2DNXA

Solution structure of rsgi ruh-063, an n-terminal domain of syntaxin 12 from human cdna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
130
structure length
130
Chain Sequence
b'GSSGSSGQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntaxin-12
publication title Solution structure of RSGI RUH-063, an N-terminal domain of Syntaxin 12 from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 46
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dnxA00
5LG4A 1FIOA 1G73A 2XHEB 3C98B 4JEUB 4TX5A 5M4YA 4JEHB 1BR0A 1EZ3A 1FEWA 3LG7A 1S94A 2DNXA 1HS7A
chains in the Genus database with same CATH superfamily
2VVNA 3RX6A 4GYRA 2WB5A 3P4RA 4DV1T 5LG4A 4MBQA 4YXDA 5LGUB 1MMAA 2E5LT 4NUUA 1CHUA 2W62A 1UX5A 3KINB 4FJOA 4YHHT 2E9XB 3C4XA 1HX1B 2X0HA 5HEHA 4DR1T 1UCUA 4B6XA 3TLSA 2LKGA 2FBWA 4YJ2E 3X1DA 3UU5A 3AA0B 1XDOA 2L8KA 3PUVF 1NEKA 1XMOT 3RC8A 2QVAA 4GOUA 1X79A 3ZEFB 3UU3A 2BG9C 4BAYB 5HWYA 4JI2T 2WCAA 2YN6A 1OEDA 2X68A 2DCFA 5LP6E 4H9NC 2WY2A 3IEEA 4JI1T 1IBLT 1UX4A 4PFOA 5ABFA 5AQGB 4TNVA 2DWKA 3RH3A 4ZS3A 4TWFA 2V7IA 4DR4T 4PJMA 2MTQA 3N2KE 4UF0B 2XHEB 4LMLA 4X64T 4EEDA 4EZHA 2ZLYA 3UU6A 2BDEA 3QNUA 5LHHB 4IREA 1NENA 3KFWX 2LM2A 2QYWA 2X67A 3N9OA 2ODUA 5KMGP 4QX7B 4EGWA 2YDRA 4HN9A 2D5UA 2HPLA 3UU8A 3ZYLA 3N9MA 1T98A 1NWMX 5EZYE 3RC3A 3WAJA 2Y8DA 2BKNA 3VKGA 4YJ3E 3AVRA 4CI2B 1HTJF 2IDOB 3J9X1 4ZI2D 2IIUA 4H9PC 2KT9A 1E1HB 4I4TE 2E5VA 2NTXA 3C4WA 4DVDA 3N2OA 2KLQA 3UUBA 2YDSA 4HE8A 5FXVA 3AA1B 2IC6A 2DHRA 4AXPA 3UT5E 3QUJA 5AQMB 4K0KT 3NZPA 4Z91A 3VU7H 4ZHQE 5LA6E 2M6IA 2JPFA 4F8HA 1LVKA 4DNDA 4EB6E 2VURA 2BZBA 4A56A 2UXNB 3FZKB 5AQIB 2CRBA 2R6GF 5HAXA 3PUWF 2DWGA 3N9NA 3MJXA 4AKIA 4ISTA 1H7CA 3KVAA 1WYCA 2LHNA 2AE9A 3AE5A 4JV5T 3HR0A 1OEDC 3L09A 4ZOLE 4QXBB 2DI4A 2PG8A 3LK42 4JUYA 2CMRA 2WSSV 4PFPA 4DMVA 1IJ5A 3JCFA 4X1IE 5C3JA 2X9YA 3BQKA 4QWNB 5LHIB 2XTLA 2ZM2A 3T1HT 5A1LA 1D1CA 3ZJ1A 3OJAA 2VWAA 4XAXB 1KF6A 2V6YA 2FJBA 4JI3T 3OBVE 4YSYA 2CBJA 3ZCIA 2CLYB 2N1GA 3RRCA 4GK0E 3BK9A 2QA7A 2WU2A 1G73A 4N78D 3T1YT 3FZLB 1WFDA 4H9QC 3FXEB 2UXDT 5AQQB 3J7Yq 4KI0F 1YKEB 2K48A 3RIFA 4TZ4C 2X9HA 3AEBA 5FXXA 2Y48B 2BG9E 4U7IA 3V5UA 4KX6A 3SOLA 4BJMA 3I9WA 5HEUA 3TLWA 4IDNA 2XASB 5FP3A 3UUXB 5HXEA 5HEOA 4EYUA 3E08A 4CXYA 5HXSA 4DR7T 4E7SA 1S94A 2MOZA 2OA5A 5FY7A 2X66A 4JI7T 2VKJA 2LJLA 4X5TA 5F3JA 2UUAT 3ZMSB 4LFAT 5JREA 3FZFB 4JI8T 3O1IA 4KP3C 5KX5E 5KDMC 1XNRT 5H6RB 4AKGA 4O4LE 2PTFA 3JC6C 3LG7A 1XZYA 4H9OC 5JH7E 2M67A 2LEHA 4UVAB 2LSKA 2HN2A 5FL0A 4U2ZA 1WYBA 3EI0A 2BVMA 4Q25A 2JQ9A 3OYZA 4AISA 1D0YA 5JR9B 4ERRA 2K5BB 2LLYA 5FL1A 3RIUC 5BMVE 4I50E 2K9AA 4WZXA 1UUSA 2XM1A 2CXLA 5LNKA 4Z8XA 4IHJE 4UELA 4UF0A 3VHLA 1XWMA 1MNEA 2RPAA 1OWAA 2V7KA 4ZI7E 2CA5A 2ZM0A 3GMIA 2W00A 3Q5WA 1KNZA 3KDSE 3MK7C 2WZIA 4Z90A 3BQIA 3FZHB 3RIAA 3JAEA 3QB5A 4L0RA 2XAJB 2FJEA 4QH4A 4AI6A 4LF6T 4G2AA 5L4EA 1Y01A 3B5MA 3P4QA 4COFA 2X0YA 4ZZCA 1FEWA 3DTOA 3VR9A 1OEDE 4X65T 2LRKA 1I6ZA 5LOVE 2BBJA 3I0QA 2V6YB 3AA6B 3CKDA 1WCRA 1HNXT 2UXXB 2XZEA 3NKZA 3ZLIA 2W67A 3AA7B 3W15B 2WBLA 2A2FX 3Q5XA 3F57A 4WW0A 1J5WA 3ABVA 2BKPA 4I43B 4U33A 4P1NA 3SRZA 4ANJA 2E9XC 3QOFA 5C8YE 2WMOA 4CZZB 3AE1A 4YTNA 2C0SA 1S35A 4J2CA 5FXZA 2B1EA 5HCMA 4B3RT 2H7VC 1YXRA 4TN7B 4ASKA 4HWIB 3OKQA 4AKLA 4H63H 3AEDA 3AAEB 5JDLA 3AE6A 5ETWA 2XQ9A 4IE5A 2ZM6T 2XSAA 4NUVA 3HKBE 2CHNA 2K24A 5FKYA 3RGLA 5CA1E 2Q9QD 4XZCA 4IL9A 3ZMZB 3EVYA 2L3LA 3O9XA 2RP4A 3ZT6A 3Q5EA 3RYHE 2QRXA 1N33T 5HYAA 4P0BA 4AQYT 4UR9A 4B3TT 2VKHA 5JTGA 2IHR1 3AXJA 2JMKA 2C5KT 2YK0A 3JAFA 2KNDA 1LRZA 4KBMB 1R8IA 3EUHA 2Q9QB 2JQHA 1SE7A 4YT0A 3ETVA 4TX5A 4EOZB 4UVCB 2KWIB 5JDMA 4GIWA 1N36T 2NW9A 2XQYA 3N9QA 4IE4A 4HEAA 4E7ZA 3Q2MA 5L3EB 2XAGB 1VRBA 2VQFT 2QGSA 3P4WA 3IF8B 4ZS2A 4CN1A 2EHOC 5AQRB 1BR4A 4QXHB 3QB5K 4ILBA 2KINB 3N5LA 2YOEA 3EDUA 4JYAT 1IBKT 4YY3T 1DU2A 5M4YA 1Z0PA 2G0UA 5FNVE 4LF4T 2WWUA 3HI2A 4O8SA 5L47A 4HWHA 3LDQB 2J62A 2I59A 4DBRA 2OV9A 2BBHA 5HWXA 2N2NA 4C90A 3CQXC 1D0XA 4DV6T 4CN6A 3DJBA 3PJAJ 3F31A 5AQKB 2BG9B 2Z6EA 2IW5B 5AQJB 4ZI2C 5L3GB 3LSVA 3LJCA 1HFAA 4DR6T 2JQQA 3ZMUB 4DR2T 1D1AA 2MAWA 4EAHA 3ZC0A 3CWZB 4WBNE 3L3PA 4O2BE 4IDPA 1HCIA 1HG5A 1MMDA 1YQ4A 5DQVA 2LKHA 3MXZA 3FBZA 5AQOB 2JMHA 2OLTA 4H63V 2BS3A 3S4UA 2W63A 4LF5T 2WDVA 2V7LA 1AJ3A 5JR9A 