UA 2KMFA 2I59A 5DABA 5FXVA 5HXHA 5FNVE 1V9DA 1WYBA 1M7KA 2CWYA 1WR6A 4QHOA 1T7SA 1UGOA 2CE7A 1JNRA 2XQ6A 4HWIB 2KSRA 2QVAA 3CVRA 3AEGA 1WYCA 3PUSA 2E9XD 2BBHA 5LBMA 2DWKA 5IHYA 1Z0PA 3RIUA 3BQIA 4CXXA 3R84B 5LYJE 2NTYA 4FI5A 4NUVA 3JAEA 4O4IE 2WDRA 2YKSA 3NWIA 3RIUC 1OEDB 4ZXLA 3AEDA 2MOZA 3AE1A 3UQ4A 2VQFT 2IC6A 4MALA 3CQGB 3KVAA 4QX8B 1MMGA 4QX7B 4EZHA 5FVLA 1T8BA 5C3JA 1DU2A 4HWFA 2CM0A 3I0QA 5H6QB 1XZYA 2KNDA 3UFEA 1OWAA 3NRXA 4UIGA 4JI0T 2V1DB 3C4XA 3JAFA 4QH1A 1WCRA 2VVNA 2C5JA 3BQLA 2EHOA 3B13A 2HN2A 2C0SA 1XDOA 2X0YA 5JH7E 3O1JA 4ASKA 4PFOA 5AQFB 5C8YE 4QXHB 3SFEA 3H37A 2UXXB 2ODVA 3WAJA 4AI6A 3AAEB 1QLBA 5HXRA 2D0UA 1MIYA 5M4YA 4H63V 4PK6A 3RYHE 2BDEA 5BR8T 2WCAA 3N9NA 5FXWA 5L3FB 4ZOLE 3ZT7A 4A97A 3TLWA 2EHOD 4KP3C 5HAXA 1HNXT 1W0BA 4HFVA 3ZSTA 2CBIA 5CB4E 3RKOA 1LVFA 4HGAA 3ONXA 3SS1A 3ZT5A 5FP3A 4EV6A 4TN7B 4IDPA 3SFDA 4DV5T 4YSXA 2JJ9A 2RP4A 4ZZCA 5JREA 3T8OA 4TWFA 1I94T 2WS3A 2XQ5A 3OYXA 4EYYR 3M65A 4JI2T 5AQTB 3ZMUB 2BG9A 3EDVA 3GN5B 4HFDA 2DWGA 5A1LA 4WW0A 4L0RA 2V7LA 5F3JA 2L9QA 3C4ZA 4P0AA 2PJQA 2P9BA 2VB6A 3LG7A 4GYSA 4O2AE 4PNIA 1R8IA 3AE2A 5E0OA 2BG9C 4A98A 5ABEA 2V5DA 1BR1A 4U2ZA 4X20E 1IBKT 1JNZA 3FXEB 4UVBB 2JMKA 4ADZA 1XNRT 1WRDA 1AJ3A 4TNWA 3ZPOA 4QXCB 5IUXA 4AKLA 5ABGA 2XZEA 5HCJA 5HWXA 2XSAA 4LF8T 2K9AA 2B1EA 2ZM0A 3HKEE 4O2BE 1HG5A 4U72A 3VKHA 3U3IA 1XWMA 4H9PC 2ZM6T 5AQHB 1KK7A 4YHHT 3E0ZA 5AQVB 1SE7A 2V6YA 2J1DG 3ZJ1A 3QB5K 3AA1B 5AQIB 3AA6B 1VOMA 4OYKA 3I0OA 1ZKEA 3K3NA 3LSVA 2NR4A 3DP7A 2BKOA 3PUZF 5HXCA 4ILCA 4YJ3E 2V8SV 3NZQA 3IA3A 3RYFE 2XQ4A 3ZYMA 5LNKA 4EGWA 2V26A 4MHCA 3PUXF 2XTLA 5L3BB 1KF6A 4YY3T 3QUJA 4NIQA 4PJNA 3EABA 2W62A 3F57A 2CXFA 1MMAA 2D0TA 4JI3T 4IDNA 1FMVA 3P8CD 3RF1A 4AIUA 4DR3T 1N33T 4PAGA 4U74A 2W66A 3LBXB 1HFAA 5ETWA 3AE3A 3P4PA 2BVLA 4B3RT 2H3RA 3FZKB 3PUVF 4TWDA 1X79A 2X0HA 3KV4A 1UCUA 5HEOA 4ZHQE 3SOLA 3A7MA 2JQQA 1UUSA 5LHIB 5FXXA 5J2TE 3ZJ2A 2X51A 4Q25A 3FZLB 3E22E 4DR6T 2KINB 1GQEA 2YK0A 5AQLB 4GKJT 2ZLYA 3K3QC 1WLXA 2VQET 4DIDB 1L0VA 3AXJA 1T72A 4JI7T 3PU3A 2HHHT 5HXEA 3SWHA 5AQUB 2N9DA 4YTNA 4Z90A 4CN1A 3FHNA 2FBWA 1G8XA 3ABVA 1CHUA 3MK7C 3BQKA 2V7MA 2KZ7B 3PUGA 4IDQA 2XQAA 4HKAA 4LMKA 2LRKA 3RRWA 5EK2A 2ZM2A 3UUNA 2QGSA 2YEVC 2CWOA 4JI5T 1ZP0A 4JI1T 5HEJA 3PV0F 2WMOA 2XAJB 2N1GA 3FZHB 2LSKA 4NXNT 3PJAA 5AQMB 2MAWA 5CA1E 2YN6A 3PURA 2V5CA 4UV9B 3AVRA 3NKZA 2UXDT 2JQ9A 2C5KT 4QH5A 2ZM8A 3IHRA 3KDSE 3JCFA 3PTRB 1J5ET 1HCIA 2H89A 2YDSA 5JR9A 2WDVA 5LHGB 3ZN1B 2X9HA 2UXCT 3ZMVB 4ANJA 2PTFA 3MKDA 3TLVA 5JVDE 4QXBB 2M67A 4JI8T 5JRCB 4HE8A 4LFAT 2LE8A 5JR9C 3VR9A 5FYMA 2H7OA 2X67A 4U7IA 2FJAA 2WWUA 2Q9QA 4DV7T 4ZI3D 5LJMA 4WNKA 1KNZA 4DUYT 4KHZF 5LP6E 2HPJA 5J2UE 4KHPT 4YTPA 2CEAA 3FZMB 1S94A 1LVKA 3K1SA 1CUNA 3RX6A 2Q9QC 4IL4A 2WAUA 2X66A 4L9IA 1IZNB 4ZZBA 3B57A 3ZMZB 4IE4A 4ISSA 3J9X1 1SA0E 2WZHA 4CXYA 1KFYA 4MFRA 3RKGA 5GONE 1XNQT 3N9PA 3EUHA 2LM9A 3UT5E 4CZZB 3Q5XA 2V7KA 4K0UA 4H9SE 4LF9T 2X0LB 2BBJA 3AAIA 3LDQB 3AE4A 5HEHA 3C98B 2WQYA 3F2EA 4IT4A 1Y01A 4O8SA 3GMIA 2E9XB 1YKHB 2W00A 3CKDA 4H9OC 4DV4T 4XZCA 3P4RA 4KBMB 1OEDA 4ILBA 3UU8A 3AEAA 4CI2B 2IHR1 4YTMA 2XAGB 5EK4A 3I9WA 1YQ3A 2JPFA 1S35A 3R6NA 3AECA 5JTGA 1OEDC 3C50A 3DTOA 3NVOA 5HEUA 2XQ7A 2X9YA 1W0AA 4DMWA 4KMCA 2JMHA 4J2CA 4COFA 4DO0A 4U7YA 4UXNB 2ES0A 1N36T 2DNXA 3ZN0B 5JDMA 5IWAT 1SHZC 4IREA 1MIVA 4UR9A 2VKOA 2KT9A 2FUPA 3QOFA 2KWIB 2UUAT 2WSSV 4HFIA 1IJ6A 1Z8UA 2NP9A 2WWVA 3MA9A 2A72A 1N34T 3X1DA 1XDPA 1KNPA 2OV9A 1YKEB 3EHZA 2SPCA 2IMLA 5DQVA 4E7SA 4ILAA 4KUMB 4WZXA 5HWYA 4CN6A 2HPLA 2WU5A 4UEMA 3UU6A 5J1GA 2EHOB 4JI6T 5FVKA 2DLRA 3PUQA 5JDNA 4I0UA 1D0XA 4X1IE 4O4JE 5L3GB 3H3AA 1XMQT 5LBQB 3RYCE 3VRBA 3P4WA 2CPTA 5KDMC 5LCYA 2AE9A 3DJBA 3RQUA 3UUMA 3OJAA 3JC6C 3PJAJ 1EZ3A 3HR0A 3CIRA 5DJQC 1ZV4X 3L09A 4EXTA 1G73A 1E1HB 1U4QA 2WDQA 3C51A 3ANWB 2KXPB 5DQWA 4TV9E 5JDLA 4YFSA 3ZCJA 4YLHA 4DBRA 4HWCA 5LHHB 4A56A 3N2KE 2D9DA 2XM2A 4GK5E 4V1Av 2E5LT 5FY7A 4C91A 2X9WA 