4NUUA

Heterotrimer structure of region ii from plasmodium vivax duffy binding protein (pvdbp) bound to the ectodomain of the duffy antigen receptor for chemokines (darc)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
299
structure length
282
Chain Sequence
SNTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLVITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLKICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEQTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, cell invasion
molecule keywords Duffy receptor
publication title Red Blood Cell Invasion by Plasmodium vivax: Structural Basis for DBP Engagement of DARC.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 116
structure length 282
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4nuuA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4nuuA01
4NUVA 3BQIA 3CPZA 4YFSA 2YK0A 3CMLA 2WAUA 4NUUA 3C64A 3RRCA 5F3JA 2XU0A 2Y8DA 3BQKA 3BQLA
chains in the Genus database with same CATH superfamily
4WW0A 2V1DB 5AQQB 4HN9A 2KLQA 4TUYE 4P1NA 4ADZA 3CIRA 1ZP0A 4O8SA 4AIUA 5JQGE 2Y48B 2PG8A 1G8XA 4HFBA 1YXRA 3C50A 1U4QA 3FHNA 3EABA 3UUMA 3TLSA 4HTEA 4UELA 2L8KA 3AB3B 2NTXA 3AEEA 4LF4T 2V7JA 3K3NA 2E9XD 2KT9A 5FYMA 4IL9A 5J2TE 1D1BA 1JNZA 2X9YA 2XQYA 4GOUA 4PAGA 2LKHA 4IE0A 4YSXA 1WRDA 3X1DA 3ZCIA 3N9NA 3ZYLA 3L8RA 4APFB 2UXCT 5F8PA 2VVSA 2XQ6A 2WY2A 3KFWX 3RC3A 3A8YC 3AE4A 3U3IA 4NUVA 5FVKA 3AE3A 4OX9T 4E7SA 5ABFB 4XBFB 3C51A 3RYCE 2IDOB 5KXJA 2WB5A 4ILCA 5C3JA 2YOEA 2H3RA 2Q9QB 3N2KE 4CXXA 3ZMSB 2LOSA 2CXFA 2YDRA 2C5JA 2E9XA 4GK5E 3VRAA 2JQ9A 1Y01A 4UIGA 4I4TE 4YY3T 3RI5A 2YEVC 3I0OA 2BKOA 3ANWA 3N9QA 4PJMA 3AVRA 4IIJE 3ZMZB 3ZEFB 5HEOA 2LKGA 2ZM6T 5FNVE 4TNWA 3CPZA 1NENA 5FXXA 5L4HA 3GMIA 4YT0A 3AE2A 5AQFB 4KX6A 5JDNA 2JQHA 2XM1A 1MNEA 2CBJA 2P9BA 2D9DA 2BZBA 1W9RA 2C0SA 5LA6E 5H6RB 4OFZA 4DR3T 3P4PA 3LSVA 4QX7B 1T72A 3AXJA 2LJLA 3H37A 3TLTA 1LRZA 5FXVA 2XSAA 4BJNA 2XQ7A 5HYAA 2NR4A 5FMNA 1R8IA 3HKBE 4NPPA 2E5LT 3Q5WA 4I55E 4EIWA 5L3BB 2VL0A 4H9NC 3AA7B 4PJNA 5HCJA 4HXIB 2BVLA 2D2SA 3HI2A 2L9QA 5LB7B 3JC6D 1WCRA 4EGWA 2ES0A 1N36T 2LSGA 4LF5T 3PUQA 4DR5T 2CA5A 4HWDA 4ZI2D 3C64A 1XMQT 2CXDA 2WU2A 2N2NA 2V5CA 3JCFA 3UFEA 3KBUA 3P4WA 4PJJA 3JC6C 3RIUA 5DJQC 2ZLYA 1LDKA 4HFHA 4H9QC 2CE7A 2LE8A 4ZI2C 3EDUA 3S4UA 3Q2MA 1IJ6A 3AE8A 3K8PC 1J5ET 4H63H 2BBJA 2V5DA 3WI3A 3KVAA 5LP6E 4U2YA 1FMWA 4LFBT 1QSDA 2MYSA 2BG9C 2OV9A 2CLYC 2HN2A 3C4XA 2CRBA 3ONXA 4GKKT 3ONJA 3I9YA 3HL6A 2WMNA 5FY1A 2WWUA 4K0KT 1BR0A 1MMNA 3ZSSA 2PBIA 5JDFA 1G73A 1NEKA 4IHJE 4U7YA 2ZM0A 3AA1B 3PTRB 5L3DB 3VHLA 4DUYT 3P7IA 4JI5T 4GYSA 3ZT5A 3SFDA 4AKLA 4AKIA 5GONE 4HFVA 4DUZT 4ZS3A 3ZYKA 2PJQA 3CK6A 2J47A 4TX5A 1MMAA 2HHHT 3UFGA 3B13A 5HEHA 3RKOA 3FZKB 2BBHA 1MIVA 5JDMA 1M62A 3WAJA 3PV0F 4IDPA 3PJAA 4IREA 3RIFA 4DV2T 3RH3A 5KDMC 3VRBA 1HNXT 2D5UA 5LHHB 3B5MA 3ZKRA 4P5OA 3T1HT 4U33A 5ABGA 2C5IT 2PFVA 4HE8A 3CX8B 3RLFF 3UULA 4JI6T 4A98A 3N2OA 4O4JE 2BG9E 2W66A 2KXPB 