2DNXA

Solution structure of rsgi ruh-063, an n-terminal domain of syntaxin 12 from human cdna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
130
structure length
130
Chain Sequence
GSSGSSGQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-063, an N-terminal domain of Syntaxin 12 from human cDNA
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Syntaxin-12
total genus 46
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dnxA00
4JEUB 2XHEB 3LG7A 4JEHB 4TX5A 1S94A 1HS7A 1G73A 1EZ3A 5M4YA 3C98B 5LG4A 1FEWA 1FIOA 2DNXA 1BR0A
chains in the Genus database with same CATH superfamily
3AXJA 1J5ET 1SUMB 3AA0B 5LJMA 2WDVA 3R6NA 2VK9A 4PK6A 2BG9B 2XQ8A 4EEBA 5FL1A 2VASA 4ZI2C 1I94T 5AQMB 4ADZA 4YJ3E 1E1HB 2E5LT 4LFCT 1UCUA 3N2OA 1M62A 3L3PA 3C51A 5FY0A 4EAHA 3RYHE 1SA0E 5HWXA 2LLYA 2MTQA 5JR9B 2N9DA 3NRXA 3AE4A 1YKEB 3LK42 3S4UA 5CA0E 1X9BA 1M7KA 4JI4T 4JV5T 4LMJA 2XAFB 3AE5A 2VURA 3N9MA 2CA5A 2W63A 5FL0A 3AB3B 5HWYA 3TLWA 4FJOA 4JI2T 1UUSA 4TV9E 4JI5T 3QB5K 3ZN1B 2FJBA 1WR0A 4BJMA 4YHJA 4LF6T 3EI0A 2XQYA 2FUPA 2BBJA 2ZLYA 3MACA 5LBQB 5AQVB 4DV1T 3UQ4A 2LSIA 3L09A 4MLKA 2IAKA 2NTXA 2Z6EA 2DI4A 2Q9QB 2XQ9A 4U7IA 2E8IA 4U2YA 3U78A 3K8PC 3ZCJA 5BMVE 4AXPA 4DV3T 1HX8A 3Q2MA 1IZNB 4JUYA 4AI6A 1CUNA 2R6GF 5AQRB 5HXRA 2ZM0A 3UUMA 2CPTA 1YW0A 4DMVA 2V7JA 4YT0A 3P50A 2ODVA 3AA6B 2WAUA 2IDOB 4CZZB 3KBTA 5AQNB 4OX9T 5LMUT 2UXCT 3HR0A 3UU3A 3ZMVB 3IA3A 4OYJA 1O3XA 2HPJA 2WP9A 4QH4A 2BG9A 3EUHA 1N33T 5EK2A 3VR8A 3V5SA 5M4YA 3P4RA 3CQGB 5JRCB 4MALA 2WMOA 4ZI3C 1DU2A 3VKGA 2KWIB 4IT4A 5L3FB 2CBIA 2H3RA 3EDUA 3MZKB 3N2KE 4AKLA 5FY1A 3WAJA 1T98A 3UT5E 3KV4A 2WS3A 3KBUA 3RYIE 4JI1T 4DR3T 3AEBA 2JQKA 2CCQA 2VWAA 3IF8B 4ILAA 4X5TA 4ZI2D 2D0TA 3U3IA 2UXXB 2C5KT 2NR4A 3ZMZB 4AIUA 5L3EB 5LP6E 3SWHA 3N9OA 2WSSV 4WZXA 4XZCA 5AQUB 5LG3A 2WDQA 3KV5A 3ZSTA 4C90A 3RIUA 2JIWA 5JVDE 2ZM6T 4BJNA 1IBKT 4QHOA 3EDVA 5JH7E 2OV9A 2VKDA 3ETUA 2WBLA 2NW9A 4EYYR 5LNKA 2XZEA 1MMAA 2OA5A 2XM2A 4HFEA 2BVLA 2LKHA 3RKOA 3OKQA 1ZP0A 2X66A 2BZBA 2IIUA 1G8XA 2YU1A 3V5UA 4UELA 3K3NA 4LF7T 2ZMAA 1OXZA 3NBXX 4CI2B 3PU3A 3ZT6A 4DUZT 3TLSA 1OEDB 1B7TA 4PJLA 3N9PA 5LYJE 4F6RC 1T72A 5LGUB 3ZPOA 2RA1A 4XAXB 2QA7A 5LG4A 2BDEA 3N9QA 4DV2T 1WYBA 2SPCA 3Q5EA 3RRWA 4EOZB 3ETVA 5JQGE 3FZHB 2Y6XA 4MHCA 3EAMA 2W61A 5FYMA 3ZEFB 4U31A 4QX7B 3AAIA 1SHZC 4ZI7E 2I59A 3AE7A 4G2AA 3O1JA 4BAYB 3P4QA 4UVBB 5DJQC 2LSGA 3CX8B 2UUAT 4A98A 5LJNA 5JTGA 4X1YE 2YDQA 3HA4A 5ABFB 1QUUA 5JDNA 4LF9T 2NWBA 5LGNB 3AVSA 2BKOA 4WW0A 2W00A 1KFYA 2L8KA 4IL4A 4KP3C 4TX5A 3FHNA 4TWHA 2VL8A 4C91A 4IHJE 2CE7A 2Q9QA 4CI1B 2KLQA 2ACXA 1ZHCA 3AXJB 1MMDA 3PDYA 2JQHA 3ABVA 3PV0F 4B3ST 3AE9A 3P4PA 2XY8B 2V7LA 3N9LA 4N78D 3R84B 3ZYLA 3VKHA 3AAEB 3UUXB 3PJAA 1BR1A 3CKDA 2KINB 4H9RC 4HFVA 4IDNA 2PJQA 3OJAA 5L3BB 4TWDA 5CA1E 2X51A 4IREA 4UVCB 3ZYKA 3AEDA 3ESLA 4NPPA 4HE8A 2YU2A 5ABHA 2WU5A 1LRZA 3KV6A 4HFDA 2Q9QC 2W67A 5AQTB 3ZCIA 4XBFB 5J2TE 4HWDA 5FXVA 3OTOT 1OEDA 3RQWA 3C4ZA 4U72A 3RX6A 1N32T 5E0OA 1ZOYA 3WAKA 2KSRA 2LRLA 4V1Av 5FVLA 2MBGA 3SS1A 4CN6A 4GKKT 5LHIB 4B3TT 2BKNA 4KBMB 3RIFA 2LKGA 2VL0A 4IE6A 5L47A 2H7OA 2YK0A 4JBWF 3FXEB 4QX8B 1W0BA 2BVMA 2JQQA 2Q9QD 2ES0A 3FZMB 3NWIA 4H9QC 5AQGB 2UU9T 4K0KT 4QH1A 1N34T 4KHZF 5AQLB 2A9UA 3AE1A 3C98B 3QB5A 2VB6A 4L0RA 3MKDA 2CWOA 3PUYF 3T1YT 3O1IA 3CPZA 1YD8G 2WQYA 3AEAA 3P4SA 1IAPA 2VVSA 3AE8A 4KMCA 3F2EA 4KX6A 4AQFC 2E9XC 4GOUA 4QXBB 1VRBA 1D1CA 4HWHA 4TNVA 4DR2T 1HF8A 3EVYA 2FJEA 2QGSA 4EXTA 2WU2A 2MPKA 4IIJE 1KF6A 4HEAA 2LSYA 4JEHB 2LEHA 5JDHA 4DV0T 3RI5A 3FZFB 3UUNA 3MXZA 2KNDA 4IE5A 4IL9A 2DLRA 1XDPA 4CXYA 3GN5B 1MMNA 3X1DA 4COFA 3Q9DA 4X66T 2BKPA 3OPCA 3O4XE 3JAEA 4PK5A 1KNZA 4A5XA 3BQIA 3FBZA 3LK2B 4LFBT 4HFBA 4UXNB 3AECA 1VCTA 3CK6A 3VRBA 3NVOA 5L3CB 2WM9A 2BS4A 2JQ9A 2X0HA 3CQCB 3HKEE 2K48A 4FI5A 4IDOA 4X62T 1D0XA 4UV8B 2WWUA 3LK3B 2V6YA 4B6XA 2VQFT 4YLHA 4DR4T 4WYVA 1US7B 2IHR1 1LKXA 2V1DB 3VHLA 3A8YC 4KUMB 4U3CA 1Z0PA 3P8CD 4PJNA 3IHRA 3T8OA 3H37A 2WB5A 5HEOA 4ZI3D 4GK5E 5DQWA 4DMWA 3GMIA 2J47A 4UF0B 2F4VT 2BBHA 4NUUA 1IBLT 4GYRA 1ZKEA 2E9XA 5KDMC 5J0ZA 3H3MA 1KNRA 2B76A 3HKBE 5EK4A 3HKCE 4HWIB 4E7SA 1HCIA 4DIDB 3RQUA 5C2TA 2X9WA 1H7CA 1WYCA 2PBIA 2CMRA 2XPKA 3E0ZA 3HKDE 3PUGA 2CLYB 5IYZE 1HNWT 2N2NA 4TZ4C 2XSBA 4IDPA 4YFSA 