2DNXA

Solution structure of rsgi ruh-063, an n-terminal domain of syntaxin 12 from human cdna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
130
structure length
130
Chain Sequence
b'GSSGSSGQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntaxin-12
molecule tags Transport protein
source organism Homo sapiens
publication title Solution structure of RSGI RUH-063, an N-terminal domain of Syntaxin 12 from human cDNA
rcsb
total genus 46
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dnxA00
3LG7A 2XHEB 4JEHB 1FEWA 1S94A 3C98B 4TX5A 2DNXA 1BR0A 5M4YA 5LG4A 4JEUB 1FIOA 1G73A 1HS7A 1EZ3A
chains in the Genus database with same CATH superfamily
4DNDA 4CXWA 1D0ZA 3H3MA 4HFCA 1JNRA 4DBRA 1HNZT 2YK0A 2K24A 2J1DG 4DV3T 3HA4A 5AQIB 5JR9A 3RI5A 3HKBE 2DL1A 4XAXB 3C51A 1SE7A 2J47A 3ZKRA 2RPAA 3ZT7A 2KXPB 4ADZA 1VOMA 4YT0A 4F8HA 3L39A 4H9PC 2D0UA 3CKDA 3CX6B 3N2OA 4JI1T 2R6GF 4CI2B 2HHHT 3AAEB 4IDZA 2VURA 5AQKB 3RIAA 3O1JA 2ZM0A 2V8SV 2WWVA 3K3QC 2WBLA 4IIJE 4U74A 5FY7A 4ZZCA 5JTGA 5LMUT 2WMOA 4G63A 4M1PA 4ZZBA 3HKCE 3KVBA 3UU4A 5FL0A 3V5UA 2X0YA 4YSYA 4IL4A 3QUJA 5CA0E 3JC6D 3VRAA 2KINB 4U33A 1ZOYA 2YN6A 5JVDE 3LBXA 3QB5A 5F3JA 1OEDA 2J4GA 3FBLA 1QSDA 3ZJ2A 3PUAA 3TLWA 3GA8A 4WZXA 1OEDB 3P8CD 4HWIB 2WWUA 2H7VC 4HE8A 5HCJA 1MMDA 1D0XA 2CHNA 3JAEA 4U2ZA 3U78A 3O9XA 1WR6A 4AKIA 4L5GA 2IUBA 3O1HA 1D1CA 4X1KE 5HXCA 1I94T 4AQFC 4ERRA 4AKGA 2ODVA 3SFDA 3K3NA 3ZT6A 4EOZB 5HYAA 2XAQB 1YQ4A 3LK2B 3PUXF 5EZYE 3SWHA 2Y6XA 4HTEA 2IC9A 1W09A 3ONJA 3Q5EA 2BS2A 4YHHT 5KXJA 5AQGB 3N5LA 4LMJA 5CGMA 4JI5T 4DR1T 3GMIA 2ZM8A 2ZM2A 4U7YA 4WBOA 3WAJA 2V5CA 5HWYA 2V1DB 3A8YC 3VHLA 5ABEA 3DP7A 2BBJA 3RH3A 1YQ3A 2UXBT 2IHR1 3H3AA 4O4IE 3N9QA 4IE7A 3VRBA 2HN1A 2N9DA 1XNRT 2Y8DA 3P50A 2M6BA 2N1GA 4KMCA 4TZ4C 2H89A 2XHEB 2LLYA 4EGWA 5IWAT 4JI6T 5JRCA 3KVAA 1Z0PA 5JDMA 4DV4T 2WZIA 1XZYA 4Z91A 4EZ4A 2JPFA 3LDQB 4KP3C 3T8OA 2JQKA 3PUZF 1S94A 1OXZA 3UULA 4AI6A 2I59A 3ETUA 1CHUA 4JI3T 1D1BA 1VCSA 2DLRA 4MLKA 4O4JE 5AQPB 2WDVA 2WS3A 3EUHA 3L8RA 4UF0B 5J1GA 1KEYA 1T72A 2BS3A 4FJOA 4GYRA 4PJMA 4X64T 3IBPA 5JDFA 3T1YT 5FXWA 4IGUA 3KFWX 4GK5E 2DNXA 3ZC1A 2XAGB 5L4EA 3RKGA 4JI7T 2UXXB 3MACA 1ZKEA 2E9XA 3HL6A 3UFEA 2YDRA 2ZLYA 2MYSA 3LG7A 3ABVA 2ACZA 4KX6A 5LBMA 2X66A 5L3DB 1I6ZA 2AE9A 2LJLA 2JMKA 4H63V 4HFVA 2D9DA 2XJ7A 4PFOA 4WYVA 4XZCA 5DQWA 3RX6A 4A5XA 4QWNB 3ZEFB 4ZI2D 2BVLA 3L09A 5HXRA 4GOUA 3KINB 4XBFB 4X65T 1XWMA 4IL9A 3H37A 1BR4A 3AECA 2C5KT 4ILUA 3IF8B 2Q9QA 2OLTA 2XTLA 3B57A 4YJ3E 3BK9A 3ZCJA 2WDQA 1D1AA 2VL0A 4DUYT 2CM0A 5HEOA 1ZEEA 3C50A 2VQET 4I0UA 4YFSA 3AEGA 3ZSSA 2CHOA 3AVRA 2X0LB 1LRZA 2K48A 3AA1B 4UVCB 1Z8UA 1HF8A 2XQYA 1L0VA 4IREA 2LSIA 3UTKA 2EHOA 4OYJA 5GONE 5HAXA 1FMVA 4MFRA 4HFHA 5M4YA 2CXLA 5C8YE 2VB6A 3DJBA 2CLYB 1WR0A 4ILCA 1UK5A 2MOZA 3F31A 4AIUA 2ES0A 4YHJA 2VWAA 2WSSV 5LB7B 5FP3A 4ZI7E 3R6NA 4Z8XA 1FJGT 5JR9C 4LFBT 4WNKA 3CPZA 3LFMA 2DHRA 3ZYMA 5LHIB 4QX7B 4JYAT 4KI0F 4CZZB 2HN2A 2W2UA 3PUGA 2BG9C 4HFIA 3PE0A 3RIUC 2PJQA 3UQ4A 3PU3A 2CXDA 1X79A 5AQOB 4PK6A 3UFGA 5LJNA 4KBMB 1E1HB 2KWIB 4DMWA 5JREA 2XQ9A 4JUYA 2LOSA 4H9QC 3TKLB 3FXDB 4LFAT 4O4HE 4QH5A 1MIVA 3A7MA 3IA3A 3LK42 1IJ6A 1MMNA 2X9HA 3Q9DA 4JBWF 3BQLA 3KV5A 5HEGA 5AFUL 5LBQB 3I1AA 1UX5A 5AQRB 3PUQA 4YSXA 3CX8B 4JEHB 2NTYA 2YEVC 1BR2A 3UU8A 5J2UE 3EVYA 3ONXA 2HPJA 4MHCA 4DR4T 4IE4A 5LXTE 3N2GE 4ZXLA 4MALA 4EYYR 2XASB 3OJAA 4IHJE 4GKKT 5JRCB 5DJQC 4Q25A 2H7OA 5DQVA 2XPKA 3Q2MA 3PUVF 5AQFB 3RHWA 3RLFF 2B1EA 4PJLA 4EAHA 2Y48B 2YU2A 3SFEA 1SHZC 4E7SA 4YTNA 4DR2T 2XY8B 2QGSA 2V26A 2JQHA 2KNDA 3PJAJ 4NXNT 1NEKA 4O2AE 2WMNA 2F4VT 2CE7A 2V7JA 5L3GB 5LMNT 5CJ5A 1FMWA 1YD8G 2W0GA 3RQWA 3RRWA 4UV9B 3RKOA 1HR0T 1WYBA 4KUMB 4F6RC 5LJMA 1Y01A 4JI0T 5LGTB 5LGNB 3M65A 3QB5K 2NTXA 4O2BE 1B7TA 5DABA 5L2LA 1SUMB 1HNWT 2E8IA 1WYCA 3TLVA 4A98A 4CN6A 4IDQA 1XDOA 4QH1A 3UU5A 3HR0A 1M62A 5C2TA 2M67A 1XDPA 3RGLA 3UUNA 1FEWA 2L3LA 3NVOA 2VASA 2X68A 5FY1A 1R8IA 4DUZT 3F2EA 4HWFA 4DV2T 4QH4A 4UXNB 3KBUA 5J0ZA 4X66T 2L8KA 1U5PA 3SRZA 2XAJB 4TWDA 2EHOD 4DV0T 3GN5A 3L3PA 2BKPA 2L9QA 1G8XA 3NWIA 2XQ3A 3OVUA 2XAHB 3Q5XA 2BZBA 1HFAA 2XQ8A 3HKDE 2V7LA 3JADA 3KBTA 5AQNB 2XAFB 4DO0A 2CCQA 2CWOA 4ZHQE 2P9BA 2MPKA 4WW0A 4OK0A 5FMNA 4JV5T 3EDUA 1IBLT 4U7IA 5FKYA 5J2TE 1YW0A 2WP9A 4MBQA 