2XZEA 2LT3A 4AI6A 4KBMB 1YD8G 2BKNA 2IC6A 4EZHA 5HEUA 3ESLA 2XU0A 5J2UE 3UU3A 4PJLA 1JNRA 2XJ7A 1KNPA 1M7KA 3ZCJA 2YINA 5ABFA 3BK9A 1Z8UA 4ZEYA 4N78D 5FVLA 5FY0A 4HFDA 2VASA 2Q9QA 3AAAB 4YSZA 4U74A 1XMOT 2V7LA 2X0LB 3EUHA 3AE9A 2LHNA 4A97A 4JEUB 4HWIB 3ETVA 5H6QB 4EAHA 3K3QC 3JADA 3PURA 3ZMUB 1E2AA 3DPLC 3QB5K 3RYFE 1QLBA 4Z91A 4WYVA 1YQ3A 3ZJ2A 3FXDB 3J9X1 5AQSB 2D0UA 2JPFA 3AAEB 4HFCA 2BS2A 4L9IA 2Z6EA 4Q25A 3IBPA 1LVKA 2WSSV 1VCSA 3A5XA 4G2AA 2X66A 2ZM8A 3P4QA 2FUPA 4LFAT 3CKDA 4NIQA 4UR9A 3V5SA 2LRKA 5LJMA 4WQOD 3P8CD 4QHOA 2UUBT 1S35A 2I6HA 2BS4A 5AQTB 5LMNT 1LKXA 2LHRA 5BR8T 5JVDE 4AQYT 2QYWA 3TLWA 2YKSA 3NBXX 1MMDA 5LBMA 1HG2A 2LLYA 3O9XA 3ZMTB 3RRWA 4DV7T 2BG9B 4O4HE 2CLYB 3EHZA 4HEAA 1YKEB 5JR9C 4X65T 5FP3A 4JYAT 4PK5A 4KMCA 2X0HA 1T7SA 3SRZA 3PUWF 3LJCA 2X9HA 1QUUA 5AQPB 2WAUA 3OYZA 4HKAA 3IF8B 2BVMA 2K24A 4DVDA 2XASB 3A7MA 2IHR1 3O1JA 2JJ9A 2ODVA 4ILAA 1NAFA 2V7KA 1FJGT 3GA8A 4TZ4C 4L5GA 3ZC0A 3AAIA 5AQGB 4IE4A 4HFEA 2VKOA 3OYXA 4ZI3C 2XQAA 2CEAA 3EAMA 4ZZCA 2DWKA 4TN7B 4AKHA 3L39A 2VB6A 3PUVF 3HKCE 3UU6A 4AXPA 3ABVA 3TLVA 4YJ2E 2XSBA 3VKHA 2XPKA 4DR1T 2AE9A 3FZLB 3IA3A 2EHOD 2WM9A 4CZZB 4O2AE 3AVSA 1HNZT 3RPUA 2HH7A 3OPCA 3NRYA 4U7IA 3PJAJ 2BS3A 4YHHT 1WYBA 2WDVA 3F2EA 3ZT6A 4TWFA 4DV3T 3RRCA 5JDHA 4UV8B 4PK6A 2EHOC 2F4VT 3DTOA 4U2ZA 3F31A 4AP2B 2KWIB 5FL1A 4DV6T 4F8HA 4WNKA 4PNIA 2W63A 2X68A 2J1DG 3N9MA 4I50E 3RC8A 3AEFA 5EK4A 4DBRA 2XQ3A 3AE1A 3Q5DA 3LG7A 1T8BA 4TNVA 5HXSA 4DIDB 1N34T 5ABEA 5DABA 2CPTA 2XAHB 3K3OA 2UUCT 2LOPA 3FBZA 4UVBB 1HS7A 1SHZC 3NKZA 4QH1A 1HR0T 2VURA 3QK6A 5TAOA 2KSRA 2DWGA 3RQWA 5HWXA 1UUSA 2UUAT 2UXDT 4ERRA 3ZN1B 2WZKA 1XWMA 2DL1A 3CQCB 4Z8XA 1IBKT 4QWNB 5L47A 5LJNA 4EXTA 1CUNA 1BR2A 1W0AA 2V7IA 2I59A 4LF6T 1XZYA 4PFPA 2E2AA 4O4IE 1UURA 3RKGA 1O3XA 1XDOA 1V9DA 2N1GA 4N9F3 4EZ4A 1YQ4A 4V1Av 5J0ZA 4JI0T 1UGOA 4QXHB 2UXNB 2QGSA 3EVYA 3LK42 3RGLA 4WBOA 3T8OA 4JI4T 5HEJA 3DP7A 2NOXA 4X1KE 3PU3A 2YU2A 2XQ4A 2YN6A 3FBLA 1UX4A 4MFRA 5JDLA 2W67A 2XHEB 2ACXA 1CHUA 5CGMA 5JR9B 3PUZF 3NZPA 4B3MT 4UV9B 3T1YT 1DU2A 4H9SE 4ILUA 3AEGA 4PW8A 5DQWA 4UVCB 4AISA 2KZ7B 2X51A 2YDQA 2OLTA 2RPAA 3KV6A 4JV5T 2WU5A 2V6XA 2W2UA 4L0RA 2A72A 2XUEA 4M1PA 3P50A 5LGNB 3LK3B 4X66T 4EEBA 1KFYA 1FEWA 5AQJB 2L3LA 2SPCA 4DNDA 2VL8A 1UX5A 1MMGA 5IYZE 4ISTA 2ODUA 2CBIA 3BQKA 4IE6A 4EEDA 2BG9A 3SFEA 1J5WA 4DR6T 3OVUA 2CCQA 3MK7C 4X20E 1HX8A 1Z0PA 4KI0F 2CHOA 5L3EB 4CN4A 1E7PA 5AQOB 4UF0B 5A1LA 3PDYA 3I9WA 2XQ5A 3MKDA 4B3TT 2NWBA 4MLKA 5AQMB 2OA5A 2XAFB 4AKRB 3IEEA 5KX5E 4YSYA 5HWYA 4HWCA 2UU9T 2WQYA 2HPJA 2EHOB 3Q5EA 4XZCA 4ZI7E 1LDJA 4ILBA 1LVFA 4H9RC 4BA9A 3PUYF 1AJ3A 2FBWA 3O1HA 3PU8A 2IIUA 4OYJA 3RX6A 1MIWA 3UU8A 3N9LA 2WMOA 3MXZA 1WLXA 3ZYMA 3I0QA 4O2BE 3KV4A 2JMKA 4K0UA 4HFIA 3QC9A 1L0VA 3Q9DA 1SA0E 3ZLIA 1SUMB 3CQGB 4KUMB 2X67A 2H7VC 3E0ZA 5LMUT 2NW8A 4QXCB 3RHWA 3M3ZB 4U72A 1OEDC 2JRKA 2X0YA 5LYJE 3OBVE 4UXNB 3LDQB 5AQNB 3VR9A 5IWAT 5LXTE 2G0UA 2PTFA 4OYKA 2NW7A 3MJXA 4LF7T 4DV5T 4YTNA 