3E08A 3SFDA 2KWHA 3L39A 3UQ7A 4EZ4A 5FVKA 1HTJF 3QK6A 2Y48B 1MIYA 2D9DA 5HCMA 3WI3A 2W2UA 2L9QA 2CHOA 4Q25A 5LHHB 2LSJA 4A56A 4YXDA 1XNQT 5FY7A 5KXJA 2G0UA 1T7SA 5L4HA 2V8SV 2UXNB 3C50A 4DO0A 2BG9E 2Y8DA 4YHHT 4AKHA 2V5CA 5LCYA 4LMKA 2ODUA 3C4XA 3RC3A 3RIAA 4EZHA 2RP4A 2XQ7A 3LDQB 3GWHA 2C5IT 4EGWA 3I0QA 3UU5A 5FKYA 4X64T 2W62A 1OEDE 2XHEB 4B3MT 3PUXF 3JC6C 3ZYMA 4ERRA 3UU8A 5HEGA 1U5PA 1WRDA 2C0SA 5HYAA 1KNPA 2N1GA 3RLFF 2GK9A 2YINA 5H6QB 4MBQA 4ZXLA 2XUEA 5ADXL 1S94A 3AE6A 5AQKB 5JDGA 4DV4T 2VQET 4X65T 1HX1B 2D2SA 3FB2A 3K3QC 4H9OC 2DWKA 2DL1A 4AKRB 2W4XA 1MIWA 2CWYA 4F8HA 3JAFA 4ZHQE 3CVRA 3HL6A 3N9NA 1IJ6A 3Q5XA 2DNXA 3KVBA 2LM9A 1CHUA 2V6YB 2XAQB 2XQ5A 3AAAB 4DNDA 4WNKA 1W0AA 3PTRB 3AE3A 3IBPA 4U33A 3J9X1 3ANWB 3RF1A 5LMNT 2DWGA 4LFAT 1U4QA 5HEHA 4KI0F 3SOLA 5C8YE 4JI7T 3LBXA 4CN1A 3N5LA 3PUZF 4DR5T 5HEUA 3TKLB 1FMVA 5F5WA 1WLXA 2D5UA 4U7YA 3LJCA 1E2AA 2YKSA 4AISA 4YTNA 4AKIA 4JI0T 2HH7A 2K9AA 4ILCA 5TAOA 2VKHA 1NWMX 1I6ZA 3RYFE 3A7MA 4OHFA 2YN6A 4AKGA 3Q5DA 4HWCA 5LOVE 5JDLA 3ZT5A 5GONE 4JI6T 3BK9A 1UX4A 4LF5T 3ONXA 3QNUA 4PW8A 4H9SE 3NRYA 2KXPB 2I0MA 2H89A 4PJJA 5FXWA 1JNZA 2X9XA 3FZLB 5JR9A 5CB4E 3RPUA 1VCSA 2DHRA 1JNRA 5JDQA 3O9XA 5AQIB 5FNVE 1Y64B 3PE0A 4QWNB 2CXFA 4EEDA 4GK0E 2NW8A 2LJLA 2LT3A 2X0LB 4NXMT 3DJBA 1G73A 4EYUA 4UVAB 3UFGA 3CX7B 1LVKA 2XJ7A 5F3JA 1MNDA 4U74A 4Z91A 3JADA 5JREA 4IGUA 4PFOA 3VR9A 2QYWA 2XTLA 2V6XA 1D0YA 1NEKA 2HN2A 3PUWF 2WMNA 1KEYA 2WDRA 3T1HT 3FBLA 2WZIA 4Z90A 2KMFA 4H9PC 5AQHB 2YDSA 1L0VA 2VKOA 3RRCA 2FBWA 2XM1A 4KHPT 2E5VA 2LRKA 2UUCT 3D0TA 3ZMSB 1W9RA 4TV8E 3OBVE 1AJ3A 2AXDS 3AA1B 3G06A 5AFUL 4EB6E 2AE9A 3GA8A 4JYAT 2WY2A 3VRAA 4DUYT 3CIRA 2E9XD 3NKZA 4X20E 5CJ5A 4O4HE 2XAHB 4GIWA 3AE2A 2JPFA 1HG2A 3JC6D 3KFWX 3OVUA 4J2CA 4QXCB 2L3LA 4QXHB 4ZS2A 3UU6A 4TUYE 2VVNA 4NIQA 2QVAA 5IHYA 5LGTB 5H6RB 2BS2A 3K3OA 3B5MA 4UR9A 2ZM8A 3TLTA 2X9HA 1LVFA 5L2LA 5HXSA 2IMLA 4UF0A 2J4GA 3PU8A 1QSDA 5LXTE 2CXLA 2UXDT 2DCFA 5FXZA 1R8IA 2H7VC 2M6IA 4ZZCA 1UURA 4YSZA 4ZOLE 1ZV4X 5CGMA 1YXRA 5HXEA 3B13A 3UULA 2X9YA 3W15B 1W09A 2IUBA 1BR4A 3C4WA 4IDZA 1NENA 3I0OA 5KMGP 4PAGA 3RIUC 3ZKRA 2WWVA 3EABA 1WFDA 3EHZA 3BQKA 3ONLC 3AEFA 4CXWA 3ZC1A 1MIVA 1EZ3A 2EHOB 4IDQA 4HWFA 4DV6T 1VOMA 4P0AA 4YY3T 2LHNA 4HKAA 2J1DG 2QRXA 4ZS3A 2W66A 4ASKA 1XNRT 3JCFA 3K1SA 2X67A 5C3JA 4ZZBA 4UEMA 4JI8T 1IJ5A 5LHGB 3GN5A 4A97A 3PUSA 3F57A 2PTFA 4H63H 4MFRA 5FXXA 4EV6A 1HFAA 4AQGA 4ZEYA 2LE8A 2PFVA 2V7IA 1BR0A 2MOZA 3C64A 4NUVA 1HG5A 3M65A 3MJXA 4HN9A 2VKJA 1J5WA 2XAJB 2KZ7B 4P1NA 4TWFA 4CI3B 3LSVA 4K0UA 2MAWA 4P09A 3DP7A 2I6HA 1BR2A 2EHOC 4DR6T 1YQ4A 1UK5A 1XWMA 3E22E 4O4IE 4EIWA 4DV5T 5ABFA 5A1LA 4O2AE 4DVDA 4O4LE 4G63A 5LBMA 4AQFA 3CMLA 5FMNA 4I4TE 3MK7C 1QLBA 2HHHT 1X79A 4PJMA 2E2AA 4YSYA 3QC9A 2JMKA 2V7KA 5ABEA 3CWZB 2PG8A 2EHOD 3VU7H 4CQIA 3ZMTB 2EHOA 2W0GA 5EZYE 1UGOA 3ANWA 2LSKA 3M3ZB 3RYCE 3ZJ2A 3NZQA 2ACZA 4P0BA 1HR0T 3ZC0A 2XAGB 2A72A 1Z8UA 3F31A 1MNEA 1OWAA 2OLTA 3P4WA 3UTKA 4OK0A 4E7ZA 2MYSA 5HEJA 1KK7A 2WCAA 4YTPA 3UFEA 3AVRA 1HS7A 2JMHA 5L3DB 3PJAJ 2K5BB 2M67A 3RKGA 3KINB 4CN4A 5JR9C 4H63V 4ISSA 2CBJA 2IC6A 2B1EA 3I9YA 1V9DA 1ZEEA 2FJAA 3DTOA 5JDFA 1D1AA 1GQEA 3LFMA 4O4JE 4OYKA 4UV9B 1YKHB 4GYSA 5AQSB 2C5JA 4I0UA 1S35A 1YQ3A 3FZKB 3ONJA 1N36T 2IC9A 3LG7A 1XDOA 5HXHA 4UIGA 2XQ4A 3FXDB 3PUVF 4U2ZA 3CQXC 3TLVA 4YSXA 1XMOT 2CHNA 5AQPB 2NOXA 2YEVC 2V7MA 5HCJA 4WBNE 4L9IA 2NW7A 2LOSA 2A3DA 3P7IA 1FIOA 5CFBA 2CRBA 4DR1T 4NXNT 4JEUB 3ZMUB 2CEAA 4GKJT 2M6BA 2BS3A 4HFCA 4HTEA 4IE0A 2X0YA 3MA9A 2UXBT 1OEDC 3J7Yq 1SE7A 4O8SA 4DV7T 1XZYA 4HFIA 3QUJA 1D0ZA 3ZT7A 5ABGA 3AA7B 3AEGA 3A5XA 1HNZT 5AQOB 1J1JA 2XQ6A 2BG9C 4DBRA 5AQQB 3I9WA 3L8RA 3NZPA 3RGLA 2CXDA 4HGAA 2JRKA 1MMGA 2CM0A 2P9BA 4YJ2E 4PNIA 3KV9A 3PUAA 2LM2A 5F8PA 2XQ3A 5AQFB 1Y01A 5DABA 1XMQT 1FJGT 2E9XB 4Z8XA 2HPLA 4H9NC 2NP9A 4I55E 5LB7B 3B57A 4OFZA 4PFPA 4IE4A 3RHWA 2A2FX 3SRZA 4B3RT 4QH5A 3N2GE 2KT9A 2J62A 3OYZA 4ILBA 1WR6A 3PUQA 4JLEA 3RH3A 3LBXB 4LF8T 2IW5B 5L4EA 5ETWA 2LOPA 5IWAT 4YTMA 3PURA 4L5GA 4ILUA 2JJ9A 3O1HA 2HN1A 4WBOA 4CXXA 3H3AA 2K3WA 3Q5WA 2FJDA 2WZHA 3UU4A 1IBMT 1D1BA 3OYXA 4TN7B 1FEWA 1T8BA 5IUXA 3I1AA 2XSAA 2K24A 2YOEA 5DQVA 2ZM2A 4ANJA 5BR8T 5JDMA 2X68A 5J2UE 1FMWA 4IE7A 1NAFA 3RC8A 1HNXT 1UX5A 4M1PA 3ZLIA 4BA9A 4QKNA 5L3GB 2NTYA 2UUBT 5HAXA 4LF4T 5AQJB 3UUBA 3QOFA 4I50E 4ISTA 4O2BE 3ZN0B 5LA6E 3IEEA 4DBQA 2XASB 5HXCA 5FP3A 3BQLA 2LHRA 3KDSE 4HFHA 3TLUA 4DR7T 2H88A 4X1IE 5JRCA 4X1KE 5KX5E 2RPAA 1WCRA 3KVAA 4PK4A 4AQYT 3AEEA 5EK3A 2XQAA 3SFEA 3ZSSA 3HI2A 4LMLA 5J1GA 4JI3T 2V5DA 2CLYC 3CX6B 4TNWA 4I43B 2V26A 1E7PA 3ZJ1A 2YDRA 2D0UA
