4NUUA

Heterotrimer structure of region ii from plasmodium vivax duffy binding protein (pvdbp) bound to the ectodomain of the duffy antigen receptor for chemokines (darc)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
299
structure length
282
Chain Sequence
SNTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLKICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Duffy receptor
publication title Red Blood Cell Invasion by Plasmodium vivax: Structural Basis for DBP Engagement of DARC.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Membrane protein, cell invasion
total genus 116
structure length 282
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4nuuA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4nuuA01
2XU0A 3CPZA 2Y8DA 3CMLA 4NUUA 5F3JA 3RRCA 2YK0A 3BQIA 3BQKA 4NUVA 3BQLA 3C64A 2WAUA 4YFSA
chains in the Genus database with same CATH superfamily
3GMIA 4B3ST 2WWUA 2LSYA 3JAEA 3X1DA 3HI2A 2KZ7B 2LE8A 1B7TA 4TZ4C 2JQKA 1LRZA 2P9BA 2X51A 3JC6C 2JJ9A 3UUBA 2YEVC 2BKNA 3OYXA 3ANWA 2LRLA 3H37A 4E7ZA 3FHNA 2LRKA 3ZCIA 5LG4A 4CI3B 2XQ5A 3RQUA 4UF0A 4JI8T 1CUNA 3AEDA 4IDZA 2E9XD 2JQ9A 3ZMZB 4DBQA 2ES0A 3Q5XA 5C2TA 4HKAA 1AJ3A 2XJ7A 1FIOA 4YHJA 4P5OA 3KV4A 4H9PC 3ZC0A 2YDQA 3CVRA 2OLTA 3AXJA 4ZEYA 4IREA 4DV6T 5L3CB 2MPKA 5HXRA 5IHYA 4UF0B 3AAAB 1V9DA 2QGSA 4PK4A 1N36T 5FYMA 5AQMB 4NIQA 2MOZA 4UVCB 4C90A 2W62A 4IT4A 2VKOA 1XNRT 4MBQA 2VVNA 1S35A 1BR4A 3UU5A 1OWAA 4X62T 2BVMA 3PE0A 5HXSA 1X9BA 2JIWA 1W09A 5HYAA 2V6XA 4EXTA 4ZI7E 4UV8B 1HNXT 1ZP0A 1T98A 2XM2A 2UXXB 3ZMUB 4WQOD 1N32T 1WLXA 4WZXA 3KBUA 3RPUA 3ZMSB 5FKYA 4U3CA 2DWKA 3AEAA 2HPJA 2YK0A 3ONXA 4ILAA 5ABFA 5ADXL 1N33T 5DQVA 5H6QB 2H7OA 3RIAA 3SFDA 4GKKT 2WZIA 5JQGE 4ZI3D 1W9RA 3N2GE 3QC9A 2XQ4A 4UEMA 3ZEFB 4CXYA 4YTNA 3OVUA 4OK0A 4HWDA 2EHOC 2CLYB 3FZFB 1M62A 4ASKA 4O4IE 2WAUA 4P09A 5ABFB 4UXNB 2MTQA 2RP4A 2NWBA 5L4HA 2UXBT 4JEHB 1Y64B 2N9DA 5LB7B 3OJAA 2BS3A 4U2ZA 2V6YA 2W00A 2WZHA 4QHOA 4U33A 2MBGA 3ZCJA 2L3LA 2IDOB 3MACA 4ILUA 2D9DA 5LBMA 3EVYA 4I4TE 3LK42 5KMGP 2CMRA 4ZS3A 4YY3T 3ZC1A 3ZSTA 2YINA 3P4WA 1HF8A 1ZOYA 4UVBB 4KX6A 3LBXA 3J7Yq 4IE7A 3RI5A 2C5IT 4OYKA 3PUVF 4LF8T 2XY8B 3VR9A 4DR5T 1T72A 2V6YB 3P7IA 4DV7T 4ERRA 1HNZT 1ZHCA 3NZQA 4DV2T 4FI5A 3CKDA 2YKSA 2CM0A 4OHFA 2OV9A 3SFEA 1IZNB 4DR4T 2WU5A 5HXCA 4LFCT 4HTEA 3LBXB 4PJLA 4HFCA 5FMNA 3RF1A 4MFRA 1SE7A 2LKGA 2LOPA 4BJNA 3ZT5A 5L3EB 4GOUA 3FBLA 4PNIA 4ADZA 2Z6EA 5DJQC 4BA9A 4TWDA 3ZPOA 5JDGA 1HR0T 1UK5A 2CA5A 5AQKB 4YT0A 1I6ZA 2NOXA 5ETWA 3RC8A 3A8YC 2QA7A 2VWAA 5M4YA 4NPPA 1ZV4X 2E9XC 4JEUB 5FXVA 1UX4A 2XQ9A 1KNRA 3C51A 3G06A 1XMOT 2UXDT 4IE5A 2PFVA 5L4EA 2YU1A 5FXZA 1HNWT 2X9XA 3IF8B 1YQ3A 4H63V 3N2KE 5LJNA 2VKJA 3K3OA 4EGWA 2BS2A 4O4LE 4PFOA 2X9HA 3DPLC 3P4PA 5AQQB 4PK5A 5HEHA 4JYAT 4TWFA 4F6RC 2HH7A 3N9OA 2FUPA 5LOVE 3VKHA 4F52A 2WDVA 1ZEEA 2XASB 2WDRA 4H9RC 1D1CA 5LCYA 1VCTA 5DQWA 1LVFA 2CLYC 3TLWA 4U7YA 2X9YA 1IAPA 5EK2A 1X79A 1SHZC 5GONE 5L2LA 1FMVA 4G63A 4MLKA 3AE3A 3AEBA 4JI7T 3MJXA 3ZKRA 3NBXX 4KHPT 2KWIB 2CWYA 3ZJ2A 5AQVB 1XWMA 2BZBA 5L3FB 3ZT7A 2V7MA 4UR9A 2R6GF 2KLQA 2A3DA 2KWHA 4JI6T 4CI2B 4JGHD 3ETUA 5LXTE 3UFGA 3DQVC 2K24A 3NWIA 2LSIA 5FXWA 3SS1A 3LK2B 1BR1A 4KUMB 2PTFA 2M6IA 1IBKT 1J5WA 3Q2MA 4L0RA 3H3AA 3PUWF 3OYZA 1XDPA 2CRBA 2K3WA 1U4QA 3RH3A 4CXWA 4YSYA 2UUBT 4I55E 3N2OA 5L3BB 2XTLA 2OA5A 5AQUB 3HKBE 4O8SA 2NTYA 2WZKA 5CJ5A 2CWOA 4NXMT 2BKPA 3B5MA 1W0AA 3MK7C 1R8IA 4JI4T 3IHRA 3PUYF 3O1IA 2X66A 3ABVA 4WNKA 2E5LT 2AE9A 5LNKA 3AVSA 5JR9A 3ZN0B 4I43B 2XQ6A 2VVSA 3M3ZB 4AKIA 3TLVA 3RQWA 1Z0PA 3PJAA 1YXRA 4GK0E 1NAFA 4AKLA 4DMVA 5F5WA 4BJMA 3L39A 3RYIE 2VQFT 1KK7A 2NTXA 4LF6T 2JQQA 2V7JA 3ETVA 5LP6E 3EHZA 3FB2A 4OYJA 3FZKB 5JR9B 4WBOA 4QWNB 4DVDA 5JDQA 3RLFF 2A2FX 2LJLA 2CEAA 4DV0T 2CCQA 4Z90A 2V1DB 2KNDA 1I94T 3KV9A 4CN4A 5IWAT 2BDEA 5LGTB 4LF7T 1KF6A 3Q5DA 3TKLB 5A1LA 3N5LA 3U78A 2LEHA 1QLBA 2RPAA 3RGLA 4A5XA 4X1KE 2LSJA 3B13A 3MA9A 3JADA 1DU2A 3I0QA 4EYYR 3E08A 4ZXLA 1LDKA 5JDFA 3N9LA 1MNDA 3ANWB 2XQYA 4K0UA 4M1PA 4EIWA 1HCIA 4IE6A 5JRCA 2XZEA 2XM1A 2K5BB 2BKOA 1WYBA 2IHR1 4LMLA 4HXIB 5CA0E 4UV9B 4X64T 4G2AA 2E9XA 3DTOA 5J2TE 3BK9A 4I50E 5FL0A 2XSAA 5JDLA 4HFIA 4Z91A 3ZMTB 3WAKA 1Z8UA 4LMKA 4A64A 4HN9A 1LDKB 1WCRA 4AIUA 5LMUT 4B3MT 4ZI2D 4IE4A 1J1JA 3AA6B 3RTRA 3AXJB 5LHGB 3VR8A 3MXZA 4C91A 4EEDA 4KBMB 