2DNXA

Solution structure of rsgi ruh-063, an n-terminal domain of syntaxin 12 from human cdna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
130
structure length
130
Chain Sequence
GSSGSSGQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntaxin-12
publication title Solution structure of RSGI RUH-063, an N-terminal domain of Syntaxin 12 from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 46
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dnxA00
5M4YA 1FIOA 1FEWA 3LG7A 1HS7A 2DNXA 3C98B 5LG4A 4JEHB 4JEUB 1G73A 4TX5A 1EZ3A 1S94A 2XHEB 1BR0A
chains in the Genus database with same CATH superfamily
2A3DA 4DV2T 3ZSTA 2PG8A 4HN9A 3JAFA 3E0ZA 3ZC0A 4JV5T 5EK4A 2ZM0A 2XZEA 3OPCA 3UT5E 3IBPA 4OX9T 1NENA 5FXXA 2CBJA 2WWVA 2JJ9A 1Y64B 4DIDB 3RYHE 4BJNA 5JH7E 2Q9QB 5FXWA 3ETVA 3NVOA 3DJBA 2MYSA 2XM1A 2WBLA 5F3JA 2V7IA 1W09A 3AA7B 1UK5A 4ILBA 3DP7A 3VRAA 3AB3B 4H63V 5F8PA 3ZMZB 5HCMA 4XAXB 3RX6A 2HH7A 4GOUA 2K24A 1BR0A 5FL1A 3WAKA 3GA8A 3PJAJ 3AEFA 4F6RC 4TWFA 2LE8A 4B3MT 4JI5T 2LJLA 3FZMB 2Q9QD 1HG2A 5DABA 2KMFA 5FY1A 2IDOB 5LJMA 1LVFA 1WRDA 3KINB 2KLQA 2X9YA 4F8HA 4H9OC 2VWAA 4CXWA 4EIWA 2K48A 3X1DA 1U5PA 2E9XC 4KP3C 1UX5A 1V9DA 4P0AA 4YLHA 4YSXA 4ANJA 3SRZA 4OYJA 5FNVE 4UR9A 4B3ST 5AFUL 2BBHA 2LRKA 4UXNB 3UU3A 4ADZA 2V6YA 2WY2A 4MALA 2VURA 4CZZB 3RIFA 5LHHB 4EYUA 2XQ9A 5LMNT 4WBOA 3N2GE 3HL6A 4JBWF 3SOLA 3T1HT 3HKDE 2XAHB 4ZI7E 3FB2A 3K3NA 2BZBA 5LG4A 4IDPA 3O9XA 4Q25A 3UU6A 4JI2T 4NIQA 5JR9B 3RRCA 3UQ7A 4QHOA 1KFYA 4UEMA 3F57A 2LSYA 4AISA 3T1YT 3RLFF 4I50E 4JI3T 3UU4A 3QK6A 4JI6T 2DWKA 2JMHA 1OEDB 2EHOB 2VB6A 3ABVA 2C5KT 5AQRB 3AEEA 5EK3A 3L09A 1FMVA 2LKHA 4FI5A 3FZFB 3QB5A 4ZZCA 4P1NA 3AVRA 4L0RA 3RKOA 3CK6A 1QSDA 5TAOA 3V5UA 3ZJ1A 2EHOD 3RI5A 3CX8B 5HYAA 3UTKA 4TX5A 2XJ7A 1XNQT 2N1GA 4PK6A 3RC3A 3TKLB 3JADA 3N5LA 4PJNA 4ILCA 2DNXA 3O4XE 1G73A 5ETWA 1E2AA 4EV6A 1HX8A 3CX7B 4ILUA 5LGUB 4X1KE 2E5VA 4TNVA 3RKGA 2ZM2A 1H7CA 2BVLA 3CVRA 4X5TA 3BQLA 5LHIB 2WDVA 2C0SA 1T98A 3I9WA 1WYBA 2LT3A 5HWYA 3EI0A 4OK0A 1J5WA 2VVSA 3N2KE 2X9HA 1M62A 4LFCT 5LP6E 4AQFA 3KV9A 1QUUA 1CHUA 3A5XA 4PK4A 2UXNB 5JRCB 4AKHA 5L3GB 2LHRA 4ZS3A 1IZNB 4ZI2D 4H63H 4KHPT 2CHOA 1S35A 3ZSSA 4JI8T 4MFRA 2XAGB 3UU5A 2E2AA 4H9NC 1XMQT 4IDQA 4BJMA 4U31A 2VKOA 2LSGA 3AEDA 1IBLT 3RQWA 2KXPB 1MNEA 5AQKB 3O1JA 5IUXA 3RIUC 2M6IA 2W61A 2K9AA 4QXHB 4JUYA 4O2BE 1HTJF 3PUXF 2WU5A 1ZHCA 1YW0A 3HKBE 4I55E 3PTRB 2C5IT 3AAIA 2W0GA 1UGOA 2WZIA 3AE2A 3EHZA 1KNZA 2DWGA 4UVAB 4XZCA 4H9SE 3N9LA 5AQJB 4KUMB 3LK3B 4CXXA 5CFBA 3ANWA 1IBMT 3N9MA 1E1HB 2MPKA 2JPFA 2IC6A 5J1GA 3EAMA 5LB7B 2V6XA 3N9NA 2DLRA 3NWIA 4MBQA 2AXDS 4AQYT 4DMWA 5FY0A 4DV4T 5AQHB 1WR0A 4P09A 5LCYA 1D1CA 3AEBA 4NUVA 2XAQB 5KDMC 3NKZA 3DTOA 2CWYA 3Q5EA 1NEKA 3SWHA 1OEDE 2ACXA 3LDQB 3ZN0B 1XDPA 3OJAA 1E7PA 3FXEB 5EK2A 4ZZBA 5L3FB 3I0OA 2Y6XA 2JIWA 1OXZA 2D0UA 4TN7B 3ZYLA 2NW7A 3N9OA 2J62A 3U3IA 3L8RA 2XQ3A 2UXCT 3LK42 4IE6A 5C2TA 2M67A 4HWHA 3MXZA 1KEYA 1MNDA 4NXMT 3KV4A 4K0KT 1U4QA 2X9WA 3N9PA 4GYSA 3VKHA 2IMLA 1D1BA 2V6YB 4M1PA 4EEDA 4LF6T 2N2NA 3C4XA 1MIWA 3RYIE 1MIYA 1HNZT 5ADXL 2YU2A 5LXTE 5JVDE 3ZT7A 4DUYT 3AE7A 5IWAT 1YKEB 4QX8B 4O4HE 3D0TA 3IEEA 4C91A 1VCSA 2ZM6T 3H3AA 3JC6D 4WZXA 2HPLA 4K0UA 5KXJA 5FVLA 1T7SA 2DHRA 4DVDA 2CLYB 2YINA 4CI1B 4TZ4C 2NP9A 3VR9A 5JRCA 1IBKT 4O4LE 1JNRA 2CLYC 2DL1A 5AQSB 3S4UA 3RF1A 4ZS2A 4PK5A 5E0OA 4ZI3D 3ZKRA 3PUZF 5FKYA 3P4PA 5JREA 3FHNA 4DV6T 5ABFA 3OTOT 3PV0F 4C90A 2NTYA 2X51A 1M7KA 2HPJA 2NWBA 3AA1B 1WR6A 3B5MA 2B76A 4JI1T 2BKPA 4U2ZA 1O3XA 4UV8B 4IREA 4V1Av 3AE8A 5FMNA 2VASA 2WQYA 4JI7T 3K3QC 3ZJ2A 3QNUA 4X62T 3KVAA 4UF0A 3ZEFB 4PFPA 3VRBA 2VL8A 1QLBA 2VVNA 2LM9A 4Z90A 3PUSA 3IHRA 3I9YA 3P8CD 3VHLA 5JDQA 1IJ6A 5EZYE 5CA0E 3PURA 5F5WA 3L3PA 5CA1E 4AKIA 4LF9T 5H6QB 4LF7T 2Q9QC 1HG5A 3LJCA 3HA4A 3KV5A 5LNKA 4YXDA 1WFDA 3LK2B 1N32T 4YTMA 2J1DG 1W0AA 4LMKA 4MHCA 4U72A 3W15B 5JDGA 4JI4T 5L3BB 1BR2A 3AAEB 2RP4A 4AQFC 5CGMA 5BMVE 5LGTB 4OYKA 2JQQA 2ODUA 3HKEE 3ONXA 3BK9A 5LGNB 4ZEYA 1ZOYA 5FY7A 5L3EB 4ASKA 3RGLA 3FZHB 2I6HA 4UELA 2KINB 3PU8A 4O4IE 4LF4T 4A5XA 2UUBT 2V5CA 3ONJA 5C3JA 5ABHA 4A98A 3ZT5A 4GKJT 2X67A 3MKDA 2XAFB 2V8SV 2BS4A 3KV6A 2YU1A 5DQVA 2UXBT 3WAJA 3ANWB 3PUYF 3EDUA 4COFA 3Q5WA 1YKHB 1ZEEA 2LOPA 4CQIA 3ZLIA 5JR9C 3QB5K 