3Q5XA 3IHRA 5FKYA 3TLUA 4NXNT 5L3GB 4X5TA 2IAKA 5AQUB 2VKJA 2WDRA 5L3CB 1D1CA 3OJAA 4DO0A 2WP9A 4NUUA 3R6NA 3LBXB 2VKHA 2JMHA 2WS3A 3NVOA 1ZKEA 2HPLA 4QKNA 3UUXB 5LG3A 4HWFA 2XQ9A 4C91A 1SE7A 4JI1T 1ZEEA 3UU5A 1KF6A 4X62T 4P09A 5FXZA 4AQFC 1W09A 3OKQA 2FJEA 3VKGA 5JRCB 2YDSA 1U6GA 4JLEA 3UUNA 4JI7T 4DV4T 4U31A 5LCYA 4QXBB 4CI3B 4OK0A 4IE5A 4YTPA 4GK0E 5J1GA 5JDGA 1OEDE 1T98A 5C8YE 5F5WA 3UU4A 4P0AA 2XM2A 2J62A 5CA0E 1YKHB 4TV9E 1MIYA 4YHJA 3FXEB 2JQKA 2K48A 2XTLA 5LHGB 3ZN0B 4IDQA 4ZI3D 4TWHA 3CMLA 3AA6B 5M4YA 2V7MA 2UXXB 2K3WA 4EOZB 4ANJA 1OWAA 1US7B 3FB2A 3H3AA 4TWDA 1D0YA 1D1AA 5L2LA 5AFUL 1YW0A 1VOMA 3CX7B 3FZMB 2FJBA 5FL0A 4CQIA 5JR9A 1J1JA 1OXZA 5FXWA 2MOZA 3PUXF 4F6RC 4GYRA 3QB5A 1KEYA 4ZZBA 2NP9A 4PFOA 3RIAA 1S94A 4H9OC 3CX6B 3N2GE 3B57A 4Z90A 2V6YB 4LMLA 4EB6E 4X1IE 4CN1A 3AE6A 2KMFA 3KBTA 1HTJF 4KP3C 3RQUA 5JH7E 4A5XA 2E9XC 4UVAB 5CJ5A 3QOFA 2QVAA 3GWHA 3NRXA 4DR7T 4B6XA 2CMRA 2LM9A 3N9PA 5LOVE 4AKGA 4A56A 2XAGB 3N9OA 1FMVA 3PUAA 4LF8T 3W15B 4JUYA 4H63V 2DNXA 1H7CA 4ZOLE 3EI0A 1KK7A 4DR4T 4NXMT 4I0UA 2W0GA 5C2TA 3VU7H 4AQGA 4UF0A 3O4XE 4FI5A 1IBLT 1HF8A 1UK5A 3PE0A 3K1SA 3ZT7A 5HCMA 3V5UA 4OHFA 3C4ZA 1IBMT 3E08A 2LSJA 1OEDB 2X9WA 1N33T 3QNUA 3GN5B 4HWHA 1HCIA 1WR0A 1ZV4X 4TV8E 3I1AA 4G63A 4JBWF 4JI3T 4JEHB 4P0BA 2EHOA 3R84B 1I94T 5KMGP 4DBQA 2W00A 3SWHA 3BQIA 2A3DA 2QRXA 3N5LA 5LGTB 3ZMVB 2LRLA 3G06A 2B76A 1X9BA 4EV6A 4COFA 3P4RA 4F52A 4B3RT 4IE7A 3ZSTA 1B7TA 1HNWT 4H9PC 3NZQA 4B3ST 3AEBA 4C90A 5AQVB 4WZXA 1BR1A 2AXDS 3KINB 3RYHE 2DCFA 5LHIB 4QH5A 3DQVC 3L09A 2HN1A 5LG4A 5HXEA 3HR0A 4MALA 3CVRA 2D0TA 3AE7A 3L3PA 4UEMA 2VQFT 3O1IA 3RIUC 3ZC1A 2BKPA 2W61A 2VVNA 3H3MA 4GKJT 1VRBA 3NWIA 2I0MA 2V26A 4DMWA 2WWVA 3ZJ1A 1X79A 4FJOA 3AA0B 4EYYR 1ZHCA 5AQRB 1N32T 2CWYA 5BMVE 2ZM2A 1XDPA 1U5PA 3KDSE 1HG5A 1WYCA 1NWMX 3MZKB 4LF9T 3AEDA 5JREA 4YXDA 4YJ3E 3LBXA 2H89A 1W0BA 5IUXA 3P4SA 2J4GA 2VK9A 2LM2A 5L3FB 2ACZA 2FJAA 3UTKA 2VQET 4BAYB 3HA4A 2DHRA 2WZHA 3C98B 2CXLA 3KV5A 1KNZA 2VKDA 2BDEA 5E0OA 3U78A 2A9UA 5JRCA 3C4WA 4I43B 3UUBA 4ZHQE 4QX8B 1EZ3A 2GK9A 5HAXA 1KNRA 4LMJA 2IC9A 3WAKA 2XQ8A 4DV0T 1IAPA 3CQXC 3AEAA 2IUBA 3ONLC 2CM0A 4IDOA 2WZIA 1UCUA 5AQIB 2WCAA 2RP4A 5ETWA 2E9XB 2IMLA 2YK0A 3CWZB 5F3JA 4WBNE 4JI8T 2MBGA 4IGUA 5AQHB 3ANWB 3F57A 2W4XA 1GQEA 4CXYA 2E8IA 2M67A 2QA7A 1ZOYA 4DV1T 4ZS2A 2MTQA 4XAXB 2CHNA 4O4LE 4X64T 5CB4E 2B1EA 4MBQA 1VCTA 2XY8B 5CA1E 3FZFB 3HKEE 4CI1B 2E5VA 4BJMA 3FZHB 2Q9QD 4DMVA 3HKDE 5L4EA 2YU1A 1D0XA 5EK3A 2V6YA 2K5BB 2H7OA 2H88A 2XAQB 2KWHA 4QH4A 3AXJB 4DR2T 3SOLA 3D0TA 3OTOT 2MPKA 3LK2B 2Q9QC 3LFMA 2ZMAA 3KV9A 4X1YE 3AE5A 2NTYA 3QUJA 1MNDA 3KVBA 4J2CA 5EZYE 5IHYA 4IDNA 2WBLA 3SS1A 4U3CA 2K9AA 2UXBT 2A2FX 1BR4A 2VWAA 2DLRA 4EYUA 3DJBA 2DI4A 1IZNB 5AQLB 4IT4A 4E7ZA 5FY7A 1WFDA 2JQQA 3MACA 3E22E 2KNDA 3TKLB 1XNQT 2M6BA 1HX1B 2JIWA 4LFCT 3PUGA 1HFAA 4CN6A 2M6IA 5EK2A 2V8SV 2Y8DA 4ZXLA 4LMKA 4GIWA 3PUSA 3M65A 1Y64B 4ISSA 1D0ZA 1OEDA 4CI2B 4JI2T 4CXWA 2N9DA 1XNRT 3GN5A 1LDKB 1IJ5A 4ASKA 3RTRA 5HXRA 2CWOA 4PK4A 2NW9A 3JAFA 2Y6XA 4KHPT 3UQ7A 1I6ZA 5HEGA 4JGHD 4MHCA 5HXHA 2KINB 2FJDA 4A64A 5LNKA 2W62A 4YFSA 4IDZA 2XAJB 2R6GF 2RA1A 2IW5B 3ZPOA 2WDQA 2C5KT 5ABHA 2LSYA 4YTMA 5JTGA 4HGAA 1FIOA 2MAWA 3EDVA 2X9XA 5HXCA 5CFBA 1WR6A 5DQVA 3VR8A 4IL4A 2LSIA 3JAEA 5LGUB 5ADXL 3J7Yq 2LEHA 3BQLA 4YLHA 5JDQA 5LBQB 3AECA 5AQKB 4AQFA 3UQ4A 3ETUA 3UT5E 3MA9A 4KHZF 1E1HB 3RYIE 3RF1A 2LSKA