2CWYA 3K8PC 3E22E 3H3AA 4EIWA 5LGNB 3EAMA 1W0AA 3HKEE 1KK7A 2XPKA 3K3NA 3AAAB 3H37A 4HWCA 3P50A 3RKGA 4O4JE 3SFDA 1G8XA 2ACZA 5CA0E 2VB6A 2WDQA 3NWIA 4BA9A 1HX8A 3CX7B 5IUXA 3KV4A 3ONXA 2WQYA 3PUZF 4QKNA 3RI5A 1FIOA 2X9XA 4CN4A 4DV2T 5LJMA 3PUQA 3A5XA 2LE8A 2XJ7A 2WAUA 3ZN1B 3ZJ2A 1BR2A 4IE7A 3RLFF 3FBLA 5LHGB 2LM9A 5FY0A 1HS7A 3AXJB 3NZQA 2D0TA 4CI3B 3O4XE 4DV0T 4P0AA 2RA1A 2D9DA 1M7KA 4LF9T 3BQLA 4HKAA 4O4IE 4IL4A 4JI5T 3GN5A 3TLTA 3IA3A 5L4HA 2LHRA 2ODVA 3ZMVB 3P7IA 2MBGA 1N34T 3O1JA 4GYSA 4HFVA 4ILAA 4H9SE 2BKOA 2IC9A 2L9QA 2DLRA 3PUYF 2A3DA 2FJDA 5L3FB 1WR6A 3SFEA 2HPJA 5JDNA 1WLXA 2XY8B 2N9DA 2XUEA 3VR8A 4F6RC 4NPPA 3N9LA 2J1DG 5LBMA 2VKDA 3OYXA 4IGUA 3R84B 4YFSA 3CK6A 2K3WA 4NXMT 4A5XA 5AQNB 1QUUA 1GQEA 2V26A 1MIYA 4AIUA 1XNQT 4HTEA 4HFDA 1HF8A 1ZOYA 4MLKA 3AE8A 3LFMA 4TWDA 5LXTE 1VCSA 2CEAA 4QHOA 3HKDE 3UQ4A 2D0UA 5JR9C 4X66T 5J0ZA 2WU5A 5JDQA 5ADXL 2KMFA 4ADZA 3N9PA 2W0GA 5FXWA 3VRBA 2W2UA 5F8PA 3NRXA 1ZHCA 4M1PA 4OFZA 3GA8A 4HFEA 3ZKRA 5AQFB 2XQ4A 4U2YA 4DIDB 4IDQA 3CMLA 4QH5A 4YHJA 4DR3T 4EEBA 4HFHA 4JBWF 2PBIA 2Q9QA 5FMNA 1E7PA 3ONLC 4I0UA 2V5DA 3ZPOA 4JEHB 3DP7A 3PU3A 3UUNA 3UUMA 4WYVA 1SUMB 3MKDA 3PUGA 2DNXA 3WI3A 5AQTB 5HXHA 1MNDA 3ESLA 4U72A 2YU2A 2H88A 2XQ5A 2PJQA 4YLHA 2DL1A 4CQIA 2VQET 3PUXF 2JQKA 5FYMA 3EDVA 3F2EA 2CHOA 5HEGA 3C98B 2ZM8A 4QH1A 2J47A 2V5CA 3K1SA 4QXCB 3UULA 3KV5A 5L3CB 3CQCB 4WBOA 4MHCA 4LF7T 1W9RA 4ZZBA 2V7JA 2CXDA 1X9BA 2GK9A 1U4QA 1HNZT 3FB2A 4X1KE 3L8RA 5CFBA 2I6HA 4ZXLA 4IIJE 1NAFA 2LT3A 3RRWA 2BG9A 2YINA 3ANWA 1UK5A 1Z8UA 3M3ZB 1Y64B 5AQUB 4JLEA 2IAKA 5L3BB 1MIVA 3PUAA 5ABEA 1MMNA 3GN5B 3I0OA 4PK5A 3E0ZA 2XAHB 3FXDB 1UGOA 2KXPB 4YTPA 4PNIA 4GKKT 5JDGA 2ACXA 4HFIA 3I9YA 2XQ8A 3PTRB 4WNKA 4ZI3C 3LK2B 3RF1A 4DV3T 3OVUA 1U5PA 2F4VT 1ZKEA 3AE9A 5JDHA 1BR0A 1J5ET 2MPKA 1MMGA 4U7YA 5FVLA 4U3CA 3PDYA 3O1HA 4IDZA 2CCQA 1IJ6A 2VL0A 3N2GE 1UURA 2Q9QC 5GONE 4TUYE 4HGAA 4ILUA 4NIQA 3K3QC 2NTYA 2LSIA 4H9RC 2UUBT 2V7MA 1CUNA 5F5WA 2LSJA 3PE0A 2CPTA 4DV5T 2C5JA 3AEEA 2NW7A 5CGMA 3P4SA 5LG3A 2VASA 2BS4A 3C64A 4O2AE 1IBMT 1B7TA 3AVSA 2YDQA 2H89A 4JI0T 4A98A 4U74A 1J1JA 4X1YE 3WAKA 3PV0F 4AQGA 3TLUA 2KSRA 3UQ7A 1T7SA 2HH7A 2SPCA 2ES0A 3TKLB 3KBUA 2UXCT 5JRCB 4AKRB 4TNWA 5FY1A 5ABHA 4I55E 4PAGA 3AB3B 4L5GA 3LK3B 4DMWA 3RQUA 2UU9T 4CXXA 1SA0E 3HKCE 1QSDA 3ZSTA 3PU8A 1V9DA 3OTOT 3ETUA 1KNRA 4GKJT 1W09A 3C51A 2V6XA 3FZMB 1IZNB 1FMWA 5LYJE 4PW8A 2EHOD 1XMQT 4DUYT 3MACA 4EXTA 4L9IA 3AECA 3RHWA 3Q9DA 4IE0A 3AAIA 4KHZF 5EK3A 2LOSA 3AE4A 1LKXA 4TV8E 3ANWB 4TWHA 4FI5A 5ABGA 4DV4T 3R6NA 2V1DB 3MZKB 3GWHA 4CXWA 4ISSA 2UUCT 2CWOA 3RPUA 5DABA 1SHZC 3CIRA 2CXFA 2EHOB 4A97A 3AEGA 2XQ6A 3SS1A 2NOXA 2WZHA 2LSYA 4IT4A 5IWAT 4JI4T 4IDOA 1E2AA 2NW8A 5EK4A 3NRYA 1VCTA 3ZT7A 3P8CD 5HXCA 1FJGT 5AQSB 4K0UA 3UTKA 4OHFA 3ZT5A 4AQFA 5CB4E 4BJNA 3LBXA 2CLYC 1ZV4X 3VRAA 5AFUL 5LMUT 3K3OA 2P9BA 2NWBA 1T8BA 3H3MA 4B3ST 5LJNA 3ZSSA 3ZYMA 3RYCE 2VKOA 3RQWA 4DV7T 5FVKA 4V1Av 3A8YC 2CBIA 5IHYA 2KWHA 5E0OA 4PJLA 2XAFB 3U78A 4DR5T 4YSZA 3A7MA 1US7B 5BR8T 3U3IA 2VVSA 3T8OA 2ZMAA 4DBQA 4P09A 4U31A 2A72A 4EV6A 4HWFA 2W66A 4JI6T 4EYYR 4QX8B 1EZ3A 3RIUA 4YSXA 4OK0A 4X20E 4O4HE 2XM2A 4LMJA 4UEMA 2MYSA 1M62A 5J2UE 5JVDE 3SWHA 3PUSA 2IMLA 3Q5DA 2CM0A 2HN1A 1L0VA 4KHPT 4LFBT 5DQWA 3ZMTB 1OEDB 1YD8G 4DUZT 2J4GA 3C50A 3CVRA 3CX6B 3QK6A 4UV9B 1ZP0A 2VL8A 1QLBA 4MFRA 2JRKA 5ABFB 2I0MA 3KV9A 3RYFE 1FMVA 5JQGE 2JIWA 2UXBT 1D0ZA 1ZEEA 4UIGA 5H6QB 4B3MT 3B13A 2H3RA 3QC9A 2X9WA 3KBTA 3D0TA 2YKSA 1JNZA 1KFYA 1BR1A 1VOMA 4ILCA 4UV8B 3C4ZA 3I1AA 2C5IT 5IYZE 1N32T 3UFEA 3PURA 2WS3A 4C91A 1IAPA 4AQFC 2JJ9A 3CPZA 4MALA 1KEYA 2VK9A 2WWVA 3MA9A 3IBPA 2E9XA 2D2SA 5CJ5A 2PFVA 5EK2A 5AQVB 4TV9E 4UXNB 5JDFA 2LRLA 4UVBB 1WR0A 3M65A 3RKOA 2NP9A 4LFCT 3PJAA 2IUBA 5JRCA 5KXJA 3AE7A 2XSBA 1WRDA 3RYIE 3B57A 3ZYKA 3JC6D 3ONJA 1KNPA 3EABA 5HEJA 5LCYA 5J2TE 5TAOA 2WMNA 1HR0T 5C2TA 3FHNA 4CI1B 5LB7B 4G63A 5HXRA 1OXZA 5AQLB 5L3DB 1YW0A 2B76A 3NBXX 3LBXB 2H7OA 3EHZA 4YTMA 2BS2A 4HFBA 3NVOA 4DO0A 3VKHA 2YEVC 3AE3A 5LGTB 3JADA 2XQ7A 5AQPB 2HHHT 3IHRA 1YKHB 3AEAA 2Y6XA 2FUPA 4OX9T 4NXNT 2LOPA 2W61A 3ZC1A 3AEFA 2XAQB 2BVLA 3AE2A 4PK4A 2M6BA 2YU1A 3V5SA 4OYJA 5LBQB 3HA4A 4LF8T 2NR4A 3P4PA 1T72A 3ZCJA 1W0BA 5J1GA 4KUMB 2E2AA 2KZ7B 3UU4A 2XQ3A 4AKHA 4PK6A 2WDRA 3UFGA 4HWDA 4PJJA 5HCJA 2W4XA 1I94T 3OPCA 2EHOA 3KVBA 4JEUB 1MIWA 4GK5E 2V8SV 4ZEYA 3G06A 3HL6A 1YQ3A 3TLVA 2A9UA 3ZN0B 2AXDS 3L39A 2FJAA 3KV6A 4LMKA 3CQGB 2LSGA 1O3XA 4OYKA 4EZ4A 2X0LB 4ZI3D 2E8IA 5LMNT 2XQAA 1HG2A 2WP9A 2X51A 1D1BA 4HFCA 2E9XD 4PJNA 4KMCA 4XBFB 2CE7A 1XDPA 5AQHB 3CX8B 5L2LA 5DJQC 4IE6A 2WM9A 1JNRA 4X62T 1LVFA 1HNWT