3AE8A 2WB5A 4I55E 2BKNA 2E9XC 4NPPA 3AE7A 5FXXA 3S4UA 3LJCA 2W00A 3ZSTA 1IJ5A 1NWMX 5JDHA 2CA5A 1Y64B 2E5VA 4DVDA 4IDNA 1FIOA 3BQIA 3CX7B 4P0AA 5IHYA 1XNQT 3GN5B 3ESLA 3ETVA 4ZEYA 5H6RB 4ILAA 2LOPA 4TWHA 5H6QB 3C4WA 2FBWA 3PURA 2XQ4A 2ZMAA 3NRYA 4JEUB 4TNWA 3ZMVB 2FJBA 4LF5T 3A5XA 4OYKA 1VRBA 2CBJA 2QYWA 2YU1A 3ZT5A 2CPTA 3VR8A 4ISSA 3FZMB 3MA9A 4UIGA 3AAAB 4IE5A 2E9XB 2W67A 2V6YB 3PUWF 3EDVA 1IBKT 1J1JA 3Q5WA 1W0BA 3N9NA 3N9MA 1WFDA 3TLUA 4PNIA 3AVSA 5JDNA 3BQKA 1GQEA 1UCUA 3AE3A 1O3XA 4KHPT 3FZKB 5FVKA 2K3WA 4AKRB 2PFVA 4X1IE 4ANJA 2LRLA 2KLQA 3P4SA 4ISTA 4YLHA 3FXEB 3JAFA 4L0RA 4ZOLE 2BKOA 4K0UA 4CI3B 4DBQA 5LG3A 5ABFB 2J62A 2CBIA 3AXJB 3UUMA 3PJAA 1QUUA 3UUXB 2Z6EA 2YINA 5HEJA 1SA0E 2K9AA 3QK6A 1NENA 2FJEA 2W4XA 4PK4A 2LSJA 4TNVA 3ZMUB 4EV6A 2DWKA 2IIUA 2UXDT 2W66A 4EB6E 1N32T 2IW5B 2LM9A 5EK4A 1WRDA 3TLTA 4N78D 1MMAA 4HN9A 3RRCA 5LGUB 2QRXA 4IE0A 4DV1T 4DR3T 2UUCT 1T7SA 5AQLB 2CLYC 4CXXA 3RC8A 3HI2A 1E2AA 2FJDA 2NWBA 3ZMZB 2NOXA 2V5DA 2X9XA 3AE5A 5HEUA 4CN4A 3GWHA 2XZEA 3AE9A 3KV9A 3UT5E 4E7ZA 4CXYA 1IAPA 3PV0F 4KHZF 3N2KE 3IEEA 1YXRA 2EHOC 4O4LE 4CN1A 1YKEB 4PAGA 3ANWB 4BJNA 3CQXC 4HGAA 4C91A 1LVKA 3QOFA 4YTMA 5TAOA 1YKHB 5HXEA 3QC9A 3T1HT 2JQ9A 5HCMA 5L4HA 3JC6C 5LG4A 3RYCE 1XMQT 4JI8T 2QA7A 1AJ3A 2YDQA 5F5WA 2A3DA 3J9X1 2WCAA 3ZYKA 3KV6A 5L47A 4OHFA 2LSYA 3NBXX 3OYZA 4EXTA 2XQAA 3ZCIA 4ASKA 2YDSA 5ADXL 2XQ6A 2W63A 4UVBB 1HS7A 2C5JA 2GK9A 4HEAA 1OEDC 4ZS3A 5CA1E 2WY2A 4LFCT 4G2AA 5EK3A 1E7PA 3OYXA 4IE6A 4U31A 2LSGA 3C64A 3CVRA 2BG9B 3EI0A 4H63H 1VCTA 3EHZA 1EZ3A 2XSBA 5JH7E 4HWCA 5AQMB 2VKJA 1W9RA 3C98B 3LK3B 4J2CA 4LF8T 3NZPA 3UU3A 4A56A 1HNXT 2UUAT 4JI2T 5CB4E 4IT4A 4EEDA 4I50E 1M7KA 3O1IA 3D0TA 4QKNA 4X20E 4ZS2A 3FZLB 3NRXA 3RQUA 2VKHA 3HKEE 4QXBB 4EIWA 3MKDA 5AQTB 2SPCA 4BA9A 2LM2A 4ILBA 2E2AA 5JR9B 1MMGA 2E5LT 5HEHA 2VVSA 3N9PA 2PG8A 2D0TA 3RYFE 2V6XA 1WLXA 5IYZE 5HXHA 5F8PA 2LE8A 3E22E 3P4PA 2FJAA 4AKLA 4HKAA 2D2SA 2VK9A 4I43B 2WDRA 4UELA 1HG5A 2I6HA 2MTQA 2MAWA 3AE4A 3ZPOA 3CK6A 1HX8A 5FXVA 2IAKA 3G06A 5ABHA 2X9YA 2IC6A 3VR9A 2X51A 3PTRB 3E0ZA 2KMFA 5LHHB 1XMOT 4NIQA 2JMHA 1MIYA 4LF9T 3RPUA 2VVNA 3QNUA 3C4ZA 3I9WA 4UV8B 5AQHB 2ZM6T 4B3TT 3NKZA 2V7IA 5JDGA 3ZN1B 4LMKA 5L3BB 2H3RA 2KZ7B 3FZFB 2FUPA 4V1Av 3VU7H 2PTFA 1KFYA 4YY3T 5FVLA 2A9UA 3OKQA 4DV5T 1CUNA 2JQQA 3M3ZB 4HFBA 2LHRA 3FZHB 4TX5A 3N9OA 4HFDA 3V5SA 5LNKA 4GIWA 1MNDA 2K5BB 3AXJA 5AQUB 1HX1B 5ABFA 3O4XE 3PUYF 2BVMA 4LF7T 2BS4A 3PUSA 4H9NC 5KDMC 1IBMT 1ZP0A 3ZLIA 4BAYB 4TV9E 4PJJA 1H7CA 5JQGE 1UUSA 2UXNB 3AA0B 3AE1A 2XM1A 3MJXA 3P4QA 3N9LA 4H9RC 3W15B 4EYUA 2BBHA 2N2NA 2G0UA 2NW7A 4GYSA 2BG9E 2V6YA 3RF1A 4AQYT 4GKJT 4P09A 2XQ5A 4DV6T 2LSKA 4YXDA 3B13A 5C3JA 3FHNA 5FXZA 2LHNA 5AQSB 5IUXA 5FY0A 3ONLC 4UF0A 4CI1B 4L9IA 1KNPA 4B3MT 3AEEA 2LKGA 4HWHA 2PBIA 2KSRA 4DR5T 4YSZA 4ZI3D 3AEDA 3AA7B 4DR7T 4BJMA 4FI5A 4LF4T 2XUEA 1J5ET 4AKHA 3NZQA 4PW8A 2AXDS 2CRBA 1UURA 3VKHA 3PDYA 5L3CB 4NUVA 1UX4A 2QVAA 3EAMA 4PFPA 3TLSA 5AQQB 1BR1A 4EZHA 2RA1A 4GK0E 1BR0A 4AQFA 2BG9A 5ETWA 2KT9A 4AQGA 2DI4A 3OPCA 3WAKA 1KNRA 3I0OA 2I0MA 3P4WA 4C90A 3CIRA 4NUUA 4CQIA 4PK5A 3I0QA 5LCYA 2UUBT 3CWZB 2M6IA 4OFZA 1N34T 3MZKB 4B3ST 4UVAB 2HPLA 1UGOA 1KF6A 4IDOA 3RC3A 4ZI2C 1D0YA 2D5UA 1V9DA 2OA5A 1HTJF 2YKSA 4P0BA 4QX8B 3KDSE 1U4QA 4QXCB 4AXPA 4A97A 2NW8A 3CQGB 2E9XD 1N33T 3EABA 3ANWA 2V7MA 2KWHA 2LRKA 4EEBA 3CMLA 3UU6A 5E0OA 1T8BA 2WU2A 2OV9A 2C5IT 3K3OA 4K0KT 2WQYA 3VKGA 2MBGA 1G73A 3K1SA 1N36T 4UR9A 2Q9QD 3FBZA 5ABGA 3SOLA 3X1DA 3UQ7A 2RP4A 3ZJ1A 4LF6T 2Q9QC 5AQJB 4UEMA 4OX9T 2ACXA 2EHOB 3I9YA 2BDEA 4B3RT 1X9BA 3FB2A 4LMLA 3LBXB 2JRKA 4TUYE 2LT3A 3AAIA 3RYIE 5JDLA 2XQ7A 1J5WA 4DMVA 2UXCT 5BR8T 4DIDB 3C4XA 4U2YA 4P1NA 4B6XA 5L3EB 5L3FB 4COFA 1HCIA 3E08A 3K8PC 2A72A 2VKOA 3B5MA 5HWXA 4NXMT 3UUBA 4TN7B 2Q9QB 4IDPA 5CFBA 4YJ2E 3AE2A 1HG2A 2A2FX 3MK7C 4DR6T 2UU9T 4QHOA 1OEDE 1WCRA 3Q5DA 5EK2A 2CEAA 2DCFA 2CWYA 2WM9A 3U3IA 2ODUA 3CQCB 3R84B 5FNVE 3DTOA 3WI3A 3AEAA 5A1LA 3PU8A 2VQFT 1ZHCA 2XM2A 4PJNA 3AEFA 1LVFA 2B76A 2XSAA 3ZN0B 2NW9A 2WAUA 3OTOT 1JNZA 5LA6E 1ZV4X 4DV7T 2NP9A 5LHGB 5LYJE 1DU2A 1MIWA 1T98A 1W0AA 2X9WA 3F57A 3KV4A 1LKXA 4JLEA 4QXHB 3SS1A 5AQVB 4WBNE 5FL1A 4U72A 3J7Yq 2IDOB 2W62A 2X67A 3RIUA 3AE6A 3AA6B 4HFEA 2WZHA 4O8SA 4TV8E 3AB3B 3P4RA 3RYHE 3ZMSB 3LSVA 4JI4T 2WU5A 4X5TA 3OBVE 5FYMA 3JCFA 4YTPA 2W61A 5KX5E 2NR4A 4H9SE 4H9OC 2LKHA 4X62T 3IHRA 1KNZA 2DWGA 4AISA 1US7B 2V7KA 1KK7A 4I4TE 2VKDA 2C0SA 4TWFA 5JDQA 3ZC0A 3ZMTB 4Z90A 3P7IA 5KMGP 2IMLA 1NAFA 1S35A 2VL8A 2HH7A 3AEBA 3ZYLA 5HXSA 3MXZA 5BMVE 2CMRA 4HWDA 1QLBA 2JJ9A 4X1YE 5LOVE 3RIFA 2YOEA 2LEHA 2X0HA 2JIWA 1OWAA 2CXFA 2H88A 1MNEA 4U3CA 5LP6E 1IZNB 4ZI3C