1HX8A 4HN9A 2DCFA 3ETVA 3AAAB 2CHNA 5C2TA 5HEGA 3Q2MA 2XAFB 5IYZE 2E5VA 3ZT6A 2V6XA 3ZYKA 5ABFA 3AA7B 4AISA 4HTEA 4BJNA 3O1HA 1HNZT 2A3DA 4JBWF 2D2SA 1W9RA 2BS2A 3C64A 4B3TT 3PDYA 5L3CB 1MMNA 1KNRA 2A9UA 5F5WA 2PFVA 5JDQA 3TLUA 3A5XA 4I43B 2W2UA 4OK0A 2QRXA 1HR0T 2VWAA 2LOPA 1U5PA 2CCQA 3PE0A 4UVCB 2W4XA 4IE6A 1UK5A 5FL0A 2M6BA 4MLKA 3RIFA 1HNWT 2YU1A 4U2YA 2IDOB 2F4VT 4EEDA 2CHOA 3PU8A 1ZHCA 2L8KA 4JV5T 2Z6EA 4K0KT 4TNVA 3HKCE 3RQWA 2LT3A 3VRAA 2CLYC 3AE8A 3PUWF 3EI0A 2LRLA 3UULA 4P1NA 2B76A 3Q9DA 2NOXA 2NWBA 4GK0E 3PUAA 1NENA 2LOSA 4IE7A 1HG2A 2LSGA 2K5BB 3FZFB 5EZYE 4LFBT 5AQRB 1YD8G 2ZMAA 4UF0B 5LOVE 2LEHA 4DV1T 2LJLA 4DBQA 3AE7A 1OXZA 3D0TA 3N9LA 3UQ7A 3UU5A 4NXMT 4YJ2E 2J4GA 5FY1A 4YT0A 3N9MA 4L5GA 2LSJA 2Y48B 1KEYA 5ABHA 4QKNA 2BZBA 1H7CA 3O1IA 4PK4A 2E8IA 2JQHA 1VCSA 4KX6A 3VR8A 2QYWA 1BR2A 4JUYA 4DR5T 3RLFF 1NWMX 4WBNE 3UUBA 4B6XA 5LMNT 3AA0B 1YXRA 4PJJA 4MBQA 3OKQA 3ZKRA 3LK2B 3RC3A 5JDHA 4E7ZA 2XAQB 3QNUA 5L2LA 4EOZB 4JYAT 3GWHA 4FJOA 1UURA 2E2AA 1IJ5A 2WU2A 2NW8A 1UX4A 3CMLA 4AQFA 1D0ZA 1NAFA 2DL1A 3AE5A 1FIOA 3FBZA 2VKJA 1HTJF 4F8HA 2XQ9A 2YOEA 4HWDA 3AVSA 2FJEA 3RGLA 4AQFC 3CX8B 4P09A 4I50E 2VL8A 2WMNA 1MNDA 5TAOA 1B7TA 5H6RB 3L39A 4YHJA 4X64T 3P7IA 2ODUA 3N9OA 4TWHA 3ZEFB 3IF8B 4I4TE 5JRCA 3KINB 5FMNA 3NBXX 2WM9A 4LF4T 4WBOA 4ERRA 3CQCB 4O4HE 4DNDA 4F6RC 2LLYA 4H9QC 2KLQA 3RHWA 4OYJA 2CA5A 4KI0F 2YU2A 5FKYA 2X9XA 2CXLA 5AQNB 2XPKA 4I55E 2HN1A 1IAPA 3P4SA 4IDOA 3OBVE 4BAYB 3P4QA 4X1KE 3A8YC 5L3EB 3W15B 3Q5DA 1D1AA 5L4EA 1D1CA 3CX7B 4N78D 3FXDB 4BA9A 3ESLA 4OFZA 2J62A 2WY2A 3OVUA 2RPAA 4B3ST 2QA7A 5LG4A 3L8RA 2Q9QD 2BKNA 2IUBA 5BMVE 2WZIA 3B5MA 4DV2T 3KBUA 4AKGA 4H63H 2MBGA 2E9XA 3HA4A 3N2OA 5LJNA 2W0GA 4CI3B 3TLSA 1IBMT 2C5IT 2D5UA 4AKRB 2W61A 2VKDA 3H3MA 3QK6A 4U33A 2E9XC 5HXSA 4X1YE 1LRZA 2UXBT 1HX1B 1I6ZA 2ACXA 4DV3T 4QWNB 4M1PA 3J7Yq 5FY0A 2LHRA 4GIWA 2Y8DA 2CXDA 4CN4A 5HYAA 4JEUB 1E2AA 2BG9E 2IC9A 3TKLB 2NW7A 4YSZA 4U3CA 2NW9A 1SUMB 2XQ8A 3PUYF 3AE6A 1YW0A 4X66T 2VL0A 1WR0A 4TV8E 4DV6T 3OYZA 2UXNB 1UX5A 3ZCIA 3CK6A 3GA8A 3M3ZB 3KV6A 1D1BA 4DVDA 4HWHA 3UFGA 2XJ7A 3MXZA 2YDQA 4O4LE 3T1HT 2OA5A 2WB5A 4HFBA 1BR0A 4EYUA 1FJGT 3MZKB 3HL6A 3O9XA 4IE0A 3VU7H 3KV5A 4XBFB 2XUEA 2YDRA 2FJDA 1D0YA 5LG3A 4ISTA 4ZS2A 5FXZA 2EHOC 1HF8A 5HCMA 4LF7T 1VRBA 4UVAB 2LSIA
chains in the Genus database with same CATH topology
1WYBA 2KZ7B 2V7MA 2VWAA 4IHJE 4EZ4A 3ZC0A 3PUGA 2CWYA 2VK9A 1WR6A 2LOPA 4QHOA 4G2AA 1U5PA 2LSYA 2CCQA 4IE5A 3PE0A 2CE7A 3V5UA 4HKAA 4UVCB 4IE6A 3RRWA 5EK2A 3UUXB 2ZM2A 3UUNA 2QGSA 2YEVC 2CWOA 3ANWA 1MMDA 4MLKA 3CVRA 2WMOA 2YU1A 2XAJB 4OHFA 2N1GA 2LSKA 1WYCA 3PUSA 3GN5A 2E9XD 3PU8A 1ZHCA 2L8KA 2Z6EA 5LBMA 2DWKA 5IHYA 1Z0PA 3HKCE 3JC6D 5CA1E 2W63A 3SRZA 3BQIA 3ETUA 3RYIE 3I1AA 2LT3A 4CXXA 3R84B 3PURA 2CLYC 2NTYA 5LYJE 4IDZA 3ZC1A 1FMWA 4UV9B 3AVRA 4FI5A 4NUVA 4IIJE 3IBPA 4O4IE 2C5KT 2ZM8A 3UULA 3IHRA 2H7VC 3CX6B 2NOXA 3Q9DA 2NWBA 3V5SA 3WAKA 3KDSE 4PW8A 4GK0E 3RRCA 3PUAA 3PTRB 2LOSA 4IE7A 1HG2A 2XQYA 2LSGA 2K5BB 2IW5B 2MOZA 3F31A 2IC6A 1HCIA 5EZYE 2K48A 4MALA 3CQGB 3KVAA 4QX8B 5JR9A 1MMGA 1YD8G 3E08A 2WBLA 2ZMAA 3KV9A 4QX7B 5LHGB 2YINA 4UF0B 3ZN1B 4EZHA 2X9HA 5LOVE 3ZMVB 4ANJA 2MTQA 3N5LA 3MKDA 2LEHA 5AFUL 3HKDE 5JVDE 4QXBB 2M67A 2CM0A 2LJLA 4DBQA 3I0QA 5JRCB 5H6QB 2LHNA 2KNDA 3UFEA 1OWAA 3NRXA 1OXZA 3D0TA 3QC9A 4HE8A 3N9LA 4EB6E 4ZI2C 2GK9A 2LE8A 4UIGA 2V1DB 5JR9C 3CQXC 4YJ2E 5FYMA 5FY1A 3C4XA 3N9MA 2H7OA 4L5GA 2X67A 2LSJA 3RH3A 2WWUA 2Y48B 2Q9QA 4ZI3D 4QKNA 5LJMA 4ZI2D 2NTXA 2BZBA 2C5JA 3BQLA 3LFMA 1H7CA 3O1IA 2EHOA 4WNKA 3B13A 2BVMA 3VHLA 1KNZA 2C0SA 4PK4A 5LP6E 2E8IA 2HPJA 2KWHA 5J2UE 3I9YA 5JH7E 3O1JA 4DMVA 4ASKA 2CEAA 1S94A 1BR2A 4JUYA 1LVKA 1CUNA 4PFOA 3NRYA 2Q9QC 3RX6A 2WAUA 5C8YE 2X66A 4QXHB 4JEHB 4L9IA 1IZNB 3H37A 2UXXB 3B57A 1NWMX 4WBNE 2ODVA 3WAJA 3ZMZB 4IE4A 3KFWX 4ISSA 5KMGP 4AI6A 3AAEB 3J9X1 4B6XA 3AA0B 4JLEA 5HXRA 2D0UA 4PJJA 4MBQA 3OKQA 1SA0E 1MIYA 