3LFMA 3PUGA 5JRCB 3AE4A 3GN5A 2BS4A 4DV4T 3PV0F 4QH5A 2JMKA 2WB5A 3AE7A 4JUYA 2E9XB 2H88A 3DJBA 4JLEA 2ODVA 4JBWF 2V7LA 3C50A 4O4JE 4X20E 1D0XA 4YJ3E 2I6HA 4JI1T 1L0VA 3QB5K 1MNEA 1MIWA 3PTRB 3GN5B 1WYCA 4LF9T 2WS3A 1OXZA 1MIYA 5FP3A 3KVAA 1IJ6A 5AQNB 1BR2A 3JAFA 2V7IA 3S4UA 3AECA 2X67A 4K0KT 2KMFA 4DR6T 2HHHT 3CQCB 4PJJA 3VKGA 3MZKB 5EK3A 1CHUA 3PJAJ 2I0MA 2WDQA 3QK6A 2VQET 2YDSA 5JR9C 4HEAA 4KMCA 2J62A 2VB6A 3CPZA 2PBIA 2CBIA 3UQ4A 2YDRA 3AE8A 5LHIB 2YU2A 4YXDA 4N78D 4ZZCA 5HEUA 2XPKA 1D1BA 2MAWA 4HFEA 4OX9T 4YFSA 2Q9QD 2M67A 2XAGB 3OPCA 2WCAA 5FVKA 3MKDA 2BG9E 2VKHA 3K3QC 3HL6A 3UUNA 3RIUA 3EDVA 4L5GA 4JV5T 1XNQT 2X9WA 4X1YE 4DIDB 4TNWA 2HN1A 3E22E 5H6RB 4LF5T 3IBPA 1KNZA 5LMNT 5FY1A 4YSXA 2SPCA 3O1JA 5ABHA 4ILCA 2Q9QA 3LK3B 4TV8E 2DI4A 1OEDE 5AQSB 2AXDS 2XQ7A 1JNZA 4ZHQE 2VK9A 2XQ8A 3NRYA 1NENA 3VRAA 1YKHB 4QX7B 1HFAA 1KFYA 2VL0A 3QUJA 2E8IA 3AEGA 3JC6D 4GYRA 3VRBA 1NEKA 3IA3A 4CN6A 3L3PA 4HFDA 2E2AA 3FZHB 2A9UA 3UT5E 5LG3A 2K48A 3AE5A 2NW9A 4FJOA 5AQIB 4U72A 4WW0A 4B6XA 4EYUA 5LYJE 3P4QA 1LDJA 1XZYA 3UU4A 2IC9A 4TN7B 4PJNA 2KT9A 4H63H 3F2EA 2BVLA 3AA7B 2V8SV 4PW8A 5FVLA 4AP2B 3RKOA 3R84B 4ANJA 2X68A 3CIRA 2XUEA 5BR8T 3KVBA 3C4WA 3M65A 2ZM8A 2N1GA 2D2SA 5AQPB 2ZM6T 3VHLA 1UCUA 2J1DG 3PUQA 4H9SE 3L8RA 4LMJA 5FL1A 5L47A 2B1EA 3SWHA 1SA0E 1JNRA 4HWIB 3QB5A 4Q25A 1UX5A 5JDHA 1U6GA 3CQGB 2FJBA 5C8YE 3RYCE 3N9PA 4DV5T 1YD8G 3VU7H 4NUUA 3HR0A 2DCFA 5JH7E 1N34T 3UU8A 4YHHT 5FY7A 1J5ET 2LSKA 2HN2A 5LJMA 3AA1B 4PAGA 2KINB 4DV3T 3T1YT 5LGUB 2ZMAA 3A5XA 5LGNB 2FJEA 2CPTA 2LKHA 2WMNA 4GIWA 2X0YA 4IL9A 3GA8A 4DMWA 4O4HE 2WBLA 3UULA 2CHOA 1WFDA 2BG9A 5KXJA 1D1AA 4GKJT 2BBJA 3BQIA 5J1GA 4AXPA 2X0LB 2DNXA 3SOLA 2LOSA 4E7SA 4ZI3C 4TV9E 2DHRA 4APFB 2E5VA 1HX8A 5C3JA 5AQJB 2LHNA 5DABA 1WR0A 1E2AA 2ODUA 2EHOD 3UFEA 3ZLIA 3P4SA 1OEDA 4UVAB 2XSBA 4CZZB 4EOZB 4A97A 3C64A 4HWFA 1G73A 3ZSSA 2LM9A 2W0GA 5CB4E 3V5UA 1D0ZA 3J9X1 2BG9B 3OTOT 2V26A 1KEYA 1FEWA 4CQIA 2W63A 3RIUC 4AQYT 3AAEB 4LF4T 4WYVA 3UUXB 5CGMA 2UU9T 5AQGB 5E0OA 4DBRA 4XBFB 3I9YA 2VL8A 3OKQA 1LVKA 4CXXA 2UUCT 2Q9QC 5HXHA 1OEDB 2XAHB 5F3JA 2XQ3A 4IGUA 4H9QC 2HPLA 3LSVA 4V1Av 4P0BA 2N2NA 2W4XA 3EAMA 3Q9DA 4COFA 4UELA 4U7IA 3PURA 3AEFA 2M6BA 3SRZA 3C4ZA 4P0AA 2WM9A 2A72A 3UTKA 3AA0B 2B76A 1HG5A 3AVRA 1BR0A 3LG7A 4QXCB 4B3RT 3RKGA 4DR2T 2WY2A 2NW7A 4H9NC 2FBWA 2LHRA 2DL1A 2RA1A 2L8KA 4DO0A 5JVDE 3Q5EA 4TX5A 5HCMA 2LM2A 3N9MA 3ZMVB 4JI0T 5TAOA 2QRXA 1FJGT 4QKNA 3AE9A 4BAYB 2QYWA 4UIGA 2ACXA 2J4GA 2DLRA 4IHJE 4AQFA 2PG8A 3RRCA 4I0UA 3AE1A 3ZT6A 4YJ2E 4AQGA 4HFBA 2W66A 2PJQA 4H9OC 4QH1A 1WRDA 4CN1A 1KNPA 1FMWA 4YTPA 4ZS2A 1NWMX 4IIJE 2LLYA 3CWZB 2F4VT 4OFZA 2Y48B 2FJAA 5KDMC 3NVOA 1LKXA 2ZM0A 5L3GB 2IC6A 5HWYA 3EUHA 4LFBT 4HGAA 4P1NA 1XMQT 2ZM2A 3PU3A 3C98B 5AQRB 4HFVA 5FNVE 4YSZA 2IAKA 1MMAA 5CA1E 1WR6A 2VASA 3K1SA 1US7B 2BBHA 4HE8A 3EABA 1HTJF 2XQAA 3QNUA 4F8HA 3E0ZA 5AQHB 3ZYLA 2BG9C 5LA6E 2W61A 2IUBA 3EDUA 4TUYE 4HFHA 2CXFA 4CI1B 3RC3A 3Q5WA 2H3RA 3P4RA 2XU0A 1IBMT 3TLSA 4JI2T 5KX5E 2Y6XA 1O3XA 2K9AA 4AKHA 3HKEE 2H7VC 3AE6A 1OEDC 2CXLA 3R6NA 3RIFA 1IBLT 3I9WA 5AQTB 3RYHE 3U3IA 2XHEB 4EZHA 2C0SA 3N9NA 5F8PA 3FBZA 3KDSE 1E7PA 4DNDA 5AFUL 3PUAA 3P50A 4EAHA 1MMNA 3RHWA 2IMLA 3UU6A 2NW8A 4TWHA 3CX6B 1HX1B 2DWGA 1G8XA 4MALA 4YTMA 3PU8A 4DV1T 3FZMB 2UXCT 2KSRA 4EB6E 3PDYA 2QVAA 1MIVA 4U2YA 2L9QA 2YN6A 3B57A 4X66T 4DR1T 4EZ4A 3CQXC 5FY0A 3FXEB 4QXBB 2NR4A 1HS7A 2KXPB 1YW0A 2JRKA 4QH4A 2UXNB 5L3DB 2CHNA 5ABGA 1UURA 2IIUA 4XZCA 3QOFA 4A98A 4PJMA 4PFPA 3WI3A 2Y8DA 4B3TT 3TLUA 2V7KA 3L09A 4DUYT 4HWCA 2D0TA 5HEGA 1VOMA 4AKRB 2IW5B 5AQFB 2XAQB 1EZ3A 2VURA 2VKDA 3HKDE 3AE2A 4MHCA 1GQEA 4EV6A 1VCSA 3I1AA 3KV6A 4GK5E 2W2UA 4AISA 4IDQA 3ZN1B 3NZPA 5JDMA 3LJCA 1IJ5A 1MMGA 4YLHA 4AQFC 5ABEA 4NUVA 1SUMB 4DR7T 3K8PC 3UQ7A 3CK6A 5EZYE 3RYFE 1YKEB 1QUUA 3ZYKA 2Q9QB 2CE7A 3PUZF 4ZOLE 4O2BE 2I59A 1U5PA 3FXDB 2ZLYA 3T1HT 3ESLA 3CX8B 3H3MA 1H7CA 3D0TA 2CBJA 3RX6A 4X65T 1ZKEA 2JPFA 4Z8XA 4DUZT 1M7KA 5JTGA 3TLTA 1QSDA 5HCJA 3F57A 2CXDA 5CFBA 5HAXA 2YOEA 4JI3T 3PUXF 2JQHA 2C5KT 2V5DA 2D5UA 3KBTA 4ISTA 3OBVE 4DR3T 5AQLB 1D0YA 3A7MA 5BMVE 3CMLA 4O2AE 1W0BA 1T7SA 5FXXA 4ZI2C 3HA4A 1VRBA 5LHHB 3WAJA 4KI0F 3F31A 2WMOA 3ONLC 4AKGA 4U31A 3N9QA 2D0UA 3KV5A 1T8BA 4IDPA 3GWHA 4J2CA 2WQYA 4QXHB 3O9XA 3PUSA 2FJDA 2W67A 5HEJA 3ZJ1A 4IDOA 1S94A 1Y01A 4IE0A 3HKCE 3IEEA 3C4XA 3AB3B 3ONJA 2ACZA 2LT3A 3DP7A 3UUMA 3I0OA 4N9F3 2MYSA 3UU3A 4X1IE 4IDNA 4QX8B 3RRWA 1XDOA 2WP9A 4HWHA 5EK4A 4AI6A 2JMHA 4NXNT 3JCFA 3O4XE 4U74A 4GYSA 4XAXB 4A56A 4KHZF 5LBQB 2GK9A 3ZYMA 2WSSV 4TNVA 1HG2A 3BQKA 2NP9A 1UGOA 3O1HA 3FZLB 2V5CA 5HWXA 2J47A 1MMDA 5HXEA 5J0ZA 3P8CD 3NKZA 4IL4A 3W15B 2G0UA 3AEEA 2C5JA 4KP3C 2WWVA 3KINB 2H89A 3V5SA 5JREA 4JI5T 5AQOB 2WU2A 2EHOA 4WBNE 3CX7B 4EEBA 4L9IA 3LDQB 5IYZE 2LSGA 4ZZBA 3BQLA 1YQ4A 3KFWX 3K3NA 1E1HB 3T8OA 4X5TA 2X0HA 4PK6A 5HEOA 4LFAT 5J2UE 3NRXA 2XAFB 2XAJB 3AAIA 4ILBA 5JDNA 5IUXA 2EHOB 2UUAT 1UUSA 4ISSA 3EI0A