chains in the Genus database with same CATH topology
4H9SE 3GWHA 4CXWA 2IC9A 4ISSA 2CXLA 2L9QA 5LNKA 4Z8XA 4IHJE 4UELA 4UF0A 2CWOA 3RX6A 2DLRA 4GYRA 3RPUA 3VHLA 1MNEA 5DABA 1OWAA 2A3DA 1SHZC 1WR6A 5L3FB 2HPJA 5LG4A 2V7KA 4ZI7E 4MBQA 5LGUB 2CA5A 1MMAA 2ZM0A 3GMIA 2CXFA 2W00A 2EHOB 3Q5WA 1KNZA 3KDSE 3MK7C 5JDNA 1WLXA 4NUUA 2N9DA 2XUEA 4F6RC 3BQIA 2W62A 3SS1A 1UX5A 3N9LA 3KINB 4FJOA 2E9XB 2J1DG 4L0RA 5LBMA 2XAJB 2VKDA 3C4XA 3OYXA 4IGUA 3R84B 2NOXA 4YFSA 2LSYA 1UCUA 4AI6A 4B6XA 1QUUA 4G2AA 2NW8A 5EK4A 3NRYA 2V26A 1MIYA 4YJ2E 3P8CD 5HXCA 4HTEA 3AA0B 1HF8A 4K0UA 1FEWA 2L8KA 3DTOA 3UTKA 4OHFA 4MLKA 3LFMA 5LOVE 3RC8A 4GOUA 1X79A 3ZEFB 4AQFA 4QHOA 2CEAA 5LXTE 5CB4E 3I0QA 3HKDE 4BJNA 3LBXA 2D0UA 2CLYC 1ZV4X 5HWYA 4BAYB 5AFUL 5JR9C 3AA6B 3K3OA 5JDQA 2P9BA 2DCFA 2X68A 3CKDA 5LP6E 4H9NC 2NWBA 5ADXL 2KMFA 2UXXB 4ADZA 3N9PA 2W0GA 5FXWA 3ZLIA 3IEEA 3AA7B 5LJNA 5F8PA 3ZYMA 3RYCE 3W15B 2WBLA 1UX4A 2A2FX 2VKOA 3NRXA 1ZHCA 4M1PA 3Q5XA 4PFOA 4OFZA 3F57A 3GA8A 4WW0A 2DWKA 4V1Av 4ZS3A 3RH3A 2V7IA 3CMLA 5IHYA 4I43B 2KWHA 4PJMA 2MTQA 5E0OA 4YHJA 3N2KE 4UF0B 4PJLA 2XHEB 2XAFB 3SRZA 3U78A 4ANJA 4EZHA 2E9XC 2ZLYA 2PBIA 2Q9QA 5C8YE 2BDEA 2WMOA 1US7B 5LHHB 5FMNA 4CZZB 2C0SA 3KFWX 1S35A 3U3IA 4J2CA 5FXZA 2B1EA 3T8OA 2X67A 2ZMAA 2H7VC 3ZPOA 4JEHB 4DBQA 3N9OA 4P09A 3DP7A 2A72A 2ODUA 3PU3A 4TN7B 3UUNA 4ASKA 5KMGP 3UUMA 3OKQA 4AKLA 4EYYR 4H63H 4QX7B 4QX8B 4HN9A 1EZ3A 3AAEB 2D5UA 2HPLA 3MKDA 3PUGA 3N9MA 1T98A 3ZYLA 2DNXA 3WI3A 5JDLA 5ETWA 4OK0A 4X20E 5HXHA 1MNDA 1NWMX 3ESLA 2YU2A 4O4HE 4IE5A 4U72A 5EZYE 4UEMA 2MYSA 2PJQA 4YLHA 5J2UE 4CQIA 4NUVA 3RC3A 3HKBE 5JVDE 3SWHA 3WAJA 2Y8DA 2K24A 3PUSA 5FYMA 5CA1E 2Q9QD 3EDVA 4XZCA 3F2EA 2CM0A 3VKGA 4YJ3E 3C98B 3ZMZB 3EVYA 2ZM8A 3AVRA 2L3LA 5DQWA 3O9XA 2RP4A 4CI2B 3ZMTB 1HTJF 1YD8G 3C50A 4QXCB 3CVRA 3UULA 3J9X1 3KV5A 3CX6B 3QK6A 4UV9B 5L3CB 3CQCB 3RYHE 4WBOA 4MHCA 5HYAA 4ZI2D 4H9PC 2VL8A 4P0BA 2KT9A 4MFRA 1E1HB 2V7JA 4I4TE 2JRKA 2NTXA 2CXDA 2VKHA 3C4WA 4DVDA 3KV9A 2GK9A 3RYFE 1FMVA 5JQGE 3N2OA 1U4QA 2KLQA 1D0ZA 2JMKA 2C5KT 2YK0A 3FB2A 1ZEEA 4HE8A 4UIGA 4X1KE 5H6QB 5FXVA 3AA1B 2IC6A 2KNDA 2DHRA 1LRZA 3B13A 4AXPA 3UT5E 2H3RA 4KBMB 3QC9A 2X9WA 3QUJA 3KBTA 3NZPA 3D0TA 1NAFA 4IIJE 3EUHA 2Q9QB 2LT3A 3RRWA 3VU7H 2YINA 3ANWA 4ZHQE 3ETVA 4TX5A 1BR1A 1VOMA 5LA6E 4EOZB 4UVCB 2JPFA 4UV8B 3C4ZA 1Y64B 2KWIB 1LVKA 3I1AA 4DNDA 2C5IT 4GIWA 4EB6E 5JDMA 5IYZE 4JLEA 2BZBA 2IAKA 2NW9A 2XQYA 5L3BB 4A56A 1MIVA 3N9QA 3PUAA 2UXNB 4IE4A 1MMNA 3UFEA 3GN5B 3I0OA 4PK5A 3E0ZA 2XAHB 4HEAA 5HAXA 3PURA 4E7ZA 2DWGA 3N9NA 3FXDB 3Q2MA 4C91A 5L3EB 2KXPB 2XAGB 1IAPA 1VRBA 3MJXA 4ISTA 4PNIA 1H7CA 3KVAA 4AKIA 1WYCA 2ACXA 5JDGA 2LHNA 2QGSA 4AQFC 3I9YA 3IF8B 3PTRB 4WNKA 4ZI3C 2JJ9A 3LK2B 4ZS2A 3CPZA 3HR0A 4MALA 2EHOC 2VK9A 3L09A 1BR4A 4ZOLE 4QXBB 4QXHB 2DI4A 2PG8A 3LK42 1U5PA 2CMRA 2WSSV 3IBPA 3MA9A 4JUYA 2E9XA 4PFPA 1ZKEA 1IJ5A 2KINB 3N5LA 5JDHA 1BR0A 2D2SA 2PFVA 4X1IE 3EDUA 5EK2A 5M4YA 1Z0PA 1MMGA 4TV9E 4UXNB 5JDFA 2X9YA 4UVBB 3BQKA 3M65A 2G0UA 3RKOA 4QWNB 2NP9A 5FNVE 5LHIB 2XTLA 3PDYA 2ZM2A 5JRCA 5A1LA 3O1HA 1D1CA 4IDZA 2CCQA 2WWUA 3HI2A 4O8SA 1IJ6A 1WRDA 3RYIE 2I59A 3N2GE 3B57A 3ZJ1A 4DBRA 3ZYKA 3JC6D 3OJAA 5HWXA 2N2NA 2VWAA 2Q9QC 5LCYA 5J2TE 5TAOA 5GONE 4XAXB 2WMNA 4TUYE 4HGAA 4C90A 4ILUA 3CQXC 1D0XA 3OBVE 3K3QC 3DJBA 2NTYA 2LSIA 4H9RC 3FHNA 4CI1B 2V7MA 3ZCIA 3F31A 1CUNA 4G63A 5HXRA 1OXZA 2LSJA 2CLYB 2Z6EA 3PE0A 2IW5B 5L3DB 1YW0A 2N1GA 3NBXX 4ZI2C 3LBXB 2H7OA 5L3GB 3RRCA 4GK0E 3LJCA 2C5JA 3BK9A 1HFAA 2QA7A 2NW7A 3VKHA 4DO0A 2YEVC 1G73A 4N78D 2JQQA 3ZMUB 5LGTB 2VASA 4H9QC 3FXEB 1D1AA 3J7Yq 4EAHA 3C64A 3IHRA 3CWZB 4WBNE 3L3PA 4O2BE 4O2AE 3ZC0A 1HCIA 1YKHB 1YKEB 2Y6XA 1B7TA 1HG5A 1MMDA 2K48A 5DQVA 4TZ4C 2X9HA 5FXXA 3AVSA 2Y48B 3MXZA 3FBZA 2LOPA 2JMHA 2W61A 3V5UA 4H63V 3SOLA 3ZC1A 4BJMA 2XAQB 2BVLA 4U74A 4X1YE 3S4UA 3I9WA 4PK4A 3WAKA 2W63A 2V7LA 2YU1A 1AJ3A 4AQGA 5JR9A 2CWYA 3K8PC 3V5SA 