chains in the Genus database with same CATH topology
4DNDA 4CXWA 1D0ZA 4DBRA 2YK0A 2K24A 2J1DG 3HA4A 5JR9A 3HKBE 4XAXB 3C51A 4ADZA 2KXPB 1VOMA 4H9PC 2D0UA 3CKDA 3CX6B 3N2OA 4CI2B 3AAEB 4IDZA 3O1JA 2ZM0A 3K3QC 2WBLA 4IIJE 4U74A 5FY7A 2WMOA 4G63A 4M1PA 3HKCE 3KVBA 3V5UA 5CA0E 3QUJA 5JQGE 3JC6D 2KINB 5JVDE 3LBXA 5F3JA 3FBLA 1QSDA 3ZJ2A 3PUAA 3GA8A 3P8CD 2WWUA 2H7VC 4HE8A 3O9XA 1MMDA 1D0XA 3U78A 1WR6A 4AKIA 4L5GA 4X1KE 3O1HA 1D1CA 5HXCA 4AQFC 4ERRA 4AKGA 2ODVA 3K3NA 4EOZB 5HYAA 2XAQB 3LK2B 5EZYE 3SWHA 2Y6XA 4HTEA 2IC9A 3N5LA 3GMIA 2ZM8A 2ZM2A 4WBOA 3WAJA 5HWYA 2V1DB 3VHLA 3DP7A 3RH3A 3H3AA 4O4IE 3N9QA 4IE7A 2N9DA 2Y8DA 4KMCA 2N1GA 4TZ4C 2XHEB 5JRCA 3KVAA 1Z0PA 5JDMA 4EZ4A 2JPFA 4KP3C 3T8OA 1S94A 1OXZA 3UULA 4AI6A 2I59A 3ETUA 1D1BA 2DLRA 4MLKA 4O4JE 5J1GA 3EUHA 4UF0B 4FJOA 4GYRA 4PJMA 3IBPA 5JDFA 5FXWA 4IGUA 3KFWX 4GK5E 2DNXA 3ZC1A 2XAGB 2UXXB 3MACA 1ZKEA 2E9XA 3HL6A 3UFEA 2ZLYA 2MYSA 3LG7A 5LBMA 2X66A 5L3DB 2LJLA 2JMKA 4H63V 4HFVA 4PFOA 4XZCA 5DQWA 3VKGA 4ZI2D 3RX6A 4QWNB 3ZEFB 2BVLA 3L09A 5HXRA 4GOUA 3KINB 4XBFB 3H37A 1BR4A 2C5KT 4ILUA 3IF8B 3B57A 2XTLA 2Q9QA 3ZCJA 4YJ3E 3BK9A 1D1AA 2CM0A 1ZEEA 3C50A 4YFSA 3AVRA 2X0LB 1LRZA 2K48A 3AA1B 4UVCB 1HF8A 2XQYA 4B6XA 2LSIA 3UTKA 2EHOA 4OYJA 5GONE 5HAXA 1FMVA 4MFRA 5M4YA 2CXLA 5C8YE 2VB6A 3DJBA 2CLYB 2MOZA 3F31A 2ES0A 4YHJA 2VWAA 2WSSV 5FP3A 4ZI7E 3R6NA 4Z8XA 5JR9C 4WNKA 3CPZA 3LFMA 2DHRA 3ZYMA 5LHIB 4QX7B 4CZZB 3PUGA 3PE0A 2PJQA 3PU3A 2CXDA 1X79A 4PK6A 5LJNA 4KBMB 1E1HB 2KWIB 4DMWA 5JREA 4JUYA 2LOSA 4H9QC 3TKLB 3FXDB 4O4HE 1MIVA 3LK42 1IJ6A 1MMNA 2X9HA 3Q9DA 3BQLA 3KV5A 5AFUL 5LBQB 3I1AA 1UX5A 3PUQA 3CX8B 4JEHB 2NTYA 2YEVC 1BR2A 5J2UE 3EVYA 3ONXA 2HPJA 4MHCA 4IE4A 5LXTE 3N2GE 4MALA 4EYYR 2XASB 3OJAA 4IHJE 5JRCB 5DJQC 2H7OA 5DQVA 3Q2MA 2B1EA 4PJLA 4EAHA 2Y48B 2YU2A 1SHZC 4E7SA 2QGSA 2V26A 2KNDA 4O2AE 2WMNA 2CE7A 2V7JA 5L3GB 1FMWA 1YD8G 2W0GA 3RRWA 4UV9B 3RKOA 1WYBA 4KUMB 4F6RC 5LJMA 5LGTB 5LGNB 3M65A 2NTXA 4O2BE 1B7TA 5DABA 5L2LA 2E8IA 1WYCA 3HR0A 2M67A 3UUNA 1FEWA 2L3LA 2VASA 2X68A 5FY1A 3F2EA 4UXNB 3KBUA 2L8KA 1U5PA 3SRZA 2XAJB 2EHOD 3GN5A 3L3PA 1G8XA 2L9QA 3Q5XA 2XAHB 2BZBA 1HFAA 3HKDE 3KBTA 2V7LA 4ZHQE 2XAFB 4DO0A 2CCQA 2CWOA 2P9BA 4WW0A 4OK0A 5FMNA 3EDUA 5J2TE 1YW0A 4MBQA 4I55E 5FXXA 2E9XC 3LJCA 2W00A 1IJ5A 1NWMX 5JDHA 2CA5A 1Y64B 4DVDA 1FIOA 3BQIA 3CX7B 4P0AA 5IHYA 3GN5B 3ESLA 3ETVA 5H6RB 5H6QB 2LOPA 3S4UA 3C4WA 3PURA 3ZMVB 2ZMAA 3NRYA 4JEUB 3A5XA 4OYKA 1VRBA 2YU1A 4ISSA 3MA9A 4UIGA 3AAAB 4IE5A 2E9XB 3EDVA 3Q5WA 3N9NA 3N9MA 4PNIA 3AVSA 5JDNA 3BQKA 1UCUA 1O3XA 4AKRB 2PFVA 4X1IE 4ANJA 2KLQA 4ISTA 4YLHA 4CI3B 3FXEB 4ZOLE 4L0RA 4K0UA 3UUMA 1QUUA 3UUXB 2Z6EA 2YINA 1SA0E 2K9AA 3QK6A 3ZMUB 4PK4A 2LSJA 2DWKA 4EB6E 2IW5B 2LM9A 5EK4A 1WRDA 4N78D 1MMAA 4HN9A 3RRCA 5LGUB 4IE0A 2CLYC 4CXXA 3RC8A 3HI2A 2NWBA 3ZMZB 2NOXA 2X9XA 3GWHA 3KV9A 3UT5E 4E7ZA 4CXYA 1IAPA 3N2KE 3IEEA 2EHOC 4O4LE 1YKEB 4PAGA 3ANWB 4BJNA 3CQXC 4HGAA 4C91A 1LVKA 5TAOA 4DBQA 5HXEA 1YKHB 3QC9A 3JC6C 5LG4A 3RYCE 2QA7A 1AJ3A 2A3DA 3J9X1 3ZYKA 3KV6A 4OHFA 2LSYA 3NBXX 3OYZA 3ZCIA 4ASKA 5ADXL 2W63A 4UVBB 1HS7A 2C5JA 2GK9A 4HEAA 4ZS3A 5CA1E 4G2AA 5EK3A 3OYXA 4EXTA 4IE6A 2LSGA 3C64A 3CVRA 4H63H 1EZ3A 5JH7E 2VKJA 3C98B 3LK3B 4J2CA 3NZPA 4A56A 5CB4E 4I50E 3O1IA 3D0TA 4QKNA 4X20E 4ZS2A 3NRXA 2VKHA 3HKEE 4QXBB 4EIWA 3MKDA 2SPCA 4BA9A 5JR9B 1MMGA 3N9PA 3RYFE 2PG8A 2D0TA 1WLXA 5IYZE 5HXHA 5F8PA 2LE8A 3E22E 4AKLA 4HKAA 2D2SA 2VK9A 4I43B 4UELA 1HG5A 2MTQA 3ZPOA 1HX8A 5FXVA 2IAKA 2X9YA 2IC6A 5LHHB 2X51A 3PTRB 3E0ZA 2KMFA 2JMHA 1MIYA 3RPUA 4UV8B 3C4ZA 3I9WA 2V7IA 5JDGA 3ZN1B 5L3BB 2H3RA 2KZ7B 4V1Av 3VU7H 3OKQA 1CUNA 2JQQA 2LHRA 4TX5A 3V5SA 3N9OA 5LNKA 4GIWA 1MNDA 2K5BB 3O4XE 2BVMA 3PUSA 4H9NC 5KDMC 4BAYB 3ZLIA 4TV9E 4PJJA 1H7CA 2UXNB 3AA0B 3MJXA 3W15B 4EYUA 3N9LA 4H9RC 2G0UA 2N2NA 2NW7A 4GYSA 4P09A 2LSKA 3B13A 3FHNA 5FXZA 2LHNA 5FY0A 4UF0A 4CI1B 4L9IA 