chains in the Genus database with same CATH topology
3GMIA 2BZBA 3RC3A 3Q5WA 2H3RA 5L3FB 2V7MA 2WWUA 2LSYA 4ZHQE 2VK9A 2XU0A 3HI2A 3NRYA 2KZ7B 2LE8A 1B7TA 1YKHB 4QX7B 2KLQA 5KX5E 2A3DA 2Y6XA 1HFAA 3QUJA 1O3XA 2K9AA 4AKHA 4TZ4C 2E8IA 2KWHA 1LRZA 2P9BA 2X51A 3JC6C 4CI2B 3JC6D 4GYRA 3HKEE 2JJ9A 2H7VC 3ETUA 2CXLA 3R6NA 5LXTE 2YEVC 3L3PA 3I9WA 3OYXA 3ANWA 3UT5E 2K48A 3RYHE 2NW9A 2K24A 4FJOA 3U3IA 2LSIA 3H37A 5FXWA 4U72A 4E7ZA 4WW0A 3SS1A 3LK2B 1BR1A 3FHNA 4B6XA 4EYUA 5LYJE 2XHEB 4KUMB 4EZHA 3ZCIA 2C0SA 5LG4A 3N9NA 5F8PA 4CI3B 4UF0A 3Q2MA 2IC9A 3FBZA 3KDSE 4L0RA 1CUNA 4TN7B 4DNDA 5AFUL 4PJNA 2KT9A 3PUAA 3H3AA 4H63H 3F2EA 2BVLA 3OYZA 3AA7B 4IDZA 4PW8A 4EAHA 2E9XD 1MMNA 1U4QA 3RH3A 3ZMZB 4CXWA 4DBQA 3RKOA 2ES0A 3R84B 4I55E 3ZJ2A 4ANJA 3N2OA 2NW8A 5L3BB 2X68A 2XTLA 2OA5A 3Q5XA 3CX6B 2XUEA 2DWGA 3HKBE 4O8SA 3KVBA 1G8XA 2NTYA 3C4WA 4MALA 4HKAA 3M65A 2ZM8A 2N1GA 3PU8A 1AJ3A 2D2SA 1FIOA 4YHJA 3KV4A 4H9PC 2CWOA 3ZC0A 4EB6E 3CVRA 3VHLA 1UCUA 2J1DG 3PDYA 3PUQA 4H9SE 1MIVA 5L3CB 2L9QA 3B57A 3MK7C 5HXRA 3IHRA 5IHYA 4UF0B 2B1EA 4EZ4A 3AAAB 3SWHA 1SA0E 3CQXC 5FY0A 3FXEB 3O1IA 1V9DA 2X66A 4QXBB 1UX5A 2QGSA 4WNKA 1HS7A 2KXPB 1YW0A 2JRKA 5JDHA 4PK4A 3CQGB 5FYMA 2MOZA 4UVCB 5C8YE 5LNKA 3AVSA 2UXNB 5L3DB 4C90A 5JR9A 3ZN0B 2W62A 3RYCE 4I43B 2VKOA 4MBQA 3N9PA 1S35A 1BR4A 1YD8G 4XZCA 3VU7H 4NUUA 3HR0A 4PJMA 1OWAA 2DCFA 5JH7E 2BVMA 3PE0A 5HXSA 4AKIA 1Z0PA 4PFPA 3WI3A 2Y8DA 5HYAA 5FY7A 4EXTA 2V7KA 2LSKA 3L09A 4GK0E 1NAFA 4ZI7E 2D0TA 4UV8B 4AKLA 4DMVA 5LJMA 1VOMA 3AA1B 4PAGA 4AKRB 4BJMA 2IW5B 2KINB 3RYIE 1T98A 1KK7A 2NTXA 2XAQB 1EZ3A 5LGUB 2UXXB 2VKDA 3ZMUB 3HKDE 2ZMAA 1WLXA 4MHCA 2JQQA 2V7JA 3A5XA 3ETVA 3KBUA 3RPUA 5LGNB 3ZMSB 5LP6E 2DWKA 3I1AA 3KV6A 4GK5E 3FB2A 2HPJA 2WMNA 2YK0A 4OYJA 3ONXA 5JR9B 4WBOA 4QWNB 4GIWA 3ZN1B 4DVDA 3NZPA 5JDQA 3GA8A 5JDMA 3LJCA 4DMWA 5ADXL 1IJ5A 1MMGA 4O4HE 2A2FX 2WBLA 4YLHA 4AQFC 5DQVA 5H6QB 3UULA 2H7OA 4NUVA 2LJLA 1D1AA 2CEAA 3BQIA 3K8PC 5J1GA 4AXPA 5EZYE 2X0LB 2CCQA 3RYFE 1YKEB 2V1DB 2DNXA 1QUUA 3ZYKA 2KNDA 3SOLA 2Q9QB 2LOSA 3KV9A 4E7SA 2CE7A 4ZI3C 5JQGE 4ZI3D 4TV9E 2DHRA 2BDEA 4ZOLE 5LGTB 4O2BE 3N2GE 2I59A 3QC9A 4UEMA 3TKLB 5A1LA 3N5LA 1U5PA 3U78A 3ZEFB 2LEHA 1HX8A 4CXYA 3FXDB 2ZLYA 4OK0A 3ESLA 2LHNA 2LSJA 3CX8B 3B13A 4X1KE 5DABA 2ODUA 2EHOC 2CLYB 2EHOD 1H7CA 3D0TA 3UFEA 3ZLIA 4O4IE 4ASKA 3MA9A 2WAUA 4P09A 3I0QA 3RX6A 4UVAB 4UXNB 3E08A 2MTQA 4EYYR 4CZZB 4EOZB 5JDFA 3C64A 3N9LA 2RP4A 1MNDA 2NWBA 3ANWB 1G73A 1ZKEA 2LM9A 1Y64B 2JPFA 2W0GA 2N9DA 2XQYA 4JEHB 4Z8XA 3OJAA 4K0UA 5CB4E 3V5UA 1D0ZA 3J9X1 4M1PA 2W00A 4EIWA 4QHOA 2MBGA 2V26A 1FEWA 4CQIA 1HCIA 2W63A 4IE6A 1QSDA 5JRCA 3F57A 3ZCJA 2L3LA 2CXDA 3AAEB 3MACA 4ILUA 2K5BB 5HAXA 1WYBA 3UUXB 5CA0E 5LBMA 2C5KT 4UV9B 3EVYA 4I4TE 4G2AA 5E0OA 3LK42 5KMGP 2D5UA 3KBTA 4TV8E 4ISTA 4DBRA 4XBFB 3I9YA 3OBVE 2VL8A 2E9XA 3DTOA 3OKQA 5J2TE 2CMRA 3BK9A 4I50E 4ZS3A 3ZC1A 1D0YA 5JDLA 2YINA 1LVKA 1HF8A 3ZMTB 3WAKA 4CXXA 4UVBB 2Q9QC 3LBXA 5HXHA 3J7Yq 5BMVE 2XAHB 3CMLA 5F3JA 4O2AE 4IE7A 4HN9A 2C5IT 5FXXA 4IGUA 4OYKA 4ZI2C 4ZI2D 3HA4A 1VRBA 4H9QC 4IE4A 5LHHB 3WAJA 3F31A 3AA6B 2HPLA 2WMOA 4V1Av 4P0BA 2N2NA 3Q9DA 5LHGB 3MXZA 4C91A 4AKGA 3P7IA 4UELA 3N9QA 3PURA 3LFMA 2D0UA 4KBMB 4ERRA 1ZHCA 3PUGA 3C4ZA 3KV5A 3SRZA 4P0AA 5JRCB 3NZQA 3GN5A 3GWHA 2WM9A 2A72A 4FI5A 3CKDA 3UTKA 2JMKA 4J2CA 3AA0B 4QXHB 2CM0A 3O9XA 4OHFA 3PUSA 1HG5A 3AVRA 1BR0A 4JUYA 2E9XB 3LG7A 4QXCB 1IZNB 3ZJ1A 1S94A 3DJBA 4JLEA 4IE0A 2NW7A 4H9NC 3HKCE 5HXCA 2ODVA 2LHRA 4HTEA 3LBXB 3IEEA 3C4XA 3AB3B 4PJLA 5FMNA 2RA1A 2LT3A 4MFRA 3DP7A 2V7LA 3UUMA 3C50A 2L8KA 4O4JE 2LOPA 3I0OA 4X20E 1D0XA 4YJ3E 4BJNA 4DO0A 5JVDE 2MYSA 1MNEA 1MIWA 4X1IE 5L3EB 4QX8B 4GOUA 3RRWA 3FBLA 4PNIA 4TX5A 4ADZA 2Z6EA 5DJQC 3PTRB 