chains in the Genus database with same CATH topology
4WW0A 2V1DB 4HN9A 1HCIA 4PJLA 2KLQA 1ZV4X 4TV8E 4TUYE 4L0RA 2A72A 2XUEA 3I1AA 4G63A 4ADZA 3ZCJA 4JEHB 2YINA 4P0BA 4M1PA 5LGNB 2EHOA 3LK3B 3BK9A 4O8SA 3R84B 5JQGE 2Y48B 2PG8A 5KMGP 1G8XA 4N78D 4DBQA 3C50A 5FY0A 1U4QA 2W00A 3SWHA 3BQIA 1FEWA 3FHNA 2A3DA 3N5LA 2VASA 3ZMVB 5LGTB 2Q9QA 3AAAB 3UUMA 2L3LA 4U74A 2V7LA 4HTEA 2X0LB 2SPCA 3EUHA 4UELA 2L8KA 3AB3B 2LHNA 2NTXA 4JEUB 4DNDA 2VL8A 4IE7A 1B7TA 1UX5A 4H9PC 3NZQA 3ETVA 2V7JA 5H6QB 4EAHA 1MMGA 5IYZE 3K3QC 3K3NA 2E9XD 2KT9A 2ODUA 4ISTA 5FYMA 4C90A 3BQKA 4IE6A 1BR1A 5J2TE 1D1BA 3KINB 3RYHE 3PURA 3ZMUB 2CCQA 3MK7C 2X9YA 2DCFA 2XQYA 4X20E 5LHIB 3L09A 3RYFE 1HX8A 1Z0PA 4GOUA 4PAGA 3ZJ2A 5L3EB 3FXDB 3J9X1 5LG4A 4IE0A 5HXEA 3HR0A 4UF0B 5A1LA 1WRDA 2D0UA 3PDYA 2JPFA 3AAEB 3I9WA 4MALA 3CVRA 3ZCIA 3N9NA 2D0TA 3ZYLA 3MKDA 2NWBA 4MLKA 3L3PA 4UEMA 2OA5A 4L9IA 2Z6EA 2XAFB 3IBPA 1LVKA 2WSSV 4AKRB 3A5XA 4G2AA 2X66A 3O1IA 2ZM8A 5F8PA 3ZC1A 3IEEA 2W61A 5KX5E 5HWYA 3KFWX 1VRBA 3CKDA 3RC3A 3V5SA 5LJMA 2V26A 3U3IA 2HPJA 4DMWA 3P8CD 4NUVA 4QHOA 1S35A 2EHOB 4E7SA 4XBFB 4XZCA 3C51A 4ZI7E 3ZJ1A 3RYCE 1X79A 4FJOA 3AA0B 4EYYR 1ZHCA 1LKXA 2LHRA 1LVFA 4H9RC 5JVDE 4BA9A 2H3RA 2Q9QB 3N2KE 4CXXA 3ZMSB 1AJ3A 2LOSA 3NBXX 2CWYA 2CXFA 5BMVE 2C5JA 2ZM2A 2E9XA 1MMDA 4GK5E 3O1HA 3PU8A 1U5PA 3KDSE 4OYJA 1HG5A 1WYCA 5LBMA 3RX6A 1MIWA 4UIGA 1NWMX 3MZKB 4I4TE 5JREA 1HG2A 4YJ3E 3O9XA 2YEVC 3LBXA 3I0OA 3ZMTB 3RRWA 3ANWA 3N9QA 3N9LA 4O4HE 2CLYB 2WMOA 4PJMA 3AVRA 4IIJE 4HEAA 3MXZA 3ZMZB 3ZEFB 1WLXA 5FNVE 1YKEB 3ZYMA 5JR9C 3CPZA 3I0QA 5FXXA 2VK9A 3GMIA 4O2BE 5FP3A 3KV4A 5L3FB 2JMKA 4K0UA 4PK5A 3QC9A 5JDNA 3Q9DA 1SA0E 3UTKA 3ZLIA 3CQGB 4KUMB 4BAYB 4KMCA 1MNEA 2X67A 3HA4A 2H7VC 2DHRA 3E0ZA 3C98B 2CXLA 3KV5A 1KNZA 2NW8A 2VKDA 2BDEA 3SRZA 4QXCB 5E0OA 3LJCA 3U78A 2X9HA 1QUUA 2P9BA 4U72A 2WAUA 5JRCA 2BZBA 2JRKA 3OYZA 4HKAA 3C4WA 2C0SA 3IF8B 2BVMA 5LYJE 4I43B 2K24A 4DVDA 3OBVE 2XASB 4UXNB 4ZHQE 3O1JA 2JJ9A 2ODVA 4QX8B 5LA6E 5H6RB 1EZ3A 2GK9A 1NAFA 5HAXA 2V7KA 2IC9A 4OFZA 3GA8A 4TZ4C 3WAKA 4L5GA 5LXTE 2G0UA 3ZC0A 4QX7B 3AAIA 4OYKA 2NW7A 4IE4A 3MJXA 1IAPA 3CQXC 2LJLA 2VKOA 3H37A 1LRZA 2CM0A 3Q5XA 5FXVA 4BJNA 3IHRA 3OYXA 4ZI3C 1UCUA 2CEAA 5HYAA 5L3GB 2IAKA 2DWKA 5FMNA 2RP4A 5ETWA 2VKJA 2E9XB 4TN7B 2YK0A 3CWZB 4AKHA 3HKBE 5F3JA 2VB6A 5L3CB 1D1CA 3OJAA 4DO0A 3HKCE 4NUUA 3Q5WA 4I55E 4WBNE 3R6NA 3LBXB 2MBGA 4IGUA 4EIWA 3ANWB 4AXPA 3F57A 5L3BB 4YJ2E 4H9NC 2VKHA 4CXYA 3VKHA 3AA7B 4PJNA 2E8IA 2M67A 2QA7A 2JMHA 4ZS2A 2BVLA 2D2SA 3HI2A 2L9QA 2MTQA 3JC6D 1ZKEA 4XAXB 2HPLA 