2E5LT 3L39A 2PBIA 2V7JA 4JEHB 1Y01A 4IE0A 1X9BA 1SUMB 2W2UA 4DV5T 2HHHT 3IA3A 3UFEA 3UULA 1OEDC 2FUPA 2EHOC 5HWXA 2LEHA 1XNRT 2BKNA 2V26A 2H88A 5H6RB 2NW8A 2CBIA 1Z0PA 2N9DA 1MMGA 1KNPA 3F2EA 3RIAA 3O1HA 3PUWF 3VU7H 2C5JA 1HCIA 4KBMB 2HN1A 2YDSA 4CN4A 3EVYA 2BG9A 3PUQA 3Q2MA 4LFAT 3K1SA 3EUHA 3QOFA 2ZMAA 4NUUA 2ODVA 5IHYA 2WZHA 3CKDA 1MMDA 2HN2A 5AQTB 5C8YE 3JCFA 2CHNA 5AQVB 4FJOA 5LA6E 2PJQA 4HWCA 4DR7T 2YKSA 5LMUT 1UURA 3GWHA 3IF8B 4ZHQE 4AQGA 1G8XA 2BBJA 2LRLA 3C51A 3AEAA 3H3MA 4QXCB 2CCQA 1HFAA 4PFOA 3TLWA 5L47A 5BR8T 3UUXB 2XQAA 2W62A 5J0ZA 4ZI2C 1FMWA 4LF5T 3RHWA 4I4TE 5FXZA 3T8OA 3ZMTB 4DO0A 2A72A 3ZCJA 3FZLB 4EGWA 3C50A 3UQ4A 2R6GF 1D0ZA 3ZYKA 3MZKB 3A7MA 3NBXX 2PFVA 3PU3A 1FIOA 4E7SA 3PE0A 5LOVE 1MIVA 1XZYA 3M65A 5FVKA 4GK0E 3RYCE 2E9XA 2WM9A 4I0UA 2X0HA 2WS3A 5ABFB 4UVBB 2H7VC 1D0XA 3ESLA 4EZHA 2W66A 4X66T 4UIGA 3KFWX 1NWMX 1I6ZA 4U7IA 2OA5A 2OV9A 3OYXA 1FJGT 2VQFT 2VKDA 5AQFB 4EAHA 3ZMVB 3I0QA 3R84B 4IE4A 2GK9A 4YY3T 4UF0B 5JTGA 3N2OA 3VKGA 3PUVF 3ZC1A 4HTEA 2CM0A 3UUBA 3Q5DA 3Q9DA 1YD8G 5HXCA 3FZKB 2FJEA 4HWDA 2WU2A 1KF6A 4N78D 4KMCA 2NTXA 3J7Yq 2XQ7A 1N36T 4O8SA 3RH3A 5HXRA 1ZV4X 4UVCB 4QH5A 1CUNA 2XQ4A 2YDRA 3TLTA 1LRZA 3AE3A 5AQUB 2JRKA 5HEJA 2IC9A 3GMIA 2XQYA 2CE7A 3C4ZA 5FXVA 2JQ9A 4ZOLE 1D1AA 5FP3A 5LJNA 3OYZA 4PW8A 4IDNA 3UU8A 4L5GA 2LHNA 5FYMA 5AQGB 4AI6A 4TWDA 3K8PC 4HKAA 2WP9A 2XPKA 4HFVA 2XQ6A 3QC9A 4YJ2E 2XTLA 1L0VA 3CX6B 5HEGA 1HNWT 3K3OA 3JC6C 5HXEA 3PUGA 4CI2B 3Q5XA 3AA0B 4AKRB 3CPZA 2CXFA 2LM2A 2UXXB 2ACZA 2WAUA 3TLVA 5J2TE 3NRYA 4YTPA 3AECA 4B3TT 2E8IA 4YTNA 3MA9A 3AXJA 4TV8E 4ZI3C 3C4WA 4X1IE 3A8YC 5HCJA 3AE9A 2CWOA 2LSJA 3LFMA 2X66A 2WB5A 5AQQB 5HEHA 3NRXA 4HEAA 2J47A 4LMJA 3CQGB 2UU9T 4JLEA 4IL4A 1EZ3A 1W9RA 3P4RA 3CQCB 3V5SA 4YSYA 3ONLC 3VR8A 2ES0A 4DV3T 5JDNA 4HFIA 2XY8B 3RPUA 2VL0A 1VOMA 2BG9B 3RIUA 4DUZT 5IYZE 2FJBA 5L4HA 3LBXA 1MMAA 1N33T 5HXHA 4IE7A 4YHJA 4GK5E 3PUAA 3ZPOA 2V7LA 4B6XA 4JI0T 1LKXA 3NZPA 5AQMB 1SE7A 2D5UA 3F31A 4H9QC 3SFEA 2WWUA 2WSSV 4WBNE 1UUSA 1AJ3A 3KBTA 5AQLB 1US7B 4LFBT 4AKGA 4HGAA 2FJDA 5HEOA 2V5DA 1J5ET 2MAWA 3HI2A 5JDMA 4YJ3E 3ZCIA 1WLXA 2NOXA 4GKKT 4IDZA 1HS7A 1HX1B 3BQKA 1SHZC 5JDHA 1IAPA 4Z91A 2W00A 3C64A 3FXDB 2IW5B 2NR4A 4JEUB 2AE9A 2BS3A 4X65T 4IDOA 2YN6A 2KNDA 3H37A 2D9DA 2ZM8A 3AVSA 5AQNB 4DR2T 1WCRA 2D0TA 3RYFE 2V1DB 4WYVA 3SS1A 2H89A 1BR1A 2E9XB 3B57A 5ABEA 2YK0A 2KZ7B 4PAGA 2UUAT 2A2FX 5JQGE 3AAAB 4ISSA 5L3CB 3UFGA 4KHZF 1R8IA 3I1AA 2WMOA 4TUYE 5M4YA 4XBFB 4QH4A 2E9XD 4YSZA 1ZP0A 3CIRA 3ZMUB 4GIWA 1FEWA 2B1EA 4ZXLA 5JDFA 4L9IA 1W0BA 4U74A 3KBUA 4X1YE 2XAJB 3R6NA 2K3WA 1UX4A 2L8KA 1YXRA 3OVUA 3AA6B 5A1LA 2CMRA 2WMNA 1HF8A 4WNKA 2LLYA 4IGUA 2MTQA 4H9PC 4DBQA 4QWNB 4U7YA 3GN5A 5AQIB 4PJLA 4PJMA 4CN6A 2NW9A 4PJJA 3E22E 5CJ5A 3N9QA 4EXTA 2H3RA 4CXYA 3FBLA 4CI3B 4B3RT 3BQIA 4AXPA 4G2AA 3EDVA 3ZN1B 4DR5T 2QA7A 2CXLA 1SA0E 2FJAA 1GQEA 1X79A 4EYYR 3HR0A 4GYRA 2X68A 5LBMA 3AE4A 4E7ZA 1HR0T 2YOEA 4YHHT 3WI3A 4IE5A 4QXBB 2XHEB 3CMLA 4ILAA 2XASB 2LSKA 2V7KA 2BG9E 2Y8DA 3PJAA 4IIJE 2W63A 2I0MA 4TV9E 3M3ZB 4DV1T 5DQWA 3AE6A 4QX7B 2QRXA 3UUMA 2WDQA 3TLSA 5FL0A 4DR6T 2QGSA 2BVMA 2Q9QA 4DV7T 3ZT6A 4HFHA 1N34T 3RC8A 2JQKA 2P9BA 4DBRA 2LOSA 2OLTA 1JNZA 3LG7A 4I43B 4H9RC 3PDYA 4X20E 4A56A 2KSRA 4P0BA 3AXJB 4EEBA 2F4VT 2CRBA 4HFDA 2BS2A 4TNWA 3AE5A 2G0UA 4AIUA 1XWMA 1MMNA 4EZ4A 2W67A 1VCTA 4HE8A 2D2SA 5GONE 3KDSE 2KWHA 2VKJA 4O2AE 2QVAA 4ISTA 2RPAA 3U78A 4DMVA 3MJXA 1B7TA 1UCUA 3LBXB 4QKNA 2JQHA 3FBZA 3QUJA 2MBGA 1BR4A 4A97A 4HWFA 3P4QA 1HNXT 2V7MA 1J1JA 3RRWA 4HWIB 4G63A 2CA5A 1VRBA 3SFDA 1IJ5A 3EABA 4DR1T 2IIUA 4JYAT 2YEVC 5AQPB 1S94A 4KI0F 2XQ8A 1DU2A 2KT9A 1KNRA 4U2YA 2J4GA 4U33A 3B13A 2VK9A 4UV9B 4J2CA 5JR9A 2X9XA 4EB6E 2CEAA 4TWHA 1YQ3A 2M6BA 4AKLA 4PNIA 2BKOA 3ZMSB 3ETUA 1KK7A 5KX5E 4YT0A 3MK7C 1OEDA 2EHOA 1XDOA 1YQ4A 2L3LA 3CWZB 4QH1A 4BAYB 2Z6EA 4CN1A 4IHJE 5ABGA 4DNDA 4O4JE 5J2UE 3TLUA 1Z8UA 1ZKEA 1T72A 4NPPA 2KWIB 2XQ5A 3UUNA 2ZLYA 2H7OA 5HEUA 3OKQA 2W4XA 2X0LB 3KVBA 2JMKA 5L4EA 1WYCA 3LSVA 4NXNT 5LBQB 3O1IA 4BA9A 5CB4E 2MOZA 2VKHA 4DR4T 2IUBA 4LMLA 1XMOT 2YDQA 2FBWA 3JAEA 4EOZB 2CXDA 3J9X1 3G06A 2SPCA 2PTFA 3AEGA 5LYJE 5AQOB 2DI4A 4OHFA 3E08A 3NZQA 1OWAA 5LHGB 4IT4A 1LVKA 1NAFA 4HFEA 2BDEA 3ZYMA 4U3CA 2IHR1 1T8BA 3AE1A 3P4SA 4KX6A 3GN5B 3P7IA 2RA1A 3RQUA 5L3DB 4DV0T 4DR3T 5HAXA 4LF8T 4ERRA 5KMGP 2UXDT 3CQXC 4YFSA 3P50A 4X64T 2L9QA 2QYWA 2X0YA 2Y48B 3HKCE 4HFBA 5JDLA 2A9UA 2XUEA 5DJQC 3OBVE 4IL9A 2LKGA 2VQET 2UUCT 5L2LA 2XSBA 5HXSA 2IAKA 2K5BB 2WCAA 3P4WA 2WDRA 2I59A 2CPTA 3MACA 2XM2A 4OFZA 4WW0A 4Z8XA 2XSAA 2LSIA 4HFCA 1D0YA 3C98B 4MLKA 1I94T 2BG9C 5LG3A 2DCFA
chains in the Genus database with same CATH topology
5L3FB 3ZCJA 1UX4A 2A3DA 2L8KA 3C50A 3I0OA 2Y6XA 1OXZA 2D0UA 2PG8A 3AA6B 4HN9A 4TN7B 5A1LA 1D0ZA 3ZYLA 2CMRA 3ZYKA 3MZKB 2NW7A 2WMNA 1HF8A 3E0ZA 3ZC0A 3N9OA 3NBXX 2PFVA 4WNKA 3PU3A 1FIOA 5EK4A 2ZM0A 3U3IA 4E7SA 3LK42 3PE0A 4IE6A 4IGUA 2MTQA 4H9PC 3UT5E 2M67A 4DBQA 5LOVE 1MIVA 3IBPA 4QWNB 5FXXA 3M65A 3GN5A 3MXZA 1MNDA 3KV4A 4PJLA 1U4QA 2JJ9A 2X9WA 3N9PA 4PJMA 4GYSA 4GK0E 3RYCE 1Y64B 2E9XA 3VKHA 1D1BA 3RYHE 4BJNA 2WM9A 4M1PA 2N2NA 5JH7E 2NW9A 4PJJA 3C4XA 1MIWA 3E22E 3RYIE 2Q9QB 5FXWA 4UVBB 1MIYA 2H7VC 3ETVA 1D0XA 3N9QA 3DJBA 3ESLA 2MYSA 4EZHA 4EXTA 5ADXL 2WBLA 2YU2A 5F3JA 5LXTE 2H3RA 2V7IA 4UIGA 5JVDE 4CXYA 3AA7B 3FBLA 4CI3B 3KFWX 1NWMX 3BQIA 3DP7A 4AXPA 4G2AA 3AB3B 3EDVA 4H63V 2OA5A 5F8PA 3ZN1B 3ZMZB 2QA7A 4XAXB 2CXLA 3OYXA 1SA0E 2HH7A 3RX6A 1YKEB 2VKDA 4O4HE 1X79A 3D0TA 4QX8B 4GOUA 2K24A 1BR0A 3IEEA 4EAHA 3WAKA 3ZMVB 4C91A 3I0QA 4EYYR 3HR0A 3GA8A 4GYRA 3R84B 2X68A 4IE4A 4F6RC 5LBMA 2LE8A 2GK9A 2LJLA 3H3AA 4E7ZA 3JC6D 2Q9QD 3WI3A 2HPLA 1HG2A 4K0UA 5DABA 2KMFA 4UF0B 5FY1A 4IE5A 4QXBB 3N2OA 3VKGA 2DHRA 5LJMA 2XHEB 1LVFA 1WRDA 3CMLA 3ZC1A 4DVDA 4HTEA 2CLYB 2CM0A 3KINB 2YINA 3Q9DA 2XASB 2KLQA 1YD8G 2LSKA 5HXCA 4CI1B 2X9YA 4TZ4C 2NP9A 4H9OC 2VWAA 4CXWA 5JRCA 4EIWA 2V7KA 2K48A 2Y8DA 4IIJE 4O4LE 1U5PA 2E9XC 2W63A 2CLYC 4N78D 4TV9E 4KMCA 2NTXA 5DQWA 4KP3C 1UX5A 3J7Yq 4QX7B 1V9DA 3S4UA 4O8SA 4P0AA 4YLHA 3RH3A 5HXRA 1ZV4X 4ANJA 4UVCB 3UUMA 4ZS2A 3SRZA 4OYJA 4PK5A 5FNVE 5E0OA 4ZI3D 1CUNA 5AFUL 4UXNB 4ADZA 2QGSA 5JREA 3FHNA 4MALA 1LRZA 2BVMA 4CZZB 2Q9QA 2JRKA 5LHHB 2IC9A 4EYUA 3RC8A 3GMIA 2XQYA 4WBOA 3N2GE 3HL6A 4C90A 2P9BA 4DBRA 2LOSA 2CE7A 2NTYA 3LG7A 2X51A 4I43B 4H9RC 3SOLA 3PDYA 3HKDE 3C4ZA 2HPJA 5FXVA 2XAHB 2NWBA 3FB2A 4ZI7E 3K3NA 4X20E 3AA1B 4A56A 1WR6A 4ZOLE 4P0BA 2BZBA 5LG4A 3O9XA 1D1AA 5FP3A 5LJNA 3OYZA 1O3XA 5JR9B 4UV8B 3RRCA 4PW8A 2G0UA 4V1Av 4QHOA 5FMNA 2VASA 1MMNA 4L5GA 4UEMA 3K3QC 4EZ4A 3ZJ2A 3F57A 2LSYA 3KVAA 4I50E 4HE8A 4UF0A 3ZEFB 2D2SA 4PFPA 5GONE 2VL8A 3KDSE 2KWHA 2LM9A 3QK6A 2VKJA 2LHNA 4O2AE 5FYMA 2DWKA 2JMHA 3PUSA 4AI6A 2EHOB 3IHRA 2VB6A 3I9YA 3P8CD 3VHLA 5JDQA 1IJ6A 5EZYE 5CA0E 3K8PC 2C5KT 4HKAA 5EK3A 4HFVA 3L09A 1FMVA 3PURA 3QC9A 4ISTA 4FI5A 3U78A 4YJ2E 3L3PA 2XTLA 4DMVA 3MJXA 5CA1E 4AKIA 5H6QB 1B7TA 3CX6B 1UCUA 3LBXB 4QKNA 3K3OA 3JC6C 2Q9QC 3AVRA 1HG5A 3LJCA 3FBZA 4L0RA 5HXEA 3RKOA 3HA4A 3KV5A 3QUJA 2MBGA 1BR4A 3PUGA 1QSDA 4CI2B 3Q5XA 5TAOA 3V5UA 5LNKA 2V7MA 3AA0B 4AKRB 3RRWA 3ZJ1A 4G63A 3LK2B 2EHOD 3CPZA 2CA5A 2CXFA 1VRBA 2J1DG 2UXXB 1IJ5A 3CX8B 4MHCA 4U72A 3W15B 5JDGA 5HYAA 3UTKA 4TX5A 5L3BB 1BR2A 3AAEB 2RP4A 2WAUA 2YEVC 4AQFC 2N1GA 1S94A 5BMVE 5LGTB 4OYKA 4PK6A 2JQQA 3RC3A 2KT9A 3TKLB 5J2TE 2ODUA 3NRYA 3B13A 3N5LA 2VK9A 3HKEE 3ONXA 4PJNA 2E8IA 2DNXA 3MA9A 3BK9A 4TV8E 4UV9B 3O4XE 4J2CA 4ZI3C 1G73A 3C4WA 5LGNB 5ETWA 4X1IE 5JR9A 2X9XA 1HX8A 3CX7B 4ILUA 5FY7A 2CWOA 2CEAA 4EB6E 4X1KE 5L3EB 5LGUB 4ASKA 2LSJA 3LFMA 2X66A 4AKLA 4PNIA 3NRXA 4HEAA 2ZM2A 3CQGB 3ZMSB 4UELA 3ETUA 1KK7A 5KX5E 4JLEA 3MK7C 1H7CA 1EZ3A 2BVLA 2KINB 3CQCB 3CVRA 3PU8A 4O4IE 3BQLA 2EHOA 3V5SA 5LHIB 2ES0A 2C0SA 1T98A 3I9WA 5JDNA 2L3LA 3CWZB 4BAYB 3RPUA 2Z6EA 2X67A 3MKDA 2XAFB 4IHJE 4DNDA 1WYBA 2LT3A 1VOMA 4O4JE 5HWYA 5J2UE 4OK0A 5IYZE 3LBXA 1ZKEA 3KV6A 1MMAA 2YU1A 2KWIB 5DQVA 5HXHA 3UUNA 2ZLYA 4IE7A 3N2KE 2X9HA 3WAJA 2H7OA 4YHJA 4GK5E 3PUAA 5LP6E 3ANWB 4AQFA 3KV9A 3ZPOA 3OKQA 3EDUA 2X0LB 1QUUA 3KVBA 3A5XA 2V7LA 4B6XA 1LKXA 3NZPA 2JMKA 2D5UA 3Q5WA 3F31A 4PK4A 2UXNB 4H9QC 1YKHB 1ZEEA 2LOPA 4CQIA 5JRCB 3ZLIA 2WWUA 4AKHA 5L3GB 2LHRA 4ZS3A 1WYCA 2WSSV 5JR9C 1IZNB 4ZI2D 4WBNE 4H63H 2PBIA 2V7JA 4JEHB 1AJ3A 3KBTA 4IE0A 1S35A 5LBQB 1US7B 3O1IA 4AKGA 4BA9A 5CB4E 4HGAA 2MOZA 2VKHA 4MFRA 2XAGB 3HI2A 4H9NC 3UFEA 5JDMA 3UULA 4YJ3E 3ZCIA 4EOZB 1WLXA 2CXDA 2NOXA 2EHOC 3J9X1 4BJMA 2SPCA 4IDZA 5HWXA 2VKOA 2LEHA 1HS7A 2V26A 3BQKA 1SHZC 5JDHA 5LYJE 