2PBIA 4ZI3D 3AA7B 4BJMA 4FI5A 2XUEA 4AKHA 3NZQA 4PW8A 3VKHA 3PDYA 5L3CB 4NUVA 1UX4A 4PFPA 4EZHA 1BR1A 2RA1A 4GK0E 1BR0A 4AQFA 5ETWA 2KT9A 4AQGA 2DI4A 3WAKA 3I0OA 4C90A 4NUUA 4CQIA 4PK5A 3I0QA 5LCYA 3CWZB 4OFZA 3MZKB 4UVAB 2HPLA 3RC3A 4ZI2C 1D0YA 2D5UA 1V9DA 2OA5A 1HTJF 4P0BA 4QX8B 4AXPA 3KDSE 1U4QA 4QXCB 2NW8A 3CQGB 2E9XD 3ANWA 2V7MA 2KWHA 3CMLA 5E0OA 2C5IT 3K3OA 2MBGA 1G73A 2Q9QD 3FBZA 3SOLA 2RP4A 3ZJ1A 2Q9QC 4UEMA 2ACXA 2EHOB 3I9YA 2BDEA 3FB2A 3LBXB 2JRKA 4TUYE 2LT3A 3AAIA 3RYIE 5JDLA 4DMVA 3C4XA 5L3EB 5L3FB 1HCIA 3E08A 3K8PC 2A72A 2VKOA 5HWXA 4TN7B 2Q9QB 4YJ2E 1HG2A 2A2FX 3MK7C 4QHOA 5EK2A 2CEAA 2DCFA 2WM9A 2CWYA 3U3IA 2ODUA 3CQCB 3R84B 5FNVE 3DTOA 3WI3A 5A1LA 3PU8A 1ZHCA 4PJNA 3ZN0B 1LVFA 2NW9A 2WAUA 5LA6E 1ZV4X 2NP9A 5LHGB 5LYJE 3F57A 1T98A 1MIWA 2X9WA 3KV4A 4JLEA 1LKXA 4QXHB 3SS1A 4WBNE 4U72A 3J7Yq 2W62A 2X67A 4O8SA 3AA6B 4TV8E 3AB3B 3RYHE 3ZMSB 3OBVE 5FYMA 5KX5E 2W61A 1KNZA 4H9SE 4H9OC 3IHRA 2DWGA 5JDQA 1US7B 2V7KA 1KK7A 4I4TE 2VKDA 2C0SA 3ZC0A 3ZMTB 3P7IA 5KMGP 2VL8A 1NAFA 1S35A 3ZYLA 2HH7A 5HXSA 3MXZA 5BMVE 2CMRA 2JJ9A 4X1YE 5LOVE 2LEHA 1OWAA 2CXFA 1MNEA 5LP6E 1IZNB 4ZI3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LG7 A;  2XHE B;  4JEH B;  1FEW A;  1S94 A;  3C98 B;  4TX5 A;  2DNX A;  1BR0 A;  5M4Y A;  5LG4 A;  4JEU B;  1FIO A;  1G73 A;  1HS7 A;  1EZ3 A; 
#chains in the Genus database with same CATH topology
 4DND A;  4CXW A;  1D0Z A;  3H3M A;  4HFC A;  1JNR A;  4DBR A;  1HNZ T;  2YK0 A;  2K24 A;  2J1D G;  4DV3 T;  3HA4 A;  5AQI B;  5JR9 A;  3RI5 A;  3HKB E;  2DL1 A;  4XAX B;  3C51 A;  1SE7 A;  2J47 A;  3ZKR A;  2RPA A;  3ZT7 A;  2KXP B;  4ADZ A;  1VOM A;  4YT0 A;  4F8H A;  3L39 A;  4H9P C;  2D0U A;  3CKD A;  3CX6 B;  3N2O A;  4JI1 T;  2R6G F;  4CI2 B;  2HHH T;  3AAE B;  4IDZ A;  2VUR A;  5AQK B;  3RIA A;  3O1J A;  2ZM0 A;  2V8S V;  2WWV A;  3K3Q C;  2WBL A;  4IIJ E;  4U74 A;  5FY7 A;  4ZZC A;  5JTG A;  5LMU T;  2WMO A;  4G63 A;  4M1P A;  4ZZB A;  3HKC E;  3KVB A;  3UU4 A;  5FL0 A;  3V5U A;  2X0Y A;  4YSY A;  4IL4 A;  3QUJ A;  5CA0 E;  3JC6 D;  3VRA A;  2KIN B;  4U33 A;  1ZOY A;  2YN6 A;  5JVD E;  3LBX A;  3QB5 A;  5F3J A;  1OED A;  2J4G A;  3FBL A;  1QSD A;  3ZJ2 A;  3PUA A;  3TLW A;  3GA8 A;  4WZX A;  1OED B;  3P8C D;  4HWI B;  2WWU A;  2H7V C;  4HE8 A;  5HCJ A;  1MMD A;  1D0X A;  2CHN A;  3JAE A;  4U2Z A;  3U78 A;  3O9X A;  1WR6 A;  4AKI A;  4L5G A;  2IUB A;  3O1H A;  1D1C A;  4X1K E;  5HXC A;  1I94 T;  4AQF C;  4ERR A;  4AKG A;  2ODV A;  3SFD A;  3K3N A;  3ZT6 A;  4EOZ B;  5HYA A;  2XAQ B;  1YQ4 A;  3LK2 B;  3PUX F;  5EZY E;  3SWH A;  2Y6X A;  4HTE A;  2IC9 A;  1W09 A;  3ONJ A;  3Q5E A;  2BS2 A;  4YHH T;  5KXJ A;  5AQG B;  3N5L A;  4LMJ A;  5CGM A;  4JI5 T;  4DR1 T;  3GMI A;  2ZM8 A;  2ZM2 A;  4U7Y A;  4WBO A;  3WAJ A;  2V5C A;  5HWY A;  2V1D B;  3A8Y C;  3VHL A;  5ABE A;  3DP7 A;  2BBJ A;  3RH3 A;  1YQ3 A;  2UXB T;  2IHR 1;  3H3A A;  4O4I E;  3N9Q A;  4IE7 A;  3VRB A;  2HN1 A;  2N9D A;  1XNR T;  2Y8D A;  3P50 A;  2M6B A;  2N1G A;  4KMC A;  4TZ4 C;  2H89 A;  2XHE B;  2LLY A;  4EGW A;  5IWA T;  4JI6 T;  5JRC A;  3KVA A;  1Z0P A;  5JDM A;  4DV4 T;  2WZI A;  1XZY A;  4Z91 A;  4EZ4 A;  2JPF A;  3LDQ B;  4KP3 C;  3T8O A;  2JQK A;  3PUZ F;  1S94 A;  1OXZ A;  3UUL A;  4AI6 A;  2I59 A;  3ETU A;  1CHU A;  4JI3 T;  1D1B A;  1VCS A;  2DLR A;  4MLK A;  4O4J E;  5AQP B;  2WDV A;  2WS3 A;  3EUH A;  3L8R A;  4UF0 B;  5J1G A;  1KEY A;  1T72 A;  2BS3 A;  4FJO A;  4GYR A;  4PJM A;  4X64 T;  3IBP A;  5JDF A;  3T1Y T;  5FXW A;  4IGU A;  3KFW X;  4GK5 E;  2DNX A;  3ZC1 A;  2XAG B;  5L4E A;  3RKG A;  4JI7 T;  2UXX B;  3MAC A;  1ZKE A;  2E9X A;  3HL6 A;  3UFE A;  2YDR A;  2ZLY A;  2MYS A;  3LG7 A;  3ABV A;  2ACZ A;  4KX6 A;  5LBM A;  2X66 A;  5L3D B;  1I6Z A;  2AE9 A;  2LJL A;  2JMK A;  4H63 V;  4HFV A;  2D9D A;  2XJ7 A;  4PFO A;  4WYV A;  4XZC A;  5DQW A;  3RX6 A;  4A5X A;  4QWN B;  3ZEF B;  4ZI2 D;  2BVL A;  3L09 A;  5HXR A;  4GOU A;  3KIN B;  4XBF B;  4X65 T;  1XWM A;  4IL9 A;  3H37 A;  1BR4 A;  3AEC A;  2C5K T;  4ILU A;  3IF8 B;  2Q9Q A;  2OLT A;  2XTL A;  3B57 A;  4YJ3 E;  3BK9 A;  3ZCJ A;  2WDQ A;  1D1A A;  2VL0 A;  4DUY T;  2CM0 A;  5HEO A;  1ZEE A;  3C50 A;  2VQE T;  4I0U A;  4YFS A;  