4O4LE 4QKNA 3UUXB 5CB4E 2EHOD 4C91A 2ES0A 2WM9A 2B1EA 1ZEEA 2LSGA 4CZZB 4MBQA 3AVSA 4O2AE 3RPUA 3PUQA 5CA1E 3HKEE 4CI1B 2CA5A 2HH7A 4P09A 4ZI2D 3NRYA 4BJMA 5FXZA 2Q9QD 4AQFC 3C64A 3HKDE 4DMVA 2CXDA 3OKQA 1WYBA 3VKGA 5JRCB 2N2NA 3F2EA 3UFEA 3KBUA 4JLEA 3UUNA 2YU1A 1D0XA 5EK3A 4PJJA 3JC6C 3RRCA 2K5BB 2H7OA 5JDHA 5DJQC 2ZLYA 4UV8B 2XAQB 5LCYA 4PK6A 2EHOC 4QXBB 4CI3B 2KWHA 4OK0A 3DTOA 4IE5A 4H9QC 2CE7A 4GK0E 3F31A 2LE8A 5J1GA 5JDGA 3SOLA 3D0TA 1T98A 5C8YE 2KWIB 4ZI2C 4WNKA 3EDUA 3LK2B 3Q2MA 3S4UA 2Q9QC 4P0AA 1IJ6A 4PNIA 2W63A 2X68A 2J1DG 3N9MA 3LFMA 3K8PC 4I50E 3RC8A 4H63H 2ZMAA 3KV9A 5CA0E 5EK4A 1YKHB 3WI3A 4DBRA 4TV9E 1MIYA 4YHJA 3FXEB 4X1YE 2K48A 3KVAA 2NTYA 5LP6E 3QUJA 1FMWA 3LG7A 1MNDA 2XTLA 3KVBA 4J2CA 5EZYE 5IHYA 5HXSA 5LHGB 3ZN0B 2WBLA 3SS1A 1QSDA 4ZI3D 5DABA 2K9AA 3CMLA 2A2FX 1BR4A 2VWAA 3AA6B 2MYSA 2V7MA 5M4YA 2UXXB 2DLRA 4EOZB 2CLYC 3DJBA 2DI4A 4EYUA 4ANJA 3C4XA 2XAHB 1IZNB 1OWAA 3ONXA 3K3OA 2LOPA 1US7B 3FBZA 3FB2A 3H3AA 4E7ZA 5FY7A 1D0YA 4UVBB 1HS7A 2JQQA 1D1AA 3I9YA 1SHZC 3HL6A 5L2LA 3MACA 5AFUL 1YW0A 1VOMA 2WMNA 3CX7B 3E22E 2KNDA 5FY1A 2WWUA 1BR0A 3QK6A 1MMNA 5TAOA 3TKLB 4CQIA 5JR9A 2DWGA 2PBIA 5JDFA 1OXZA 1G73A 5HWXA 5FXWA 3PUGA 4IHJE 2MOZA 1HFAA 4F6RC 5EK2A 4GYRA 2ZM0A 2Y8DA 3AA1B 3PTRB 5L3DB 3VHLA 4ERRA 3ZN1B 4GIWA 3P7IA 2NP9A 3CQCB 4PFOA 4Z8XA 3PUSA 1S94A 3M65A 4H9OC 1Y64B 4ISSA 1D0ZA 4GYSA 3CX6B 3N2GE 3B57A 4AKLA 4QWNB 4AKIA 4CI2B 5GONE 4CXWA 2N9DA 3GN5A 5LJNA 4HFVA 4EXTA 1IJ5A 1CUNA 4ZS3A 4EB6E 3ZYKA 1BR2A 2PJQA 4ASKA 2V7IA 2I59A 4X1IE 5HXRA 2CWOA 4PK4A 4TX5A 2KMFA 1MMAA 4PFPA 2NW9A 4O4IE 2Y6XA 3B13A 3KBTA 1O3XA 1HTJF 4KP3C 1V9DA 2N1GA 4EZ4A 3RKOA 4MHCA 5HXHA 5JH7E 4V1Av 1MIVA 2E9XC 5JDMA 2KINB 4UVAB 5LNKA 4QXHB 2UXNB 3WAJA 2QGSA 3GWHA 2W62A 3EVYA 4YFSA 4IDZA 3LK42 2XAJB 3NRXA 3RH3A 5KDMC 4B6XA 4WBOA 2CMRA 2D5UA 2LM9A 2RA1A 3N9PA 2IW5B 3T8OA 3DP7A 3ZPOA 5LOVE 2NOXA 5LHHB 4AKGA 2C5KT 4X1KE 2LSYA 4A56A 2XAGB 3N9OA 3PU3A 2YU2A 1FMVA 3PUAA 4HGAA 2C5IT 2PFVA 3FBLA 1FIOA 3W15B 4JUYA 1UX4A 4HE8A 4MFRA 5JDLA 4H63V 3EDVA 2X9XA 3CX8B 3UULA 5HXCA 2DNXA 1H7CA 1WR6A 2XHEB 3N2OA 2ACXA 5DQVA 4O4JE 5JR9B 4ZOLE 1KK7A 3NZPA 2W0GA 2KXPB 2LSIA 4UV9B 3VU7H 4AQGA 4H9SE 4ILUA 2LT3A 4UF0A 5LGUB 5ADXL 3O4XE 4AI6A 3J7Yq 4FI5A 2LEHA 4KBMB 3BQLA 4YLHA 4PW8A 5DQWA 5LBQB 5JDQA 1YD8G 4UVCB 1HF8A 3PE0A 2IC6A 2KZ7B 2X51A 3V5UA 4EZHA 4AQFA 3KV6A 3ETUA 4OHFA 3UT5E 3C4ZA 3ESLA 3MA9A 3E08A 2LSJA 1E1HB 2X9WA 3RYIE 2XU0A 5J2UE 2LSKA 3GN5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUV A;  3BQI A;  3CPZ A;  4YFS A;  2YK0 A;  3CML A;  2WAU A;  4NUU A;  3C64 A;  3RRC A;  5F3J A;  2XU0 A;  2Y8D A;  3BQK A;  3BQL A; 
#chains in the Genus database with same CATH topology