1IAPA 2LSGA 2KXPB 1MNEA 2NW8A 5H6RB 3O1JA 1Z0PA 2DI4A 2N9DA 4OHFA 2W00A 3C64A 3E08A 3FXDB 3NZQA 2IW5B 1MMGA 2W61A 1OWAA 2K9AA 3F2EA 5LHGB 4JEUB 4QXHB 4JUYA 4O2BE 1HTJF 1LVKA 1NAFA 3O1HA 3VU7H 1ZHCA 1YW0A 2C5JA 3HKBE 4I55E 2KNDA 1HCIA 3PTRB 2C5IT 3AAIA 3H37A 2W0GA 4KBMB 2ZM8A 3AVSA 2BDEA 3ZYMA 3EVYA 3PUQA 1KNZA 2DWGA 2D0TA 3GN5B 3P7IA 3Q2MA 4UVAB 2RA1A 4XZCA 3RYFE 5L3DB 4H9SE 2V1DB 3EUHA 3N9LA 5HAXA 3SS1A 2ZMAA 4KUMB 3LK3B 4NUUA 4CXXA 1BR1A 2ODVA 5IHYA 3ANWA 4ERRA 3CKDA 2E9XB 3B57A 1MMDA 5KMGP 3N9MA 1E1HB 3CQXC 2JPFA 4YFSA 2L9QA 5C8YE 2IC6A 5J1GA 2YK0A 2KZ7B 4PAGA 4FJOA 5LA6E 2A2FX 5JQGE 2Y48B 2PJQA 3HKCE 3N9NA 2DLRA 3AAAB 5JDLA 4ISSA 4MBQA 5L3CB 2XUEA 5DJQC 3OBVE 3GWHA 3IF8B 4ZHQE 4AQGA 4DMWA 1G8XA 5FY0A 3I1AA 3C51A 2WMOA 4TUYE 5L2LA 4P09A 5LCYA 1D1CA 5M4YA 4XBFB 4QXCB 2CCQA 4NUVA 2XAQB 1HFAA 4PFOA 5HXSA 2E9XD 3ZMUB 4GIWA 1FEWA 5KDMC 2IAKA 2K5BB 3DTOA 2B1EA 3UUXB 2CWYA 2I59A 5JDFA 3MACA 4L9IA 3SWHA 4OFZA 4WW0A 2ACXA 4Z8XA 2W62A 3KBUA 4U74A 4ZI2C 1FMWA 3ZN0B 2LSIA 3OJAA 4I4TE 1D0YA 3C98B 3FXEB 4MLKA 2XAJB 4X1YE 5FXZA 3T8OA 3ZMTB 4DO0A 5EK2A 2DCFA 3R6NA 2A72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4Y A;  1FIO A;  1FEW A;  3LG7 A;  1HS7 A;  2DNX A;  3C98 B;  5LG4 A;  4JEH B;  4JEU B;  1G73 A;  4TX5 A;  1EZ3 A;  1S94 A;  2XHE B;  1BR0 A; 
#chains in the Genus database with same CATH topology
 2A3D A;  4DV2 T;  3ZST A;  2PG8 A;  4HN9 A;  3JAF A;  3E0Z A;  3ZC0 A;  4JV5 T;  5EK4 A;  2ZM0 A;  2XZE A;  3OPC A;  3UT5 E;  3IBP A;  4OX9 T;  1NEN A;  5FXX A;  2CBJ A;  2WWV A;  2JJ9 A;  1Y64 B;  4DID B;  3RYH E;  4BJN A;  5JH7 E;  2Q9Q B;  5FXW A;  3ETV A;  3NVO A;  3DJB A;  2MYS A;  2XM1 A;  2WBL A;  5F3J A;  2V7I A;  1W09 A;  3AA7 B;  1UK5 A;  4ILB A;  3DP7 A;  3VRA A;  3AB3 B;  4H63 V;  5F8P A;  3ZMZ B;  5HCM A;  4XAX B;  3RX6 A;  2HH7 A;  4GOU A;  2K24 A;  1BR0 A;  5FL1 A;  3WAK A;  3GA8 A;  3PJA J;  3AEF A;  4F6R C;  4TWF A;  2LE8 A;  4B3M T;  4JI5 T;  2LJL A;  3FZM B;  2Q9Q D;  1HG2 A;  5DAB A;  2KMF A;  5FY1 A;  2IDO B;  5LJM A;  1LVF A;  1WRD A;  3KIN B;  2KLQ A;  2X9Y A;  4F8H A;  4H9O C;  2VWA A;  4CXW A;  4EIW A;  2K48 A;  3X1D A;  1U5P A;  2E9X C;  4KP3 C;  1UX5 A;  1V9D A;  4P0A A;  4YLH A;  4YSX A;  4ANJ A;  3SRZ A;  4OYJ A;  5FNV E;  4UR9 A;  4B3S T;  5AFU L;  2BBH A;  2LRK A;  4UXN B;  3UU3 A;  4ADZ A;  2V6Y A;  2WY2 A;  4MAL A;  2VUR A;  4CZZ B;  3RIF A;  5LHH B;  4EYU A;  2XQ9 A;  5LMN T;  4WBO A;  3N2G E;  3HL6 A;  4JBW F;  3SOL A;  3T1H T;  3HKD E;  2XAH B;  4ZI7 E;  3FB2 A;  3K3N A;  2BZB A;  5LG4 A;  4IDP A;  3O9X A;  4Q25 A;  3UU6 A;  4JI2 T;  4NIQ A;  5JR9 B;  3RRC A;  3UQ7 A;  4QHO A;  1KFY A;  4UEM A;  3F57 A;  2LSY A;  4AIS A;  3T1Y T;  3RLF F;  4I50 E;  4JI3 T;  3UU4 A;  3QK6 A;  4JI6 T;  2DWK A;  2JMH A;  1OED B;  2EHO B;  2VB6 A;  3ABV A;  2C5K T;  5AQR B;  3AEE A;  5EK3 A;  3L09 A;  1FMV A;  2LKH A;  4FI5 A;  3FZF B;  3QB5 A;  4ZZC A;  4P1N A;  3AVR A;  4L0R A;  3RKO A;  3CK6 A;  1QSD A;  5TAO A;  3V5U A;  3ZJ1 A;  2EHO D;  3RI5 A;  3CX8 B;  5HYA A;  3UTK A;  4TX5 A;  2XJ7 A;  1XNQ T;  2N1G A;  4PK6 A;  3RC3 A;  3TKL B;  3JAD A;  3N5L A;  4PJN A;  4ILC A;  2DNX A;  3O4X E;  1G73 A;  5ETW A;  1E2A A;  4EV6 A;  1HX8 A;  3CX7 B;  4ILU A;  5LGU B;  4X1K E;  2E5V A;  4TNV A;  3RKG A;  2ZM2 A;  1H7C A;  2BVL A;  3CVR A;  4X5T A;  3BQL A;  5LHI B;  2WDV A;  2C0S A;  1T98 A;  3I9W A;  1WYB A;  2LT3 A;  5HWY A;  3EI0 A;  4OK0 A;  1J5W A;  2VVS A;  3N2K E;  2X9H A;  1M62 A;  4LFC T;  5LP6 E;  4AQF A;  3KV9 A;  1QUU A;  1CHU A;  3A5X A;  4PK4 A;  2UXN B;  5JRC B;  4AKH A;  5L3G B;  2LHR A;  4ZS3 A;  1IZN B;  4ZI2 D;  4H63 H;  4KHP T;  2CHO A;  1S35 A;  3ZSS A;  4JI8 T;  4MFR A;  2XAG B;  3UU5 A;  2E2A A;  4H9N C;  1XMQ T;  4IDQ A;  4BJM A;  4U31 A;  2VKO A;  2LSG A;  3AED A;  1IBL T;  3RQW A;  2KXP B;  1MNE A;  5AQK B;  3O1J A;  5IUX A;  3RIU C;  2M6I A;  2W61 A;  2K9A A;  4QXH B;  4JUY A;  4O2B E;  1HTJ F;  3PUX F;  2WU5 A;  1ZHC A;  1YW0 A;  3HKB E;  4I55 E;  3PTR B;  2C5I T;  3AAI A;  2W0G A;  1UGO A;  2WZI A;  3AE2 A;  3EHZ A;  1KNZ A;  2DWG A;  4UVA B;  4XZC A;  4H9S E;  3N9L A;  5AQJ B;  4KUM B;  3LK3 B;  4CXX A;  5CFB A;  3ANW A;  1IBM T;  3N9M A;  1E1H B;  2MPK