chains in the Genus database with same CATH topology
5LJMA 3AA0B 3R6NA 2VK9A 4PK6A 2VASA 4ZI2C 4ADZA 4YJ3E 1E1HB 1UCUA 3N2OA 3L3PA 3C51A 5FY0A 4EAHA 3RYHE 1SA0E 5HWXA 2MTQA 2N9DA 3NRXA 1YKEB 3LK42 3S4UA 5CA0E 2XAFB 3N9MA 2CA5A 2W63A 3AB3B 5HWYA 4FJOA 4TV9E 3ZN1B 4BJMA 4YHJA 2XQYA 3MACA 2ZLYA 5LBQB 2LSIA 3L09A 4MLKA 2IAKA 2NTXA 2Z6EA 2DI4A 2Q9QB 3U78A 5BMVE 2E8IA 3ZCJA 3K8PC 4AXPA 1HX8A 3Q2MA 1IZNB 4JUYA 4AI6A 1CUNA 5HXRA 3UUMA 2ZM0A 1YW0A 4DMVA 2V7JA 2ODVA 3AA6B 2WAUA 4CZZB 3KBTA 3HR0A 3ZMVB 4OYJA 1O3XA 2HPJA 3EUHA 5EK2A 3V5SA 5M4YA 3VKGA 3CQGB 5JRCB 4MALA 2WMOA 4ZI3C 2KWIB 5L3FB 2H3RA 3MZKB 3EDUA 3N2KE 4AKLA 5FY1A 3WAJA 1T98A 3UT5E 3KV4A 3RYIE 3KBUA 3IF8B 2CCQA 2VWAA 4ZI2D 2D0TA 3U3IA 2UXXB 2C5KT 3ZMZB 5LP6E 5L3EB 3SWHA 3N9OA 2WSSV 4XZCA 3KV5A 4C90A 5JVDE 4BJNA 4QHOA 3EDVA 5JH7E 2VKDA 3ETUA 2WBLA 2NW9A 4EYYR 1MMAA 2OA5A 2BVLA 3RKOA 3OKQA 2X66A 3V5UA 2BZBA 2YU1A 1G8XA 4UELA 3K3NA 2ZMAA 1OXZA 3NBXX 4CI2B 3PU3A 4PJLA 1B7TA 3N9PA 5LYJE 4F6RC 5LGUB 3ZPOA 2RA1A 4XAXB 2QA7A 5LG4A 2BDEA 3N9QA 1WYBA 2SPCA 3RRWA 4EOZB 3ETVA 5JQGE 2Y6XA 4MHCA 2W61A 5FYMA 3ZEFB 4ZI7E 4QX7B 3AAIA 1SHZC 2I59A 4G2AA 3O1JA 4BAYB 4UVBB 5DJQC 2LSGA 3CX8B 5LJNA 4X1YE 3HA4A 1QUUA 5JDNA 2NWBA 5LGNB 3AVSA 4WW0A 2W00A 2L8KA 4KP3C 4TX5A 3FHNA 4C91A 2VL8A 4CI1B 4IHJE 2CE7A 2Q9QA 2ACXA 2KLQA 1ZHCA 3PDYA 1MMDA 3R84B 2V7LA 3N9LA 4N78D 3ZYLA 3VKHA 3AAEB 3UUXB 1BR1A 3CKDA 2KINB 4H9RC 4HFVA 5L3BB 2PJQA 3OJAA 5CA1E 2X51A 4UVCB 3ZYKA 3ESLA 4HE8A 2YU2A 4XBFB 1LRZA 3KV6A 3ZCIA 2Q9QC 5J2TE 5FXVA 3RX6A 3C4ZA 4U72A 5E0OA 3WAKA 4V1Av 2MBGA 3SS1A 5LHIB 4KBMB 4IE6A 2H7OA 2YK0A 3FXEB 4QX8B 2BVMA 2JQQA 2Q9QD 2ES0A 4H9QC 3C98B 2VB6A 4L0RA 3MKDA 2CWOA 3O1IA 3CPZA 1YD8G 4KMCA 5FMNA 1IAPA 4DMWA 3F2EA 4AQFC 4DNDA 2E9XC 4GOUA 4QXBB 1VRBA 1D1CA 1HF8A 3EVYA 2QGSA 4EXTA 4IIJE 4HEAA 2LSYA 4JEHB 2LEHA 5JDHA 3UUNA 3MXZA 2KNDA 4IE5A 4CXYA 2DLRA 3GN5B 1MMNA 3Q9DA 3O4XE 4PK5A 1KNZA 3BQIA 3FBZA 3LK2B 4UXNB 5L3CB 2WM9A 3HKEE 3CQCB 4FI5A 2K48A 1D0XA 4UV8B 2WWUA 3LK3B 4B6XA 4YLHA 1US7B 3VHLA 1LKXA 2V1DB 4KUMB 1Z0PA 3P8CD 4PJNA 3IHRA 3T8OA 3H37A 4ZI3D 4GK5E 5DQWA 3GMIA 4UF0B 4NUUA 4GYRA 1ZKEA 2E9XA 5KDMC 3HKBE 5EK4A 3HKCE 4E7SA 1HCIA 2X9WA 1H7CA 1WYCA 2PBIA 2CMRA 3E0ZA 3HKDE 3PUGA 2CLYB 5IYZE 2N2NA 4TZ4C 4YFSA 3E08A 2KWHA 4EZ4A 1HTJF 3QK6A 2Y48B 1MIYA 3WI3A 2L9QA 5LHHB 2LSJA 4A56A 5FY7A 2G0UA 3C50A 2UXNB 4DO0A 2Y8DA 4AKHA 5LCYA 3RC3A 2ODUA 3C4XA 4EZHA 2RP4A 3GWHA 2C5IT 3I0QA 2W62A 2XHEB 3JC6C 3ZYMA 4ERRA 1U5PA 1WRDA 2C0SA 5HYAA 2N1GA 2GK9A 2YINA 5H6QB 4MBQA 2XUEA 5ADXL 1S94A 5JDGA 2D2SA 3FB2A 3K3QC 4H9OC 2DWKA 4AKRB 1MIWA 2CWYA 4ZHQE 3CVRA 3HL6A 3N9NA 1IJ6A 3Q5XA 2DNXA 3KVBA 2LM9A 2XAQB 3AAAB 4WNKA 3PTRB 3IBPA 3J9X1 3ANWB 2DWGA 1U4QA 3SOLA 5C8YE 3LBXA 3N5LA 3TKLB 1FMVA 1WLXA 2D5UA 3LJCA 4AKIA 2HH7A 2K9AA 5TAOA 2VKHA 1NWMX 3RYFE 4OHFA 4AKGA 5LOVE 5JDLA 5GONE 3BK9A 1UX4A 3ONXA 4PW8A 4H9SE 3NRYA 2KXPB 5FXWA 4PJJA 5JR9A 2X9XA 3RPUA 5CB4E 2DHRA 5JDQA 3O9XA 5FNVE 1Y64B 3PE0A 4QWNB 2CXFA 4GK0E 2NW8A 2LJLA 2LT3A 2X0LB 3DJBA 1G73A 4EYUA 4UVAB 3CX7B 1LVKA 5JREA 5F3JA 1MNDA 4U74A 4IGUA 4PFOA 2XTLA 1D0YA 2WMNA 3FBLA 3RRCA 2KMFA 4H9PC 2VKOA 3D0TA 3ZMSB 4TV8E 3OBVE 1AJ3A 3AA1B 5AFUL 4EB6E 3GA8A 2E9XD 4X20E 4O4HE 2XAHB 4GIWA 2JPFA 1HG2A 3JC6D 3KFWX 4J2CA 4QXCB 4ZS2A 2L3LA 4QXHB 5J1GA 4TUYE 5IHYA 5LGTB 5H6RB 3K3OA 2ZM8A 2X9HA 1LVFA 5L2LA 5HXSA 4UF0A 3PU8A 1QSDA 5LXTE 2CXLA 2DCFA 5FXZA 2H7VC 5LNKA 5HXEA 4ZOLE 1ZV4X 3B13A 3UULA 2X9YA 3W15B 1BR4A 3C4WA 4IDZA 5KMGP 3I0OA 4PAGA 3BQKA 4CXWA 3ZC1A 1MIVA 1EZ3A 2EHOB 4P0AA 1VOMA 2LHNA 4HKAA 2J1DG 4ZS3A 4ASKA 2X67A 4UEMA 1IJ5A 5LHGB 3GN5A 3PUSA 3F57A 4H63H 4MFRA 5FXXA 1HFAA 4AQGA 2LE8A 2PFVA 2V7IA 1BR0A 2MOZA 3C64A 4NUVA 1HG5A 3M65A 3MJXA 4HN9A 2VKJA 2XAJB 2KZ7B 4CI3B 4K0UA 4P09A 3DP7A 1BR2A 2EHOC 3E22E 4EIWA 4O4IE 5A1LA 4O2AE 4DVDA 4O4LE 4G63A 5LBMA 4AQFA 3CMLA 4I4TE 3MK7C 1X79A 4PJMA 3QC9A 2JMKA 2V7KA 3CWZB 2PG8A 2EHOD 