 4WW0 A;  2V1D B;  5AQQ B;  4HN9 A;  2KLQ A;  4TUY E;  4P1N A;  4ADZ A;  3CIR A;  1ZP0 A;  4O8S A;  4AIU A;  5JQG E;  2Y48 B;  2PG8 A;  1G8X A;  4HFB A;  1YXR A;  3C50 A;  1U4Q A;  3FHN A;  3EAB A;  3UUM A;  3TLS A;  4HTE A;  4UEL A;  2L8K A;  3AB3 B;  2NTX A;  3AEE A;  4LF4 T;  2V7J A;  3K3N A;  2E9X D;  2KT9 A;  5FYM A;  4IL9 A;  5J2T E;  1D1B A;  1JNZ A;  2X9Y A;  2XQY A;  4GOU A;  4PAG A;  2LKH A;  4IE0 A;  4YSX A;  1WRD A;  3X1D A;  3ZCI A;  3N9N A;  3ZYL A;  3L8R A;  4APF B;  2UXC T;  5F8P A;  2VVS A;  2XQ6 A;  2WY2 A;  3KFW X;  3RC3 A;  3A8Y C;  3AE4 A;  3U3I A;  4NUV A;  5FVK A;  3AE3 A;  4OX9 T;  4E7S A;  5ABF B;  4XBF B;  3C51 A;  3RYC E;  2IDO B;  5KXJ A;  2WB5 A;  4ILC A;  5C3J A;  2YOE A;  2H3R A;  2Q9Q B;  3N2K E;  4CXX A;  3ZMS B;  2LOS A;  2CXF A;  2YDR A;  2C5J A;  2E9X A;  4GK5 E;  3VRA A;  2JQ9 A;  1Y01 A;  4UIG A;  4I4T E;  4YY3 T;  3RI5 A;  2YEV C;  3I0O A;  2BKO A;  3ANW A;  3N9Q A;  4PJM A;  3AVR A;  4IIJ E;  3ZMZ B;  3ZEF B;  5HEO A;  2LKG A;  2ZM6 T;  5FNV E;  4TNW A;  3CPZ A;  1NEN A;  5FXX A;  5L4H A;  3GMI A;  4YT0 A;  3AE2 A;  5AQF B;  4KX6 A;  5JDN A;  2JQH A;  2XM1 A;  1MNE A;  2CBJ A;  2P9B A;  2D9D A;  2BZB A;  1W9R A;  2C0S A;  5LA6 E;  5H6R B;  4OFZ A;  4DR3 T;  3P4P A;  3LSV A;  4QX7 B;  1T72 A;  3AXJ A;  2LJL A;  3H37 A;  3TLT A;  1LRZ A;  5FXV A;  2XSA A;  4BJN A;  2XQ7 A;  5HYA A;  2NR4 A;  5FMN A;  1R8I A;  3HKB E;  4NPP A;  2E5L T;  3Q5W A;  4I55 E;  4EIW A;  5L3B B;  2VL0 A;  4H9N C;  3AA7 B;  4PJN A;  5HCJ A;  4HXI B;  2BVL A;  2D2S A;  3HI2 A;  2L9Q A;  5LB7 B;  3JC6 D;  1WCR A;  4EGW A;  2ES0 A;  1N36 T;  2LSG A;  4LF5 T;  3PUQ A;  4DR5 T;  2CA5 A;  4HWD A;  4ZI2 D;  3C64 A;  1XMQ T;  2CXD A;  2WU2 A;  2N2N A;  2V5C A;  3JCF A;  3UFE A;  3KBU A;  3P4W A;  4PJJ A;  3JC6 C;  3RIU A;  5DJQ C;  2ZLY A;  1LDK A;  4HFH A;  4H9Q C;  2CE7 A;  2LE8 A;  4ZI2 C;  3EDU A;  3S4U A;  3Q2M A;  1IJ6 A;  3AE8 A;  3K8P C;  1J5E T;  4H63 H;  2BBJ A;  2V5D A;  3WI3 A;  3KVA A;  5LP6 E;  4U2Y A;  1FMW A;  4LFB T;  1QSD A;  2MYS A;  2BG9 C;  2OV9 A;  2CLY C;  2HN2 A;  3C4X A;  2CRB A;  3ONX A;  4GKK T;  3ONJ A;  3I9Y A;  3HL6 A;  2WMN A;  5FY1 A;  2WWU A;  4K0K T;  1BR0 A;  1MMN A;  3ZSS A;  2PBI A;  5JDF A;  1G73 A;  1NEK A;  4IHJ E;  4U7Y A;  2ZM0 A;  3AA1 B;  3PTR B;  5L3D B;  3VHL A;  4DUY T;  3P7I A;  4JI5 T;  4GYS A;  3ZT5 A;  3SFD A;  4AKL A;  4AKI A;  5GON E;  4HFV A;  4DUZ T;  4ZS3 A;  3ZYK A;  2PJQ A;  3CK6 A;  2J47 A;  4TX5 A;  1MMA A;  2HHH T;  3UFG A;  3B13 A;  5HEH A;  3RKO A;  3FZK B;  2BBH A;  1MIV A;  5JDM A;  1M62 A;  3WAJ A;  3PV0 F;  4IDP A;  3PJA A;  4IRE A;  3RIF A;  4DV2 T;  3RH3 A;  5KDM C;  3VRB A;  1HNX T;  2D5U A;  5LHH B;  3B5M A;  3ZKR A;  4P5O A;  3T1H T;  4U33 A;  5ABG A;  2C5I T;  2PFV A;  4HE8 A;  3CX8 B;  3RLF F;  3UUL A;  4JI6 T;  4A98 A;  3N2O A;  4O4J E;  2BG9 E;  2W66 A;  2KXP B;  2XZE A;  2LT3 A;  4AI6 A;  4KBM B;  1YD8 G;  2BKN A;  2IC6 A;  4EZH A;  5HEU A;  3ESL A;  2XU0 A;  5J2U E;  3UU3 A;  4PJL A;  1JNR A;  2XJ7 A;  1KNP A;  1M7K A;  3ZCJ A;  2YIN A;  5ABF A;  3BK9 A;  1Z8U A;  4ZEY A;  4N78 D;  5FVL A;  5FY0 A;  4HFD A;  2VAS A;  2Q9Q A;  3AAA B;  4YSZ A;  4U74 A;  1XMO T;  