A;  2JPF A;  2IC6 A;  5J1G A;  3EAM A;  5LB7 B;  2V6X A;  3N9N A;  2DLR A;  3NWI A;  4MBQ A;  2AXD S;  4AQY T;  4DMW A;  5FY0 A;  4DV4 T;  5AQH B;  1WR0 A;  4P09 A;  5LCY A;  1D1C A;  3AEB A;  4NUV A;  2XAQ B;  5KDM C;  3NKZ A;  3DTO A;  2CWY A;  3Q5E A;  1NEK A;  3SWH A;  1OED E;  2ACX A;  3LDQ B;  3ZN0 B;  1XDP A;  3OJA A;  1E7P A;  3FXE B;  5EK2 A;  4ZZB A;  5L3F B;  3I0O A;  2Y6X A;  2JIW A;  1OXZ A;  2D0U A;  4TN7 B;  3ZYL A;  2NW7 A;  3N9O A;  2J62 A;  3U3I A;  3L8R A;  2XQ3 A;  2UXC T;  3LK4 2;  4IE6 A;  5C2T A;  2M67 A;  4HWH A;  3MXZ A;  1KEY A;  1MND A;  4NXM T;  3KV4 A;  4K0K T;  1U4Q A;  2X9W A;  3N9P A;  4GYS A;  3VKH A;  2IML A;  1D1B A;  2V6Y B;  4M1P A;  4EED A;  4LF6 T;  2N2N A;  3C4X A;  1MIW A;  3RYI E;  1MIY A;  1HNZ T;  5ADX L;  2YU2 A;  5LXT E;  5JVD E;  3ZT7 A;  4DUY T;  3AE7 A;  5IWA T;  1YKE B;  4QX8 B;  4O4H E;  3D0T A;  3IEE A;  4C91 A;  1VCS A;  2ZM6 T;  3H3A A;  3JC6 D;  4WZX A;  2HPL A;  4K0U A;  5KXJ A;  5FVL A;  1T7S A;  2DHR A;  4DVD A;  2CLY B;  2YIN A;  4CI1 B;  4TZ4 C;  2NP9 A;  3VR9 A;  5JRC A;  1IBK T;  4O4L E;  1JNR A;  2CLY C;  2DL1 A;  5AQS B;  3S4U A;  3RF1 A;  4ZS2 A;  4PK5 A;  5E0O A;  4ZI3 D;  3ZKR A;  3PUZ F;  5FKY A;  3P4P A;  5JRE A;  3FHN A;  4DV6 T;  5ABF A;  3OTO T;  3PV0 F;  4C90 A;  2NTY A;  2X51 A;  1M7K A;  2HPJ A;  2NWB A;  3AA1 B;  1WR6 A;  3B5M A;  2B76 A;  4JI1 T;  2BKP A;  4U2Z A;  1O3X A;  4UV8 B;  4IRE A;  4V1A v;  3AE8 A;  5FMN A;  2VAS A;  2WQY A;  4JI7 T;  3K3Q C;  3ZJ2 A;  3QNU A;  4X62 T;  3KVA A;  4UF0 A;  3ZEF B;  4PFP A;  3VRB A;  2VL8 A;  1QLB A;  2VVN A;  2LM9 A;  4Z90 A;  3PUS A;  3IHR A;  3I9Y A;  3P8C D;  3VHL A;  5JDQ A;  1IJ6 A;  5EZY E;  5CA0 E;  3PUR A;  5F5W A;  3L3P A;  5CA1 E;  4AKI A;  4LF9 T;  5H6Q B;  4LF7 T;  2Q9Q C;  1HG5 A;  3LJC A;  3HA4 A;  3KV5 A;  5LNK A;  4YXD A;  1WFD A;  3LK2 B;  1N32 T;  4YTM A;  2J1D G;  1W0A A;  4LMK A;  4MHC A;  4U72 A;  3W15 B;  5JDG A;  4JI4 T;  5L3B B;  1BR2 A;  3AAE B;  2RP4 A;  4AQF C;  5CGM A;  5BMV E;  5LGT B;  4OYK A;  2JQQ A;  2ODU A;  3HKE E;  3ONX A;  3BK9 A;  5LGN B;  4ZEY A;  1ZOY A;  5FY7 A;  5L3E B;  4ASK A;  3RGL A;  3FZH B;  2I6H A;  4UEL A;  2KIN B;  3PU8 A;  4O4I E;  4LF4 T;  4A5X A;  2UUB T;  2V5C A;  3ONJ A;  5C3J A;  5ABH A;  4A98 A;  3ZT5 A;  4GKJ T;  2X67 A;  3MKD A;  2XAF B;  2V8S V;  2BS4 A;  3KV6 A;  2YU1 A;  5DQV A;  2UXB T;  3WAJ A;  3ANW B;  3PUY F;  3EDU A;  4COF A;  3Q5W A;  1YKH B;  1ZEE A;  2LOP A;  4CQI A;  3ZLI A;  5JR9 C;  3QB5 K;  2E5L T;  3L39 A;  2PBI A;  2V7J A;  4JEH B;  1Y01 A;  4IE0 A;  1X9B A;  1SUM B;  2W2U A;  4DV5 T;  2HHH T;  3IA3 A;  3UFE A;  3UUL A;  1OED C;  2FUP A;  2EHO C;  5HWX A;  2LEH A;  1XNR T;  2BKN A;  2V26 A;  2H88 A;  5H6R B;  2NW8 A;  2CBI A;  1Z0P A;  2N9D A;  1MMG A;  1KNP A;  3F2E A;  3RIA A;  3O1H A;  3PUW F;  3VU7 H;  2C5J A;  1HCI A;  4KBM B;  2HN1 A;  2YDS A;  4CN4 A;  3EVY A;  2BG9 A;  3PUQ A;  3Q2M A;  4LFA T;  3K1S A;  3EUH A;  3QOF A;  2ZMA A;  4NUU A;  2ODV A;  5IHY A;  2WZH A;  3CKD A;  1MMD A;  2HN2 A;  5AQT B;  5C8Y E;  3JCF A;  2CHN A;  5AQV B;  4FJO A;  5LA6 E;  2PJQ A;  4HWC A;  4DR7 T;  2YKS A;  5LMU T;  1UUR A;  3GWH A;  3IF8 B;  4ZHQ E;  4AQG A;  1G8X A;  2BBJ A;  2LRL A;  3C51 A;  3AEA A;  3H3M A;  4QXC B;  2CCQ A;  1HFA A;  4PFO A;  3TLW A;  5L47 A;  5BR8 T;  3UUX B;  2XQA A;  2W62 A;  5J0Z A;  4ZI2 C;  1FMW A;  4LF5 T;  3RHW A;  4I4T E;  5FXZ A;  3T8O A;  3ZMT B;  4DO0 A;  2A72 A;  3ZCJ A;  3FZL B;  4EGW A;  3C50 A;  3UQ4 A;  2R6G F;  1D0Z A;  3ZYK A;  3MZK B;  3A7M A;  3NBX X;  2PFV A;  3PU3 A;  1FIO A;  4E7S A;  3PE0 A;  5LOV E;  1MIV A;  1XZY A;  3M65 A;  5FVK A;  4GK0 E;  3RYC E;  2E9X A;  2WM9 A;  4I0U A;  2X0H A;  2WS3 A;  5ABF B;  4UVB B;  2H7V C;  1D0X A;  3ESL A;  4EZH A;  2W66 A;  4X66 T;  4UIG A;  3KFW X;  1NWM X;  1I6Z A;  4U7I A;  2OA5 A;  2OV9 A;  3OYX A;  1FJG T;  2VQF T;  2VKD A;  5AQF B;  4EAH A;  3ZMV B;  3I0Q A;  3R84 B;  4IE4 A;  2GK9 A;  4YY3 T;  4UF0 B;  5JTG A;  3N2O A;  3VKG A;  3PUV F;  3ZC1 A;  4HTE A;  2CM0 A;  3UUB A;  3Q5D A;  3Q9D A;  1YD8 G;  5HXC A;  3FZK B;  2FJE A;  4HWD A;  2WU2 A;  1KF6 A;  4N78 D;  4KMC A;  2NTX A;  3J7Y q;  2XQ7 A;  1N36 T;  4O8S A;  