4BA9A 3GN5B 5EK4A 1WYCA 4AI6A 2JMHA 3ZPOA 5JDGA 3N9MA 3ZMVB 1OXZA 3O4XE 5TAOA 4U74A 2CA5A 1MIYA 5FP3A 3KVAA 1IJ6A 4GYSA 2NOXA 4XAXB 4QKNA 5LBQB 4A56A 1BR2A 4BAYB 2GK9A 5ETWA 2V7IA 4UIGA 2ACXA 3S4UA 3ZYMA 2WSSV 3RC8A 2X67A 2KMFA 1HG2A 2DLRA 3BQKA 2NP9A 3O1HA 4IHJE 3CQCB 4PJJA 3VKGA 4AQFA 2QA7A 2VWAA 2PG8A 3MZKB 5EK3A 5M4YA 3RRCA 5HWXA 4YJ2E 1MMDA 4AQGA 3QK6A 1ZV4X 2E9XC 5HXEA 4JEUB 3P8CD 1UX4A 5FXVA 2PJQA 3C51A 4H9OC 1WRDA 3W15B 2G0UA 5JR9C 4IE5A 2C5JA 2PFVA 4KP3C 1FMWA 2YU1A 5FXZA 4HEAA 2X9XA 3IF8B 4KMCA 3KINB 2VB6A 4ZS2A 3CPZA 3V5SA 2PBIA 5JREA 1NWMX 4H63V 4IIJE 3N2KE 3CWZB 5LJNA 4OFZA 2VKJA 2Y48B 3K3OA 5KDMC 5LHIB 1LKXA 4O4LE 2ZM0A 4PFOA 2YU2A 2X9HA 4N78D 2IC6A 5L3GB 2EHOA 4WBNE 1D1BA 3EUHA 5HWYA 3CX7B 4PK5A 4YFSA 4L9IA 4HGAA 2Q9QD 4F6RC 2HH7A 2ZM2A 2M67A 2XAGB 3N9OA 5LOVE 5IYZE 3VKHA 3PU3A 3C98B 2LSGA 1ZEEA 2XASB 4HFVA 5FNVE 3BQLA 2IAKA 3MKDA 1MMAA 2VKHA 1D1CA 3K3NA 3KFWX 4H9RC 5LCYA 1WR6A 5CA1E 1E1HB 3T8OA 5DQWA 2VASA 1LVFA 3K3QC 3HL6A 3UUNA 2CLYC 1US7B 3EDVA 4L5GA 4PK6A 2X9YA 1IAPA 4HE8A 5EK2A 2X9WA 1X79A 1HTJF 4X1YE 2CXFA 1SHZC 5J2UE 5GONE 3NRXA 5L2LA 2XAFB 3E22E 5H6RB 1FMVA 3E0ZA 3ZYLA 4G63A 2XAJB 3IBPA 1KNZA 4MLKA 3AAIA 5FY1A 5LA6E 5JDNA 2W61A 2SPCA 3EDUA 3O1JA 4TUYE 2EHOB 3MJXA 3NBXX 4ISSA 2Q9QA 3LK3B 2KWIB 2CWYA 2DI4A 4CI1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU0 A;  3CPZ A;  2Y8D A;  3CML A;  4NUU A;  5F3J A;  3RRC A;  2YK0 A;  3BQI A;  3BQK A;  4NUV A;  3BQL A;  3C64 A;  2WAU A;  4YFS A; 
#chains in the Genus database with same CATH topology
 3GMI A;  4B3S T;  2WWU A;  2LSY A;  3JAE A;  3X1D A;  3HI2 A;  2KZ7 B;  2LE8 A;  1B7T A;  4TZ4 C;  2JQK A;  1LRZ A;  2P9B A;  2X51 A;  3JC6 C;  2JJ9 A;  3UUB A;  2YEV C;  2BKN A;  3OYX A;  3ANW A;  2LRL A;  3H37 A;  4E7Z A;  3FHN A;  2LRK A;  3ZCI A;  5LG4 A;  4CI3 B;  2XQ5 A;  3RQU A;  4UF0 A;  4JI8 T;  1CUN A;  3AED A;  4IDZ A;  2E9X D;  2JQ9 A;  3ZMZ B;  4DBQ A;  2ES0 A;  3Q5X A;  5C2T A;  4HKA A;  1AJ3 A;  2XJ7 A;  1FIO A;  4YHJ A;  4P5O A;  3KV4 A;  4H9P C;  3ZC0 A;  2YDQ A;  3CVR A;  2OLT A;  3AXJ A;  4ZEY A;  4IRE A;  4DV6 T;  5L3C B;  2MPK A;  5HXR A;  5IHY A;  4UF0 B;  3AAA B;  1V9D A;  2QGS A;  4PK4 A;  1N36 T;  5FYM A;  5AQM B;  4NIQ A;  2MOZ A;  4UVC B;  4C90 A;  2W62 A;  4IT4 A;  2VKO A;  1XNR T;  4MBQ A;  2VVN A;  1S35 A;  1BR4 A;  3UU5 A;  1OWA A;  4X62 T;  2BVM A;  3PE0 A;  5HXS A;  1X9B A;  2JIW A;  1W09 A;  5HYA A;  2V6X A;  4EXT A;  4ZI7 E;  4UV8 B;  1HNX T;  1ZP0 A;  1T98 A;  2XM2 A;  2UXX B;  3ZMU B;  4WQO D;  1N32 T;  1WLX A;  4WZX A;  3KBU A;  3RPU A;  3ZMS B;  5FKY A;  4U3C A;  2DWK A;  3AEA A;  2HPJ A;  2YK0 A;  3ONX A;  4ILA A;  5ABF A;  5ADX L;  1N33 T;  5DQV A;  5H6Q B;  2H7O A;  3RIA A;  3SFD A;  4GKK T;  2WZI A;  5JQG E;  4ZI3 D;  1W9R A;  3N2G E;  3QC9 A;  2XQ4 A;  4UEM A;  3ZEF B;  4CXY A;  4YTN A;  3OVU A;  4OK0 A;  4HWD A;  2EHO C;  2CLY B;  3FZF B;  1M62 A;  4ASK A;  4O4I E;  2WAU A;  4P09 A;  5ABF B;  4UXN B;  2MTQ A;  2RP4 A;  2NWB A;  5L4H A;  2UXB T;  4JEH B;  1Y64 B;  2N9D A;  5LB7 B;  3OJA A;  2BS3 A;  4U2Z A;  2V6Y A;  2W00 A;  2WZH A;  4QHO A;  4U33 A;  2MBG A;  3ZCJ A;  2L3L A;  2IDO B;  3MAC A;  4ILU A;  2D9D A;  5LBM A;  3EVY A;  4I4T E;  3LK4 2;  5KMG P;  2CMR A;  4ZS3 A;  4YY3 T;  3ZC1 A;  3ZST A;  2YIN A;  3P4W A;  1HF8 A;  1ZOY A;  4UVB B;  4KX6 A;  3LBX A;  3J7Y q;  4IE7 A;  3RI5 A;  2C5I T;  4OYK A;  3PUV F;  4LF8 T;  2XY8 B;  3VR9 A;  4DR5 T;  1T72 A;  2V6Y B;  3P7I A;  4DV7 T;  4ERR A;  1HNZ T;  1ZHC A;  3NZQ A;  4DV2 T;  4FI5 A;  3CKD A;  2YKS A;  2CM0 A;  4OHF A;  2OV9 A;  3SFE A;  1IZN B;  4DR4 T;  2WU5 A;  5HXC A;  4LFC T;  4HTE A;  3LBX B;  4PJL A;  4HFC A;  5FMN A;  3RF1 A;  4MFR A;  1SE7 A;  2LKG A;  2LOP A;  4BJN A;  3ZT5 A;  5L3E B;  4GOU A;  3FBL A;  4PNI A;  4ADZ A;  2Z6E A;  5DJQ C;  4BA9 A;  4TWD A;  3ZPO A;  5JDG A;  1HR0 T;  1UK5 A;  2CA5 A;  5AQK B;  4YT0 A;  1I6Z A;  2NOX A;  5ETW A;  3RC8 A;  3A8Y C;  2QA7 A;  2VWA A;  5M4Y A;  4NPP A;  1ZV4 X;  2E9X C;  4JEU B;  5FXV A;  1UX4 A;  2XQ9 A;  1KNR A;  3C51 A;  3G06 A;  1XMO T;  2UXD T;  4IE5 A;  2PFV A;  5L4E A;  2YU1 A;  5FXZ A;  1HNW T;  2X9X A;  3IF8 B;  1YQ3 A;  4H63 V;  3N2K E;  5LJN A;  2VKJ A;  3K3O A;  4EGW A;  2BS2 A;  4O4L E;  4PFO A;  2X9H A;  3DPL C;  3P4P A;  5AQQ B;  4PK5 A;  5HEH A;  4JYA T;  4TWF A;  4F6R C;  2HH7 A;  3N9O A;  2FUP A;  5LOV E;  3VKH A;  4F52 A;  2WDV A;  1ZEE A;  2XAS B;  2WDR A;  4H9R C;  1D1C A;  5LCY A;  1VCT A;  5DQW A;  1LVF A;  2CLY C;  3TLW A;  4U7Y A;  2X9Y A;  1IAP A;  5EK2 A;  1X79 A;  1SHZ C;  5GON E;  5L2L A;  1FMV A;  4G63 A;  4MLK A;  3AE3 A;  3AEB A;  4JI7 T;  3MJX A;  3ZKR A;  3NBX X;  4KHP T;  2KWI B;  2CWY A;  3ZJ2 A;  5AQV B;  1XWM A;  2BZB A;  5L3F B;  3ZT7 A;  2V7M A;  4UR9 A;  2R6G F;  2KLQ A;  2A3D A;  2KWH A;  4JI6 T;  4CI2 B;  4JGH D;  3ETU A;  5LXT E;  3UFG A;  3DQV C;  2K24 A;  3NWI A;  2LSI A;  5FXW A;  3SS1 A;  3LK2 B;  1BR1 A;  4KUM B;  2PTF A;  2M6I A;  1IBK T;  1J5W A;  3Q2M A;  4L0R A;  3H3A A;  3PUW F;  3OYZ A;  1XDP A;  2CRB A;  2K3W A;  1U4Q A;  3RH3 A;  4CXW A;  4YSY A;  2UUB T;  4I55 E;  3N2O A;  5L3B B;  2XTL A;  2OA5 A;  5AQU B;  3HKB E;  4O8S A;  2NTY A;  2WZK A;  5CJ5 A;  2CWO A;  4NXM T;  2BKP A;  3B5M A;  1W0A A;  3MK7 C;  1R8I A;  4JI4 T;  3IHR A;  3PUY F;  3O1I A;  2X66 A;  3ABV A;  4WNK A;  2E5L T;  2AE9 A;  5LNK A;  3AVS A;  5JR9 A;  3ZN0 B;  4I43 B;  2XQ6 A;  2VVS A;  3M3Z B;  4AKI A;  3TLV A;  3RQW A;  1Z0P A;  3PJA A;  1YXR A;  4GK0 E;  1NAF A;  4AKL A;  4DMV A;  5F5W A;  4BJM A;  3L39 A;  3RYI E;  2VQF T;  1KK7 A;  2NTX A;  4LF6 T;  2JQQ A;  2V7J A;  3ETV A;  5LP6 E;  3EHZ A;  3FB2 A;  4OYJ A;  3FZK B;  5JR9 B;  4WBO A;  4QWN B;  4DVD A;  5JDQ A;  3RLF F;  2A2F X;  2LJL A;  2CEA A;  4DV0 T;  2CCQ A;  4Z90 A;  2V1D B;  2KND A;  1I94 T;  3KV9 A;  4CN4 A;  5IWA T;  2BDE A;  5LGT B;  4LF7 T;  1KF6 A;  3Q5D A;  3TKL B;  5A1L A;  3N5L A;  3U78 A;  2LEH A;  1QLB A;  2RPA A;  3RGL A;  4A5X A;  4X1K E;  2LSJ A;  3B13 A;  3MA9 A;  3JAD A;  1DU2 A;  3I0Q A;  4EYY R;  3E08 A;  4ZXL A;  1LDK A;  5JDF A;  3N9L A;  1MND A;  3ANW B;  2XQY A;  4K0U A;  4M1P A;  4EIW A;  1HCI A;  4IE6 A;  5JRC A;  2XZE A;  2XM1 A;  2K5B B;  2BKO A;  1WYB A;  2IHR 1;  4LML A;  4HXI B;  5CA0 E;  4UV9 B;  4X64 T;  4G2A A;  2E9X A;  3DTO A;  5J2T E;  3BK9 A;  4I50 E;  5FL0 A;  2XSA A;  5JDL A;  4HFI A;  4Z91 A;  3ZMT B;  3WAK A;  1Z8U A;  4LMK A;  4A64 A;  4HN9 A;  1LDK B;  1WCR A;  4AIU A;  5LMU T;  4B3M T;  4ZI2 D;  4IE4 A;  1J1J A;  3AA6 B;  3RTR A;  3AXJ B;  5LHG B;  3VR8 A;  3MXZ A;  4C91 A;  4EED A;  4KBM B;  3LFM A;  3PUG A;  5JRC B;  3AE4 A;  3GN5 A;  2BS4 A;  4DV4 T;  3PV0 F;  4QH5 A;  2JMK A;  2WB5 A;  3AE7 A;  4JUY A;  2E9X B;  2H88 A;  3DJB A;  4JLE A;  2ODV A;  4JBW F;  2V7L A;  3C50 A;  4O4J E;  4X20 E;  1D0X A;  4YJ3 E;  2I6H A;  4JI1 T;  1L0V A;  3QB5 K;  1MNE A;  1MIW A;  3PTR B;  3GN5 B;  1WYC A;  4LF9 T;  2WS3 A;  1OXZ A;  1MIY A;  5FP3 A;  3KVA A;  1IJ6 A;  5AQN B;  1BR2 A;  3JAF A;  2V7I A;  3S4U A;  3AEC A;  2X67 A;  4K0K T;  2KMF A;  4DR6 T;  2HHH T;  3CQC B;  4PJJ A;  3VKG A;  3MZK B;  5EK3 A;  1CHU A;  3PJA J;  2I0M A;  2WDQ A;  3QK6 A;  2VQE T;  2YDS A;  5JR9 C;  4HEA A;  4KMC A;  2J62 A;  2VB6 A;  3CPZ A;  2PBI A;  2CBI A;  3UQ4 A;  2YDR A;  3AE8 A;  5LHI B;  2YU2 A;  4YXD A;  4N78 D;  4ZZC A;  5HEU A;  2XPK A;  1D1B A;  2MAW A;  4HFE A;  4OX9 T;  4YFS A;  2Q9Q D;  2M67 A;  2XAG B;  3OPC A;  2WCA A;  5FVK A;  3MKD A;  2BG9 E;  2VKH A;  3K3Q C;  3HL6 A;  3UUN A;  3RIU A;  3EDV A;  4L5G A;  4JV5 T;  1XNQ T;  2X9W A;  4X1Y E;  4DID B;  4TNW A;  2HN1 A;  3E22 E;  5H6R B;  4LF5 T;  3IBP A;  1KNZ A;  5LMN T;  5FY1 A;  4YSX A;  2SPC A;  3O1J A;  5ABH A;  4ILC A;  2Q9Q A;  3LK3 B;  4TV8 E;  2DI4 A;  1OED E;  5AQS B;  2AXD S;  2XQ7 A;  1JNZ A;  4ZHQ E;  2VK9 A;  2XQ8 A;  3NRY A;  1NEN A;  3VRA A;  1YKH B;  4QX7 B;  1HFA A;  1KFY A;  2VL0 A;  3QUJ A;  2E8I A;  3AEG A;  3JC6 D;  4GYR A;  3VRB A;  1NEK A;  3IA3 A;  4CN6 A;  3L3P A;  4HFD A;  2E2A A;  3FZH B;  2A9U A;  3UT5 E;  5LG3 A;  2K48 A;  3AE5 A;  2NW9 A;  4FJO A;  5AQI B;  4U72 A;  4WW0 A;  4B6X A;  4EYU A;  5LYJ E;  3P4Q A;  1LDJ A;  1XZY A;  3UU4 A;  2IC9 A;  4TN7 B;  4PJN A;  2KT9 A;  4H63 H;  3F2E A;  2BVL A;  3AA7 B;  2V8S V;  4PW8 A;  5FVL A;  4AP2 B;  3RKO A;  3R84 B;  4ANJ A;  2X68 A;  3CIR A;  2XUE A;  5BR8 T;  3KVB A;  3C4W A;  3M65 A;  2ZM8 A;  2N1G A;  2D2S A;  5AQP B;  2ZM6 T;  3VHL A;  1UCU A;  2J1D G;  3PUQ A;  4H9S E;  3L8R A;  4LMJ A;  5FL1 A;  5L47 A;  2B1E A;  3SWH A;  1SA0 E;  1JNR A;  4HWI