4OYJA 2XASB 2HH7A 5LBQB 5FP3A 2SPCA 2ES0A 3UUXB 5HXEA 3TKLB 3E22E 3H3AA 3HA4A 3KBUA 5JRCB 4EIWA 4AKRB 3ZCJA 4EYUA 5LGNB 5FY1A 5J1GA 3HKEE 1KK7A 4KUMB 3K3NA 2KZ7B 3E08A 3AAAB 3H37A 4I55E 4PAGA 4O4JE 4CXYA 4AKHA 4PK6A 5HXSA 3AB3B 4L5GA 4PJJA 3LK3B 1G8XA 4DMWA 5CA0E 2VB6A 2EHOA 4BA9A 1HX8A 3CX7B 4E7SA 3KVBA 1S94A 2MOZA 4DMVA 2OA5A 4JEUB 1MIWA 5FY7A 4CXXA 2X66A 3KV4A 4GK5E 3ONXA 2VKJA 4QKNA 2LJLA 5F3JA 1FIOA 2X9XA 3HL6A 1SA0E 3ZN0B 3HKCE 1QSDA 3ZMSB 5LJMA 5JREA 3PUQA 3A5XA 2LE8A 3PU8A 3KV6A 2WAUA 1V9DA 3ZN1B 3O1IA 3ETUA 4KP3C 3ZJ2A 5KX5E 1BR2A 5KDMC 4IE7A 5H6RB 4AKGA 4O4LE 3CQGB 2LSGA 3JC6C 1O3XA 3FBLA 3C51A 3LG7A 4OYKA 5LHGB 4EZ4A 2X0LB 1IZNB 4ZI3D 2LM9A 1FMWA 4H9OC 5FY0A 1HS7A 5LYJE 4PW8A 3NZQA 2EHOD 2D0TA 2E8IA 2M67A 5JH7E 4CI3B 2LEHA 3O4XE 4UVAB 1HG2A 3MACA 2LSKA 4EXTA 2X51A 4L9IA 1D1BA 4P0AA 2RA1A 3Q9DA 2E9XD 4IE0A 4PJNA 3BQLA 4HKAA 3AAIA 1WYBA 2BVMA 4KMCA 5EK3A 4O4IE 4XBFB 3GN5A 2LOSA 2CE7A 3OYZA 1LKXA 2LHRA 1D0YA 2ODVA 4TV8E 5JR9B 3ZMVB 3ANWB 4ERRA 2K5BB 3P7IA 2MBGA 3CX8B 4FI5A 5BMVE 1LVFA 5L2LA 3O1JA 5DJQC 4IE6A 4I50E 3R6NA 2K9AA 2WM9A 4GYSA 4HFVA 2V1DB 3MZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG4 A;  1FIO A;  1G73 A;  2XHE B;  3C98 B;  4JEU B;  4TX5 A;  5M4Y A;  4JEH B;  1BR0 A;  1EZ3 A;  1FEW A;  3LG7 A;  1S94 A;  2DNX A;  1HS7 A; 
#chains in the Genus database with same CATH topology
 2VVN A;  3RX6 A;  4GYR A;  2WB5 A;  3P4R A;  4DV1 T;  5LG4 A;  4MBQ A;  4YXD A;  5LGU B;  1MMA A;  2E5L T;  4NUU A;  1CHU A;  2W62 A;  1UX5 A;  3KIN B;  4FJO A;  4YHH T;  2E9X B;  3C4X A;  1HX1 B;  2X0H A;  5HEH A;  4DR1 T;  1UCU A;  4B6X A;  3TLS A;  2LKG A;  2FBW A;  4YJ2 E;  3X1D A;  3UU5 A;  3AA0 B;  1XDO A;  2L8K A;  3PUV F;  1NEK A;  1XMO T;  3RC8 A;  2QVA A;  4GOU A;  1X79 A;  3ZEF B;  3UU3 A;  2BG9 C;  4BAY B;  5HWY A;  4JI2 T;  2WCA A;  2YN6 A;  1OED A;  2X68 A;  2DCF A;  5LP6 E;  4H9N C;  2WY2 A;  3IEE A;  4JI1 T;  1IBL T;  1UX4 A;  4PFO A;  5ABF A;  5AQG B;  4TNV A;  2DWK A;  3RH3 A;  4ZS3 A;  4TWF A;  2V7I A;  4DR4 T;  4PJM A;  2MTQ A;  3N2K E;  4UF0 B;  2XHE B;  4LML A;  4X64 T;  4EED A;  4EZH A;  2ZLY A;  3UU6 A;  2BDE A;  3QNU A;  5LHH B;  4IRE A;  1NEN A;  3KFW X;  2LM2 A;  2QYW A;  2X67 A;  3N9O A;  2ODU A;  5KMG P;  4QX7 B;  4EGW A;  2YDR A;  4HN9 A;  2D5U A;  2HPL A;  3UU8 A;  3ZYL A;  3N9M A;  1T98 A;  1NWM X;  5EZY E;  3RC3 A;  3WAJ A;  2Y8D A;  2BKN A;  3VKG A;  4YJ3 E;  3AVR A;  4CI2 B;  1HTJ F;  2IDO B;  3J9X 1;  4ZI2 D;  2IIU A;  4H9P C;  2KT9 A;  1E1H B;  4I4T E;  2E5V A;  2NTX A;  3C4W A;  4DVD A;  3N2O A;  2KLQ A;  3UUB A;  2YDS A;  4HE8 A;  5FXV A;  3AA1 B;  2IC6 A;  2DHR A;  4AXP A;  3UT5 E;  3QUJ A;  5AQM B;  4K0K T;  3NZP A;  4Z91 A;  3VU7 H;  4ZHQ E;  5LA6 E;  2M6I A;  2JPF A;  4F8H A;  1LVK A;  4DND A;  4EB6 E;  2VUR A;  2BZB A;  4A56 A;  2UXN B;  3FZK B;  5AQI B;  2CRB A;  2R6G F;  5HAX A;  3PUW F;  2DWG A;  3N9N A;  3MJX A;  4AKI A;  4IST A;  1H7C A;  3KVA A;  1WYC A;  2LHN A;  2AE9 A;  3AE5 A;  4JV5 T;  3HR0 A;  1OED C;  3L09 A;  4ZOL E;  4QXB B;  2DI4 A;  2PG8 A;  3LK4 2;  4JUY A;  2CMR A;  2WSS V;  4PFP A;  4DMV A;  1IJ5 A;  3JCF A;  4X1I E;  5C3J A;  2X9Y A;  3BQK A;  4QWN B;  5LHI B;  2XTL A;  2ZM2 A;  3T1H T;  5A1L A;  1D1C A;  3ZJ1 A;  3OJA A;  2VWA A;  4XAX B;  1KF6 A;  2V6Y A;  2FJB A;  4JI3 T;  3OBV E;  4YSY A;  2CBJ A;  3ZCI A;  2CLY B;  2N1G A;  3RRC A;  4GK0 E;  3BK9 A;  2QA7 A;  2WU2 A;  1G73 A;  4N78 D;  3T1Y T;  3FZL B;  1WFD A;  4H9Q C;  3FXE B;  2UXD T;  5AQQ B;  3J7Y q;  4KI0 F;  1YKE B;  2K48 A;  3RIF A;  4TZ4 C;  2X9H A;  3AEB A;  5FXX A;  2Y48 B;  2BG9 E;  4U7I A;  3V5U A;  4KX6 A;  3SOL A;  4BJM A;  3I9W A;  5HEU A;  3TLW A;  4IDN A;  2XAS B;  5FP3 A;  3UUX B;  5HXE A;  5HEO A;  4EYU A;  3E08 A;  4CXY A;  5HXS A;  4DR7 T;  4E7S A;  1S94 A;  2MOZ A;  2OA5 A;  5FY7 A;  2X66 A;  4JI7 T;  2VKJ A;  2LJL A;  4X5T A;  5F3J A;  2UUA T;  3ZMS B;  4LFA T;  5JRE A;  3FZF B;  4JI8 T;  3O1I A;  4KP3 C;  5KX5 E;  5KDM C;  1XNR T;  5H6R B;  4AKG A;  4O4L E;  2PTF A;  3JC6 C;  3LG7 A;  1XZY A;  4H9O C;  5JH7 E;  2M67 A;  2LEH A;  4UVA B;  2LSK A;  2HN2 A;  5FL0 A;  4U2Z A;  1WYB A;  3EI0 A;  2BVM A;  4Q25 A;  2JQ9 A;  3OYZ A;  4AIS A;  1D0Y A;  5JR9 