3AEG A;  3ZSS A;  2CHO A;  3AVR A;  2X0L B;  1LRZ A;  2K48 A;  3AA1 B;  4UVC B;  1Z8U A;  1HF8 A;  2XQY A;  1L0V A;  4IRE A;  2LSI A;  3UTK A;  2EHO A;  4OYJ A;  5GON E;  5HAX A;  1FMV A;  4MFR A;  4HFH A;  5M4Y A;  2CXL A;  5C8Y E;  2VB6 A;  3DJB A;  2CLY B;  1WR0 A;  4ILC A;  1UK5 A;  2MOZ A;  3F31 A;  4AIU A;  2ES0 A;  4YHJ A;  2VWA A;  2WSS V;  5LB7 B;  5FP3 A;  4ZI7 E;  3R6N A;  4Z8X A;  1FJG T;  5JR9 C;  4LFB T;  4WNK A;  3CPZ A;  3LFM A;  2DHR A;  3ZYM A;  5LHI B;  4QX7 B;  4JYA T;  4KI0 F;  4CZZ B;  2HN2 A;  2W2U A;  3PUG A;  2BG9 C;  4HFI A;  3PE0 A;  3RIU C;  2PJQ A;  3UQ4 A;  3PU3 A;  2CXD A;  1X79 A;  5AQO B;  4PK6 A;  3UFG A;  5LJN A;  4KBM B;  1E1H B;  2KWI B;  4DMW A;  5JRE A;  2XQ9 A;  4JUY A;  2LOS A;  4H9Q C;  3TKL B;  3FXD B;  4LFA T;  4O4H E;  4QH5 A;  1MIV A;  3A7M A;  3IA3 A;  3LK4 2;  1IJ6 A;  1MMN A;  2X9H A;  3Q9D A;  4JBW F;  3BQL A;  3KV5 A;  5HEG A;  5AFU L;  5LBQ B;  3I1A A;  1UX5 A;  5AQR B;  3PUQ A;  4YSX A;  3CX8 B;  4JEH B;  2NTY A;  2YEV C;  1BR2 A;  3UU8 A;  5J2U E;  3EVY A;  3ONX A;  2HPJ A;  4MHC A;  4DR4 T;  4IE4 A;  5LXT E;  3N2G E;  4ZXL A;  4MAL A;  4EYY R;  2XAS B;  3OJA A;  4IHJ E;  4GKK T;  5JRC B;  5DJQ C;  4Q25 A;  2H7O A;  5DQV A;  2XPK A;  3Q2M A;  3PUV F;  5AQF B;  3RHW A;  3RLF F;  2B1E A;  4PJL A;  4EAH A;  2Y48 B;  2YU2 A;  3SFE A;  1SHZ C;  4E7S A;  4YTN A;  4DR2 T;  2XY8 B;  2QGS A;  2V26 A;  2JQH A;  2KND A;  3PJA J;  4NXN T;  1NEK A;  4O2A E;  2WMN A;  2F4V T;  2CE7 A;  2V7J A;  5L3G B;  5LMN T;  5CJ5 A;  1FMW A;  1YD8 G;  2W0G A;  3RQW A;  3RRW A;  4UV9 B;  3RKO A;  1HR0 T;  1WYB A;  4KUM B;  4F6R C;  5LJM A;  1Y01 A;  4JI0 T;  5LGT B;  5LGN B;  3M65 A;  3QB5 K;  2NTX A;  4O2B E;  1B7T A;  5DAB A;  5L2L A;  1SUM B;  1HNW T;  2E8I A;  1WYC A;  3TLV A;  4A98 A;  4CN6 A;  4IDQ A;  1XDO A;  4QH1 A;  3UU5 A;  3HR0 A;  1M62 A;  5C2T A;  2M67 A;  1XDP A;  3RGL A;  3UUN A;  1FEW A;  2L3L A;  3NVO A;  2VAS A;  2X68 A;  5FY1 A;  1R8I A;  4DUZ T;  3F2E A;  4HWF A;  4DV2 T;  4QH4 A;  4UXN B;  3KBU A;  5J0Z A;  4X66 T;  2L8K A;  1U5P A;  3SRZ A;  2XAJ B;  4TWD A;  2EHO D;  4DV0 T;  3GN5 A;  3L3P A;  2BKP A;  2L9Q A;  1G8X A;  3NWI A;  2XQ3 A;  3OVU A;  2XAH B;  3Q5X A;  2BZB A;  1HFA A;  2XQ8 A;  3HKD E;  2V7L A;  3JAD A;  3KBT A;  5AQN B;  2XAF B;  4DO0 A;  2CCQ A;  2CWO A;  4ZHQ E;  2P9B A;  2MPK A;  4WW0 A;  4OK0 A;  5FMN A;  4JV5 T;  3EDU A;  1IBL T;  4U7I A;  5FKY A;  5J2T E;  1YW0 A;  2WP9 A;  4MBQ A;  3AE8 A;  2WB5 A;  4I55 E;  2BKN A;  2E9X C;  4NPP A;  3AE7 A;  5FXX A;  3S4U A;  3LJC A;  2W00 A;  3ZST A;  1IJ5 A;  1NWM X;  5JDH A;  2CA5 A;  1Y64 B;  2E5V A;  4DVD A;  4IDN A;  1FIO A;  3BQI A;  3CX7 B;  4P0A A;  5IHY A;  1XNQ T;  3GN5 B;  3ESL A;  3ETV A;  4ZEY A;  5H6R B;  4ILA A;  2LOP A;  4TWH A;  5H6Q B;  3C4W A;  2FBW A;  3PUR A;  2XQ4 A;  2ZMA A;  3NRY A;  4JEU B;  4TNW A;  3ZMV B;  2FJB A;  4LF5 T;  3A5X A;  4OYK A;  1VRB A;  2CBJ A;  2QYW A;  2YU1 A;  3ZT5 A;  2CPT A;  3VR8 A;  4ISS A;  3FZM B;  3MA9 A;  4UIG A;  3AAA B;  4IE5 A;  2E9X B;  2W67 A;  2V6Y B;  3PUW F;  3EDV A;  1IBK T;  1J1J A;  3Q5W A;  1W0B A;  3N9N A;  3N9M A;  1WFD A;  3TLU A;  4PNI A;  3AVS A;  5JDN A;  3BQK A;  1GQE A;  1UCU A;  3AE3 A;  1O3X A;  4KHP T;  3FZK B;  5FVK A;  2K3W A;  4AKR B;  2PFV A;  4X1I E;  4ANJ A;  2LRL A;  2KLQ A;  3P4S A;  4IST A;  4YLH A;  3FXE B;  3JAF A;  4L0R A;  4ZOL E;  2BKO A;  4K0U A;  4CI3 B;  4DBQ A;  5LG3 A;  5ABF B;  2J62 A;  2CBI A;  3AXJ B;  3UUM A;  3PJA A;  1QUU A;  3UUX B;  2Z6E A;  2YIN A;  5HEJ A;  1SA0 E;  2K9A A;  3QK6 A;  1NEN A;  2FJE A;  2W4X A;  4PK4 A;  2LSJ A;  4TNV A;  3ZMU B;  4EV6 A;  2DWK A;  2IIU A;  2UXD T;  2W66 A;  4EB6 E;  1N32 T;  2IW5 B;  2LM9 A;  5EK4 A;  1WRD A;  3TLT A;  4N78 D;  1MMA A;  4HN9 A;  3RRC A;  5LGU B;  2QRX A;  4IE0 A;  4DV1 T;  4DR3 T;  2UUC T;  1T7S A;  5AQL B;  2CLY C;  4CXX A;  3RC8 A;  3HI2 A;  1E2A A;  2FJD A;  2NWB A;  3ZMZ B;  2NOX A;  2V5D A;  2X9X A;  3AE5 A;  5HEU A;  4CN4 A;  3GWH A;  2XZE A;  3AE9 A;  3KV9 A;  3UT5 E;  4E7Z A;  4CXY A;  1IAP A;  3PV0 F;  4KHZ F;  3N2K E;  3IEE A;  1YXR A;  2EHO C;  4O4L E;  4CN1 A;  1YKE B;  4PAG A;  3ANW B;  4BJN A;  3CQX C;  4HGA A;  4C91 A;  1LVK