5M4YA 1LKXA 4H63V 4PK6A 2BDEA 3LK2B 3RYHE 2XHEB 3RC3A 5JDHA 3FB2A 4E7ZA 2XAQB 4MFRA 4CXYA 5L2LA 4EOZB 3N9NA 5GONE 3GWHA 3MJXA 4FJOA 5FXWA 1IJ5A 3N9PA 5L3FB 2NW8A 4ZOLE 3EUHA 2EHOD 4KP3C 2LM9A 2PG8A 5HAXA 1UX4A 4HFVA 3CMLA 3UT5E 4AQFA 4CZZB 3Q5XA 1D0ZA 1NAFA 2V7KA 4K0UA 4H9SE 4EAHA 5CB4E 3ZLIA 3RKOA 1LVFA 2X0LB 3AAIA 4PK5A 2DI4A 1FIOA 4HGAA 3ONXA 3C98B 3SS1A 4UV8B 3F2EA 3FBZA 2V7JA 2VKJA 4O8SA 3GMIA 1HTJF 2E9XB 5FP3A 4TN7B 1YKHB 5JQGE 4AKIA 3AVSA 2W00A 3CKDA 4H9OC 1T98A 3ZMSB 3N9QA 1Y64B 3LBXA 4AQFC 3CX8B 4P09A 4I50E 2VL8A 2WMNA 4XZCA 4ZI7E 4KBMB 2JJ9A 2RP4A 1MNDA 5TAOA 5JREA 3T8OA 1B7TA 5LGUB 4CI2B 5H6RB 2VKHA 4UF0A 4YHJA 1US7B 2XAGB 5EK4A 3I9WA 3P7IA 2JPFA 4TZ4C 1S35A 3R6NA 2CLYB 2ODUA 3N9OA 3OYXA 4ZS3A 4EYYR 3ZEFB 3IF8B 4I4TE 5JRCA 3KINB 3M65A 5FMNA 3C50A 3DTOA 3ZMUB 4TUYE 1QUUA 2HH7A 3EDVA 3GN5B 3NBXX 2DWGA 1FEWA 5A1LA 4H9RC 2RA1A 4WW0A 4L0RA 2V7LA 2X9YA 5F3JA 2L9QA 2WM9A 3C4ZA 4P0AA 3UTKA 4DMWA 3MACA 4WBOA 4ERRA 5LXTE 3CQCB 2DHRA 3BK9A 3KVBA 4PJLA 4KMCA 4O4HE 5KX5E 5L3DB 2JMHA 4DNDA 2PJQA 4F6RC 1QSDA 4J2CA 2P9BA 2VB6A 4DO0A 3LG7A 4GYSA 1BR4A 4H9QC 4O2AE 2KLQA 4PNIA 4OYJA 2CA5A 4UXNB 2ES0A 1MNEA 5E0OA 2L3LA 5CA0E 5FNVE 2YU2A 2DNXA 3ZN0B 5JDMA 4GYRA 1BR1A 1SHZC 2X9XA 1MIVA 2CXLA 4X20E 2VKOA 2KT9A 4I55E 1IAPA 3FXEB 4UVBB 2JMKA 4ADZA 1MIWA 1WRDA 2KWIB 4TX5A 1AJ3A 2WSSV 3ZPOA 4QXCB 3OBVE 4BAYB 1IJ6A 3AB3B 4AKLA 5HWXA 2NP9A 4G63A 3MA9A 4X1KE 2K9AA 5L3EB 2B1EA 2A72A 3W15B 2ZM0A 3HKEE 4O2BE 1ZEEA 1HG5A 1D1AA 4U72A 1D1CA 2N2NA 3CX7B 4N78D 3FXDB 3VKHA 3U3IA 5LA6E 4BA9A 3ESLA 1YKEB 4AXPA 4CXWA 2SPCA 4OFZA 5DQVA 4E7SA 4H9PC 4KUMB 2QA7A 5HWYA 5LG4A 4IGUA 1KK7A 2Q9QD 3E0ZA 2Y6XA 5BMVE 2HPLA 4UEMA 3ZYLA 2J1DG 3KBUA 5J1GA 2EHOB 3ZJ1A 4AKGA 4H63H 3AA1B 2MBGA 2E9XA 3HA4A 3N2OA 3CWZB 2DLRA 3PUQA 5LJNA 5JDNA 3AA6B 2W0GA 3HI2A 1D0XA 1VOMA 4CI3B 2XAHB 4O4JE 4X1IE 2CMRA 5L3GB 4OYKA 3H3AA 3I0OA 1ZKEA 3K3NA 4CI1B 5LBQB 2C5IT 3RYCE 2IAKA 2K24A 3DP7A 2D5UA 4UELA 5KDMC 5LCYA 4AKRB 2W61A 2VKDA 5HXCA 4EIWA 3QK6A 3DJBA 5ADXL 4YJ3E 3NZQA 5LGNB 2E9XC 5HXSA 4P0BA 3RYFE 3Q5WA 4X1YE 1LRZA 3UUMA 4AQGA 3OJAA 3ZYMA 3RC8A 5LNKA 5EK3A 2ACXA 3N2GE 2V26A 3JC6C 4MHCA 1EZ3A 4QWNB 3HR0A 2XTLA 5L3BB 3EVYA 5DJQC 1O3XA 1ZV4X 3K8PC 3L09A 4M1PA 4BJMA 4EXTA 3QUJA 3J7Yq 1G73A 5FY0A 5JDGA 2LHRA 4PJNA 4GIWA 2W62A 1E1HB 1U4QA 3C51A 2Y8DA 3NZPA 2CXDA 3F57A 4AKHA 3ANWB 2KXPB 2CXFA 1MMAA 5DQWA 4TV9E 5HYAA 2D0TA 4JEUB 5JDLA 4YFSA 3ZCJA 4YLHA 1FMVA 3LK42 3P8CD 3WI3A 2IC9A 4DBRA 3TKLB 3CPZA 2NW7A 4PAGA 4U74A 2NW9A 3LBXB 1HFAA 3ZMTB 5ETWA 5LHHB 4A56A 3N2KE 4HEAA 1YW0A 4GK5E 2BVLA 3HKBE 4V1Av 2H3RA 4TV8E 2V7IA 5FY7A 4C91A 2MYSA 2X9WA 3OYZA 2UXNB 1HX8A 1X79A 4NUUA 4HN9A 2DCFA 1UX5A 3ZCIA 3EDUA 3GA8A 3KV4A 1UCUA 3AAAB 3ETVA 4XAXB 3KV6A 1D1BA 3K3OA 4DVDA 3Q2MA 4ZHQE 2XAFB 3RPUA 4C90A 5IYZE 3FBLA 2X68A 3SOLA 5JR9B 2JQQA 4ZI3C 2A2FX 5LHIB 3VKGA 3ZYKA 3MXZA 5FXXA 3AA7B 5JDFA 5J2TE 4HTEA 4O4LE 3ZJ2A 3KBTA 2PBIA 2X51A 2OA5A 2VASA 4ILUA 3E22E 4BJNA 4H9NC 2KINB 3O1HA 1BR0A 3C4WA 4EYUA 2A3DA 2YK0A 4CQIA 4PFPA 3MZKB 3O4XE 3HL6A 5F8PA 1HS7A 2XASB 4GOUA 4Z8XA 2ZLYA 5LGTB 3O9XA 2D2SA 3K3QC 2G0UA 1WLXA 4IE0A 3VU7H 3KV5A 4XBFB 3U78A 3C64A 3LK3B 2XUEA 2JRKA 3IEEA 2Q9QB 3PDYA 5L3CB 3PU3A 1D0YA 4ISTA 1MMNA 5HXEA 3SWHA 3LJCA 2PFVA 2N9DA 5JDQA 4ZS2A 3A5XA 3L3PA 4I43B 5FXZA 2EHOC 1HF8A 3FHNA 4PJMA 3S4UA 1VRBA 2I59A 2KMFA 1G8XA 5DABA 4OK0A 3MK7C 5FXVA 4UVAB 5HXHA 2LSIA 3BQKA 1V9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4Y A;  4JEH B;  1BR0 A;  1FIO A;  1G73 A;  1S94 A;  2XHE B;  1FEW A;  3C98 B;  4TX5 A;  5LG4 A;  1HS7 A;  4JEU B;  3LG7 A;  2DNX A;  1EZ3 A; 
#chains in the Genus database with same CATH topology