B;  3QB5 A;  4Q25 A;  1UX5 A;  5JDH A;  1U6G A;  3CQG B;  2FJB A;  5C8Y E;  3RYC E;  3N9P A;  4DV5 T;  1YD8 G;  3VU7 H;  4NUU A;  3HR0 A;  2DCF A;  5JH7 E;  1N34 T;  3UU8 A;  4YHH T;  5FY7 A;  1J5E T;  2LSK A;  2HN2 A;  5LJM A;  3AA1 B;  4PAG A;  2KIN B;  4DV3 T;  3T1Y T;  5LGU B;  2ZMA A;  3A5X A;  5LGN B;  2FJE A;  2CPT A;  2LKH A;  2WMN A;  4GIW A;  2X0Y A;  4IL9 A;  3GA8 A;  4DMW A;  4O4H E;  2WBL A;  3UUL A;  2CHO A;  1WFD A;  2BG9 A;  5KXJ A;  1D1A A;  4GKJ T;  2BBJ A;  3BQI A;  5J1G A;  4AXP A;  2X0L B;  2DNX A;  3SOL A;  2LOS A;  4E7S A;  4ZI3 C;  4TV9 E;  2DHR A;  4APF B;  2E5V A;  1HX8 A;  5C3J A;  5AQJ B;  2LHN A;  5DAB A;  1WR0 A;  1E2A A;  2ODU A;  2EHO D;  3UFE A;  3ZLI A;  3P4S A;  1OED A;  4UVA B;  2XSB A;  4CZZ B;  4EOZ B;  4A97 A;  3C64 A;  4HWF A;  1G73 A;  3ZSS A;  2LM9 A;  2W0G A;  5CB4 E;  3V5U A;  1D0Z A;  3J9X 1;  2BG9 B;  3OTO T;  2V26 A;  1KEY A;  1FEW A;  4CQI A;  2W63 A;  3RIU C;  4AQY T;  3AAE B;  4LF4 T;  4WYV A;  3UUX B;  5CGM A;  2UU9 T;  5AQG B;  5E0O A;  4DBR A;  4XBF B;  3I9Y A;  2VL8 A;  3OKQ A;  1LVK A;  4CXX A;  2UUC T;  2Q9Q C;  5HXH A;  1OED B;  2XAH B;  5F3J A;  2XQ3 A;  4IGU A;  4H9Q C;  2HPL A;  3LSV A;  4V1A v;  4P0B A;  2N2N A;  2W4X A;  3EAM A;  3Q9D A;  4COF A;  4UEL A;  4U7I A;  3PUR A;  3AEF A;  2M6B A;  3SRZ A;  3C4Z A;  4P0A A;  2WM9 A;  2A72 A;  3UTK A;  3AA0 B;  2B76 A;  1HG5 A;  3AVR A;  1BR0 A;  3LG7 A;  4QXC B;  4B3R T;  3RKG A;  4DR2 T;  2WY2 A;  2NW7 A;  4H9N C;  2FBW A;  2LHR A;  2DL1 A;  2RA1 A;  2L8K A;  4DO0 A;  5JVD E;  3Q5E A;  4TX5 A;  5HCM A;  2LM2 A;  3N9M A;  3ZMV B;  4JI0 T;  5TAO A;  2QRX A;  1FJG T;  4QKN A;  3AE9 A;  4BAY B;  2QYW A;  4UIG A;  2ACX A;  2J4G A;  2DLR A;  4IHJ E;  4AQF A;  2PG8 A;  3RRC A;  4I0U A;  3AE1 A;  3ZT6 A;  4YJ2 E;  4AQG A;  4HFB A;  2W66 A;  2PJQ A;  4H9O C;  4QH1 A;  1WRD A;  4CN1 A;  1KNP A;  1FMW A;  4YTP A;  4ZS2 A;  1NWM X;  4IIJ E;  2LLY A;  3CWZ B;  2F4V T;  4OFZ A;  2Y48 B;  2FJA A;  5KDM C;  3NVO A;  1LKX A;  2ZM0 A;  5L3G B;  2IC6 A;  5HWY A;  3EUH A;  4LFB T;  4HGA A;  4P1N A;  1XMQ T;  2ZM2 A;  3PU3 A;  3C98 B;  5AQR B;  4HFV A;  5FNV E;  4YSZ A;  2IAK A;  1MMA A;  5CA1 E;  1WR6 A;  2VAS A;  3K1S A;  1US7 B;  2BBH A;  4HE8 A;  3EAB A;  1HTJ F;  2XQA A;  3QNU A;  4F8H A;  3E0Z A;  5AQH B;  3ZYL A;  2BG9 C;  5LA6 E;  2W61 A;  2IUB A;  3EDU A;  4TUY E;  4HFH A;  2CXF A;  4CI1 B;  3RC3 A;  3Q5W A;  2H3R A;  3P4R A;  2XU0 A;  1IBM T;  3TLS A;  4JI2 T;  5KX5 E;  2Y6X A;  1O3X A;  2K9A A;  4AKH A;  3HKE E;  2H7V C;  3AE6 A;  1OED C;  2CXL A;  3R6N A;  3RIF A;  1IBL T;  3I9W A;  5AQT B;  3RYH E;  3U3I A;  2XHE B;  4EZH A;  2C0S A;  3N9N A;  5F8P A;  3FBZ A;  3KDS E;  1E7P A;  4DND A;  5AFU L;  3PUA A;  3P50 A;  4EAH A;  1MMN A;  3RHW A;  2IML A;  3UU6 A;  2NW8 A;  4TWH A;  3CX6 B;  1HX1 B;  2DWG A;  1G8X A;  4MAL A;  4YTM A;  3PU8 A;  4DV1 T;  3FZM B;  2UXC T;  2KSR A;  4EB6 E;  3PDY A;  2QVA A;  1MIV A;  4U2Y A;  2L9Q A;  2YN6 A;  3B57 A;  4X66 T;  4DR1 T;  4EZ4 A;  3CQX C;  5FY0 A;  3FXE B;  4QXB B;  2NR4 A;  1HS7 A;  2KXP B;  1YW0 A;  2JRK A;  4QH4 A;  2UXN B;  5L3D B;  2CHN A;  5ABG A;  1UUR A;  2IIU A;  4XZC A;  3QOF A;  4A98 A;  4PJM A;  4PFP A;  3WI3 A;  2Y8D A;  4B3T T;  3TLU A;  2V7K A;  3L09 A;  4DUY T;  4HWC A;  2D0T A;  5HEG A;  1VOM A;  4AKR B;  2IW5 B;  5AQF B;  2XAQ B;  1EZ3 A;  2VUR A;  2VKD A;  3HKD E;  3AE2 A;  4MHC A;  1GQE A;  4EV6 A;  1VCS A;  3I1A A;  3KV6 A;  4GK5 E;  2W2U A;  4AIS A;  4IDQ A;  3ZN1 B;  3NZP A;  5JDM A;  3LJC A;  1IJ5 A;  1MMG A;  4YLH A;  4AQF C;  5ABE A;  4NUV A;  1SUM B;  4DR7 T;  3K8P C;  3UQ7 A;  3CK6 A;  5EZY E;  3RYF E;  1YKE B;  1QUU A;  3ZYK A;  2Q9Q B;  2CE7 A;  3PUZ F;  4ZOL E;  4O2B E;  2I59 A;  1U5P A;  3FXD B;  2ZLY A;  3T1H T;  3ESL A;  3CX8 B;  3H3M A;  1H7C A;  3D0T A;  2CBJ A;  3RX6 A;  4X65 T;  1ZKE A;  2JPF A;  4Z8X A;  4DUZ T;  1M7K A;  5JTG A;  3TLT A;  1QSD A;  5HCJ A;  3F57 A;  2CXD A;  5CFB A;  5HAX A;  2YOE A;  4JI3 T;  3PUX F;  2JQH A;  2C5K T;  2V5D A;  2D5U A;  3KBT A;  4IST A;  3OBV E;  4DR3 T;  5AQL B;  1D0Y A;  3A7M A;  5BMV E;  3CML A;  4O2A E;  1W0B A;  1T7S A;  5FXX A;  4ZI2 C;  3HA4 A;  1VRB A;  5LHH B;  3WAJ A;  4KI0 F;  3F31 A;  2WMO A;  3ONL C;  4AKG A;  4U31 A;  3N9Q A;  2D0U