B;  4ERR A;  2K5B B;  2LLY A;  5FL1 A;  3RIU C;  5BMV E;  4I50 E;  2K9A A;  4WZX A;  1UUS A;  2XM1 A;  2CXL A;  5LNK A;  4Z8X A;  4IHJ E;  4UEL A;  4UF0 A;  3VHL A;  1XWM A;  1MNE A;  2RPA A;  1OWA A;  2V7K A;  4ZI7 E;  2CA5 A;  2ZM0 A;  3GMI A;  2W00 A;  3Q5W A;  1KNZ A;  3KDS E;  3MK7 C;  2WZI A;  4Z90 A;  3BQI A;  3FZH B;  3RIA A;  3JAE A;  3QB5 A;  4L0R A;  2XAJ B;  2FJE A;  4QH4 A;  4AI6 A;  4LF6 T;  4G2A A;  5L4E A;  1Y01 A;  3B5M A;  3P4Q A;  4COF A;  2X0Y A;  4ZZC A;  1FEW A;  3DTO A;  3VR9 A;  1OED E;  4X65 T;  2LRK A;  1I6Z A;  5LOV E;  2BBJ A;  3I0Q A;  2V6Y B;  3AA6 B;  3CKD A;  1WCR A;  1HNX T;  2UXX B;  2XZE A;  3NKZ A;  3ZLI A;  2W67 A;  3AA7 B;  3W15 B;  2WBL A;  2A2F X;  3Q5X A;  3F57 A;  4WW0 A;  1J5W A;  3ABV A;  2BKP A;  4I43 B;  4U33 A;  4P1N A;  3SRZ A;  4ANJ A;  2E9X C;  3QOF A;  5C8Y E;  2WMO A;  4CZZ B;  3AE1 A;  4YTN A;  2C0S A;  1S35 A;  4J2C A;  5FXZ A;  2B1E A;  5HCM A;  4B3R T;  2H7V C;  1YXR A;  4TN7 B;  4ASK A;  4HWI B;  3OKQ A;  4AKL A;  4H63 H;  3AED A;  3AAE B;  5JDL A;  3AE6 A;  5ETW A;  2XQ9 A;  4IE5 A;  2ZM6 T;  2XSA A;  4NUV A;  3HKB E;  2CHN A;  2K24 A;  5FKY A;  3RGL A;  5CA1 E;  2Q9Q D;  4XZC A;  4IL9 A;  3ZMZ B;  3EVY A;  2L3L A;  3O9X A;  2RP4 A;  3ZT6 A;  3Q5E A;  3RYH E;  2QRX A;  1N33 T;  5HYA A;  4P0B A;  4AQY T;  4UR9 A;  4B3T T;  2VKH A;  5JTG A;  2IHR 1;  3AXJ A;  2JMK A;  2C5K T;  2YK0 A;  3JAF A;  2KND A;  1LRZ A;  4KBM B;  1R8I A;  3EUH A;  2Q9Q B;  2JQH A;  1SE7 A;  4YT0 A;  3ETV A;  4TX5 A;  4EOZ B;  4UVC B;  2KWI B;  5JDM A;  4GIW A;  1N36 T;  2NW9 A;  2XQY A;  3N9Q A;  4IE4 A;  4HEA A;  4E7Z A;  3Q2M A;  5L3E B;  2XAG B;  1VRB A;  2VQF T;  2QGS A;  3P4W A;  3IF8 B;  4ZS2 A;  4CN1 A;  2EHO C;  5AQR B;  1BR4 A;  4QXH B;  3QB5 K;  4ILB A;  2KIN B;  3N5L A;  2YOE A;  3EDU A;  4JYA T;  1IBK T;  4YY3 T;  1DU2 A;  5M4Y A;  1Z0P A;  2G0U A;  5FNV E;  4LF4 T;  2WWU A;  3HI2 A;  4O8S A;  5L47 A;  4HWH A;  3LDQ B;  2J62 A;  2I59 A;  4DBR A;  2OV9 A;  2BBH A;  5HWX A;  2N2N A;  4C90 A;  3CQX C;  1D0X A;  4DV6 T;  4CN6 A;  3DJB A;  3PJA J;  3F31 A;  5AQK B;  2BG9 B;  2Z6E A;  2IW5 B;  5AQJ B;  4ZI2 C;  5L3G B;  3LSV A;  3LJC A;  1HFA A;  4DR6 T;  2JQQ A;  3ZMU B;  4DR2 T;  1D1A A;  2MAW A;  4EAH A;  3ZC0 A;  3CWZ B;  4WBN E;  3L3P A;  4O2B E;  4IDP A;  1HCI A;  1HG5 A;  1MMD A;  1YQ4 A;  5DQV A;  2LKH A;  3MXZ A;  3FBZ A;  5AQO B;  2JMH A;  2OLT A;  4H63 V;  2BS3 A;  3S4U A;  2W63 A;  4LF5 T;  2WDV A;  2V7L A;  1AJ3 A;  5JR9 A;  2CWY A;  3K8P C;  3E22 E;  3H3A A;  4EIW A;  5LGN B;  3EAM A;  1W0A A;  3HKE E;  1KK7 A;  2XPK A;  3K3N A;  3AAA B;  3H37 A;  4HWC A;  3P50 A;  3RKG A;  4O4J E;  3SFD A;  1G8X A;  2ACZ A;  5CA0 E;  2VB6 A;  2WDQ A;  3NWI A;  4BA9 A;  1HX8 A;  3CX7 B;  5IUX A;  3KV4 A;  3ONX A;  2WQY A;  3PUZ F;  4QKN A;  3RI5 A;  1FIO A;  2X9X A;  4CN4 A;  4DV2 T;  5LJM A;  3PUQ A;  3A5X A;  2LE8 A;  2XJ7 A;  2WAU A;  3ZN1 B;  3ZJ2 A;  1BR2 A;  4IE7 A;  3RLF F;  3FBL A;  5LHG B;  2LM9 A;  5FY0 A;  1HS7 A;  3AXJ B;  3NZQ A;  2D0T A;  4CI3 B;  3O4X E;  4DV0 T;  4P0A A;  2RA1 A;  2D9D A;  1M7K A;  4LF9 T;  3BQL A;  4HKA A;  4O4I E;  4IL4 A;  4JI5 T;  3GN5 A;  3TLT A;  3IA3 A;  5L4H A;  2LHR A;  2ODV A;  3ZMV B;  3P7I A;  2MBG A;  1N34 T;  3O1J A;  4GYS A;  4HFV A;  4ILA A;  4H9S E;  2BKO A;  2IC9 A;  2L9Q A;  2DLR A;  3PUY F;  2A3D A;  2FJD A;  5L3F B;  1WR6 A;  3SFE A;  2HPJ A;  5JDN A;  1WLX A;  2XY8 B;  2N9D A;  2XUE A;  3VR8 A;  4F6R C;  4NPP A;  3N9L A;  2J1D G;  5LBM A;  2VKD A;  3OYX A;  4IGU A;  3R84 B;  4YFS A;  3CK6 A;  2K3W A;  4NXM T;  4A5X A;  5AQN B;  1QUU A;  1GQE A;  2V26 A;  1MIY A;  4AIU A;  1XNQ T;  4HTE A;  4HFD A;  1HF8 A;  1ZOY A;  4MLK A;  3AE8 A;  3LFM A;  4TWD A;  5LXT E;  1VCS A;  2CEA A;  4QHO A;  3HKD E;  3UQ4 A;  2D0U A;  5JR9 C;  4X66 T;  5J0Z A;  2WU5 A;  5JDQ A;  5ADX L;  2KMF A;  4ADZ A;  3N9P A;  2W0G A;  5FXW A;  3VRB A;  2W2U A;  5F8P A;  3NRX A;  1ZHC A;  4M1P A;  4OFZ A;  3GA8 A;  4HFE A;  3ZKR A;  5AQF B;  2XQ4 A;  4U2Y A;  4DID B;  4IDQ A;  3CML A;  4QH5 A;  4YHJ A;  4DR3 T;  4EEB A;  4HFH A;  4JBW F;  2PBI A;  2Q9Q A;  5FMN A;  1E7P A;  3ONL C;  4I0U A;  2V5D A;  3ZPO A;  4JEH B;  3DP7 A;  3PU3 A;  