 4IHJ E;  5AQS B;  4EZ4 A;  3ZC0 A;  2VK9 A;  4YXD A;  4G2A A;  4B3M T;  5J0Z A;  4X65 T;  2LSY A;  4LFC T;  4IE5 A;  3AEB A;  4LF5 T;  3V5U A;  1X9B A;  2FJB A;  3UUX B;  3ANW A;  1MMD A;  4OHF A;  4JI4 T;  3GN5 A;  3JC6 D;  2W63 A;  4DUZ T;  3SRZ A;  3ETU A;  3RYI E;  3I1A A;  2JQK A;  4IDZ A;  4U31 A;  3ZC1 A;  1FMW A;  4IIJ E;  3IBP A;  1XMO T;  2XM1 A;  3V5S A;  2H7V C;  3CX6 B;  3WAK A;  2MPK A;  4PW8 A;  4ZEY A;  2XSB A;  3RRC A;  2XQY A;  2IW5 B;  3F31 A;  2M6I A;  2K48 A;  3OTO T;  3E08 A;  2WBL A;  3KV9 A;  2YIN A;  4LMJ A;  1IBL T;  2MTQ A;  3N5L A;  1J5W A;  5AFU L;  3HKD E;  2LKH A;  2LHN A;  5AQJ B;  1WFD A;  2BG9 B;  3G06 A;  3QC9 A;  4EB6 E;  4ZI2 C;  3Q5E A;  2BS3 A;  2GK9 A;  5AQO B;  4YSY A;  1YQ4 A;  3CQX C;  4DR7 T;  3RH3 A;  2R6G F;  4ZI2 D;  2NTX A;  3LFM A;  3VHL A;  2BVM A;  3RI5 A;  2KWH A;  3I9Y A;  4DMV A;  4DR4 T;  2I6H A;  3NRY A;  3UU4 A;  4JEH B;  2K3W A;  5ABF B;  5LB7 B;  3KFW X;  5KMG P;  4X5T A;  5KXJ A;  4JLE A;  1J1J A;  1LKX A;  2XHE B;  3FB2 A;  2VVS A;  3MJX A;  2BS4 A;  1VCT A;  3UU3 A;  2PG8 A;  2LKG A;  2H88 A;  5CGM A;  4EAH A;  3ZLI A;  3EAM A;  3TLT A;  1ZOY A;  4PK5 A;  2DI4 A;  4UV8 B;  2V6Y B;  2V7J A;  5JQG E;  4AKI A;  1T98 A;  3ZMS B;  3N9Q A;  1Y64 B;  3LBX A;  2UUC T;  3JAD A;  4ZI7 E;  4DV0 T;  4QH4 A;  5LGU B;  2VKH A;  4UF0 A;  4Z91 A;  1US7 B;  4TZ4 C;  2WP9 A;  2CLY B;  4ZS3 A;  2BKP A;  3QB5 A;  5FL1 A;  4TUY E;  1QUU A;  2HH7 A;  1FEW A;  4H9R C;  2RA1 A;  3UTK A;  3MAC A;  5LXT E;  2DHR A;  3BK9 A;  3KVB A;  4PJL A;  3AEE A;  5KX5 E;  5L3D B;  1QSD A;  1BR4 A;  4GKK T;  1MNE A;  2L3L A;  5CA0 E;  4GYR A;  2W67 A;  5AQG B;  4AQY T;  4LML A;  1MIW A;  5CJ5 A;  4TX5 A;  5AQK B;  2IIU A;  3AB3 B;  2OLT A;  4G63 A;  3AEF A;  1N32 T;  4LF6 T;  1ZEE A;  2I0M A;  3OPC A;  2N2N A;  5LA6 E;  4A5X A;  4AXP A;  4CXW A;  4HFE A;  4IGU A;  2Y6X A;  3ZYL A;  3ONL C;  2J47 A;  2AXD S;  2CBJ A;  3CWZ B;  3AXJ B;  3HI2 A;  1W09 A;  2XAH B;  2CMR A;  4NPP A;  4CI1 B;  2IAK A;  2K24 A;  5L47 A;  4UEL A;  4EIW A;  5ADX L;  5LGN B;  4P0B A;  3Q5W A;  4AQG A;  4DR1 T;  3RC8 A;  5EK3 A;  3N2G E;  1OED E;  3T1Y T;  3EVY A;  1O3X A;  3K8P C;  3RIA A;  4BJM A;  5JDG A;  4DR2 T;  3AE9 A;  3NZP A;  3ZSS A;  4AKH A;  4EEB A;  3P50 A;  4WYV A;  3LK4 2;  3WI3 A;  4HFC A;  3CPZ A;  1M62 A;  3ZMT B;  2ACZ A;  2CRB A;  4HEA A;  3HKB E;  5AQP B;  2V7I A;  2MYS A;  4NUU A;  4OX9 T;  3EDU A;  4XAX B;  3K3O A;  3ONJ A;  4X62 T;  5AQQ B;  1NEK A;  3RPU A;  4C90 A;  3FBL A;  2X68 A;  2XQ3 A;  5JR9 B;  4ZI3 C;  2A2F X;  3VKG A;  5JDF A;  3KBT A;  2PBI A;  2JIW A;  2VAS A;  2UUB T;  4ILU A;  2UU9 T;  4H9N C;  3C4W A;  1E7P A;  5LMU T;  4CQI A;  4PFP A;  2XY8 B;  3O4X E;  5F8P A;  1HS7 A;  2XAS B;  4GOU A;  4Z8X A;  2LM2 A;  5LGT B;  2G0U A;  3U78 A;  3LK3 B;  2JRK A;  3IEE A;  5L4H A;  2Q9Q B;  4HFH A;  5CFB A;  4IL9 A;  3LJC A;  2VUR A;  3L3P A;  4PJM A;  3S4U A;  2KMF A;  2I59 A;  5DAB A;  5FXV A;  5HXH A;  5FNV E;  1V9D A;  1WYB A;  1M7K A;  2CWY A;  1WR6 A;  4QHO A;  1T7S A;  1UGO A;  2CE7 A;  1JNR A;  2XQ6 A;  4HWI B;  2KSR A;  2QVA A;  3CVR A;  3AEG A;  1WYC A;  3PUS A;  2E9X D;  2BBH A;  5LBM A;  2DWK A;  5IHY A;  1Z0P A;  3RIU A;  3BQI A;  4CXX A;  3R84 B;  5LYJ E;  2NTY A;  4FI5 A;  4NUV A;  3JAE A;  4O4I E;  2WDR A;  2YKS A;  3NWI A;  3RIU C;  1OED B;  4ZXL A;  3AED A;  2MOZ A;  3AE1 A;  3UQ4 A;  2VQF T;  2IC6 A;  4MAL A;  3CQG B;  3KVA A;  4QX8 B;  1MMG A;  4QX7 B;  4EZH A;  5FVL A;  1T8B A;  5C3J A;  1DU2 A;  4HWF A;  2CM0 A;  3I0Q A;  5H6Q B;  1XZY A;  2KND A;  3UFE A;  1OWA A;  3NRX A;  4UIG A;  4JI0 T;  2V1D B;  3C4X A;  3JAF A;  4QH1 A;  1WCR A;  2VVN A;  2C5J A;  3BQL A;  2EHO A;  3B13 A;  2HN2 A;  2C0S A;  1XDO A;  2X0Y A;  5JH7 E;  3O1J A;  4ASK A;  4PFO A;  5AQF B;  5C8Y E;  4QXH B;  3SFE A;  3H37 A;  2UXX B;  2ODV A;  3WAJ A;  4AI6 A;  3AAE B;  1QLB A;  5HXR A;  2D0U A;  1MIY A;  5M4Y A;  4H63 V;  4PK6 A;  3RYH E;  2BDE A;  5BR8 T;  2WCA A;  3N9N A;  5FXW A;  5L3F B;  4ZOL E;  3ZT7 A;  4A97 A;  3TLW A;  2EHO D;  4KP3 C;  5HAX A;  1HNX T;  1W0B A;  4HFV A;  3ZST A;  2CBI A;  5CB4 E;  