3VU7H 4CQIA 3ZMTB 2EHOA 2W0GA 5EZYE 3ANWA 2LSKA 3RYCE 3ZJ2A 3NZQA 3ZC0A 4P0BA 2XAGB 2A72A 3F31A 1MNEA 1OWAA 4E7ZA 5JR9B 3UTKA 4OK0A 2MYSA 1KK7A 3UFEA 3AVRA 1HS7A 2JMHA 5L3DB 2K5BB 2M67A 5JR9C 3KINB 4H63V 4ISSA 2IC6A 2B1EA 3I9YA 1V9DA 1ZEEA 3DTOA 5JDFA 1D1AA 4O4JE 3LFMA 4OYKA 4UV9B 1YKHB 4GYSA 2C5JA 1S35A 2IC9A 3LG7A 5HXHA 4UIGA 3FXDB 3CQXC 2NOXA 2YEVC 2V7MA 4WBNE 4L9IA 2NW7A 2LOSA 2A3DA 3P7IA 1FIOA 4JEUB 3ZMUB 2CEAA 4HTEA 4IE0A 3MA9A 3J7Yq 4O8SA 3QUJA 1D0ZA 3AA7B 3A5XA 4DBRA 3I9WA 3NZPA 2CXDA 4HGAA 2JRKA 1MMGA 2CM0A 2P9BA 4YJ2E 4PNIA 3KV9A 3PUAA 5F8PA 5DABA 2E9XB 4Z8XA 2HPLA 4H9NC 2NP9A 4I55E 3B57A 4OFZA 4PFPA 4IE4A 2A2FX 3SRZA 3N2GE 2KT9A 3OYZA 1WR6A 3PUQA 4JLEA 3RH3A 3LBXB 2IW5B 5ETWA 2LOPA 3PURA 4L5GA 4ILUA 2JJ9A 3O1HA 4WBOA 4CXXA 3H3AA 3Q5WA 1D1BA 3OYXA 4TN7B 1FEWA 3I1AA 2K24A 5DQVA 2ZM2A 4ANJA 5JDMA 2X68A 5J2UE 1FMWA 4IE7A 1NAFA 3RC8A 1UX5A 4M1PA 3ZLIA 4BA9A 4QKNA 5L3GB 2NTYA 5HAXA 4O2BE 4I50E 4ISTA 3ZN0B 4DBQA 5LA6E 3IEEA 2XASB 5HXCA 5FP3A 3BQLA 2LHRA 3KDSE 4X1IE 5JRCA 4X1KE 5KX5E 3KVAA 4PK4A 5EK3A 3HI2A 2CLYC 3CX6B 4I43B 3ZJ1A 2V26A 2D0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEU B;  2XHE B;  3LG7 A;  4JEH B;  4TX5 A;  1S94 A;  1HS7 A;  1G73 A;  1EZ3 A;  5M4Y A;  3C98 B;  5LG4 A;  1FEW A;  1FIO A;  2DNX A;  1BR0 A; 
#chains in the Genus database with same CATH topology
 3AXJ A;  1J5E T;  1SUM B;  3AA0 B;  5LJM A;  2WDV A;  3R6N A;  2VK9 A;  4PK6 A;  2BG9 B;  2XQ8 A;  4EEB A;  5FL1 A;  2VAS A;  4ZI2 C;  1I94 T;  5AQM B;  4ADZ A;  4YJ3 E;  1E1H B;  2E5L T;  4LFC T;  1UCU A;  3N2O A;  1M62 A;  3L3P A;  3C51 A;  5FY0 A;  4EAH A;  3RYH E;  1SA0 E;  5HWX A;  2LLY A;  2MTQ A;  5JR9 B;  2N9D A;  3NRX A;  3AE4 A;  1YKE B;  3LK4 2;  3S4U A;  5CA0 E;  1X9B A;  1M7K A;  4JI4 T;  4JV5 T;  4LMJ A;  2XAF B;  3AE5 A;  2VUR A;  3N9M A;  2CA5 A;  2W63 A;  5FL0 A;  3AB3 B;  5HWY A;  3TLW A;  4FJO A;  4JI2 T;  1UUS A;  4TV9 E;  4JI5 T;  3QB5 K;  3ZN1 B;  2FJB A;  1WR0 A;  4BJM A;  4YHJ A;  4LF6 T;  3EI0 A;  2XQY A;  2FUP A;  2BBJ A;  2ZLY A;  3MAC A;  5LBQ B;  5AQV B;  4DV1 T;  3UQ4 A;  2LSI A;  3L09 A;  4MLK A;  2IAK A;  2NTX A;  2Z6E A;  2DI4 A;  2Q9Q B;  2XQ9 A;  4U7I A;  2E8I A;  4U2Y A;  3U78 A;  3K8P C;  3ZCJ A;  5BMV E;  4AXP A;  4DV3 T;  1HX8 A;  3Q2M A;  1IZN B;  4JUY A;  4AI6 A;  1CUN A;  2R6G F;  5AQR B;  5HXR A;  2ZM0 A;  3UUM A;  2CPT A;  1YW0 A;  4DMV A;  2V7J A;  4YT0 A;  3P50 A;  2ODV A;  3AA6 B;  2WAU A;  2IDO B;  4CZZ B;  3KBT A;  5AQN B;  4OX9 T;  5LMU T;  2UXC T;  3HR0 A;  3UU3 A;  3ZMV B;  3IA3 A;  4OYJ A;  1O3X A;  2HPJ A;  2WP9 A;  4QH4 A;  2BG9 A;  3EUH A;  1N33 T;  5EK2 A;  3VR8 A;  3V5S A;  5M4Y A;  3P4R A;  3CQG B;  5JRC B;  4MAL A;  2WMO A;  4ZI3 C;  1DU2 A;  3VKG A;  2KWI B;  4IT4 A;  5L3F B;  2CBI A;  2H3R A;  3EDU A;  3MZK B;  3N2K E;  4AKL A;  5FY1 A;  3WAJ A;  1T98 A;  3UT5 E;  3KV4 A;  2WS3 A;  3KBU A;  3RYI E;  4JI1 T;  4DR3 T;  3AEB A;  2JQK A;  2CCQ A;  2VWA A;  3IF8 B;  4ILA A;  4X5T A;  4ZI2 D;  2D0T A;  3U3I A;  2UXX B;  2C5K T;  2NR4 A;  3ZMZ B;  4AIU A;  5L3E B;  5LP6 E;  3SWH A;  3N9O A;  2WSS V;  4WZX A;  4XZC A;  5AQU B;  5LG3 A;  2WDQ A;  3KV5 A;  3ZST A;  4C90 A;  3RIU A;  2JIW A;  5JVD E;  2ZM6 T;  4BJN A;  1IBK T;  4QHO A;  3EDV A;  5JH7 E;  2OV9 A;  2VKD A;  3ETU A;  2WBL A;  2NW9 A;  4EYY R;  5LNK A;  2XZE A;  1MMA A;  2OA5 A;  2XM2 A;  4HFE A;  2BVL A;  2LKH A;  3RKO A;  3OKQ A;  1ZP0 A;  2X66 A;  2BZB A;  2IIU A;  1G8X A;  2YU1 A;  3V5U A;  4UEL A;  3K3N A;  4LF7 T;  2ZMA A;  1OXZ A;  3NBX X;  4CI2 B;  3PU3 A;  3ZT6 A;  4DUZ T;  3TLS A;  1OED B;  1B7T A;  4PJL A;  3N9P A;  5LYJ E;  4F6R C;  1T72 A;  5LGU B;  3ZPO A;  2RA1 A;  4XAX B;  2QA7 A;  5LG4 A;  2BDE A;  3N9Q A;  4DV2 T;  1WYB A;  2SPC A;  3Q5E A;  3RRW A;  4EOZ B;  3ETV A;  5JQG E;  3FZH B;  2Y6X A;  4MHC A;  3EAM A;  2W61 A;  5FYM A;  3ZEF B;  4U31 A;  4QX7 B;  3AAI A;  1SHZ C;  4ZI7 E;  2I59 A;  3AE7 A;  4G2A A;  3O1J A;  4BAY B;  3P4Q A;  4UVB B;  5DJQ C;  2LSG A;  3CX8 B;  2UUA T;  4A98 A;  5LJN A;  5JTG A;  4X1Y E;  2YDQ A;  3HA4 A;  5ABF B;  1QUU A;  5JDN A;  4LF9 T;  2NWB A;  5LGN B;  3AVS A;  2BKO A;  4WW0 A;  2W00 A;  1KFY A;  2L8K A;  4IL4 A;  4KP3 C;  4TX5 A;  3FHN