3UUN A;  3UUM A;  4WYV A;  1SUM B;  3MKD A;  3PUG A;  2DNX A;  3WI3 A;  5AQT B;  5HXH A;  1MND A;  3ESL A;  4U72 A;  2YU2 A;  2H88 A;  2XQ5 A;  2PJQ A;  4YLH A;  2DL1 A;  4CQI A;  2VQE T;  3PUX F;  2JQK A;  5FYM A;  3EDV A;  3F2E A;  2CHO A;  5HEG A;  3C98 B;  2ZM8 A;  4QH1 A;  2J47 A;  2V5C A;  3K1S A;  4QXC B;  3UUL A;  3KV5 A;  5L3C B;  3CQC B;  4WBO A;  4MHC A;  4LF7 T;  1W9R A;  4ZZB A;  2V7J A;  2CXD A;  1X9B A;  2GK9 A;  1U4Q A;  1HNZ T;  3FB2 A;  4X1K E;  3L8R A;  5CFB A;  2I6H A;  4ZXL A;  4IIJ E;  1NAF A;  2LT3 A;  3RRW A;  2BG9 A;  2YIN A;  3ANW A;  1UK5 A;  1Z8U A;  3M3Z B;  1Y64 B;  5AQU B;  4JLE A;  2IAK A;  5L3B B;  1MIV A;  3PUA A;  5ABE A;  1MMN A;  3GN5 B;  3I0O A;  4PK5 A;  3E0Z A;  2XAH B;  3FXD B;  1UGO A;  2KXP B;  4YTP A;  4PNI A;  4GKK T;  5JDG A;  2ACX A;  4HFI A;  3I9Y A;  2XQ8 A;  3PTR B;  4WNK A;  4ZI3 C;  3LK2 B;  3RF1 A;  4DV3 T;  3OVU A;  1U5P A;  2F4V T;  1ZKE A;  3AE9 A;  5JDH A;  1BR0 A;  1J5E T;  2MPK A;  1MMG A;  4U7Y A;  5FVL A;  4U3C A;  3PDY A;  3O1H A;  4IDZ A;  2CCQ A;  1IJ6 A;  2VL0 A;  3N2G E;  1UUR A;  2Q9Q C;  5GON E;  4TUY E;  4HGA A;  4ILU A;  4NIQ A;  3K3Q C;  2NTY A;  2LSI A;  4H9R C;  2UUB T;  2V7M A;  1CUN A;  5F5W A;  2LSJ A;  3PE0 A;  2CPT A;  4DV5 T;  2C5J A;  3AEE A;  2NW7 A;  5CGM A;  3P4S A;  5LG3 A;  2VAS A;  2BS4 A;  3C64 A;  4O2A E;  1IBM T;  1B7T A;  3AVS A;  2YDQ A;  2H89 A;  4JI0 T;  4A98 A;  4U74 A;  1J1J A;  4X1Y E;  3WAK A;  3PV0 F;  4AQG A;  3TLU A;  2KSR A;  3UQ7 A;  1T7S A;  2HH7 A;  2SPC A;  2ES0 A;  3TKL B;  3KBU A;  2UXC T;  5JRC B;  4AKR B;  4TNW A;  5FY1 A;  5ABH A;  4I55 E;  4PAG A;  3AB3 B;  4L5G A;  3LK3 B;  4DMW A;  3RQU A;  2UU9 T;  4CXX A;  1SA0 E;  3HKC E;  1QSD A;  3ZST A;  3PU8 A;  1V9D A;  3OTO T;  3ETU A;  1KNR A;  4GKJ T;  1W09 A;  3C51 A;  2V6X A;  3FZM B;  1IZN B;  1FMW A;  5LYJ E;  4PW8 A;  2EHO D;  1XMQ T;  4DUY T;  3MAC A;  4EXT A;  4L9I A;  3AEC A;  3RHW A;  3Q9D A;  4IE0 A;  3AAI A;  4KHZ F;  5EK3 A;  2LOS A;  3AE4 A;  1LKX A;  4TV8 E;  3ANW B;  4TWH A;  4FI5 A;  5ABG A;  4DV4 T;  3R6N A;  2V1D B;  3MZK B;  3GWH A;  4CXW A;  4ISS A;  2UUC T;  2CWO A;  3RPU A;  5DAB A;  1SHZ C;  3CIR A;  2CXF A;  2EHO B;  4A97 A;  3AEG A;  2XQ6 A;  3SS1 A;  2NOX A;  2WZH A;  2LSY A;  4IT4 A;  5IWA T;  4JI4 T;  4IDO A;  1E2A A;  2NW8 A;  5EK4 A;  3NRY A;  1VCT A;  3ZT7 A;  3P8C D;  5HXC A;  1FJG T;  5AQS B;  4K0U A;  3UTK A;  4OHF A;  3ZT5 A;  4AQF A;  5CB4 E;  4BJN A;  3LBX A;  2CLY C;  1ZV4 X;  3VRA A;  5AFU L;  5LMU T;  3K3O A;  2P9B A;  2NWB A;  1T8B A;  3H3M A;  4B3S T;  5LJN A;  3ZSS A;  3ZYM A;  3RYC E;  2VKO A;  3RQW A;  4DV7 T;  5FVK A;  4V1A v;  3A8Y C;  2CBI A;  5IHY A;  2KWH A;  5E0O A;  4PJL A;  2XAF B;  3U78 A;  4DR5 T;  4YSZ A;  3A7M A;  1US7 B;  5BR8 T;  3U3I A;  2VVS A;  3T8O A;  2ZMA A;  4DBQ A;  4P09 A;  4U31 A;  2A72 A;  4EV6 A;  4HWF A;  2W66 A;  4JI6 T;  4EYY R;  4QX8 B;  1EZ3 A;  3RIU A;  4YSX A;  4OK0 A;  4X20 E;  4O4H E;  2XM2 A;  4LMJ A;  4UEM A;  2MYS A;  1M62 A;  5J2U E;  5JVD E;  3SWH A;  3PUS A;  2IML A;  3Q5D A;  2CM0 A;  2HN1 A;  1L0V A;  4KHP T;  4LFB T;  5DQW A;  3ZMT B;  1OED B;  1YD8 G;  4DUZ T;  2J4G A;  3C50 A;  3CVR A;  3CX6 B;  3QK6 A;  4UV9 B;  1ZP0 A;  2VL8 A;  1QLB A;  4MFR A;  2JRK A;  5ABF B;  2I0M A;  3KV9 A;  3RYF E;  1FMV A;  5JQG E;  2JIW A;  2UXB T;  1D0Z A;  1ZEE A;  4UIG A;  5H6Q B;  4B3M T;  3B13 A;  2H3R A;  3QC9 A;  2X9W A;  3KBT A;  3D0T A;  2YKS A;  1JNZ A;  1KFY A;  1BR1 A;  1VOM A;  4ILC A;  4UV8 B;  3C4Z A;  3I1A A;  2C5I T;  5IYZ E;  1N32 T;  3UFE A;  3PUR A;  2WS3 A;  4C91 A;  1IAP A;  4AQF C;  2JJ9 A;  3CPZ A;  4MAL A;  1KEY A;  2VK9 A;  2WWV A;  3MA9 A;  3IBP A;  2E9X A;  2D2S A;  5CJ5 A;  2PFV A;  5EK2 A;  5AQV B;  4TV9 E;  4UXN B;  5JDF A;  2LRL A;  4UVB B;  1WR0 A;  3M65 A;  3RKO A;  2NP9 A;  4LFC T;  3PJA A;  2IUB A;  5JRC A;  5KXJ A;  3AE7 A;  2XSB A;  1WRD A;  3RYI E;  3B57 A;  3ZYK A;  3JC6 D;  3ONJ A;  1KNP A;  3EAB A;  5HEJ A;  5LCY A;  5J2T E;  5TAO A;  2WMN A;  1HR0 T;  5C2T A;  3FHN A;  4CI1 B;  5LB7 B;  4G63 A;  5HXR A;  1OXZ A;  5AQL B;  5L3D B;  1YW0 A;  2B76 A;  3NBX X;  3LBX B;  2H7O A;  3EHZ A;  4YTM A;  2BS2 A;  4HFB A;  3NVO A;  4DO0 