3RKO A;  1LVF A;  4HGA A;  3ONX A;  3SS1 A;  3ZT5 A;  5FP3 A;  4EV6 A;  4TN7 B;  4IDP A;  3SFD A;  4DV5 T;  4YSX A;  2JJ9 A;  2RP4 A;  4ZZC A;  5JRE A;  3T8O A;  4TWF A;  1I94 T;  2WS3 A;  2XQ5 A;  3OYX A;  4EYY R;  3M65 A;  4JI2 T;  5AQT B;  3ZMU B;  2BG9 A;  3EDV A;  3GN5 B;  4HFD A;  2DWG A;  5A1L A;  4WW0 A;  4L0R A;  2V7L A;  5F3J A;  2L9Q A;  3C4Z A;  4P0A A;  2PJQ A;  2P9B A;  2VB6 A;  3LG7 A;  4GYS A;  4O2A E;  4PNI A;  1R8I A;  3AE2 A;  5E0O A;  2BG9 C;  4A98 A;  5ABE A;  2V5D A;  1BR1 A;  4U2Z A;  4X20 E;  1IBK T;  1JNZ A;  3FXE B;  4UVB B;  2JMK A;  4ADZ A;  1XNR T;  1WRD A;  1AJ3 A;  4TNW A;  3ZPO A;  4QXC B;  5IUX A;  4AKL A;  5ABG A;  2XZE A;  5HCJ A;  5HWX A;  2XSA A;  4LF8 T;  2K9A A;  2B1E A;  2ZM0 A;  3HKE E;  4O2B E;  1HG5 A;  4U72 A;  3VKH A;  3U3I A;  1XWM A;  4H9P C;  2ZM6 T;  5AQH B;  1KK7 A;  4YHH T;  3E0Z A;  5AQV B;  1SE7 A;  2V6Y A;  2J1D G;  3ZJ1 A;  3QB5 K;  3AA1 B;  5AQI B;  3AA6 B;  1VOM A;  4OYK A;  3I0O A;  1ZKE A;  3K3N A;  3LSV A;  2NR4 A;  3DP7 A;  2BKO A;  3PUZ F;  5HXC A;  4ILC A;  4YJ3 E;  2V8S V;  3NZQ A;  3IA3 A;  3RYF E;  2XQ4 A;  3ZYM A;  5LNK A;  4EGW A;  2V26 A;  4MHC A;  3PUX F;  2XTL A;  5L3B B;  1KF6 A;  4YY3 T;  3QUJ A;  4NIQ A;  4PJN A;  3EAB A;  2W62 A;  3F57 A;  2CXF A;  1MMA A;  2D0T A;  4JI3 T;  4IDN A;  1FMV A;  3P8C D;  3RF1 A;  4AIU A;  4DR3 T;  1N33 T;  4PAG A;  4U74 A;  2W66 A;  3LBX B;  1HFA A;  5ETW A;  3AE3 A;  3P4P A;  2BVL A;  4B3R T;  2H3R A;  3FZK B;  3PUV F;  4TWD A;  1X79 A;  2X0H A;  3KV4 A;  1UCU A;  5HEO A;  4ZHQ E;  3SOL A;  3A7M A;  2JQQ A;  1UUS A;  5LHI B;  5FXX A;  5J2T E;  3ZJ2 A;  2X51 A;  4Q25 A;  3FZL B;  3E22 E;  4DR6 T;  2KIN B;  1GQE A;  2YK0 A;  5AQL B;  4GKJ T;  2ZLY A;  3K3Q C;  1WLX A;  2VQE T;  4DID B;  1L0V A;  3AXJ A;  1T72 A;  4JI7 T;  3PU3 A;  2HHH T;  5HXE A;  3SWH A;  5AQU B;  2N9D A;  4YTN A;  4Z90 A;  4CN1 A;  3FHN A;  2FBW A;  1G8X A;  3ABV A;  1CHU A;  3MK7 C;  3BQK A;  2V7M A;  2KZ7 B;  3PUG A;  4IDQ A;  2XQA A;  4HKA A;  4LMK A;  2LRK A;  3RRW A;  5EK2 A;  2ZM2 A;  3UUN A;  2QGS A;  2YEV C;  2CWO A;  4JI5 T;  1ZP0 A;  4JI1 T;  5HEJ A;  3PV0 F;  2WMO A;  2XAJ B;  2N1G A;  3FZH B;  2LSK A;  4NXN T;  3PJA A;  5AQM B;  2MAW A;  5CA1 E;  2YN6 A;  3PUR A;  2V5C A;  4UV9 B;  3AVR A;  3NKZ A;  2UXD T;  2JQ9 A;  2C5K T;  4QH5 A;  2ZM8 A;  3IHR A;  3KDS E;  3JCF A;  3PTR B;  1J5E T;  1HCI A;  2H89 A;  2YDS A;  5JR9 A;  2WDV A;  5LHG B;  3ZN1 B;  2X9H A;  2UXC T;  3ZMV B;  4ANJ A;  2PTF A;  3MKD A;  3TLV A;  5JVD E;  4QXB B;  2M67 A;  4JI8 T;  5JRC B;  4HE8 A;  4LFA T;  2LE8 A;  5JR9 C;  3VR9 A;  5FYM A;  2H7O A;  2X67 A;  4U7I A;  2FJA A;  2WWU A;  2Q9Q A;  4DV7 T;  4ZI3 D;  5LJM A;  4WNK A;  1KNZ A;  4DUY T;  4KHZ F;  5LP6 E;  2HPJ A;  5J2U E;  4KHP T;  4YTP A;  2CEA A;  3FZM B;  1S94 A;  1LVK A;  3K1S A;  1CUN A;  3RX6 A;  2Q9Q C;  4IL4 A;  2WAU A;  2X66 A;  4L9I A;  1IZN B;  4ZZB A;  3B57 A;  3ZMZ B;  4IE4 A;  4ISS A;  3J9X 1;  1SA0 E;  2WZH A;  4CXY A;  1KFY A;  4MFR A;  3RKG A;  5GON E;  1XNQ T;  3N9P A;  3EUH A;  2LM9 A;  3UT5 E;  4CZZ B;  3Q5X A;  2V7K A;  4K0U A;  4H9S E;  4LF9 T;  2X0L B;  2BBJ A;  3AAI A;  3LDQ B;  3AE4 A;  5HEH A;  3C98 B;  2WQY A;  3F2E A;  4IT4 A;  1Y01 A;  4O8S A;  3GMI A;  2E9X B;  1YKH B;  2W00 A;  3CKD A;  4H9O C;  4DV4 T;  4XZC A;  3P4R A;  4KBM B;  1OED A;  4ILB A;  3UU8 A;  3AEA A;  4CI2 B;  2IHR 1;  4YTM A;  2XAG B;  5EK4 A;  3I9W A;  1YQ3 A;  2JPF A;  1S35 A;  3R6N A;  3AEC A;  5JTG A;  1OED C;  3C50 A;  3DTO A;  3NVO A;  5HEU A;  2XQ7 A;  2X9Y A;  1W0A A;  4DMW A;  4KMC A;  2JMH A;  4J2C A;  4COF A;  4DO0 A;  4U7Y A;  4UXN B;  2ES0 A;  1N36 T;  2DNX A;  3ZN0 B;  5JDM A;  5IWA T;  1SHZ C;  4IRE A;  1MIV A;  4UR9 A;  2VKO A;  2KT9 A;  2FUP A;  3QOF A;  2KWI B;  2UUA T;  2WSS V;  4HFI A;  1IJ6 A;  1Z8U A;  2NP9 A;  2WWV A;  3MA9 A;  2A72 A;  1N34 T;  3X1D