A;  3KV5 A;  1T8B A;  4IDP A;  3GWH A;  4J2C A;  2WQY A;  4QXH B;  3O9X A;  3PUS A;  2FJD A;  2W67 A;  5HEJ A;  3ZJ1 A;  4IDO A;  1S94 A;  1Y01 A;  4IE0 A;  3HKC E;  3IEE A;  3C4X A;  3AB3 B;  3ONJ A;  2ACZ A;  2LT3 A;  3DP7 A;  3UUM A;  3I0O A;  4N9F 3;  2MYS A;  3UU3 A;  4X1I E;  4IDN A;  4QX8 B;  3RRW A;  1XDO A;  2WP9 A;  4HWH A;  5EK4 A;  4AI6 A;  2JMH A;  4NXN T;  3JCF A;  3O4X E;  4U74 A;  4GYS A;  4XAX B;  4A56 A;  4KHZ F;  5LBQ B;  2GK9 A;  3ZYM A;  2WSS V;  4TNV A;  1HG2 A;  3BQK A;  2NP9 A;  1UGO A;  3O1H A;  3FZL B;  2V5C A;  5HWX A;  2J47 A;  1MMD A;  5HXE A;  5J0Z A;  3P8C D;  3NKZ A;  4IL4 A;  3W15 B;  2G0U A;  3AEE A;  2C5J A;  4KP3 C;  2WWV A;  3KIN B;  2H89 A;  3V5S A;  5JRE A;  4JI5 T;  5AQO B;  2WU2 A;  2EHO A;  4WBN E;  3CX7 B;  4EEB A;  4L9I A;  3LDQ B;  5IYZ E;  2LSG A;  4ZZB A;  3BQL A;  1YQ4 A;  3KFW X;  3K3N A;  1E1H B;  3T8O A;  4X5T A;  2X0H A;  4PK6 A;  5HEO A;  4LFA T;  5J2U E;  3NRX A;  2XAF B;  2XAJ B;  3AAI A;  4ILB A;  5JDN A;  5IUX A;  2EHO B;  2UUA T;  1UUS A;  4ISS A;  3EI0 A; 
#chains in the Genus database with same CATH homology
 3GMI A;  2BZB A;  3RC3 A;  3Q5W A;  2H3R A;  5L3F B;  2V7M A;  2WWU A;  2LSY A;  4ZHQ E;  2VK9 A;  2XU0 A;  3HI2 A;  3NRY A;  2KZ7 B;  2LE8 A;  1B7T A;  1YKH B;  4QX7 B;  2KLQ A;  5KX5 E;  2A3D A;  2Y6X A;  1HFA A;  3QUJ A;  1O3X A;  2K9A A;  4AKH A;  4TZ4 C;  2E8I A;  2KWH A;  1LRZ A;  2P9B A;  2X51 A;  3JC6 C;  4CI2 B;  3JC6 D;  4GYR A;  3HKE E;  2JJ9 A;  2H7V C;  3ETU A;  2CXL A;  3R6N A;  5LXT E;  2YEV C;  3L3P A;  3I9W A;  3OYX A;  3ANW A;  3UT5 E;  2K48 A;  3RYH E;  2NW9 A;  2K24 A;  4FJO A;  3U3I A;  2LSI A;  3H37 A;  5FXW A;  4U72 A;  4E7Z A;  4WW0 A;  3SS1 A;  3LK2 B;  1BR1 A;  3FHN A;  4B6X A;  4EYU A;  5LYJ E;  2XHE B;  4KUM B;  4EZH A;  3ZCI A;  2C0S A;  5LG4 A;  3N9N A;  5F8P A;  4CI3 B;  4UF0 A;  3Q2M A;  2IC9 A;  3FBZ A;  3KDS E;  4L0R A;  1CUN A;  4TN7 B;  4DND A;  5AFU L;  4PJN A;  2KT9 A;  3PUA A;  3H3A A;  4H63 H;  3F2E A;  2BVL A;  3OYZ A;  3AA7 B;  4IDZ A;  4PW8 A;  4EAH A;  2E9X D;  1MMN A;  1U4Q A;  3RH3 A;  3ZMZ B;  4CXW A;  4DBQ A;  3RKO A;  2ES0 A;  3R84 B;  4I55 E;  3ZJ2 A;  4ANJ A;  3N2O A;  2NW8 A;  5L3B B;  2X68 A;  2XTL A;  2OA5 A;  3Q5X A;  3CX6 B;  2XUE A;  2DWG A;  3HKB E;  4O8S A;  3KVB A;  1G8X A;  2NTY A;  3C4W A;  4MAL A;  4HKA A;  3M65 A;  2ZM8 A;  2N1G A;  3PU8 A;  1AJ3 A;  2D2S A;  1FIO A;  4YHJ A;  3KV4 A;  4H9P C;  2CWO A;  3ZC0 A;  4EB6 E;  3CVR A;  3VHL A;  1UCU A;  2J1D G;  3PDY A;  3PUQ A;  4H9S E;  1MIV A;  5L3C B;  2L9Q A;  3B57 A;  3MK7 C;  5HXR A;  3IHR A;  5IHY A;  4UF0 B;  2B1E A;  4EZ4 A;  3AAA B;  3SWH A;  1SA0 E;  3CQX C;  5FY0 A;  3FXE B;  3O1I A;  1V9D A;  2X66 A;  4QXB B;  1UX5 A;  2QGS A;  4WNK A;  1HS7 A;  2KXP B;  1YW0 A;  2JRK A;  5JDH A;  4PK4 A;  3CQG B;  5FYM A;  2MOZ A;  4UVC B;  5C8Y E;  5LNK A;  3AVS A;  2UXN B;  5L3D B;  4C90 A;  5JR9 A;  3ZN0 B;  2W62 A;  3RYC E;  4I43 B;  2VKO A;  4MBQ A;  3N9P A;  1S35 A;  1BR4 A;  1YD8 G;  4XZC A;  3VU7 H;  4NUU A;  3HR0 A;  4PJM A;  1OWA A;  2DCF A;  5JH7 E;  2BVM A;  3PE0 A;  5HXS A;  4AKI A;  1Z0P A;  4PFP A;  3WI3 A;  2Y8D A;  5HYA A;  5FY7 A;  4EXT A;  2V7K A;  2LSK A;  3L09 A;  4GK0 E;  1NAF A;  4ZI7 E;  2D0T A;  4UV8 B;  4AKL A;  4DMV A;  5LJM A;  1VOM A;  3AA1 B;  4PAG A;  4AKR B;  4BJM A;  2IW5 B;  2KIN B;  3RYI E;  1T98 A;  1KK7 A;  2NTX A;  2XAQ B;  1EZ3 A;  5LGU B;  2UXX B;  2VKD A;  3ZMU B;  3HKD E;  2ZMA A;  1WLX A;  4MHC A;  2JQQ A;  2V7J A;  3A5X A;  3ETV A;  3KBU A;  3RPU A;  5LGN B;  3ZMS B;  5LP6 E;  2DWK A;  3I1A A;  3KV6 A;  4GK5 E;  3FB2 A;  2HPJ A;  2WMN A;  2YK0 A;  4OYJ A;  3ONX A;  5JR9 B;  4WBO A;  4QWN B;  4GIW A;  3ZN1 B;  4DVD A;  3NZP A;  5JDQ A;  3GA8 A;  5JDM A;  3LJC A;  4DMW A;  5ADX L;  1IJ5 A;  1MMG A;  4O4H E;  2A2F X;  2WBL A;  4YLH A;  4AQF C;  5DQV A;  5H6Q B;  3UUL A;  2H7O A;  4NUV A;  2LJL A;  1D1A A;  2CEA A;  3BQI A;  3K8P C;  5J1G A;  4AXP A;  5EZY E;  2X0L B;  2CCQ A;  3RYF E;  1YKE B;  2V1D B;  2DNX A;  1QUU A;  3ZYK A;  2KND A;  3SOL A;  2Q9Q B;  2LOS A;  3KV9 A;  4E7S A;  2CE7 A;  4ZI3 C;  5JQG E;  4ZI3 D;  4TV9 E;  2DHR A;  2BDE A;  4ZOL E;  5LGT B;  4O2B E;  3N2G E;  2I59 A;  3QC9 A;  4UEM A;  3TKL B;  5A1L A;  3N5L A;  1U5P A;  3U78 