A;  3VKH A;  2YEV C;  3AE3 A;  5LGT B;  3JAD A;  2XQ7 A;  5AQP B;  2HHH T;  3IHR A;  1YKH B;  3AEA A;  2Y6X A;  2FUP A;  4OX9 T;  4NXN T;  2LOP A;  2W61 A;  3ZC1 A;  3AEF A;  2XAQ B;  2BVL A;  3AE2 A;  4PK4 A;  2M6B A;  2YU1 A;  3V5S A;  4OYJ A;  5LBQ B;  3HA4 A;  4LF8 T;  2NR4 A;  3P4P A;  1T72 A;  3ZCJ A;  1W0B A;  5J1G A;  4KUM B;  2E2A A;  2KZ7 B;  3UU4 A;  2XQ3 A;  4AKH A;  4PK6 A;  2WDR A;  3UFG A;  4HWD A;  4PJJ A;  5HCJ A;  2W4X A;  1I94 T;  3OPC A;  2EHO A;  3KVB A;  4JEU B;  1MIW A;  4GK5 E;  2V8S V;  4ZEY A;  3G06 A;  3HL6 A;  1YQ3 A;  3TLV A;  2A9U A;  3ZN0 B;  2AXD S;  3L39 A;  2FJA A;  3KV6 A;  4LMK A;  3CQG B;  2LSG A;  1O3X A;  4OYK A;  4EZ4 A;  2X0L B;  4ZI3 D;  2E8I A;  5LMN T;  2XQA A;  1HG2 A;  2WP9 A;  2X51 A;  1D1B A;  4HFC A;  2E9X D;  4PJN A;  4KMC A;  4XBF B;  2CE7 A;  1XDP A;  5AQH B;  3CX8 B;  5L2L A;  5DJQ C;  4IE6 A;  2WM9 A;  1JNR A;  4X62 T;  1LVF A;  1HNW T; 
#chains in the Genus database with same CATH homology
 4H9S E;  3GWH A;  4CXW A;  2IC9 A;  4ISS A;  2CXL A;  2L9Q A;  5LNK A;  4Z8X A;  4IHJ E;  4UEL A;  4UF0 A;  2CWO A;  3RX6 A;  2DLR A;  4GYR A;  3RPU A;  3VHL A;  1MNE A;  5DAB A;  1OWA A;  2A3D A;  1SHZ C;  1WR6 A;  5L3F B;  2HPJ A;  5LG4 A;  2V7K A;  4ZI7 E;  4MBQ A;  5LGU B;  2CA5 A;  1MMA A;  2ZM0 A;  3GMI A;  2CXF A;  2W00 A;  2EHO B;  3Q5W A;  1KNZ A;  3KDS E;  3MK7 C;  5JDN A;  1WLX A;  4NUU A;  2N9D A;  2XUE A;  4F6R C;  3BQI A;  2W62 A;  3SS1 A;  1UX5 A;  3N9L A;  3KIN B;  4FJO A;  2E9X B;  2J1D G;  4L0R A;  5LBM A;  2XAJ B;  2VKD A;  3C4X A;  3OYX A;  4IGU A;  3R84 B;  2NOX A;  4YFS A;  2LSY A;  1UCU A;  4AI6 A;  4B6X A;  1QUU A;  4G2A A;  2NW8 A;  5EK4 A;  3NRY A;  2V26 A;  1MIY A;  4YJ2 E;  3P8C D;  5HXC A;  4HTE A;  3AA0 B;  1HF8 A;  4K0U A;  1FEW A;  2L8K A;  3DTO A;  3UTK A;  4OHF A;  4MLK A;  3LFM A;  5LOV E;  3RC8 A;  4GOU A;  1X79 A;  3ZEF B;  4AQF A;  4QHO A;  2CEA A;  5LXT E;  5CB4 E;  3I0Q A;  3HKD E;  4BJN A;  3LBX A;  2D0U A;  2CLY C;  1ZV4 X;  5HWY A;  4BAY B;  5AFU L;  5JR9 C;  3AA6 B;  3K3O A;  5JDQ A;  2P9B A;  2DCF A;  2X68 A;  3CKD A;  5LP6 E;  4H9N C;  2NWB A;  5ADX L;  2KMF A;  2UXX B;  4ADZ A;  3N9P A;  2W0G A;  5FXW A;  3ZLI A;  3IEE A;  3AA7 B;  5LJN A;  5F8P A;  3ZYM A;  3RYC E;  3W15 B;  2WBL A;  1UX4 A;  2A2F X;  2VKO A;  3NRX A;  1ZHC A;  4M1P A;  3Q5X A;  4PFO A;  4OFZ A;  3F57 A;  3GA8 A;  4WW0 A;  2DWK A;  4V1A v;  4ZS3 A;  3RH3 A;  2V7I A;  3CML A;  5IHY A;  4I43 B;  2KWH A;  4PJM A;  2MTQ A;  5E0O A;  4YHJ A;  3N2K E;  4UF0 B;  4PJL A;  2XHE B;  2XAF B;  3SRZ A;  3U78 A;  4ANJ A;  4EZH A;  2E9X C;  2ZLY A;  2PBI A;  2Q9Q A;  5C8Y E;  2BDE A;  2WMO A;  1US7 B;  5LHH B;  5FMN A;  4CZZ B;  2C0S A;  3KFW X;  1S35 A;  3U3I A;  4J2C A;  5FXZ A;  2B1E A;  3T8O A;  2X67 A;  2ZMA A;  2H7V C;  3ZPO A;  4JEH B;  4DBQ A;  3N9O A;  4P09 A;  3DP7 A;  2A72 A;  2ODU A;  3PU3 A;  4TN7 B;  3UUN A;  4ASK A;  5KMG P;  3UUM A;  3OKQ A;  4AKL A;  4EYY R;  4H63 H;  4QX7 B;  4QX8 B;  4HN9 A;  1EZ3 A;  3AAE B;  2D5U A;  2HPL A;  3MKD A;  3PUG A;  3N9M A;  1T98 A;  3ZYL A;  2DNX A;  3WI3 A;  5JDL A;  5ETW A;  4OK0 A;  4X20 E;  5HXH A;  1MND A;  1NWM X;  3ESL A;  2YU2 A;  4O4H E;  4IE5 A;  4U72 A;  5EZY E;  4UEM A;  2MYS A;  2PJQ A;  4YLH A;  5J2U E;  4CQI A;  4NUV A;  3RC3 A;  3HKB E;  5JVD E;  3SWH A;  3WAJ A;  2Y8D A;  2K24 A;  3PUS A;  5FYM A;  5CA1 E;  2Q9Q D;  3EDV A;  4XZC A;  3F2E A;  2CM0 A;  3VKG A;  4YJ3 E;  3C98 B;  3ZMZ B;  3EVY A;  2ZM8 A;  3AVR A;  2L3L A;  5DQW A;  3O9X A;  2RP4 A;  4CI2 B;  3ZMT B;  1HTJ F;  1YD8 G;  3C50 A;  4QXC B;  3CVR A;  3UUL A;  3J9X 1;  3KV5 A;  3CX6 B;  3QK6 A;  4UV9 B;  5L3C B;  3CQC B;  3RYH E;  4WBO A;  4MHC A;  5HYA A;  4ZI2 D;  4H9P C;  2VL8 A;  4P0B A;  2KT9 A;  4MFR A;  1E1H B;  2V7J A;  4I4T E;  2JRK A;  2NTX A;  2CXD A;  2VKH A;  3C4W A;  4DVD A;  3KV9 A;  2GK9 A;  3RYF E;  1FMV A;  5JQG E;  3N2O A;  1U4Q A;  2KLQ A;  1D0Z A;  2JMK A;  2C5K T;  2YK0 A;  3FB2 A;  1ZEE A;  4HE8 A;  4UIG A;  4X1K E;  5H6Q B;  5FXV A;  3AA1 B;  2IC6 A;  2KND A;  2DHR A;  1LRZ A;  3B13 A;  4AXP A;  3UT5 E;  2H3R A;  4KBM B;  3QC9 A;  2X9W A;  3QUJ A;  3KBT A;  3NZP A;  3D0T A;  1NAF A;  4IIJ E;  3EUH A;  