A;  1XDP A;  1KNP A;  2OV9 A;  1YKE B;  3EHZ A;  2SPC A;  2IML A;  5DQV A;  4E7S A;  4ILA A;  4KUM B;  4WZX A;  5HWY A;  4CN6 A;  2HPL A;  2WU5 A;  4UEM A;  3UU6 A;  5J1G A;  2EHO B;  4JI6 T;  5FVK A;  2DLR A;  3PUQ A;  5JDN A;  4I0U A;  1D0X A;  4X1I E;  4O4J E;  5L3G B;  3H3A A;  1XMQ T;  5LBQ B;  3RYC E;  3VRB A;  3P4W A;  2CPT A;  5KDM C;  5LCY A;  2AE9 A;  3DJB A;  3RQU A;  3UUM A;  3OJA A;  3JC6 C;  3PJA J;  1EZ3 A;  3HR0 A;  3CIR A;  5DJQ C;  1ZV4 X;  3L09 A;  4EXT A;  1G73 A;  1E1H B;  1U4Q A;  2WDQ A;  3C51 A;  3ANW B;  2KXP B;  5DQW A;  4TV9 E;  5JDL A;  4YFS A;  3ZCJ A;  4YLH A;  4DBR A;  4HWC A;  5LHH B;  4A56 A;  3N2K E;  2D9D A;  2XM2 A;  4GK5 E;  4V1A v;  2E5L T;  5FY7 A;  4C91 A;  2X9W A;  1HX8 A;  4HN9 A;  2DCF A;  3ETV A;  3AAA B;  2CHN A;  5C2T A;  5HEG A;  3Q2M A;  2XAF B;  5IYZ E;  2E5V A;  3ZT6 A;  2V6X A;  3ZYK A;  5ABF A;  3AA7 B;  4AIS A;  4HTE A;  4BJN A;  3O1H A;  1HNZ T;  2A3D A;  4JBW F;  2D2S A;  1W9R A;  2BS2 A;  3C64 A;  4B3T T;  3PDY A;  5L3C B;  1MMN A;  1KNR A;  2A9U A;  5F5W A;  2PFV A;  5JDQ A;  3TLU A;  3A5X A;  4I43 B;  2W2U A;  4OK0 A;  2QRX A;  1HR0 T;  2VWA A;  2LOP A;  1U5P A;  2CCQ A;  3PE0 A;  4UVC B;  2W4X A;  4IE6 A;  1UK5 A;  5FL0 A;  2M6B A;  4MLK A;  3RIF A;  1HNW T;  2YU1 A;  4U2Y A;  2IDO B;  2F4V T;  4EED A;  2CHO A;  3PU8 A;  1ZHC A;  2L8K A;  4JV5 T;  2Z6E A;  4K0K T;  4TNV A;  3HKC E;  3RQW A;  2LT3 A;  3VRA A;  2CLY C;  3AE8 A;  3PUW F;  3EI0 A;  2LRL A;  3UUL A;  4P1N A;  2B76 A;  3Q9D A;  2NOX A;  2NWB A;  4GK0 E;  3PUA A;  1NEN A;  2LOS A;  4IE7 A;  1HG2 A;  2LSG A;  2K5B B;  3FZF B;  5EZY E;  4LFB T;  5AQR B;  1YD8 G;  2ZMA A;  4UF0 B;  5LOV E;  2LEH A;  4DV1 T;  2LJL A;  4DBQ A;  3AE7 A;  1OXZ A;  3D0T A;  3N9L A;  3UQ7 A;  3UU5 A;  4NXM T;  4YJ2 E;  2J4G A;  5FY1 A;  4YT0 A;  3N9M A;  4L5G A;  2LSJ A;  2Y48 B;  1KEY A;  5ABH A;  4QKN A;  2BZB A;  1H7C A;  3O1I A;  4PK4 A;  2E8I A;  2JQH A;  1VCS A;  4KX6 A;  3VR8 A;  2QYW A;  1BR2 A;  4JUY A;  4DR5 T;  3RLF F;  1NWM X;  4WBN E;  3UUB A;  4B6X A;  5LMN T;  3AA0 B;  1YXR A;  4PJJ A;  4MBQ A;  3OKQ A;  3ZKR A;  3LK2 B;  3RC3 A;  5JDH A;  4E7Z A;  2XAQ B;  3QNU A;  5L2L A;  4EOZ B;  4JYA T;  3GWH A;  4FJO A;  1UUR A;  2E2A A;  1IJ5 A;  2WU2 A;  2NW8 A;  1UX4 A;  3CML A;  4AQF A;  1D0Z A;  1NAF A;  2DL1 A;  3AE5 A;  1FIO A;  3FBZ A;  2VKJ A;  1HTJ F;  4F8H A;  2XQ9 A;  2YOE A;  4HWD A;  3AVS A;  2FJE A;  3RGL A;  4AQF C;  3CX8 B;  4P09 A;  4I50 E;  2VL8 A;  2WMN A;  1MND A;  5TAO A;  1B7T A;  5H6R B;  3L39 A;  4YHJ A;  4X64 T;  3P7I A;  2ODU A;  3N9O A;  4TWH A;  3ZEF B;  3IF8 B;  4I4T E;  5JRC A;  3KIN B;  5FMN A;  3NBX X;  2WM9 A;  4LF4 T;  4WBO A;  4ERR A;  3CQC B;  4O4H E;  4DND A;  4F6R C;  2LLY A;  4H9Q C;  2KLQ A;  3RHW A;  4OYJ A;  2CA5 A;  4KI0 F;  2YU2 A;  5FKY A;  2X9X A;  2CXL A;  5AQN B;  2XPK A;  4I55 E;  2HN1 A;  1IAP A;  3P4S A;  4IDO A;  3OBV E;  4BAY B;  3P4Q A;  4X1K E;  3A8Y C;  5L3E B;  3W15 B;  3Q5D A;  1D1A A;  5L4E A;  1D1C A;  3CX7 B;  4N78 D;  3FXD B;  4BA9 A;  3ESL A;  4OFZ A;  2J62 A;  2WY2 A;  3OVU A;  2RPA A;  4B3S T;  2QA7 A;  5LG4 A;  3L8R A;  2Q9Q D;  2BKN A;  2IUB A;  5BMV E;  2WZI A;  3B5M A;  4DV2 T;  3KBU A;  4AKG A;  4H63 H;  2MBG A;  2E9X A;  3HA4 A;  3N2O A;  5LJN A;  2W0G A;  4CI3 B;  3TLS A;  1IBM T;  2C5I T;  2D5U A;  4AKR B;  2W61 A;  2VKD A;  3H3M A;  3QK6 A;  4U33 A;  2E9X C;  5HXS A;  4X1Y E;  1LRZ A;  2UXB T;  1HX1 B;  1I6Z A;  2ACX A;  4DV3 T;  4QWN B;  4M1P A;  3J7Y q;  5FY0 A;  2LHR A;  4GIW A;  2Y8D A;  2CXD A;  4CN4 A;  5HYA A;  4JEU B;  1E2A A;  2BG9 E;  2IC9 A;  3TKL B;  2NW7 A;  4YSZ A;  4U3C A;  2NW9 A;  1SUM B;  2XQ8 A;  3PUY F;  3AE6 A;  1YW0 A;  4X66 T;  2VL0 A;  1WR0 A;  4TV8 E;  4DV6 T;  3OYZ A;  2UXN B;  1UX5 A;  3ZCI A;  3CK6 A;  3GA8 A;  3M3Z B;  3KV6 A;  1D1B A;  4DVD A;  4HWH A;  3UFG A;  2XJ7 A;  3MXZ A;  2YDQ A;  4O4L E;  3T1H T;  2OA5 A;  2WB5 A;  4HFB A;  1BR0 A;  4EYU A;  1FJG T;  3MZK B;  3HL6 A;  3O9X A;  4IE0 A;  3VU7 H;  3KV5 A;  4XBF B;  2XUE A;  2YDR A;  2FJD A;  1D0Y A;  5LG3 A;  4IST A;  4ZS2 A;  5FXZ A;  2EHO C;  1HF8 A;  5HCM A;  4LF7 T;  1VRB A;  4UVA B;  2LSI A; 