A;  4TWH A;  2VL8 A;  4C91 A;  4IHJ E;  2CE7 A;  2Q9Q A;  4CI1 B;  2KLQ A;  2ACX A;  1ZHC A;  3AXJ B;  1MMD A;  3PDY A;  2JQH A;  3ABV A;  3PV0 F;  4B3S T;  3AE9 A;  3P4P A;  2XY8 B;  2V7L A;  3N9L A;  4N78 D;  3R84 B;  3ZYL A;  3VKH A;  3AAE B;  3UUX B;  3PJA A;  1BR1 A;  3CKD A;  2KIN B;  4H9R C;  4HFV A;  4IDN A;  2PJQ A;  3OJA A;  5L3B B;  4TWD A;  5CA1 E;  2X51 A;  4IRE A;  4UVC B;  3ZYK A;  3AED A;  3ESL A;  4NPP A;  4HE8 A;  2YU2 A;  5ABH A;  2WU5 A;  1LRZ A;  3KV6 A;  4HFD A;  2Q9Q C;  2W67 A;  5AQT B;  3ZCI A;  4XBF B;  5J2T E;  4HWD A;  5FXV A;  3OTO T;  1OED A;  3RQW A;  3C4Z A;  4U72 A;  3RX6 A;  1N32 T;  5E0O A;  1ZOY A;  3WAK A;  2KSR A;  2LRL A;  4V1A v;  5FVL A;  2MBG A;  3SS1 A;  4CN6 A;  4GKK T;  5LHI B;  4B3T T;  2BKN A;  4KBM B;  3RIF A;  2LKG A;  2VL0 A;  4IE6 A;  5L47 A;  2H7O A;  2YK0 A;  4JBW F;  3FXE B;  4QX8 B;  1W0B A;  2BVM A;  2JQQ A;  2Q9Q D;  2ES0 A;  3FZM B;  3NWI A;  4H9Q C;  5AQG B;  2UU9 T;  4K0K T;  4QH1 A;  1N34 T;  4KHZ F;  5AQL B;  2A9U A;  3AE1 A;  3C98 B;  3QB5 A;  2VB6 A;  4L0R A;  3MKD A;  2CWO A;  3PUY F;  3T1Y T;  3O1I A;  3CPZ A;  1YD8 G;  2WQY A;  3AEA A;  3P4S A;  1IAP A;  2VVS A;  3AE8 A;  4KMC A;  3F2E A;  4KX6 A;  4AQF C;  2E9X C;  4GOU A;  4QXB B;  1VRB A;  1D1C A;  4HWH A;  4TNV A;  4DR2 T;  1HF8 A;  3EVY A;  2FJE A;  2QGS A;  4EXT A;  2WU2 A;  2MPK A;  4IIJ E;  1KF6 A;  4HEA A;  2LSY A;  4JEH B;  2LEH A;  5JDH A;  4DV0 T;  3RI5 A;  3FZF B;  3UUN A;  3MXZ A;  2KND A;  4IE5 A;  4IL9 A;  2DLR A;  1XDP A;  4CXY A;  3GN5 B;  1MMN A;  3X1D A;  4COF A;  3Q9D A;  4X66 T;  2BKP A;  3OPC A;  3O4X E;  3JAE A;  4PK5 A;  1KNZ A;  4A5X A;  3BQI A;  3FBZ A;  3LK2 B;  4LFB T;  4HFB A;  4UXN B;  3AEC A;  1VCT A;  3CK6 A;  3VRB A;  3NVO A;  5L3C B;  2WM9 A;  2BS4 A;  2JQ9 A;  2X0H A;  3CQC B;  3HKE E;  2K48 A;  4FI5 A;  4IDO A;  4X62 T;  1D0X A;  4UV8 B;  2WWU A;  3LK3 B;  2V6Y A;  4B6X A;  2VQF T;  4YLH A;  4DR4 T;  4WYV A;  1US7 B;  2IHR 1;  1LKX A;  2V1D B;  3VHL A;  3A8Y C;  4KUM B;  4U3C A;  1Z0P A;  3P8C D;  4PJN A;  3IHR A;  3T8O A;  3H37 A;  2WB5 A;  5HEO A;  4ZI3 D;  4GK5 E;  5DQW A;  4DMW A;  3GMI A;  2J47 A;  4UF0 B;  2F4V T;  2BBH A;  4NUU A;  1IBL T;  4GYR A;  1ZKE A;  2E9X A;  5KDM C;  5J0Z A;  3H3M A;  1KNR A;  2B76 A;  3HKB E;  5EK4 A;  3HKC E;  4HWI B;  4E7S A;  1HCI A;  4DID B;  3RQU A;  5C2T A;  2X9W A;  1H7C A;  1WYC A;  2PBI A;  2CMR A;  2XPK A;  3E0Z A;  3HKD E;  3PUG A;  2CLY B;  5IYZ E;  1HNW T;  2N2N A;  4TZ4 C;  2XSB A;  4IDP A;  4YFS A;  3E08 A;  3SFD A;  2KWH A;  3L39 A;  3UQ7 A;  4EZ4 A;  5FVK A;  1HTJ F;  3QK6 A;  2Y48 B;  1MIY A;  2D9D A;  5HCM A;  3WI3 A;  2W2U A;  2L9Q A;  2CHO A;  4Q25 A;  5LHH B;  2LSJ A;  4A56 A;  4YXD A;  1XNQ T;  5FY7 A;  5KXJ A;  2G0U A;  1T7S A;  5L4H A;  2V8S V;  2UXN B;  3C50 A;  4DO0 A;  2BG9 E;  2Y8D A;  4YHH T;  4AKH A;  2V5C A;  5LCY A;  4LMK A;  2ODU A;  3C4X A;  3RC3 A;  3RIA A;  4EZH A;  2RP4 A;  2XQ7 A;  3LDQ B;  3GWH A;  2C5I T;  4EGW A;  3I0Q A;  3UU5 A;  5FKY A;  4X64 T;  2W62 A;  1OED E;  2XHE B;  4B3M T;  3PUX F;  3JC6 C;  3ZYM A;  4ERR A;  3UU8 A;  5HEG A;  1U5P A;  1WRD A;  2C0S A;  5HYA A;  1KNP A;  2N1G A;  3RLF F;  2GK9 A;  2YIN A;  5H6Q B;  4MBQ A;  4ZXL A;  2XUE A;  5ADX L;  1S94 A;  3AE6 A;  5AQK B;  5JDG A;  4DV4 T;  2VQE T;  4X65 T;  1HX1 B;  2D2S A;  3FB2 A;  3K3Q C;  4H9O C;  2DWK A;  2DL1 A;  4AKR B;  2W4X A;  1MIW A;  2CWY A;  4F8H A;  3JAF A;  4ZHQ E;  3CVR A;  3HL6 A;  3N9N A;  1IJ6 A;  3Q5X A;  2DNX A;  3KVB A;  2LM9 A;  1CHU A;  2V6Y B;  2XAQ B;  2XQ5 A;  3AAA B;  4DND A;  4WNK A;  1W0A A;  3PTR B;  3AE3 A;  3IBP A;  4U33 A;  3J9X 1;  3ANW B;  3RF1 A;  5LMN T;  2DWG A;  4LFA T;  1U4Q A;  5HEH A;  4KI0 F;  3SOL A;  5C8Y E;  4JI7 T;  3LBX A;  4CN1 A;  3N5L A;  3PUZ F;  4DR5 T;  5HEU A;  3TKL B;  1FMV A;  5F5W A;  1WLX A;  2D5U A;  4U7Y A;  3LJC A;  1E2A A;  2YKS A;  4AIS A;  4YTN A;  4AKI A;  4JI0 T;  2HH7 A;  2K9A A;  4ILC A;  5TAO A;  2VKH A;  1NWM X;  1I6Z A;  3RYF E;  3A7M A;  4OHF A;  2YN6 A;  4AKG A;  3Q5D A;  4HWC A;  5LOV E;  5JDL A;  3ZT5 A;  5GON E;  4JI6 T;  3BK9 A;  1UX4 A;  4LF5 T;  3ONX A;  3QNU A;  4PW8 A;  4H9S E;  3NRY A;  2KXP B;  2I0M A;  2H89 A;  