A;  3ZEF B;  2LEH A;  1HX8 A;  4CXY A;  3FXD B;  2ZLY A;  4OK0 A;  3ESL A;  2LHN A;  2LSJ A;  3CX8 B;  3B13 A;  4X1K E;  5DAB A;  2ODU A;  2EHO C;  2CLY B;  2EHO D;  1H7C A;  3D0T A;  3UFE A;  3ZLI A;  4O4I E;  4ASK A;  3MA9 A;  2WAU A;  4P09 A;  3I0Q A;  3RX6 A;  4UVA B;  4UXN B;  3E08 A;  2MTQ A;  4EYY R;  4CZZ B;  4EOZ B;  5JDF A;  3C64 A;  3N9L A;  2RP4 A;  1MND A;  2NWB A;  3ANW B;  1G73 A;  1ZKE A;  2LM9 A;  1Y64 B;  2JPF A;  2W0G A;  2N9D A;  2XQY A;  4JEH B;  4Z8X A;  3OJA A;  4K0U A;  5CB4 E;  3V5U A;  1D0Z A;  3J9X 1;  4M1P A;  2W00 A;  4EIW A;  4QHO A;  2MBG A;  2V26 A;  1FEW A;  4CQI A;  1HCI A;  2W63 A;  4IE6 A;  1QSD A;  5JRC A;  3F57 A;  3ZCJ A;  2L3L A;  2CXD A;  3AAE B;  3MAC A;  4ILU A;  2K5B B;  5HAX A;  1WYB A;  3UUX B;  5CA0 E;  5LBM A;  2C5K T;  4UV9 B;  3EVY A;  4I4T E;  4G2A A;  5E0O A;  3LK4 2;  5KMG P;  2D5U A;  3KBT A;  4TV8 E;  4IST A;  4DBR A;  4XBF B;  3I9Y A;  3OBV E;  2VL8 A;  2E9X A;  3DTO A;  3OKQ A;  5J2T E;  2CMR A;  3BK9 A;  4I50 E;  4ZS3 A;  3ZC1 A;  1D0Y A;  5JDL A;  2YIN A;  1LVK A;  1HF8 A;  3ZMT B;  3WAK A;  4CXX A;  4UVB B;  2Q9Q C;  3LBX A;  5HXH A;  3J7Y q;  5BMV E;  2XAH B;  3CML A;  5F3J A;  4O2A E;  4IE7 A;  4HN9 A;  2C5I T;  5FXX A;  4IGU A;  4OYK A;  4ZI2 C;  4ZI2 D;  3HA4 A;  1VRB A;  4H9Q C;  4IE4 A;  5LHH B;  3WAJ A;  3F31 A;  3AA6 B;  2HPL A;  2WMO A;  4V1A v;  4P0B A;  2N2N A;  3Q9D A;  5LHG B;  3MXZ A;  4C91 A;  4AKG A;  3P7I A;  4UEL A;  3N9Q A;  3PUR A;  3LFM A;  2D0U A;  4KBM B;  4ERR A;  1ZHC A;  3PUG A;  3C4Z A;  3KV5 A;  3SRZ A;  4P0A A;  5JRC B;  3NZQ A;  3GN5 A;  3GWH A;  2WM9 A;  2A72 A;  4FI5 A;  3CKD A;  3UTK A;  2JMK A;  4J2C A;  3AA0 B;  4QXH B;  2CM0 A;  3O9X A;  4OHF A;  3PUS A;  1HG5 A;  3AVR A;  1BR0 A;  4JUY A;  2E9X B;  3LG7 A;  4QXC B;  1IZN B;  3ZJ1 A;  1S94 A;  3DJB A;  4JLE A;  4IE0 A;  2NW7 A;  4H9N C;  3HKC E;  5HXC A;  2ODV A;  2LHR A;  4HTE A;  3LBX B;  3IEE A;  3C4X A;  3AB3 B;  4PJL A;  5FMN A;  2RA1 A;  2LT3 A;  4MFR A;  3DP7 A;  2V7L A;  3UUM A;  3C50 A;  2L8K A;  4O4J E;  2LOP A;  3I0O A;  4X20 E;  1D0X A;  4YJ3 E;  4BJN A;  4DO0 A;  5JVD E;  2MYS A;  1MNE A;  1MIW A;  4X1I E;  5L3E B;  4QX8 B;  4GOU A;  3RRW A;  3FBL A;  4PNI A;  4TX5 A;  4ADZ A;  2Z6E A;  5DJQ C;  3PTR B;  4BA9 A;  3GN5 B;  5EK4 A;  1WYC A;  4AI6 A;  2JMH A;  3ZPO A;  5JDG A;  3N9M A;  3ZMV B;  1OXZ A;  3O4X E;  5TAO A;  4U74 A;  2CA5 A;  1MIY A;  5FP3 A;  3KVA A;  1IJ6 A;  4GYS A;  2NOX A;  4XAX B;  4QKN A;  5LBQ B;  4A56 A;  1BR2 A;  4BAY B;  2GK9 A;  5ETW A;  2V7I A;  4UIG A;  2ACX A;  3S4U A;  3ZYM A;  2WSS V;  3RC8 A;  2X67 A;  2KMF A;  1HG2 A;  2DLR A;  3BQK A;  2NP9 A;  3O1H A;  4IHJ E;  3CQC B;  4PJJ A;  3VKG A;  4AQF A;  2QA7 A;  2VWA A;  2PG8 A;  3MZK B;  5EK3 A;  5M4Y A;  3RRC A;  5HWX A;  4YJ2 E;  1MMD A;  4AQG A;  3QK6 A;  1ZV4 X;  2E9X C;  5HXE A;  4JEU B;  3P8C D;  1UX4 A;  5FXV A;  2PJQ A;  3C51 A;  4H9O C;  1WRD A;  3W15 B;  2G0U A;  5JR9 C;  4IE5 A;  2C5J A;  2PFV A;  4KP3 C;  1FMW A;  2YU1 A;  5FXZ A;  4HEA A;  2X9X A;  3IF8 B;  4KMC A;  3KIN B;  2VB6 A;  4ZS2 A;  3CPZ A;  3V5S A;  2PBI A;  5JRE A;  1NWM X;  4H63 V;  4IIJ E;  3N2K E;  3CWZ B;  5LJN A;  4OFZ A;  2VKJ A;  2Y48 B;  3K3O A;  5KDM C;  5LHI B;  1LKX A;  4O4L E;  2ZM0 A;  4PFO A;  2YU2 A;  2X9H A;  4N78 D;  2IC6 A;  5L3G B;  2EHO A;  4WBN E;  1D1B A;  3EUH A;  5HWY A;  3CX7 B;  4PK5 A;  4YFS A;  4L9I A;  4HGA A;  2Q9Q D;  4F6R C;  2HH7 A;  2ZM2 A;  2M67 A;  2XAG B;  3N9O A;  5LOV E;  5IYZ E;  3VKH A;  3PU3 A;  3C98 B;  2LSG A;  1ZEE A;  2XAS B;  4HFV A;  5FNV E;  3BQL A;  2IAK A;  3MKD A;  1MMA A;  2VKH A;  1D1C A;  3K3N A;  3KFW X;  4H9R C;  5LCY A;  1WR6 A;  5CA1 E;  1E1H B;  3T8O A;  5DQW A;  2VAS A;  1LVF A;  3K3Q C;  3HL6 A;  3UUN A;  2CLY C;  1US7 B;  3EDV A;  4L5G A;  4PK6 A;  2X9Y A;  1IAP A;  4HE8 A;  5EK2 A;  2X9W A;  1X79 A;  1HTJ F;  4X1Y E;  2CXF A;  1SHZ C;  5J2U E;  5GON E;  3NRX A;  5L2L A;  2XAF B;  3E22 E;  5H6R B;  1FMV A;  3E0Z A;  3ZYL A;  4G63 A;  2XAJ B;  3IBP A;  1KNZ A;  4MLK A;  3AAI A;  5FY1 A;  5LA6 E;  5JDN A;  2W61 A;  2SPC A;  3EDU A;  3O1J A;  4TUY E;  2EHO B;  3MJX A;  3NBX X;  4ISS A;  2Q9Q A;  3LK3 B;  2KWI B;  2CWY A;  2DI4 A;  4CI1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...