2Q9Q B;  2LT3 A;  3RRW A;  3VU7 H;  2YIN A;  3ANW A;  4ZHQ E;  3ETV A;  4TX5 A;  1BR1 A;  1VOM A;  5LA6 E;  4EOZ B;  4UVC B;  2JPF A;  4UV8 B;  3C4Z A;  1Y64 B;  2KWI B;  1LVK A;  3I1A A;  4DND A;  2C5I T;  4GIW A;  4EB6 E;  5JDM A;  5IYZ E;  4JLE A;  2BZB A;  2IAK A;  2NW9 A;  2XQY A;  5L3B B;  4A56 A;  1MIV A;  3N9Q A;  3PUA A;  2UXN B;  4IE4 A;  1MMN A;  3UFE A;  3GN5 B;  3I0O A;  4PK5 A;  3E0Z A;  2XAH B;  4HEA A;  5HAX A;  3PUR A;  4E7Z A;  2DWG A;  3N9N A;  3FXD B;  3Q2M A;  4C91 A;  5L3E B;  2KXP B;  2XAG B;  1IAP A;  1VRB A;  3MJX A;  4IST A;  4PNI A;  1H7C A;  3KVA A;  4AKI A;  1WYC A;  2ACX A;  5JDG A;  2LHN A;  2QGS A;  4AQF C;  3I9Y A;  3IF8 B;  3PTR B;  4WNK A;  4ZI3 C;  2JJ9 A;  3LK2 B;  4ZS2 A;  3CPZ A;  3HR0 A;  4MAL A;  2EHO C;  2VK9 A;  3L09 A;  1BR4 A;  4ZOL E;  4QXB B;  4QXH B;  2DI4 A;  2PG8 A;  3LK4 2;  1U5P A;  2CMR A;  2WSS V;  3IBP A;  3MA9 A;  4JUY A;  2E9X A;  4PFP A;  1ZKE A;  1IJ5 A;  2KIN B;  3N5L A;  5JDH A;  1BR0 A;  2D2S A;  2PFV A;  4X1I E;  3EDU A;  5EK2 A;  5M4Y A;  1Z0P A;  1MMG A;  4TV9 E;  4UXN B;  5JDF A;  2X9Y A;  4UVB B;  3BQK A;  3M65 A;  2G0U A;  3RKO A;  4QWN B;  2NP9 A;  5FNV E;  5LHI B;  2XTL A;  3PDY A;  2ZM2 A;  5JRC A;  5A1L A;  3O1H A;  1D1C A;  4IDZ A;  2CCQ A;  2WWU A;  3HI2 A;  4O8S A;  1IJ6 A;  1WRD A;  3RYI E;  2I59 A;  3N2G E;  3B57 A;  3ZJ1 A;  4DBR A;  3ZYK A;  3JC6 D;  3OJA A;  5HWX A;  2N2N A;  2VWA A;  2Q9Q C;  5LCY A;  5J2T E;  5TAO A;  5GON E;  4XAX B;  2WMN A;  4TUY E;  4HGA A;  4C90 A;  4ILU A;  3CQX C;  1D0X A;  3OBV E;  3K3Q C;  3DJB A;  2NTY A;  2LSI A;  4H9R C;  3FHN A;  4CI1 B;  2V7M A;  3ZCI A;  3F31 A;  1CUN A;  4G63 A;  5HXR A;  1OXZ A;  2LSJ A;  2CLY B;  2Z6E A;  3PE0 A;  2IW5 B;  5L3D B;  1YW0 A;  2N1G A;  3NBX X;  4ZI2 C;  3LBX B;  2H7O A;  5L3G B;  3RRC A;  4GK0 E;  3LJC A;  2C5J A;  3BK9 A;  1HFA A;  2QA7 A;  2NW7 A;  3VKH A;  4DO0 A;  2YEV C;  1G73 A;  4N78 D;  2JQQ A;  3ZMU B;  5LGT B;  2VAS A;  4H9Q C;  3FXE B;  1D1A A;  3J7Y q;  4EAH A;  3C64 A;  3IHR A;  3CWZ B;  4WBN E;  3L3P A;  4O2B E;  4O2A E;  3ZC0 A;  1HCI A;  1YKH B;  1YKE B;  2Y6X A;  1B7T A;  1HG5 A;  1MMD A;  2K48 A;  5DQV A;  4TZ4 C;  2X9H A;  5FXX A;  3AVS A;  2Y48 B;  3MXZ A;  3FBZ A;  2LOP A;  2JMH A;  2W61 A;  3V5U A;  4H63 V;  3SOL A;  3ZC1 A;  4BJM A;  2XAQ B;  2BVL A;  4U74 A;  4X1Y E;  3S4U A;  3I9W A;  4PK4 A;  3WAK A;  2W63 A;  2V7L A;  2YU1 A;  1AJ3 A;  4AQG A;  5JR9 A;  2CWY A;  3K8P C;  3V5S A;  4OYJ A;  2XAS B;  2HH7 A;  5LBQ B;  5FP3 A;  2SPC A;  2ES0 A;  3UUX B;  5HXE A;  3TKL B;  3E22 E;  3H3A A;  3HA4 A;  3KBU A;  5JRC B;  4EIW A;  4AKR B;  3ZCJ A;  4EYU A;  5LGN B;  5FY1 A;  5J1G A;  3HKE E;  1KK7 A;  4KUM B;  3K3N A;  2KZ7 B;  3E08 A;  3AAA B;  3H37 A;  4I55 E;  4PAG A;  4O4J E;  4CXY A;  4AKH A;  4PK6 A;  5HXS A;  3AB3 B;  4L5G A;  4PJJ A;  3LK3 B;  1G8X A;  4DMW A;  5CA0 E;  2VB6 A;  2EHO A;  4BA9 A;  1HX8 A;  3CX7 B;  4E7S A;  3KVB A;  1S94 A;  2MOZ A;  4DMV A;  2OA5 A;  4JEU B;  1MIW A;  5FY7 A;  4CXX A;  2X66 A;  3KV4 A;  4GK5 E;  3ONX A;  2VKJ A;  4QKN A;  2LJL A;  5F3J A;  1FIO A;  2X9X A;  3HL6 A;  1SA0 E;  3ZN0 B;  3HKC E;  1QSD A;  3ZMS B;  5LJM A;  5JRE A;  3PUQ A;  3A5X A;  2LE8 A;  3PU8 A;  3KV6 A;  2WAU A;  1V9D A;  3ZN1 B;  3O1I A;  3ETU A;  4KP3 C;  3ZJ2 A;  5KX5 E;  1BR2 A;  5KDM C;  4IE7 A;  5H6R B;  4AKG A;  4O4L E;  3CQG B;  2LSG A;  3JC6 C;  1O3X A;  3FBL A;  3C51 A;  3LG7 A;  4OYK A;  5LHG B;  4EZ4 A;  2X0L B;  1IZN B;  4ZI3 D;  2LM9 A;  1FMW A;  4H9O C;  5FY0 A;  1HS7 A;  5LYJ E;  4PW8 A;  3NZQ A;  2EHO D;  2D0T A;  2E8I A;  2M67 A;  5JH7 E;  4CI3 B;  2LEH A;  3O4X E;  4UVA B;  1HG2 A;  3MAC A;  2LSK A;  4EXT A;  2X51 A;  4L9I A;  1D1B A;  4P0A A;  2RA1 A;  3Q9D A;  2E9X D;  4IE0 A;  4PJN A;  3BQL A;  4HKA A;  3AAI A;  1WYB A;  2BVM A;  4KMC A;  5EK3 A;  4O4I E;  4XBF B;  3GN5 A;  2LOS A;  2CE7 A;  3OYZ A;  1LKX A;  2LHR A;  1D0Y A;  2ODV A;  4TV8 E;  5JR9 B;  3ZMV B;  3ANW B;  4ERR A;  2K5B B;  3P7I A;  2MBG A;  3CX8 B;  4FI5 A;  5BMV E;  1LVF A;  5L2L A;  3O1J A;  5DJQ C;  4IE6 A;  4I50 E;  3R6N A;  2K9A A;  2WM9 A;  4GYS A;  4HFV A;  2V1D B;  3MZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...