3RH3 A;  5HXR A;  1ZV4 X;  4UVC B;  4QH5 A;  1CUN A;  2XQ4 A;  2YDR A;  3TLT A;  1LRZ A;  3AE3 A;  5AQU B;  2JRK A;  5HEJ A;  2IC9 A;  3GMI A;  2XQY A;  2CE7 A;  3C4Z A;  5FXV A;  2JQ9 A;  4ZOL E;  1D1A A;  5FP3 A;  5LJN A;  3OYZ A;  4PW8 A;  4IDN A;  3UU8 A;  4L5G A;  2LHN A;  5FYM A;  5AQG B;  4AI6 A;  4TWD A;  3K8P C;  4HKA A;  2WP9 A;  2XPK A;  4HFV A;  2XQ6 A;  3QC9 A;  4YJ2 E;  2XTL A;  1L0V A;  3CX6 B;  5HEG A;  1HNW T;  3K3O A;  3JC6 C;  5HXE A;  3PUG A;  4CI2 B;  3Q5X A;  3AA0 B;  4AKR B;  3CPZ A;  2CXF A;  2LM2 A;  2UXX B;  2ACZ A;  2WAU A;  3TLV A;  5J2T E;  3NRY A;  4YTP A;  3AEC A;  4B3T T;  2E8I A;  4YTN A;  3MA9 A;  3AXJ A;  4TV8 E;  4ZI3 C;  3C4W A;  4X1I E;  3A8Y C;  5HCJ A;  3AE9 A;  2CWO A;  2LSJ A;  3LFM A;  2X66 A;  2WB5 A;  5AQQ B;  5HEH A;  3NRX A;  4HEA A;  2J47 A;  4LMJ A;  3CQG B;  2UU9 T;  4JLE A;  4IL4 A;  1EZ3 A;  1W9R A;  3P4R A;  3CQC B;  3V5S A;  4YSY A;  3ONL C;  3VR8 A;  2ES0 A;  4DV3 T;  5JDN A;  4HFI A;  2XY8 B;  3RPU A;  2VL0 A;  1VOM A;  2BG9 B;  3RIU A;  4DUZ T;  5IYZ E;  2FJB A;  5L4H A;  3LBX A;  1MMA A;  1N33 T;  5HXH A;  4IE7 A;  4YHJ A;  4GK5 E;  3PUA A;  3ZPO A;  2V7L A;  4B6X A;  4JI0 T;  1LKX A;  3NZP A;  5AQM B;  1SE7 A;  2D5U A;  3F31 A;  4H9Q C;  3SFE A;  2WWU A;  2WSS V;  4WBN E;  1UUS A;  1AJ3 A;  3KBT A;  5AQL B;  1US7 B;  4LFB T;  4AKG A;  4HGA A;  2FJD A;  5HEO A;  2V5D A;  1J5E T;  2MAW A;  3HI2 A;  5JDM A;  4YJ3 E;  3ZCI A;  1WLX A;  2NOX A;  4GKK T;  4IDZ A;  1HS7 A;  1HX1 B;  3BQK A;  1SHZ C;  5JDH A;  1IAP A;  4Z91 A;  2W00 A;  3C64 A;  3FXD B;  2IW5 B;  2NR4 A;  4JEU B;  2AE9 A;  2BS3 A;  4X65 T;  4IDO A;  2YN6 A;  2KND A;  3H37 A;  2D9D A;  2ZM8 A;  3AVS A;  5AQN B;  4DR2 T;  1WCR A;  2D0T A;  3RYF E;  2V1D B;  4WYV A;  3SS1 A;  2H89 A;  1BR1 A;  2E9X B;  3B57 A;  5ABE A;  2YK0 A;  2KZ7 B;  4PAG A;  2UUA T;  2A2F X;  5JQG E;  3AAA B;  4ISS A;  5L3C B;  3UFG A;  4KHZ F;  1R8I A;  3I1A A;  2WMO A;  4TUY E;  5M4Y A;  4XBF B;  4QH4 A;  2E9X D;  4YSZ A;  1ZP0 A;  3CIR A;  3ZMU B;  4GIW A;  1FEW A;  2B1E A;  4ZXL A;  5JDF A;  4L9I A;  1W0B A;  4U74 A;  3KBU A;  4X1Y E;  2XAJ B;  3R6N A;  2K3W A;  1UX4 A;  2L8K A;  1YXR A;  3OVU A;  3AA6 B;  5A1L A;  2CMR A;  2WMN A;  1HF8 A;  4WNK A;  2LLY A;  4IGU A;  2MTQ A;  4H9P C;  4DBQ A;  4QWN B;  4U7Y A;  3GN5 A;  5AQI B;  4PJL A;  4PJM A;  4CN6 A;  2NW9 A;  4PJJ A;  3E22 E;  5CJ5 A;  3N9Q A;  4EXT A;  2H3R A;  4CXY A;  3FBL A;  4CI3 B;  4B3R T;  3BQI A;  4AXP A;  4G2A A;  3EDV A;  3ZN1 B;  4DR5 T;  2QA7 A;  2CXL A;  1SA0 E;  2FJA A;  1GQE A;  1X79 A;  4EYY R;  3HR0 A;  4GYR A;  2X68 A;  5LBM A;  3AE4 A;  4E7Z A;  1HR0 T;  2YOE A;  4YHH T;  3WI3 A;  4IE5 A;  4QXB B;  2XHE B;  3CML A;  4ILA A;  2XAS B;  2LSK A;  2V7K A;  2BG9 E;  2Y8D A;  3PJA A;  4IIJ E;  2W63 A;  2I0M A;  4TV9 E;  3M3Z B;  4DV1 T;  5DQW A;  3AE6 A;  4QX7 B;  2QRX A;  3UUM A;  2WDQ A;  3TLS A;  5FL0 A;  4DR6 T;  2QGS A;  2BVM A;  2Q9Q A;  4DV7 T;  3ZT6 A;  4HFH A;  1N34 T;  3RC8 A;  2JQK A;  2P9B A;  4DBR A;  2LOS A;  2OLT A;  1JNZ A;  3LG7 A;  4I43 B;  4H9R C;  3PDY A;  4X20 E;  4A56 A;  2KSR A;  4P0B A;  3AXJ B;  4EEB A;  2F4V T;  2CRB A;  4HFD A;  2BS2 A;  4TNW A;  3AE5 A;  2G0U A;  4AIU A;  1XWM A;  1MMN A;  4EZ4 A;  2W67 A;  1VCT A;  4HE8 A;  2D2S A;  5GON E;  3KDS E;  2KWH A;  2VKJ A;  4O2A E;  2QVA A;  4IST A;  2RPA A;  3U78 A;  4DMV A;  3MJX A;  1B7T A;  1UCU A;  3LBX B;  4QKN A;  2JQH A;  3FBZ A;  3QUJ A;  2MBG A;  1BR4 A;  4A97 A;  4HWF A;  3P4Q A;  1HNX T;  2V7M A;  1J1J A;  3RRW A;  4HWI B;  4G63 A;  2CA5 A;  1VRB A;  3SFD A;  1IJ5 A;  3EAB A;  4DR1 T;  2IIU A;  4JYA T;  2YEV C;  5AQP B;  1S94 A;  4KI0 F;  2XQ8 A;  1DU2 A;  2KT9 A;  1KNR A;  4U2Y A;  2J4G A;  4U33 A;  3B13 A;  2VK9 A;  4UV9 B;  4J2C A;  5JR9 A;  2X9X A;  4EB6 E;  2CEA A;  4TWH A;  1YQ3 A;  2M6B A;  4AKL A;  4PNI A;  2BKO A;  3ZMS B;  3ETU A;  1KK7 A;  5KX5 E;  4YT0 A;  3MK7 C;  1OED A;  2EHO A;  1XDO A;  1YQ4 A;  2L3L A;  3CWZ B;  4QH1 A;  4BAY B;  2Z6E A;  4CN1 A;  4IHJ E;  5ABG A;  4DND A;  4O4J E;  5J2U E;  3TLU A;  1Z8U A;  1ZKE A;  1T72 A;  4NPP A;  2KWI B;  2XQ5 A;  3UUN A;  2ZLY A;  2H7O A;  5HEU A;  3OKQ A;  2W4X A;  2X0L B;  3KVB A;  2JMK