#chains in the Genus database with same CATH homology
 1WYB A;  2KZ7 B;  2V7M A;  2VWA A;  4IHJ E;  4EZ4 A;  3ZC0 A;  3PUG A;  2CWY A;  2VK9 A;  1WR6 A;  2LOP A;  4QHO A;  4G2A A;  1U5P A;  2LSY A;  2CCQ A;  4IE5 A;  3PE0 A;  2CE7 A;  3V5U A;  4HKA A;  4UVC B;  4IE6 A;  3RRW A;  5EK2 A;  3UUX B;  2ZM2 A;  3UUN A;  2QGS A;  2YEV C;  2CWO A;  3ANW A;  1MMD A;  4MLK A;  3CVR A;  2WMO A;  2YU1 A;  2XAJ B;  4OHF A;  2N1G A;  2LSK A;  1WYC A;  3PUS A;  3GN5 A;  2E9X D;  3PU8 A;  1ZHC A;  2L8K A;  2Z6E A;  5LBM A;  2DWK A;  5IHY A;  1Z0P A;  3HKC E;  3JC6 D;  5CA1 E;  2W63 A;  3SRZ A;  3BQI A;  3ETU A;  3RYI E;  3I1A A;  2LT3 A;  4CXX A;  3R84 B;  3PUR A;  2CLY C;  2NTY A;  5LYJ E;  4IDZ A;  3ZC1 A;  1FMW A;  4UV9 B;  3AVR A;  4FI5 A;  4NUV A;  4IIJ E;  3IBP A;  4O4I E;  2C5K T;  2ZM8 A;  3UUL A;  3IHR A;  2H7V C;  3CX6 B;  2NOX A;  3Q9D A;  2NWB A;  3V5S A;  3WAK A;  3KDS E;  4PW8 A;  4GK0 E;  3RRC A;  3PUA A;  3PTR B;  2LOS A;  4IE7 A;  1HG2 A;  2XQY A;  2LSG A;  2K5B B;  2IW5 B;  2MOZ A;  3F31 A;  2IC6 A;  1HCI A;  5EZY E;  2K48 A;  4MAL A;  3CQG B;  3KVA A;  4QX8 B;  5JR9 A;  1MMG A;  1YD8 G;  3E08 A;  2WBL A;  2ZMA A;  3KV9 A;  4QX7 B;  5LHG B;  2YIN A;  4UF0 B;  3ZN1 B;  4EZH A;  2X9H A;  5LOV E;  3ZMV B;  4ANJ A;  2MTQ A;  3N5L A;  3MKD A;  2LEH A;  5AFU L;  3HKD E;  5JVD E;  4QXB B;  2M67 A;  2CM0 A;  2LJL A;  4DBQ A;  3I0Q A;  5JRC B;  5H6Q B;  2LHN A;  2KND A;  3UFE A;  1OWA A;  3NRX A;  1OXZ A;  3D0T A;  3QC9 A;  4HE8 A;  3N9L A;  4EB6 E;  4ZI2 C;  2GK9 A;  2LE8 A;  4UIG A;  2V1D B;  5JR9 C;  3CQX C;  4YJ2 E;  5FYM A;  5FY1 A;  3C4X A;  3N9M A;  2H7O A;  4L5G A;  2X67 A;  2LSJ A;  3RH3 A;  2WWU A;  2Y48 B;  2Q9Q A;  4ZI3 D;  4QKN A;  5LJM A;  4ZI2 D;  2NTX A;  2BZB A;  2C5J A;  3BQL A;  3LFM A;  1H7C A;  3O1I A;  2EHO A;  4WNK A;  3B13 A;  2BVM A;  3VHL A;  1KNZ A;  2C0S A;  4PK4 A;  5LP6 E;  2E8I A;  2HPJ A;  2KWH A;  5J2U E;  3I9Y A;  5JH7 E;  3O1J A;  4DMV A;  4ASK A;  2CEA A;  1S94 A;  1BR2 A;  4JUY A;  1LVK A;  1CUN A;  4PFO A;  3NRY A;  2Q9Q C;  3RX6 A;  2WAU A;  5C8Y E;  2X66 A;  4QXH B;  4JEH B;  4L9I A;  1IZN B;  3H37 A;  2UXX B;  3B57 A;  1NWM X;  4WBN E;  2ODV A;  3WAJ A;  3ZMZ B;  4IE4 A;  3KFW X;  4ISS A;  5KMG P;  4AI6 A;  3AAE B;  3J9X 1;  4B6X A;  3AA0 B;  4JLE A;  5HXR A;  2D0U A;  4PJJ A;  4MBQ A;  3OKQ A;  1SA0 E;  1MIY A;  5M4Y A;  1LKX A;  4H63 V;  4PK6 A;  2BDE A;  3LK2 B;  3RYH E;  2XHE B;  3RC3 A;  5JDH A;  3FB2 A;  4E7Z A;  2XAQ B;  4MFR A;  4CXY A;  5L2L A;  4EOZ B;  3N9N A;  5GON E;  3GWH A;  3MJX A;  4FJO A;  5FXW A;  1IJ5 A;  3N9P A;  5L3F B;  2NW8 A;  4ZOL E;  3EUH A;  2EHO D;  4KP3 C;  2LM9 A;  2PG8 A;  5HAX A;  1UX4 A;  4HFV A;  3CML A;  3UT5 E;  4AQF A;  4CZZ B;  3Q5X A;  1D0Z A;  1NAF A;  2V7K A;  4K0U A;  4H9S E;  4EAH A;  5CB4 E;  3ZLI A;  3RKO A;  1LVF A;  2X0L B;  3AAI A;  4PK5 A;  2DI4 A;  1FIO A;  4HGA A;  3ONX A;  3C98 B;  3SS1 A;  4UV8 B;  3F2E A;  3FBZ A;  2V7J A;  2VKJ A;  4O8S A;  3GMI A;  1HTJ F;  2E9X B;  5FP3 A;  4TN7 B;  1YKH B;  5JQG E;  4AKI A;  3AVS A;  2W00 A;  3CKD A;  4H9O C;  1T98 A;  3ZMS B;  3N9Q A;  1Y64 B;  3LBX A;  4AQF C;  3CX8 B;  4P09 A;  4I50 E;  2VL8 A;  2WMN A;  4XZC A;  4ZI7 E;  4KBM B;  2JJ9 A;  2RP4 A;  1MND A;  5TAO A;  5JRE A;  3T8O A;  1B7T A;  5LGU B;  4CI2 B;  5H6R B;  2VKH A;  4UF0 A;  4YHJ A;  1US7 B;  2XAG B;  5EK4 A;  3I9W A;  3P7I A;  2JPF A;  4TZ4 C;  1S35 A;  3R6N A;  2CLY B;  2ODU A;  3N9O A;  3OYX A;  4ZS3 A;  4EYY R;  3ZEF B;  3IF8 B;  4I4T E;  5JRC A;  3KIN B;  3M65 A;  5FMN A;  3C50 A;  3DTO A;  3ZMU B;  4TUY E;  1QUU A;  