A;  3QOF A;  4YTM A;  5TAO A;  1YKH B;  5HXE A;  3QC9 A;  3T1H T;  2JQ9 A;  5HCM A;  5L4H A;  3JC6 C;  5LG4 A;  3RYC E;  1XMQ T;  4JI8 T;  2QA7 A;  1AJ3 A;  2YDQ A;  5F5W A;  2A3D A;  3J9X 1;  2WCA A;  3ZYK A;  3KV6 A;  5L47 A;  4OHF A;  2LSY A;  3NBX X;  3OYZ A;  4EXT A;  2XQA A;  3ZCI A;  4ASK A;  2YDS A;  5ADX L;  2XQ6 A;  2W63 A;  4UVB B;  1HS7 A;  2C5J A;  2GK9 A;  4HEA A;  1OED C;  4ZS3 A;  5CA1 E;  2WY2 A;  4LFC T;  4G2A A;  5EK3 A;  1E7P A;  3OYX A;  4IE6 A;  4U31 A;  2LSG A;  3C64 A;  3CVR A;  2BG9 B;  3EI0 A;  4H63 H;  1VCT A;  3EHZ A;  1EZ3 A;  2XSB A;  5JH7 E;  4HWC A;  5AQM B;  2VKJ A;  1W9R A;  3C98 B;  3LK3 B;  4J2C A;  4LF8 T;  3NZP A;  3UU3 A;  4A56 A;  1HNX T;  2UUA T;  4JI2 T;  5CB4 E;  4IT4 A;  4EED A;  4I50 E;  1M7K A;  3O1I A;  3D0T A;  4QKN A;  4X20 E;  4ZS2 A;  3FZL B;  3NRX A;  3RQU A;  2VKH A;  3HKE E;  4QXB B;  4EIW A;  3MKD A;  5AQT B;  2SPC A;  4BA9 A;  2LM2 A;  4ILB A;  2E2A A;  5JR9 B;  1MMG A;  2E5L T;  5HEH A;  2VVS A;  3N9P A;  2PG8 A;  2D0T A;  3RYF E;  2V6X A;  1WLX A;  5IYZ E;  5HXH A;  5F8P A;  2LE8 A;  3E22 E;  3P4P A;  2FJA A;  4AKL A;  4HKA A;  2D2S A;  2VK9 A;  4I43 B;  2WDR A;  4UEL A;  1HG5 A;  2I6H A;  2MTQ A;  2MAW A;  3AE4 A;  3ZPO A;  3CK6 A;  1HX8 A;  5FXV A;  2IAK A;  3G06 A;  5ABH A;  2X9Y A;  2IC6 A;  3VR9 A;  2X51 A;  3PTR B;  3E0Z A;  2KMF A;  5LHH B;  1XMO T;  4NIQ A;  2JMH A;  1MIY A;  4LF9 T;  3RPU A;  2VVN A;  3QNU A;  3C4Z A;  3I9W A;  4UV8 B;  5AQH B;  2ZM6 T;  4B3T T;  3NKZ A;  2V7I A;  5JDG A;  3ZN1 B;  4LMK A;  5L3B B;  2H3R A;  2KZ7 B;  3FZF B;  2FUP A;  4V1A v;  3VU7 H;  2PTF A;  1KFY A;  4YY3 T;  5FVL A;  2A9U A;  3OKQ A;  4DV5 T;  1CUN A;  2JQQ A;  3M3Z B;  4HFB A;  2LHR A;  3FZH B;  4TX5 A;  3N9O A;  4HFD A;  3V5S A;  5LNK A;  4GIW A;  1MND A;  2K5B B;  3AXJ A;  5AQU B;  1HX1 B;  5ABF A;  3O4X E;  3PUY F;  2BVM A;  4LF7 T;  2BS4 A;  3PUS A;  4H9N C;  5KDM C;  1IBM T;  1ZP0 A;  3ZLI A;  4BAY B;  4TV9 E;  4PJJ A;  1H7C A;  5JQG E;  1UUS A;  2UXN B;  3AA0 B;  3AE1 A;  2XM1 A;  3MJX A;  3P4Q A;  3N9L A;  4H9R C;  3W15 B;  4EYU A;  2BBH A;  2N2N A;  2G0U A;  2NW7 A;  4GYS A;  2BG9 E;  2V6Y A;  3RF1 A;  4AQY T;  4GKJ T;  4P09 A;  2XQ5 A;  4DV6 T;  2LSK A;  4YXD A;  3B13 A;  5C3J A;  3FHN A;  5FXZ A;  2LHN A;  5AQS B;  5IUX A;  5FY0 A;  3ONL C;  4UF0 A;  4CI1 B;  4L9I A;  1KNP A;  4B3M T;  3AEE A;  2LKG A;  4HWH A;  2PBI A;  2KSR A;  4DR5 T;  4YSZ A;  4ZI3 D;  3AED A;  3AA7 B;  4DR7 T;  4BJM A;  4FI5 A;  4LF4 T;  2XUE A;  1J5E T;  4AKH A;  3NZQ A;  4PW8 A;  2AXD S;  2CRB A;  1UUR A;  3VKH A;  3PDY A;  5L3C B;  4NUV A;  1UX4 A;  2QVA A;  3EAM A;  4PFP A;  3TLS A;  5AQQ B;  1BR1 A;  4EZH A;  2RA1 A;  4GK0 E;  1BR0 A;  4AQF A;  2BG9 A;  5ETW A;  2KT9 A;  4AQG A;  2DI4 A;  3OPC A;  3WAK A;  1KNR A;  3I0O A;  2I0M A;  3P4W A;  4C90 A;  3CIR A;  4NUU A;  4CQI A;  4PK5 A;  3I0Q A;  5LCY A;  2UUB T;  3CWZ B;  2M6I A;  4OFZ A;  1N34 T;  3MZK B;  4B3S T;  4UVA B;  2HPL A;  1UGO A;  1KF6 A;  4IDO A;  3RC3 A;  4ZI2 C;  1D0Y A;  2D5U A;  1V9D A;  2OA5 A;  1HTJ F;  2YKS A;  4P0B A;  4QX8 B;  3KDS E;  1U4Q A;  4QXC B;  4AXP A;  4A97 A;  2NW8 A;  3CQG B;  2E9X D;  1N33 T;  3EAB A;  3ANW A;  2V7M A;  2KWH A;  2LRK A;  4EEB A;  3CML A;  3UU6 A;  5E0O A;  1T8B A;  2WU2 A;  2OV9 A;  2C5I T;  3K3O A;  4K0K T;  2WQY A;  3VKG A;  2MBG A;  1G73 A;  3K1S A;  1N36 T;  4UR9 A;  2Q9Q D;  3FBZ A;  5ABG A;  3SOL A;  3X1D A;  3UQ7 A;  2RP4 A;  3ZJ1 A;  4LF6 T;  2Q9Q C;  5AQJ B;  4UEM A;  4OX9 T;  2ACX A;  2EHO B;  3I9Y A;  2BDE A;  4B3R T;  1X9B A;  3FB2 A;  4LML A;  3LBX B;  2JRK A;  4TUY E;  2LT3 A;  3AAI A;  3RYI E;  5JDL A;  2XQ7 A;  1J5W A;  4DMV A;  2UXC T;  5BR8 T;  4DID B;  3C4X A;  4U2Y A;  4P1N A;  4B6X A;  5L3E B;  5L3F B;  4COF A;  1HCI A;  3E08 A;  3K8P C;  2A72 A;  2VKO A;  3B5M A;  5HWX A;  4NXM T;  3UUB A;  4TN7 B;  2Q9Q B;  4IDP A;  5CFB A;  4YJ2 E;  3AE2 A;  1HG2 A;  2A2F X;  3MK7 C;  4DR6 T;  2UU9 T;  4QHO A;  1OED E;  1WCR A;  3Q5D A;  5EK2 A;  2CEA A;  2DCF A;  2CWY A;  2WM9 A;  3U3I A;  2ODU A;  3CQC B;  3R84 B;  5FNV E;  3DTO A;  3WI3 A;  3AEA A;  5A1L A;  3PU8 A;  2VQF T;  1ZHC A;  2XM2 A;  4PJN A;  3AEF A;  1LVF A;  2B76 A;  2XSA A;  3ZN0 