4PJJ A;  5FXW A;  1JNZ A;  2X9X A;  3FZL B;  5JR9 A;  5CB4 E;  3RPU A;  1VCS A;  2DHR A;  1JNR A;  5JDQ A;  3O9X A;  5AQI B;  5FNV E;  1Y64 B;  3PE0 A;  4QWN B;  2CXF A;  4EED A;  4GK0 E;  2NW8 A;  2LJL A;  2LT3 A;  2X0L B;  4NXM T;  3DJB A;  1G73 A;  4EYU A;  4UVA B;  3UFG A;  3CX7 B;  1LVK A;  2XJ7 A;  5F3J A;  1MND A;  4U74 A;  4Z91 A;  3JAD A;  5JRE A;  4IGU A;  4PFO A;  3VR9 A;  2QYW A;  2XTL A;  2V6X A;  1D0Y A;  1NEK A;  2HN2 A;  3PUW F;  2WMN A;  1KEY A;  2WDR A;  3T1H T;  3FBL A;  2WZI A;  4Z90 A;  2KMF A;  4H9P C;  5AQH B;  2YDS A;  1L0V A;  2VKO A;  3RRC A;  2FBW A;  2XM1 A;  4KHP T;  2E5V A;  2LRK A;  2UUC T;  3D0T A;  3ZMS B;  1W9R A;  4TV8 E;  3OBV E;  1AJ3 A;  2AXD S;  3AA1 B;  3G06 A;  5AFU L;  4EB6 E;  2AE9 A;  3GA8 A;  4JYA T;  2WY2 A;  3VRA A;  4DUY T;  3CIR A;  2E9X D;  3NKZ A;  4X20 E;  5CJ5 A;  4O4H E;  2XAH B;  4GIW A;  3AE2 A;  2JPF A;  1HG2 A;  3JC6 D;  3KFW X;  3OVU A;  4J2C A;  4QXC B;  2L3L A;  4QXH B;  4ZS2 A;  3UU6 A;  4TUY E;  2VVN A;  4NIQ A;  2QVA A;  5IHY A;  5LGT B;  5H6R B;  2BS2 A;  3K3O A;  3B5M A;  4UR9 A;  2ZM8 A;  3TLT A;  2X9H A;  1LVF A;  5L2L A;  5HXS A;  2IML A;  4UF0 A;  2J4G A;  3PU8 A;  1QSD A;  5LXT E;  2CXL A;  2UXD T;  2DCF A;  5FXZ A;  1R8I A;  2H7V C;  2M6I A;  4ZZC A;  1UUR A;  4YSZ A;  4ZOL E;  1ZV4 X;  5CGM A;  1YXR A;  5HXE A;  3B13 A;  3UUL A;  2X9Y A;  3W15 B;  1W09 A;  2IUB A;  1BR4 A;  3C4W A;  4IDZ A;  1NEN A;  3I0O A;  5KMG P;  4PAG A;  3RIU C;  3ZKR A;  2WWV A;  3EAB A;  1WFD A;  3EHZ A;  3BQK A;  3ONL C;  3AEF A;  4CXW A;  3ZC1 A;  1MIV A;  1EZ3 A;  2EHO B;  4IDQ A;  4HWF A;  4DV6 T;  1VOM A;  4P0A A;  4YY3 T;  2LHN A;  4HKA A;  2J1D G;  2QRX A;  4ZS3 A;  2W66 A;  4ASK A;  1XNR T;  3JCF A;  3K1S A;  2X67 A;  5C3J A;  4ZZB A;  4UEM A;  4JI8 T;  1IJ5 A;  5LHG B;  3GN5 A;  4A97 A;  3PUS A;  3F57 A;  2PTF A;  4H63 H;  4MFR A;  5FXX A;  4EV6 A;  1HFA A;  4AQG A;  4ZEY A;  2LE8 A;  2PFV A;  2V7I A;  1BR0 A;  2MOZ A;  3C64 A;  4NUV A;  1HG5 A;  3M65 A;  3MJX A;  4HN9 A;  2VKJ A;  1J5W A;  2XAJ B;  2KZ7 B;  4P1N A;  4TWF A;  4CI3 B;  3LSV A;  4K0U A;  2MAW A;  4P09 A;  3DP7 A;  2I6H A;  1BR2 A;  2EHO C;  4DR6 T;  1YQ4 A;  1UK5 A;  1XWM A;  3E22 E;  4O4I E;  4EIW A;  4DV5 T;  5ABF A;  5A1L A;  4O2A E;  4DVD A;  4O4L E;  4G63 A;  5LBM A;  4AQF A;  3CML A;  5FMN A;  4I4T E;  3MK7 C;  1QLB A;  2HHH T;  1X79 A;  4PJM A;  2E2A A;  4YSY A;  3QC9 A;  2JMK A;  2V7K A;  5ABE A;  3CWZ B;  2PG8 A;  2EHO D;  3VU7 H;  4CQI A;  3ZMT B;  2EHO A;  2W0G A;  5EZY E;  1UGO A;  3ANW A;  2LSK A;  3M3Z B;  3RYC E;  3ZJ2 A;  3NZQ A;  2ACZ A;  4P0B A;  1HR0 T;  3ZC0 A;  2XAG B;  2A72 A;  1Z8U A;  3F31 A;  1MNE A;  1OWA A;  2OLT A;  3P4W A;  3UTK A;  4OK0 A;  4E7Z A;  2MYS A;  5HEJ A;  1KK7 A;  2WCA A;  4YTP A;  3UFE A;  3AVR A;  1HS7 A;  2JMH A;  5L3D B;  3PJA J;  2K5B B;  2M67 A;  3RKG A;  3KIN B;  4CN4 A;  5JR9 C;  4H63 V;  4ISS A;  2CBJ A;  2IC6 A;  2B1E A;  3I9Y A;  1V9D A;  1ZEE A;  2FJA A;  3DTO A;  5JDF A;  1D1A A;  1GQE A;  3LFM A;  4O4J E;  4OYK A;  4UV9 B;  1YKH B;  4GYS A;  5AQS B;  2C5J A;  4I0U A;  1S35 A;  1YQ3 A;  3FZK B;  3ONJ A;  1N36 T;  2IC9 A;  3LG7 A;  1XDO A;  5HXH A;  4UIG A;  2XQ4 A;  3FXD B;  3PUV F;  4U2Z A;  3CQX C;  3TLV A;  4YSX A;  1XMO T;  2CHN A;  5AQP B;  2NOX A;  2YEV C;  2V7M A;  5HCJ A;  4WBN E;  4L9I A;  2NW7 A;  2LOS A;  2A3D A;  3P7I A;  1FIO A;  5CFB A;  2CRB A;  4DR1 T;  4NXN T;  4JEU B;  3ZMU B;  2CEA A;  4GKJ T;  2M6B A;  2BS3 A;  4HFC A;  4HTE A;  4IE0 A;  2X0Y A;  3MA9 A;  2UXB T;  1OED C;  3J7Y q;  1SE7 A;  4O8S A;  4DV7 T;  1XZY A;  4HFI A;  3QUJ A;  1D0Z A;  3ZT7 A;  5ABG A;  3AA7 B;  3AEG A;  3A5X A;  1HNZ T;  5AQO B;  1J1J A;  2XQ6 A;  2BG9 C;  4DBR A;  5AQQ B;  3I9W A;  3L8R A;  3NZP A;  3RGL A;  2CXD A;  4HGA A;  2JRK A;  1MMG A;  2CM0 A;  2P9B A;  4YJ2 E;  4PNI A;  3KV9 A;  3PUA A;  2LM2 A;  5F8P A;  2XQ3 A;  5AQF B;  1Y01 A;  5DAB A;  1XMQ T;  1FJG T;  2E9X B;  4Z8X A;  2HPL A;  4H9N C;  2NP9 A;  4I55 E;  5LB7 B;  3B57 A;  4OFZ A;  4PFP A;  4IE4 A;  3RHW A;  2A2F X;  3SRZ A;  4B3R T;  4QH5 A;  3N2G E;  2KT9 A;  2J62 A;  3OYZ A;  4ILB A;  1WR6 A;  3PUQ A;  4JLE A;  3RH3 A;  3LBX B;  4LF8 T;  2IW5 B;  