2HH7 A;  3EDV A;  3GN5 B;  3NBX X;  2DWG A;  1FEW A;  5A1L A;  4H9R C;  2RA1 A;  4WW0 A;  4L0R A;  2V7L A;  2X9Y A;  5F3J A;  2L9Q A;  2WM9 A;  3C4Z A;  4P0A A;  3UTK A;  4DMW A;  3MAC A;  4WBO A;  4ERR A;  5LXT E;  3CQC B;  2DHR A;  3BK9 A;  3KVB A;  4PJL A;  4KMC A;  4O4H E;  5KX5 E;  5L3D B;  2JMH A;  4DND A;  2PJQ A;  4F6R C;  1QSD A;  4J2C A;  2P9B A;  2VB6 A;  4DO0 A;  3LG7 A;  4GYS A;  1BR4 A;  4H9Q C;  4O2A E;  2KLQ A;  4PNI A;  4OYJ A;  2CA5 A;  4UXN B;  2ES0 A;  1MNE A;  5E0O A;  2L3L A;  5CA0 E;  5FNV E;  2YU2 A;  2DNX A;  3ZN0 B;  5JDM A;  4GYR A;  1BR1 A;  1SHZ C;  2X9X A;  1MIV A;  2CXL A;  4X20 E;  2VKO A;  2KT9 A;  4I55 E;  1IAP A;  3FXE B;  4UVB B;  2JMK A;  4ADZ A;  1MIW A;  1WRD A;  2KWI B;  4TX5 A;  1AJ3 A;  2WSS V;  3ZPO A;  4QXC B;  3OBV E;  4BAY B;  1IJ6 A;  3AB3 B;  4AKL A;  5HWX A;  2NP9 A;  4G63 A;  3MA9 A;  4X1K E;  2K9A A;  5L3E B;  2B1E A;  2A72 A;  3W15 B;  2ZM0 A;  3HKE E;  4O2B E;  1ZEE A;  1HG5 A;  1D1A A;  4U72 A;  1D1C A;  2N2N A;  3CX7 B;  4N78 D;  3FXD B;  3VKH A;  3U3I A;  5LA6 E;  4BA9 A;  3ESL A;  1YKE B;  4AXP A;  4CXW A;  2SPC A;  4OFZ A;  5DQV A;  4E7S A;  4H9P C;  4KUM B;  2QA7 A;  5HWY A;  5LG4 A;  4IGU A;  1KK7 A;  2Q9Q D;  3E0Z A;  2Y6X A;  5BMV E;  2HPL A;  4UEM A;  3ZYL A;  2J1D G;  3KBU A;  5J1G A;  2EHO B;  3ZJ1 A;  4AKG A;  4H63 H;  3AA1 B;  2MBG A;  2E9X A;  3HA4 A;  3N2O A;  3CWZ B;  2DLR A;  3PUQ A;  5LJN A;  5JDN A;  3AA6 B;  2W0G A;  3HI2 A;  1D0X A;  1VOM A;  4CI3 B;  2XAH B;  4O4J E;  4X1I E;  2CMR A;  5L3G B;  4OYK A;  3H3A A;  3I0O A;  1ZKE A;  3K3N A;  4CI1 B;  5LBQ B;  2C5I T;  3RYC E;  2IAK A;  2K24 A;  3DP7 A;  2D5U A;  4UEL A;  5KDM C;  5LCY A;  4AKR B;  2W61 A;  2VKD A;  5HXC A;  4EIW A;  3QK6 A;  3DJB A;  5ADX L;  4YJ3 E;  3NZQ A;  5LGN B;  2E9X C;  5HXS A;  4P0B A;  3RYF E;  3Q5W A;  4X1Y E;  1LRZ A;  3UUM A;  4AQG A;  3OJA A;  3ZYM A;  3RC8 A;  5LNK A;  5EK3 A;  2ACX A;  3N2G E;  2V26 A;  3JC6 C;  4MHC A;  1EZ3 A;  4QWN B;  3HR0 A;  2XTL A;  5L3B B;  3EVY A;  5DJQ C;  1O3X A;  1ZV4 X;  3K8P C;  3L09 A;  4M1P A;  4BJM A;  4EXT A;  3QUJ A;  3J7Y q;  1G73 A;  5FY0 A;  5JDG A;  2LHR A;  4PJN A;  4GIW A;  2W62 A;  1E1H B;  1U4Q A;  3C51 A;  2Y8D A;  3NZP A;  2CXD A;  3F57 A;  4AKH A;  3ANW B;  2KXP B;  2CXF A;  1MMA A;  5DQW A;  4TV9 E;  5HYA A;  2D0T A;  4JEU B;  5JDL A;  4YFS A;  3ZCJ A;  4YLH A;  1FMV A;  3LK4 2;  3P8C D;  3WI3 A;  2IC9 A;  4DBR A;  3TKL B;  3CPZ A;  2NW7 A;  4PAG A;  4U74 A;  2NW9 A;  3LBX B;  1HFA A;  3ZMT B;  5ETW A;  5LHH B;  4A56 A;  3N2K E;  4HEA A;  1YW0 A;  4GK5 E;  2BVL A;  3HKB E;  4V1A v;  2H3R A;  4TV8 E;  2V7I A;  5FY7 A;  4C91 A;  2MYS A;  2X9W A;  3OYZ A;  2UXN B;  1HX8 A;  1X79 A;  4NUU A;  4HN9 A;  2DCF A;  1UX5 A;  3ZCI A;  3EDU A;  3GA8 A;  3KV4 A;  1UCU A;  3AAA B;  3ETV A;  4XAX B;  3KV6 A;  1D1B A;  3K3O A;  4DVD A;  3Q2M A;  4ZHQ E;  2XAF B;  3RPU A;  4C90 A;  5IYZ E;  3FBL A;  2X68 A;  3SOL A;  5JR9 B;  2JQQ A;  4ZI3 C;  2A2F X;  5LHI B;  3VKG A;  3ZYK A;  3MXZ A;  5FXX A;  3AA7 B;  5JDF A;  5J2T E;  4HTE A;  4O4L E;  3ZJ2 A;  3KBT A;  2PBI A;  2X51 A;  2OA5 A;  2VAS A;  4ILU A;  3E22 E;  4BJN A;  4H9N C;  2KIN B;  3O1H A;  1BR0 A;  3C4W A;  4EYU A;  2A3D A;  2YK0 A;  4CQI A;  4PFP A;  3MZK B;  3O4X E;  3HL6 A;  5F8P A;  1HS7 A;  2XAS B;  4GOU A;  4Z8X A;  2ZLY A;  5LGT B;  3O9X A;  2D2S A;  3K3Q C;  2G0U A;  1WLX A;  4IE0 A;  3VU7 H;  3KV5 A;  4XBF B;  3U78 A;  3C64 A;  3LK3 B;  2XUE A;  2JRK A;  3IEE A;  2Q9Q B;  3PDY A;  5L3C B;  3PU3 A;  1D0Y A;  4IST A;  1MMN A;  5HXE A;  3SWH A;  3LJC A;  2PFV A;  2N9D A;  5JDQ A;  4ZS2 A;  3A5X A;  3L3P A;  4I43 B;  5FXZ A;  2EHO C;  1HF8 A;  3FHN A;  4PJM A;  3S4U A;  1VRB A;  2I59 A;  2KMF A;  1G8X A;  5DAB A;  4OK0 A;  3MK7 C;  5FXV A;  4UVA B;  5HXH A;  2LSI A;  3BQK A;  1V9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...