B;  2NW9 A;  2WAU A;  3OTO T;  1JNZ A;  5LA6 E;  1ZV4 X;  4DV7 T;  2NP9 A;  5LHG B;  5LYJ E;  1DU2 A;  1MIW A;  1T98 A;  1W0A A;  2X9W A;  3F57 A;  3KV4 A;  1LKX A;  4JLE A;  4QXH B;  3SS1 A;  5AQV B;  4WBN E;  5FL1 A;  4U72 A;  3J7Y q;  2IDO B;  2W62 A;  2X67 A;  3RIU A;  3AE6 A;  3AA6 B;  4HFE A;  2WZH A;  4O8S A;  4TV8 E;  3AB3 B;  3P4R A;  3RYH E;  3ZMS B;  3LSV A;  4JI4 T;  2WU5 A;  4X5T A;  3OBV E;  5FYM A;  3JCF A;  4YTP A;  2W61 A;  5KX5 E;  2NR4 A;  4H9S E;  4H9O C;  2LKH A;  4X62 T;  3IHR A;  1KNZ A;  2DWG A;  4AIS A;  1US7 B;  2V7K A;  1KK7 A;  4I4T E;  2VKD A;  2C0S A;  4TWF A;  5JDQ A;  3ZC0 A;  3ZMT B;  4Z90 A;  3P7I A;  5KMG P;  2IML A;  1NAF A;  1S35 A;  2VL8 A;  2HH7 A;  3AEB A;  3ZYL A;  5HXS A;  3MXZ A;  5BMV E;  2CMR A;  4HWD A;  1QLB A;  2JJ9 A;  4X1Y E;  5LOV E;  3RIF A;  2YOE A;  2LEH A;  2X0H A;  2JIW A;  1OWA A;  2CXF A;  2H88 A;  1MNE A;  4U3C A;  5LP6 E;  1IZN B;  4ZI3 C; 
#chains in the Genus database with same CATH homology
 4DND A;  4CXW A;  1D0Z A;  4DBR A;  2YK0 A;  2K24 A;  2J1D G;  3HA4 A;  5JR9 A;  3HKB E;  4XAX B;  3C51 A;  4ADZ A;  2KXP B;  1VOM A;  4H9P C;  2D0U A;  3CKD A;  3CX6 B;  3N2O A;  4CI2 B;  3AAE B;  4IDZ A;  3O1J A;  2ZM0 A;  3K3Q C;  2WBL A;  4IIJ E;  4U74 A;  5FY7 A;  2WMO A;  4G63 A;  4M1P A;  3HKC E;  3KVB A;  3V5U A;  5CA0 E;  3QUJ A;  5JQG E;  3JC6 D;  2KIN B;  5JVD E;  3LBX A;  5F3J A;  3FBL A;  1QSD A;  3ZJ2 A;  3PUA A;  3GA8 A;  3P8C D;  2WWU A;  2H7V C;  4HE8 A;  3O9X A;  1MMD A;  1D0X A;  3U78 A;  1WR6 A;  4AKI A;  4L5G A;  4X1K E;  3O1H A;  1D1C A;  5HXC A;  4AQF C;  4ERR A;  4AKG A;  2ODV A;  3K3N A;  4EOZ B;  5HYA A;  2XAQ B;  3LK2 B;  5EZY E;  3SWH A;  2Y6X A;  4HTE A;  2IC9 A;  3N5L A;  3GMI A;  2ZM8 A;  2ZM2 A;  4WBO A;  3WAJ A;  5HWY A;  2V1D B;  3VHL A;  3DP7 A;  3RH3 A;  3H3A A;  4O4I E;  3N9Q A;  4IE7 A;  2N9D A;  2Y8D A;  4KMC A;  2N1G A;  4TZ4 C;  2XHE B;  5JRC A;  3KVA A;  1Z0P A;  5JDM A;  4EZ4 A;  2JPF A;  4KP3 C;  3T8O A;  1S94 A;  1OXZ A;  3UUL A;  4AI6 A;  2I59 A;  3ETU A;  1D1B A;  2DLR A;  4MLK A;  4O4J E;  5J1G A;  3EUH A;  4UF0 B;  4FJO A;  4GYR A;  4PJM A;  3IBP A;  5JDF A;  5FXW A;  4IGU A;  3KFW X;  4GK5 E;  2DNX A;  3ZC1 A;  2XAG B;  2UXX B;  3MAC A;  1ZKE A;  2E9X A;  3HL6 A;  3UFE A;  2ZLY A;  2MYS A;  3LG7 A;  5LBM A;  2X66 A;  5L3D B;  2LJL A;  2JMK A;  4H63 V;  4HFV A;  4PFO A;  4XZC A;  5DQW A;  3VKG A;  4ZI2 D;  3RX6 A;  4QWN B;  3ZEF B;  2BVL A;  3L09 A;  5HXR A;  4GOU A;  3KIN B;  4XBF B;  3H37 A;  1BR4 A;  2C5K T;  4ILU A;  3IF8 B;  3B57 A;  2XTL A;  2Q9Q A;  3ZCJ A;  4YJ3 E;  3BK9 A;  1D1A A;  2CM0 A;  1ZEE A;  3C50 A;  4YFS A;  3AVR A;  2X0L B;  1LRZ A;  2K48 A;  3AA1 B;  4UVC B;  1HF8 A;  2XQY A;  4B6X A;  2LSI A;  3UTK A;  2EHO A;  4OYJ A;  5GON E;  5HAX A;  1FMV A;  4MFR A;  5M4Y A;  2CXL A;  5C8Y E;  2VB6 A;  3DJB A;  2CLY B;  2MOZ A;  3F31 A;  2ES0 A;  4YHJ A;  2VWA A;  2WSS V;  5FP3 A;  4ZI7 E;  3R6N A;  4Z8X A;  5JR9 C;  4WNK A;  3CPZ A;  3LFM A;  2DHR A;  3ZYM A;  5LHI B;  4QX7 B;  4CZZ B;  3PUG A;  3PE0 A;  2PJQ A;  3PU3 A;  2CXD A;  1X79 A;  4PK6 A;  5LJN A;  4KBM B;  1E1H B;  2KWI B;  4DMW A;  5JRE A;  4JUY A;  2LOS A;  4H9Q C;  3TKL B;  3FXD B;  4O4H E;  1MIV A;  3LK4 2;  1IJ6 A;  1MMN A;  2X9H A;  3Q9D A;  3BQL A;  3KV5 A;  5AFU L;  5LBQ B;  3I1A A;  1UX5 A;  3PUQ A;  3CX8 B;  4JEH B;  2NTY A;  2YEV C;  1BR2 A;  5J2U E;  3EVY A;  3ONX A;  2HPJ A;  4MHC A;  4IE4 A;  5LXT E;  3N2G E;  4MAL A;  4EYY R;  2XAS B;  3OJA A;  4IHJ E;  5JRC B;  5DJQ C;  2H7O A;  5DQV A;  3Q2M A;  2B1E A;  4PJL A;  4EAH A;  2Y48 B;  2YU2 A;  1SHZ C;  4E7S A;  2QGS A;  2V26 A;  2KND A;  4O2A E;  2WMN A;  2CE7 A;  2V7J A;  5L3G B;  1FMW A;  1YD8 G;  2W0G A;  3RRW A;  4UV9 B;  3RKO A;  1WYB A;  4KUM B;  4F6R C;  5LJM A;  5LGT B;  5LGN B;  3M65 A;  2NTX A;  4O2B E;  1B7T A;  5DAB A;  5L2L A;  2E8I A;  1WYC A;  3HR0 A;  2M67 A;  3UUN A;  1FEW A;  2L3L A;  2VAS A;  2X68 A;  5FY1 A;  3F2E A;  4UXN B;  3KBU A;  2L8K A;  1U5P A;  3SRZ A;  2XAJ B;  2EHO D;  3GN5 A;  3L3P A;  1G8X A;  2L9Q A;  3Q5X A;  2XAH B;  2BZB A;  1HFA A;  3HKD E;  3KBT A;  2V7L A;  4ZHQ E;  2XAF B;  4DO0 A;  2CCQ A;  2CWO A;  2P9B A;  4WW0 A;  4OK0 