2V7L A;  2X0L B;  3EUH A;  3AE9 A;  2LHN A;  4A97 A;  4JEU B;  4HWI B;  3ETV A;  5H6Q B;  4EAH A;  3K3Q C;  3JAD A;  3PUR A;  3ZMU B;  1E2A A;  3DPL C;  3QB5 K;  3RYF E;  1QLB A;  4Z91 A;  4WYV A;  1YQ3 A;  3ZJ2 A;  3FXD B;  3J9X 1;  5AQS B;  2D0U A;  2JPF A;  3AAE B;  4HFC A;  2BS2 A;  4L9I A;  2Z6E A;  4Q25 A;  3IBP A;  1LVK A;  2WSS V;  1VCS A;  3A5X A;  4G2A A;  2X66 A;  2ZM8 A;  3P4Q A;  2FUP A;  4LFA T;  3CKD A;  4NIQ A;  4UR9 A;  3V5S A;  2LRK A;  5LJM A;  4WQO D;  3P8C D;  4QHO A;  2UUB T;  1S35 A;  2I6H A;  2BS4 A;  5AQT B;  5LMN T;  1LKX A;  2LHR A;  5BR8 T;  5JVD E;  4AQY T;  2QYW A;  3TLW A;  2YKS A;  3NBX X;  1MMD A;  5LBM A;  1HG2 A;  2LLY A;  3O9X A;  3ZMT B;  3RRW A;  4DV7 T;  2BG9 B;  4O4H E;  2CLY B;  3EHZ A;  4HEA A;  1YKE B;  5JR9 C;  4X65 T;  5FP3 A;  4JYA T;  4PK5 A;  4KMC A;  2X0H A;  1T7S A;  3SRZ A;  3PUW F;  3LJC A;  2X9H A;  1QUU A;  5AQP B;  2WAU A;  3OYZ A;  4HKA A;  3IF8 B;  2BVM A;  2K24 A;  4DVD A;  2XAS B;  3A7M A;  2IHR 1;  3O1J A;  2JJ9 A;  2ODV A;  4ILA A;  1NAF A;  2V7K A;  1FJG T;  3GA8 A;  4TZ4 C;  4L5G A;  3ZC0 A;  3AAI A;  5AQG B;  4IE4 A;  4HFE A;  2VKO A;  3OYX A;  4ZI3 C;  2XQA A;  2CEA A;  3EAM A;  4ZZC A;  2DWK A;  4TN7 B;  4AKH A;  3L39 A;  2VB6 A;  3PUV F;  3HKC E;  3UU6 A;  4AXP A;  3ABV A;  3TLV A;  4YJ2 E;  2XSB A;  3VKH A;  2XPK A;  4DR1 T;  2AE9 A;  3FZL B;  3IA3 A;  2EHO D;  2WM9 A;  4CZZ B;  4O2A E;  3AVS A;  1HNZ T;  3RPU A;  2HH7 A;  3OPC A;  3NRY A;  4U7I A;  3PJA J;  2BS3 A;  4YHH T;  1WYB A;  2WDV A;  3F2E A;  3ZT6 A;  4TWF A;  4DV3 T;  3RRC A;  5JDH A;  4UV8 B;  4PK6 A;  2EHO C;  2F4V T;  3DTO A;  4U2Z A;  3F31 A;  4AP2 B;  2KWI B;  5FL1 A;  4DV6 T;  4F8H A;  4WNK A;  4PNI A;  2W63 A;  2X68 A;  2J1D G;  3N9M A;  4I50 E;  3RC8 A;  3AEF A;  5EK4 A;  4DBR A;  2XQ3 A;  3AE1 A;  3Q5D A;  3LG7 A;  1T8B A;  4TNV A;  5HXS A;  4DID B;  1N34 T;  5ABE A;  5DAB A;  2CPT A;  2XAH B;  3K3O A;  2UUC T;  2LOP A;  3FBZ A;  4UVB B;  1HS7 A;  1SHZ C;  3NKZ A;  4QH1 A;  1HR0 T;  2VUR A;  3QK6 A;  5TAO A;  2KSR A;  2DWG A;  3RQW A;  5HWX A;  1UUS A;  2UUA T;  2UXD T;  4ERR A;  3ZN1 B;  2WZK A;  1XWM A;  2DL1 A;  3CQC B;  4Z8X A;  1IBK T;  4QWN B;  5L47 A;  5LJN A;  4EXT A;  1CUN A;  1BR2 A;  1W0A A;  2V7I A;  2I59 A;  4LF6 T;  1XZY A;  4PFP A;  2E2A A;  4O4I E;  1UUR A;  3RKG A;  1O3X A;  1XDO A;  1V9D A;  2N1G A;  4N9F 3;  4EZ4 A;  1YQ4 A;  4V1A v;  5J0Z A;  4JI0 T;  1UGO A;  4QXH B;  2UXN B;  2QGS A;  3EVY A;  3LK4 2;  3RGL A;  4WBO A;  3T8O A;  4JI4 T;  5HEJ A;  3DP7 A;  2NOX A;  4X1K E;  3PU3 A;  2YU2 A;  2XQ4 A;  2YN6 A;  3FBL A;  1UX4 A;  4MFR A;  5JDL A;  2W67 A;  2XHE B;  2ACX A;  1CHU A;  5CGM A;  5JR9 B;  3PUZ F;  3NZP A;  4B3M T;  4UV9 B;  3T1Y T;  1DU2 A;  4H9S E;  4ILU A;  3AEG A;  4PW8 A;  5DQW A;  4UVC B;  4AIS A;  2KZ7 B;  2X51 A;  2YDQ A;  2OLT A;  2RPA A;  3KV6 A;  4JV5 T;  2WU5 A;  2V6X A;  2W2U A;  4L0R A;  2A72 A;  2XUE A;  4M1P A;  3P50 