A;  5L4E A;  1WYC A;  3LSV A;  4NXN T;  5LBQ B;  3O1I A;  4BA9 A;  5CB4 E;  2MOZ A;  2VKH A;  4DR4 T;  2IUB A;  4LML A;  1XMO T;  2YDQ A;  2FBW A;  3JAE A;  4EOZ B;  2CXD A;  3J9X 1;  3G06 A;  2SPC A;  2PTF A;  3AEG A;  5LYJ E;  5AQO B;  2DI4 A;  4OHF A;  3E08 A;  3NZQ A;  1OWA A;  5LHG B;  4IT4 A;  1LVK A;  1NAF A;  4HFE A;  2BDE A;  3ZYM A;  4U3C A;  2IHR 1;  1T8B A;  3AE1 A;  3P4S A;  4KX6 A;  3GN5 B;  3P7I A;  2RA1 A;  3RQU A;  5L3D B;  4DV0 T;  4DR3 T;  5HAX A;  4LF8 T;  4ERR A;  5KMG P;  2UXD T;  3CQX C;  4YFS A;  3P50 A;  4X64 T;  2L9Q A;  2QYW A;  2X0Y A;  2Y48 B;  3HKC E;  4HFB A;  5JDL A;  2A9U A;  2XUE A;  5DJQ C;  3OBV E;  4IL9 A;  2LKG A;  2VQE T;  2UUC T;  5L2L A;  2XSB A;  5HXS A;  2IAK A;  2K5B B;  2WCA A;  3P4W A;  2WDR A;  2I59 A;  2CPT A;  3MAC A;  2XM2 A;  4OFZ A;  4WW0 A;  4Z8X A;  2XSA A;  2LSI A;  4HFC A;  1D0Y A;  3C98 B;  4MLK A;  1I94 T;  2BG9 C;  5LG3 A;  2DCF A; 
#chains in the Genus database with same CATH homology
 5L3F B;  3ZCJ A;  1UX4 A;  2A3D A;  2L8K A;  3C50 A;  3I0O A;  2Y6X A;  1OXZ A;  2D0U A;  2PG8 A;  3AA6 B;  4HN9 A;  4TN7 B;  5A1L A;  1D0Z A;  3ZYL A;  2CMR A;  3ZYK A;  3MZK B;  2NW7 A;  2WMN A;  1HF8 A;  3E0Z A;  3ZC0 A;  3N9O A;  3NBX X;  2PFV A;  4WNK A;  3PU3 A;  1FIO A;  5EK4 A;  2ZM0 A;  3U3I A;  4E7S A;  3LK4 2;  3PE0 A;  4IE6 A;  4IGU A;  2MTQ A;  4H9P C;  3UT5 E;  2M67 A;  4DBQ A;  5LOV E;  1MIV A;  3IBP A;  4QWN B;  5FXX A;  3M65 A;  3GN5 A;  3MXZ A;  1MND A;  3KV4 A;  4PJL A;  1U4Q A;  2JJ9 A;  2X9W A;  3N9P A;  4PJM A;  4GYS A;  4GK0 E;  3RYC E;  1Y64 B;  2E9X A;  3VKH A;  1D1B A;  3RYH E;  4BJN A;  2WM9 A;  4M1P A;  2N2N A;  5JH7 E;  2NW9 A;  4PJJ A;  3C4X A;  1MIW A;  3E22 E;  3RYI E;  2Q9Q B;  5FXW A;  4UVB B;  1MIY A;  2H7V C;  3ETV A;  1D0X A;  3N9Q A;  3DJB A;  3ESL A;  2MYS A;  4EZH A;  4EXT A;  5ADX L;  2WBL A;  2YU2 A;  5F3J A;  5LXT E;  2H3R A;  2V7I A;  4UIG A;  5JVD E;  4CXY A;  3AA7 B;  3FBL A;  4CI3 B;  3KFW X;  1NWM X;  3BQI A;  3DP7 A;  4AXP A;  4G2A A;  3AB3 B;  3EDV A;  4H63 V;  2OA5 A;  5F8P A;  3ZN1 B;  3ZMZ B;  2QA7 A;  4XAX B;  2CXL A;  3OYX A;  1SA0 E;  2HH7 A;  3RX6 A;  1YKE B;  2VKD A;  4O4H E;  1X79 A;  3D0T A;  4QX8 B;  4GOU A;  2K24 A;  1BR0 A;  3IEE A;  4EAH A;  3WAK A;  3ZMV B;  4C91 A;  3I0Q A;  4EYY R;  3HR0 A;  3GA8 A;  4GYR A;  3R84 B;  2X68 A;  4IE4 A;  4F6R C;  5LBM A;  2LE8 A;  2GK9 A;  2LJL A;  3H3A A;  4E7Z A;  3JC6 D;  2Q9Q D;  3WI3 A;  2HPL A;  1HG2 A;  4K0U A;  5DAB A;  2KMF A;  4UF0 B;  5FY1 A;  4IE5 A;  4QXB B;  3N2O A;  3VKG A;  2DHR A;  5LJM A;  2XHE B;  1LVF A;  1WRD A;  3CML A;  3ZC1 A;  4DVD A;  4HTE A;  2CLY B;  2CM0 A;  3KIN B;  2YIN A;  3Q9D A;  2XAS B;  2KLQ A;  1YD8 G;  2LSK A;  5HXC A;  4CI1 B;  2X9Y A;  4TZ4 C;  2NP9 A;  4H9O C;  2VWA A;  4CXW A;  5JRC A;  4EIW A;  2V7K A;  2K48 A;  2Y8D A;  4IIJ E;  4O4L E;  1U5P A;  2E9X C;  2W63 A;  2CLY C;  4N78 D;  4TV9 E;  4KMC A;  2NTX A;  5DQW A;  4KP3 C;  1UX5 A;  3J7Y q;  4QX7 B;  1V9D A;  3S4U A;  4O8S A;  4P0A A;  4YLH A;  3RH3 A;  5HXR A;  1ZV4 X;  4ANJ A;  4UVC B;  3UUM A;  4ZS2 A;  3SRZ A;  4OYJ A;  4PK5 A;  5FNV E;  5E0O A;  4ZI3 D;  1CUN A;  5AFU L;  4UXN B;  4ADZ A;  2QGS A;  5JRE A;  3FHN A;  4MAL A;  1LRZ A;  2BVM A;  4CZZ B;  2Q9Q A;  2JRK A;  5LHH B;  2IC9 A;  4EYU A;  3RC8 A;  3GMI A;  2XQY A;  4WBO A;  3N2G E;  3HL6 A;  4C90 A;  2P9B A;  4DBR A;  2LOS A;  2CE7 A;  2NTY A;  3LG7 A;  2X51 A;  4I43 B;  4H9R C;  3SOL A;  3PDY A;  3HKD E;  3C4Z A;  2HPJ A;  5FXV A;  2XAH B;  2NWB A;  3FB2 A;  4ZI7 E;  3K3N A;  4X20 E;  3AA1 B;  4A56 A;  1WR6 A;  4ZOL E;  4P0B A;  2BZB A;  5LG4 A;  3O9X A;  1D1A A;  5FP3 A;  5LJN A;  3OYZ A;  1O3X A;  5JR9 B;  4UV8 B;  3RRC A;  4PW8 A;  2G0U A;  4V1A v;  4QHO A;  5FMN A;  2VAS A;  1MMN A;  4L5G A;  4UEM A;  3K3Q C;  4EZ4 A;  3ZJ2 A;  3F57 A;  2LSY A;  3KVA A;  4I50 E;  4HE8 A;  4UF0 A;  3ZEF B;  2D2S A;  4PFP A;  5GON E;  2VL8 A;  3KDS E;  2KWH A;  2LM9 A;  3QK6 A;  2VKJ A;  2LHN A;  4O2A E;  5FYM A;  2DWK A;  2JMH A;  3PUS A;  4AI6 A;  2EHO B;  3IHR A;  2VB6 A;  3I9Y A;  3P8C D;  3VHL A;  5JDQ A;  1IJ6 A;  5EZY E;  5CA0 E;  3K8P C;  2C5K T;  4HKA A;  5EK3 A;  4HFV A;  3L09 A;  1FMV A;  3PUR A;  