A;  5FMN A;  3EDU A;  5J2T E;  1YW0 A;  4MBQ A;  4I55 E;  5FXX A;  2E9X C;  3LJC A;  2W00 A;  1IJ5 A;  1NWM X;  5JDH A;  2CA5 A;  1Y64 B;  4DVD A;  1FIO A;  3BQI A;  3CX7 B;  4P0A A;  5IHY A;  3GN5 B;  3ESL A;  3ETV A;  5H6R B;  5H6Q B;  2LOP A;  3S4U A;  3C4W A;  3PUR A;  3ZMV B;  2ZMA A;  3NRY A;  4JEU B;  3A5X A;  4OYK A;  1VRB A;  2YU1 A;  4ISS A;  3MA9 A;  4UIG A;  3AAA B;  4IE5 A;  2E9X B;  3EDV A;  3Q5W A;  3N9N A;  3N9M A;  4PNI A;  3AVS A;  5JDN A;  3BQK A;  1UCU A;  1O3X A;  4AKR B;  2PFV A;  4X1I E;  4ANJ A;  2KLQ A;  4IST A;  4YLH A;  4CI3 B;  3FXE B;  4ZOL E;  4L0R A;  4K0U A;  3UUM A;  1QUU A;  3UUX B;  2Z6E A;  2YIN A;  1SA0 E;  2K9A A;  3QK6 A;  3ZMU B;  4PK4 A;  2LSJ A;  2DWK A;  4EB6 E;  2IW5 B;  2LM9 A;  5EK4 A;  1WRD A;  4N78 D;  1MMA A;  4HN9 A;  3RRC A;  5LGU B;  4IE0 A;  2CLY C;  4CXX A;  3RC8 A;  3HI2 A;  2NWB A;  3ZMZ B;  2NOX A;  2X9X A;  3GWH A;  3KV9 A;  3UT5 E;  4E7Z A;  4CXY A;  1IAP A;  3N2K E;  3IEE A;  2EHO C;  4O4L E;  1YKE B;  4PAG A;  3ANW B;  4BJN A;  3CQX C;  4HGA A;  4C91 A;  1LVK A;  5TAO A;  4DBQ A;  5HXE A;  1YKH B;  3QC9 A;  3JC6 C;  5LG4 A;  3RYC E;  2QA7 A;  1AJ3 A;  2A3D A;  3J9X 1;  3ZYK A;  3KV6 A;  4OHF A;  2LSY A;  3NBX X;  3OYZ A;  3ZCI A;  4ASK A;  5ADX L;  2W63 A;  4UVB B;  1HS7 A;  2C5J A;  2GK9 A;  4HEA A;  4ZS3 A;  5CA1 E;  4G2A A;  5EK3 A;  3OYX A;  4EXT A;  4IE6 A;  2LSG A;  3C64 A;  3CVR A;  4H63 H;  1EZ3 A;  5JH7 E;  2VKJ A;  3C98 B;  3LK3 B;  4J2C A;  3NZP A;  4A56 A;  5CB4 E;  4I50 E;  3O1I A;  3D0T A;  4QKN A;  4X20 E;  4ZS2 A;  3NRX A;  2VKH A;  3HKE E;  4QXB B;  4EIW A;  3MKD A;  2SPC A;  4BA9 A;  5JR9 B;  1MMG A;  3N9P A;  3RYF E;  2PG8 A;  2D0T A;  1WLX A;  5IYZ E;  5HXH A;  5F8P A;  2LE8 A;  3E22 E;  4AKL A;  4HKA A;  2D2S A;  2VK9 A;  4I43 B;  4UEL A;  1HG5 A;  2MTQ A;  3ZPO A;  1HX8 A;  5FXV A;  2IAK A;  2X9Y A;  2IC6 A;  5LHH B;  2X51 A;  3PTR B;  3E0Z A;  2KMF A;  2JMH A;  1MIY A;  3RPU A;  4UV8 B;  3C4Z A;  3I9W A;  2V7I A;  5JDG A;  3ZN1 B;  5L3B B;  2H3R A;  2KZ7 B;  4V1A v;  3VU7 H;  3OKQ A;  1CUN A;  2JQQ A;  2LHR A;  4TX5 A;  3V5S A;  3N9O A;  5LNK A;  4GIW A;  1MND A;  2K5B B;  3O4X E;  2BVM A;  3PUS A;  4H9N C;  5KDM C;  4BAY B;  3ZLI A;  4TV9 E;  4PJJ A;  1H7C A;  2UXN B;  3AA0 B;  3MJX A;  3W15 B;  4EYU A;  3N9L A;  4H9R C;  2G0U A;  2N2N A;  2NW7 A;  4GYS A;  4P09 A;  2LSK A;  3B13 A;  3FHN A;  5FXZ A;  2LHN A;  5FY0 A;  4UF0 A;  4CI1 B;  4L9I A;  2PBI A;  4ZI3 D;  3AA7 B;  4BJM A;  4FI5 A;  2XUE A;  4AKH A;  3NZQ A;  4PW8 A;  3VKH A;  3PDY A;  5L3C B;  4NUV A;  1UX4 A;  4PFP A;  4EZH A;  1BR1 A;  2RA1 A;  4GK0 E;  1BR0 A;  4AQF A;  5ETW A;  2KT9 A;  4AQG A;  2DI4 A;  3WAK A;  3I0O A;  4C90 A;  4NUU A;  4CQI A;  4PK5 A;  3I0Q A;  5LCY A;  3CWZ B;  4OFZ A;  3MZK B;  4UVA B;  2HPL A;  3RC3 A;  4ZI2 C;  1D0Y A;  2D5U A;  1V9D A;  2OA5 A;  1HTJ F;  4P0B A;  4QX8 B;  4AXP A;  3KDS E;  1U4Q A;  4QXC B;  2NW8 A;  3CQG B;  2E9X D;  3ANW A;  2V7M A;  2KWH A;  3CML A;  5E0O A;  2C5I T;  3K3O A;  2MBG A;  1G73 A;  2Q9Q D;  3FBZ A;  3SOL A;  2RP4 A;  3ZJ1 A;  2Q9Q C;  4UEM A;  2ACX A;  2EHO B;  3I9Y A;  2BDE A;  3FB2 A;  3LBX B;  2JRK A;  4TUY E;  2LT3 A;  3AAI A;  3RYI E;  5JDL A;  4DMV A;  3C4X A;  5L3E B;  5L3F B;  1HCI A;  3E08 A;  3K8P C;  2A72 A;  2VKO A;  5HWX A;  4TN7 B;  2Q9Q B;  4YJ2 E;  1HG2 A;  2A2F X;  3MK7 C;  4QHO A;  5EK2 A;  2CEA A;  2DCF A;  2WM9 A;  2CWY A;  3U3I A;  2ODU A;  3CQC B;  3R84 B;  5FNV E;  3DTO A;  3WI3 A;  5A1L A;  3PU8 A;  1ZHC A;  4PJN A;  3ZN0 B;  1LVF A;  2NW9 A;  2WAU A;  5LA6 E;  1ZV4 X;  2NP9 A;  5LHG B;  5LYJ E;  3F57 A;  1T98 A;  1MIW A;  2X9W A;  3KV4 A;  4JLE A;  1LKX A;  4QXH B;  3SS1 A;  4WBN E;  4U72 A;  3J7Y q;  2W62 A;  2X67 A;  4O8S A;  3AA6 B;  4TV8 E;  3AB3 B;  3RYH E;  3ZMS B;  3OBV E;  5FYM A;  5KX5 E;  2W61 A;  1KNZ A;  4H9S E;  4H9O C;  3IHR A;  2DWG A;  5JDQ A;  1US7 B;  2V7K A;  1KK7 A;  4I4T E;  2VKD A;  2C0S A;  3ZC0 A;  3ZMT B;  3P7I A;  5KMG P;  2VL8 A;  1NAF A;  1S35 A;  3ZYL A;  2HH7 A;  5HXS A;  3MXZ A;  5BMV E;  2CMR A;  2JJ9 A;  4X1Y E;  5LOV E;  2LEH A;  1OWA A;  2CXF A;  1MNE A;  5LP6 E;  1IZN B;  4ZI3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...