5L4E A;  5ETW A;  2LOP A;  5IWA T;  4YTM A;  3PUR A;  4L5G A;  4ILU A;  2JJ9 A;  3O1H A;  2HN1 A;  4WBO A;  4CXX A;  3H3A A;  2K3W A;  3Q5W A;  2FJD A;  2WZH A;  3UU4 A;  1IBM T;  1D1B A;  3OYX A;  4TN7 B;  1FEW A;  1T8B A;  5IUX A;  3I1A A;  2XSA A;  2K24 A;  2YOE A;  5DQV A;  2ZM2 A;  4ANJ A;  5BR8 T;  5JDM A;  2X68 A;  5J2U E;  1FMW A;  4IE7 A;  1NAF A;  3RC8 A;  1HNX T;  1UX5 A;  4M1P A;  3ZLI A;  4BA9 A;  4QKN A;  5L3G B;  2NTY A;  2UUB T;  5HAX A;  4LF4 T;  5AQJ B;  3UUB A;  3QOF A;  4I50 E;  4IST A;  4O2B E;  3ZN0 B;  5LA6 E;  3IEE A;  4DBQ A;  2XAS B;  5HXC A;  5FP3 A;  3BQL A;  2LHR A;  3KDS E;  4HFH A;  3TLU A;  4DR7 T;  2H88 A;  4X1I E;  5JRC A;  4X1K E;  5KX5 E;  2RPA A;  1WCR A;  3KVA A;  4PK4 A;  4AQY T;  3AEE A;  5EK3 A;  2XQA A;  3SFE A;  3ZSS A;  3HI2 A;  4LML A;  5J1G A;  4JI3 T;  2V5D A;  2CLY C;  3CX6 B;  4TNW A;  4I43 B;  2V26 A;  1E7P A;  3ZJ1 A;  2YDR A;  2D0U A; 
#chains in the Genus database with same CATH homology
 5LJM A;  3AA0 B;  3R6N A;  2VK9 A;  4PK6 A;  2VAS A;  4ZI2 C;  4ADZ A;  4YJ3 E;  1E1H B;  1UCU A;  3N2O A;  3L3P A;  3C51 A;  5FY0 A;  4EAH A;  3RYH E;  1SA0 E;  5HWX A;  2MTQ A;  2N9D A;  3NRX A;  1YKE B;  3LK4 2;  3S4U A;  5CA0 E;  2XAF B;  3N9M A;  2CA5 A;  2W63 A;  3AB3 B;  5HWY A;  4FJO A;  4TV9 E;  3ZN1 B;  4BJM A;  4YHJ A;  2XQY A;  3MAC A;  2ZLY A;  5LBQ B;  2LSI A;  3L09 A;  4MLK A;  2IAK A;  2NTX A;  2Z6E A;  2DI4 A;  2Q9Q B;  3U78 A;  5BMV E;  2E8I A;  3ZCJ A;  3K8P C;  4AXP A;  1HX8 A;  3Q2M A;  1IZN B;  4JUY A;  4AI6 A;  1CUN A;  5HXR A;  3UUM A;  2ZM0 A;  1YW0 A;  4DMV A;  2V7J A;  2ODV A;  3AA6 B;  2WAU A;  4CZZ B;  3KBT A;  3HR0 A;  3ZMV B;  4OYJ A;  1O3X A;  2HPJ A;  3EUH A;  5EK2 A;  3V5S A;  5M4Y A;  3VKG A;  3CQG B;  5JRC B;  4MAL A;  2WMO A;  4ZI3 C;  2KWI B;  5L3F B;  2H3R A;  3MZK B;  3EDU A;  3N2K E;  4AKL A;  5FY1 A;  3WAJ A;  1T98 A;  3UT5 E;  3KV4 A;  3RYI E;  3KBU A;  3IF8 B;  2CCQ A;  2VWA A;  4ZI2 D;  2D0T A;  3U3I A;  2UXX B;  2C5K T;  3ZMZ B;  5LP6 E;  5L3E B;  3SWH A;  3N9O A;  2WSS V;  4XZC A;  3KV5 A;  4C90 A;  5JVD E;  4BJN A;  4QHO A;  3EDV A;  5JH7 E;  2VKD A;  3ETU A;  2WBL A;  2NW9 A;  4EYY R;  1MMA A;  2OA5 A;  2BVL A;  3RKO A;  3OKQ A;  2X66 A;  3V5U A;  2BZB A;  2YU1 A;  1G8X A;  4UEL A;  3K3N A;  2ZMA A;  1OXZ A;  3NBX X;  4CI2 B;  3PU3 A;  4PJL A;  1B7T A;  3N9P A;  5LYJ E;  4F6R C;  5LGU B;  3ZPO A;  2RA1 A;  4XAX B;  2QA7 A;  5LG4 A;  2BDE A;  3N9Q A;  1WYB A;  2SPC A;  3RRW A;  4EOZ B;  3ETV A;  5JQG E;  2Y6X A;  4MHC A;  2W61 A;  5FYM A;  3ZEF B;  4ZI7 E;  4QX7 B;  3AAI A;  1SHZ C;  2I59 A;  4G2A A;  3O1J A;  4BAY B;  4UVB B;  5DJQ C;  2LSG A;  3CX8 B;  5LJN A;  4X1Y E;  3HA4 A;  1QUU A;  5JDN A;  2NWB A;  5LGN B;  3AVS A;  4WW0 A;  2W00 A;  2L8K A;  4KP3 C;  4TX5 A;  3FHN A;  4C91 A;  2VL8 A;  4CI1 B;  4IHJ E;  2CE7 A;  2Q9Q A;  2ACX A;  2KLQ A;  1ZHC A;  3PDY A;  1MMD A;  3R84 B;  2V7L A;  3N9L A;  4N78 D;  3ZYL A;  3VKH A;  3AAE B;  3UUX B;  1BR1 A;  3CKD A;  2KIN B;  4H9R C;  4HFV A;  5L3B B;  2PJQ A;  3OJA A;  5CA1 E;  2X51 A;  4UVC B;  3ZYK A;  3ESL A;  4HE8 A;  2YU2 A;  4XBF B;  1LRZ A;  3KV6 A;  3ZCI A;  2Q9Q C;  5J2T E;  5FXV A;  3RX6 A;  3C4Z A;  4U72 A;  5E0O A;  3WAK A;  4V1A v;  2MBG A;  3SS1 A;  5LHI B;  4KBM B;  4IE6 A;  2H7O A;  2YK0 A;  3FXE B;  4QX8 B;  2BVM A;  2JQQ A;  2Q9Q D;  2ES0 A;  4H9Q C;  3C98 B;  2VB6 A;  4L0R A;  3MKD A;  2CWO A;  3O1I A;  3CPZ A;  1YD8 G;  4KMC A;  5FMN A;  1IAP A;  4DMW A;  3F2E A;  4AQF C;  4DND A;  2E9X C;  4GOU A;  4QXB B;  1VRB A;  1D1C A;  1HF8 A;  3EVY A;  2QGS A;  4EXT A;  4IIJ E;  4HEA A;  2LSY A;  4JEH B;  2LEH A;  5JDH A;  3UUN A;  3MXZ A;  2KND A;  4IE5 A;  4CXY A;  2DLR A;  3GN5 B;  1MMN A;  3Q9D A;  3O4X E;  4PK5 A;  1KNZ A;  3BQI A;  3FBZ A;  3LK2 B;  4UXN B;  5L3C B;  2WM9 A;  3HKE E;  3CQC B;  4FI5 A;  2K48 A;  1D0X A;  4UV8 B;  2WWU A;  3LK3 B;  4B6X A;  4YLH A;  1US7 B;  3VHL A;  1LKX A;  2V1D B;  4KUM B;  1Z0P A;  3P8C D;  4PJN A;  3IHR A;  3T8O A;  3H37 A;  4ZI3 D;  4GK5 E;  5DQW A;  3GMI A;  4UF0 B;  4NUU A;  4GYR A;  1ZKE A;  2E9X A;  5KDM C;  3HKB E;  5EK4 A;  3HKC E;  4E7S A;  1HCI A;  2X9W A;  1H7C A;  1WYC A;  2PBI A;  2CMR A;  3E0Z