3QC9 A;  4IST A;  4FI5 A;  3U78 A;  4YJ2 E;  3L3P A;  2XTL A;  4DMV A;  3MJX A;  5CA1 E;  4AKI A;  5H6Q B;  1B7T A;  3CX6 B;  1UCU A;  3LBX B;  4QKN A;  3K3O A;  3JC6 C;  2Q9Q C;  3AVR A;  1HG5 A;  3LJC A;  3FBZ A;  4L0R A;  5HXE A;  3RKO A;  3HA4 A;  3KV5 A;  3QUJ A;  2MBG A;  1BR4 A;  3PUG A;  1QSD A;  4CI2 B;  3Q5X A;  5TAO A;  3V5U A;  5LNK A;  2V7M A;  3AA0 B;  4AKR B;  3RRW A;  3ZJ1 A;  4G63 A;  3LK2 B;  2EHO D;  3CPZ A;  2CA5 A;  2CXF A;  1VRB A;  2J1D G;  2UXX B;  1IJ5 A;  3CX8 B;  4MHC A;  4U72 A;  3W15 B;  5JDG A;  5HYA A;  3UTK A;  4TX5 A;  5L3B B;  1BR2 A;  3AAE B;  2RP4 A;  2WAU A;  2YEV C;  4AQF C;  2N1G A;  1S94 A;  5BMV E;  5LGT B;  4OYK A;  4PK6 A;  2JQQ A;  3RC3 A;  2KT9 A;  3TKL B;  5J2T E;  2ODU A;  3NRY A;  3B13 A;  3N5L A;  2VK9 A;  3HKE E;  3ONX A;  4PJN A;  2E8I A;  2DNX A;  3MA9 A;  3BK9 A;  4TV8 E;  4UV9 B;  3O4X E;  4J2C A;  4ZI3 C;  1G73 A;  3C4W A;  5LGN B;  5ETW A;  4X1I E;  5JR9 A;  2X9X A;  1HX8 A;  3CX7 B;  4ILU A;  5FY7 A;  2CWO A;  2CEA A;  4EB6 E;  4X1K E;  5L3E B;  5LGU B;  4ASK A;  2LSJ A;  3LFM A;  2X66 A;  4AKL A;  4PNI A;  3NRX A;  4HEA A;  2ZM2 A;  3CQG B;  3ZMS B;  4UEL A;  3ETU A;  1KK7 A;  5KX5 E;  4JLE A;  3MK7 C;  1H7C A;  1EZ3 A;  2BVL A;  2KIN B;  3CQC B;  3CVR A;  3PU8 A;  4O4I E;  3BQL A;  2EHO A;  3V5S A;  5LHI B;  2ES0 A;  2C0S A;  1T98 A;  3I9W A;  5JDN A;  2L3L A;  3CWZ B;  4BAY B;  3RPU A;  2Z6E A;  2X67 A;  3MKD A;  2XAF B;  4IHJ E;  4DND A;  1WYB A;  2LT3 A;  1VOM A;  4O4J E;  5HWY A;  5J2U E;  4OK0 A;  5IYZ E;  3LBX A;  1ZKE A;  3KV6 A;  1MMA A;  2YU1 A;  2KWI B;  5DQV A;  5HXH A;  3UUN A;  2ZLY A;  4IE7 A;  3N2K E;  2X9H A;  3WAJ A;  2H7O A;  4YHJ A;  4GK5 E;  3PUA A;  5LP6 E;  3ANW B;  4AQF A;  3KV9 A;  3ZPO A;  3OKQ A;  3EDU A;  2X0L B;  1QUU A;  3KVB A;  3A5X A;  2V7L A;  4B6X A;  1LKX A;  3NZP A;  2JMK A;  2D5U A;  3Q5W A;  3F31 A;  4PK4 A;  2UXN B;  4H9Q C;  1YKH B;  1ZEE A;  2LOP A;  4CQI A;  5JRC B;  3ZLI A;  2WWU A;  4AKH A;  5L3G B;  2LHR A;  4ZS3 A;  1WYC A;  2WSS V;  5JR9 C;  1IZN B;  4ZI2 D;  4WBN E;  4H63 H;  2PBI A;  2V7J A;  4JEH B;  1AJ3 A;  3KBT A;  4IE0 A;  1S35 A;  5LBQ B;  1US7 B;  3O1I A;  4AKG A;  4BA9 A;  5CB4 E;  4HGA A;  2MOZ A;  2VKH A;  4MFR A;  2XAG B;  3HI2 A;  4H9N C;  3UFE A;  5JDM A;  3UUL A;  4YJ3 E;  3ZCI A;  4EOZ B;  1WLX A;  2CXD A;  2NOX A;  2EHO C;  3J9X 1;  4BJM A;  2SPC A;  4IDZ A;  5HWX A;  2VKO A;  2LEH A;  1HS7 A;  2V26 A;  3BQK A;  1SHZ C;  5JDH A;  5LYJ E;  1IAP A;  2LSG A;  2KXP B;  1MNE A;  2NW8 A;  5H6R B;  3O1J A;  1Z0P A;  2DI4 A;  2N9D A;  4OHF A;  2W00 A;  3C64 A;  3E08 A;  3FXD B;  3NZQ A;  2IW5 B;  1MMG A;  2W61 A;  1OWA A;  2K9A A;  3F2E A;  5LHG B;  4JEU B;  4QXH B;  4JUY A;  4O2B E;  1HTJ F;  1LVK A;  1NAF A;  3O1H A;  3VU7 H;  1ZHC A;  1YW0 A;  2C5J A;  3HKB E;  4I55 E;  2KND A;  1HCI A;  3PTR B;  2C5I T;  3AAI A;  3H37 A;  2W0G A;  4KBM B;  2ZM8 A;  3AVS A;  2BDE A;  3ZYM A;  3EVY A;  3PUQ A;  1KNZ A;  2DWG A;  2D0T A;  3GN5 B;  3P7I A;  3Q2M A;  4UVA B;  2RA1 A;  4XZC A;  3RYF E;  5L3D B;  4H9S E;  2V1D B;  3EUH A;  3N9L A;  5HAX A;  3SS1 A;  2ZMA A;  4KUM B;  3LK3 B;  4NUU A;  4CXX A;  1BR1 A;  2ODV A;  5IHY A;  3ANW A;  4ERR A;  3CKD A;  2E9X B;  3B57 A;  1MMD A;  5KMG P;  3N9M A;  1E1H B;  3CQX C;  2JPF A;  4YFS A;  2L9Q A;  5C8Y E;  2IC6 A;  5J1G A;  2YK0 A;  2KZ7 B;  4PAG A;  4FJO A;  5LA6 E;  2A2F X;  5JQG E;  2Y48 B;  2PJQ A;  3HKC E;  3N9N A;  2DLR A;  3AAA B;  5JDL A;  4ISS A;  4MBQ A;  5L3C B;  2XUE A;  5DJQ C;  3OBV E;  3GWH A;  3IF8 B;  4ZHQ E;  4AQG A;  4DMW A;  1G8X A;  5FY0 A;  3I1A A;  3C51 A;  2WMO A;  4TUY E;  5L2L A;  4P09 A;  5LCY A;  1D1C A;  5M4Y A;  4XBF B;  4QXC B;  2CCQ A;  4NUV A;  2XAQ B;  1HFA A;  4PFO A;  5HXS A;  2E9X D;  3ZMU B;  4GIW A;  1FEW A;  5KDM C;  2IAK A;  2K5B B;  3DTO A;  2B1E A;  3UUX B;  2CWY A;  2I59 A;  5JDF A;  3MAC A;  4L9I A;  3SWH A;  4OFZ A;  4WW0 A;  2ACX A;  4Z8X A;  2W62 A;  3KBU A;  4U74 A;  4ZI2 C;  1FMW A;  3ZN0 B;  2LSI A;  3OJA A;  4I4T E;  1D0Y A;  3C98 B;  3FXE B;  4MLK A;  2XAJ B;  4X1Y E;  5FXZ A;  3T8O A;  3ZMT B;  4DO0 A;  5EK2 A;  2DCF A;  3R6N A;  2A72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...