A;  3HKD E;  3PUG A;  2CLY B;  5IYZ E;  2N2N A;  4TZ4 C;  4YFS A;  3E08 A;  2KWH A;  4EZ4 A;  1HTJ F;  3QK6 A;  2Y48 B;  1MIY A;  3WI3 A;  2L9Q A;  5LHH B;  2LSJ A;  4A56 A;  5FY7 A;  2G0U A;  3C50 A;  2UXN B;  4DO0 A;  2Y8D A;  4AKH A;  5LCY A;  3RC3 A;  2ODU A;  3C4X A;  4EZH A;  2RP4 A;  3GWH A;  2C5I T;  3I0Q A;  2W62 A;  2XHE B;  3JC6 C;  3ZYM A;  4ERR A;  1U5P A;  1WRD A;  2C0S A;  5HYA A;  2N1G A;  2GK9 A;  2YIN A;  5H6Q B;  4MBQ A;  2XUE A;  5ADX L;  1S94 A;  5JDG A;  2D2S A;  3FB2 A;  3K3Q C;  4H9O C;  2DWK A;  4AKR B;  1MIW A;  2CWY A;  4ZHQ E;  3CVR A;  3HL6 A;  3N9N A;  1IJ6 A;  3Q5X A;  2DNX A;  3KVB A;  2LM9 A;  2XAQ B;  3AAA B;  4WNK A;  3PTR B;  3IBP A;  3J9X 1;  3ANW B;  2DWG A;  1U4Q A;  3SOL A;  5C8Y E;  3LBX A;  3N5L A;  3TKL B;  1FMV A;  1WLX A;  2D5U A;  3LJC A;  4AKI A;  2HH7 A;  2K9A A;  5TAO A;  2VKH A;  1NWM X;  3RYF E;  4OHF A;  4AKG A;  5LOV E;  5JDL A;  5GON E;  3BK9 A;  1UX4 A;  3ONX A;  4PW8 A;  4H9S E;  3NRY A;  2KXP B;  5FXW A;  4PJJ A;  5JR9 A;  2X9X A;  3RPU A;  5CB4 E;  2DHR A;  5JDQ A;  3O9X A;  5FNV E;  1Y64 B;  3PE0 A;  4QWN B;  2CXF A;  4GK0 E;  2NW8 A;  2LJL A;  2LT3 A;  2X0L B;  3DJB A;  1G73 A;  4EYU A;  4UVA B;  3CX7 B;  1LVK A;  5JRE A;  5F3J A;  1MND A;  4U74 A;  4IGU A;  4PFO A;  2XTL A;  1D0Y A;  2WMN A;  3FBL A;  3RRC A;  2KMF A;  4H9P C;  2VKO A;  3D0T A;  3ZMS B;  4TV8 E;  3OBV E;  1AJ3 A;  3AA1 B;  5AFU L;  4EB6 E;  3GA8 A;  2E9X D;  4X20 E;  4O4H E;  2XAH B;  4GIW A;  2JPF A;  1HG2 A;  3JC6 D;  3KFW X;  4J2C A;  4QXC B;  4ZS2 A;  2L3L A;  4QXH B;  5J1G A;  4TUY E;  5IHY A;  5LGT B;  5H6R B;  3K3O A;  2ZM8 A;  2X9H A;  1LVF A;  5L2L A;  5HXS A;  4UF0 A;  3PU8 A;  1QSD A;  5LXT E;  2CXL A;  2DCF A;  5FXZ A;  2H7V C;  5LNK A;  5HXE A;  4ZOL E;  1ZV4 X;  3B13 A;  3UUL A;  2X9Y A;  3W15 B;  1BR4 A;  3C4W A;  4IDZ A;  5KMG P;  3I0O A;  4PAG A;  3BQK A;  4CXW A;  3ZC1 A;  1MIV A;  1EZ3 A;  2EHO B;  4P0A A;  1VOM A;  2LHN A;  4HKA A;  2J1D G;  4ZS3 A;  4ASK A;  2X67 A;  4UEM A;  1IJ5 A;  5LHG B;  3GN5 A;  3PUS A;  3F57 A;  4H63 H;  4MFR A;  5FXX A;  1HFA A;  4AQG A;  2LE8 A;  2PFV A;  2V7I A;  1BR0 A;  2MOZ A;  3C64 A;  4NUV A;  1HG5 A;  3M65 A;  3MJX A;  4HN9 A;  2VKJ A;  2XAJ B;  2KZ7 B;  4CI3 B;  4K0U A;  4P09 A;  3DP7 A;  1BR2 A;  2EHO C;  3E22 E;  4EIW A;  4O4I E;  5A1L A;  4O2A E;  4DVD A;  4O4L E;  4G63 A;  5LBM A;  4AQF A;  3CML A;  4I4T E;  3MK7 C;  1X79 A;  4PJM A;  3QC9 A;  2JMK A;  2V7K A;  3CWZ B;  2PG8 A;  2EHO D;  3VU7 H;  4CQI A;  3ZMT B;  2EHO A;  2W0G A;  5EZY E;  3ANW A;  2LSK A;  3RYC E;  3ZJ2 A;  3NZQ A;  3ZC0 A;  4P0B A;  2XAG B;  2A72 A;  3F31 A;  1MNE A;  1OWA A;  4E7Z A;  5JR9 B;  3UTK A;  4OK0 A;  2MYS A;  1KK7 A;  3UFE A;  3AVR A;  1HS7 A;  2JMH A;  5L3D B;  2K5B B;  2M67 A;  5JR9 C;  3KIN B;  4H63 V;  4ISS A;  2IC6 A;  2B1E A;  3I9Y A;  1V9D A;  1ZEE A;  3DTO A;  5JDF A;  1D1A A;  4O4J E;  3LFM A;  4OYK A;  4UV9 B;  1YKH B;  4GYS A;  2C5J A;  1S35 A;  2IC9 A;  3LG7 A;  5HXH A;  4UIG A;  3FXD B;  3CQX C;  2NOX A;  2YEV C;  2V7M A;  4WBN E;  4L9I A;  2NW7 A;  2LOS A;  2A3D A;  3P7I A;  1FIO A;  4JEU B;  3ZMU B;  2CEA A;  4HTE A;  4IE0 A;  3MA9 A;  3J7Y q;  4O8S A;  3QUJ A;  1D0Z A;  3AA7 B;  3A5X A;  4DBR A;  3I9W A;  3NZP A;  2CXD A;  4HGA A;  2JRK A;  1MMG A;  2CM0 A;  2P9B A;  4YJ2 E;  4PNI A;  3KV9 A;  3PUA A;  5F8P A;  5DAB A;  2E9X B;  4Z8X A;  2HPL A;  4H9N C;  2NP9 A;  4I55 E;  3B57 A;  4OFZ A;  4PFP A;  4IE4 A;  2A2F X;  3SRZ A;  3N2G E;  2KT9 A;  3OYZ A;  1WR6 A;  3PUQ A;  4JLE A;  3RH3 A;  3LBX B;  2IW5 B;  5ETW A;  2LOP A;  3PUR A;  4L5G A;  4ILU A;  2JJ9 A;  3O1H A;  4WBO A;  4CXX A;  3H3A A;  3Q5W A;  1D1B A;  3OYX A;  4TN7 B;  1FEW A;  3I1A A;  2K24 A;  5DQV A;  2ZM2 A;  4ANJ A;  5JDM A;  2X68 A;  5J2U E;  1FMW A;  4IE7 A;  1NAF A;  3RC8 A;  1UX5 A;  4M1P A;  3ZLI A;  4BA9 A;  4QKN A;  5L3G B;  2NTY A;  5HAX A;  4O2B E;  4I50 E;  4IST A;  3ZN0 B;  4DBQ A;  5LA6 E;  3IEE A;  2XAS B;  5HXC A;  5FP3 A;  3BQL A;  2LHR A;  3KDS E;  4X1I E;  5JRC A;  4X1K E;  5KX5 E;  3KVA A;  4PK4 A;  5EK3 A;  3HI2 A;  2CLY C;  3CX6 B;  4I43 B;  3ZJ1 A;  2V26 A;  2D0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...