A;  5LGN B;  3LK3 B;  4X66 T;  4EEB A;  1KFY A;  1FEW A;  5AQJ B;  2L3L A;  2SPC A;  4DND A;  2VL8 A;  1UX5 A;  1MMG A;  5IYZ E;  4IST A;  2ODU A;  2CBI A;  3BQK A;  4IE6 A;  4EED A;  2BG9 A;  3SFE A;  1J5W A;  4DR6 T;  3OVU A;  2CCQ A;  3MK7 C;  4X20 E;  1HX8 A;  1Z0P A;  4KI0 F;  2CHO A;  5L3E B;  4CN4 A;  1E7P A;  5AQO B;  4UF0 B;  5A1L A;  3PDY A;  3I9W A;  2XQ5 A;  3MKD A;  4B3T T;  2NWB A;  4MLK A;  5AQM B;  2OA5 A;  2XAF B;  4AKR B;  3IEE A;  5KX5 E;  4YSY A;  5HWY A;  4HWC A;  2UU9 T;  2WQY A;  2HPJ A;  2EHO B;  3Q5E A;  4XZC A;  4ZI7 E;  1LDJ A;  4ILB A;  1LVF A;  4H9R C;  4BA9 A;  3PUY F;  1AJ3 A;  2FBW A;  3O1H A;  3PU8 A;  2IIU A;  4OYJ A;  3RX6 A;  1MIW A;  3UU8 A;  3N9L A;  2WMO A;  3MXZ A;  1WLX A;  3ZYM A;  3I0Q A;  4O2B E;  3KV4 A;  2JMK A;  4K0U A;  4HFI A;  3QC9 A;  1L0V A;  3Q9D A;  1SA0 E;  3ZLI A;  1SUM B;  3CQG B;  4KUM B;  2X67 A;  2H7V C;  3E0Z A;  5LMU T;  2NW8 A;  4QXC B;  3RHW A;  3M3Z B;  4U72 A;  1OED C;  2JRK A;  2X0Y A;  5LYJ E;  3OBV E;  4UXN B;  3LDQ B;  5AQN B;  3VR9 A;  5IWA T;  5LXT E;  2G0U A;  2PTF A;  4OYK A;  2NW7 A;  3MJX A;  4LF7 T;  4DV5 T;  4YTN A;  3Q5X A;  3IHR A;  5FKY A;  3TLU A;  4NXN T;  5L3G B;  4X5T A;  2IAK A;  5AQU B;  2VKJ A;  2WDR A;  5L3C B;  1D1C A;  3OJA A;  4DO0 A;  2WP9 A;  4NUU A;  3R6N A;  3LBX B;  2VKH A;  2JMH A;  2WS3 A;  3NVO A;  1ZKE A;  2HPL A;  4QKN A;  3UUX B;  5LG3 A;  4HWF A;  2XQ9 A;  4C91 A;  1SE7 A;  4JI1 T;  1ZEE A;  3UU5 A;  1KF6 A;  4X62 T;  4P09 A;  5FXZ A;  4AQF C;  1W09 A;  3OKQ A;  2FJE A;  3VKG A;  5JRC B;  2YDS A;  1U6G A;  4JLE A;  3UUN A;  4JI7 T;  4DV4 T;  4U31 A;  5LCY A;  4QXB B;  4CI3 B;  4OK0 A;  4IE5 A;  4YTP A;  4GK0 E;  5J1G A;  5JDG A;  1OED E;  1T98 A;  5C8Y E;  5F5W A;  3UU4 A;  4P0A A;  2XM2 A;  2J62 A;  5CA0 E;  1YKH B;  4TV9 E;  1MIY A;  4YHJ A;  3FXE B;  2JQK A;  2K48 A;  2XTL A;  5LHG B;  3ZN0 B;  4IDQ A;  4ZI3 D;  4TWH A;  3CML A;  3AA6 B;  5M4Y A;  2V7M A;  2UXX B;  2K3W A;  4EOZ B;  4ANJ A;  1OWA A;  1US7 B;  3FB2 A;  3H3A A;  4TWD A;  1D0Y A;  1D1A A;  5L2L A;  5AFU L;  1YW0 A;  1VOM A;  3CX7 B;  3FZM B;  2FJB A;  5FL0 A;  4CQI A;  5JR9 A;  1J1J A;  1OXZ A;  5FXW A;  2MOZ A;  3PUX F;  4F6R C;  4GYR A;  3QB5 A;  1KEY A;  4ZZB A;  2NP9 A;  4PFO A;  3RIA A;  1S94 A;  4H9O C;  3CX6 B;  3N2G E;  3B57 A;  4Z90 A;  2V6Y B;  4LML A;  4EB6 E;  4X1I E;  4CN1 A;  3AE6 A;  2KMF A;  3KBT A;  1HTJ F;  4KP3 C;  3RQU A;  5JH7 E;  4A5X A;  2E9X C;  4UVA B;  5CJ5 A;  3QOF A;  2QVA A;  3GWH A;  3NRX A;  4DR7 T;  4B6X A;  2CMR A;  2LM9 A;  3N9P A;  5LOV E;  4AKG A;  4A56 A;  2XAG B;  3N9O A;  1FMV A;  3PUA A;  4LF8 T;  3W15 B;  4JUY A;  4H63 V;  2DNX A;  1H7C A;  4ZOL E;  3EI0 A;  1KK7 A;  4DR4 T;  4NXM T;  4I0U A;  2W0G A;  5C2T A;  3VU7 H;  4AQG A;  4UF0 A;  3O4X E;  4FI5 A;  1IBL T;  1HF8 A;  1UK5 A;  3PE0 A;  3K1S A;  3ZT7 A;  5HCM A;  3V5U A;  4OHF A;  3C4Z A;  1IBM T;  3E08 A;  2LSJ A;  1OED B;  2X9W A;  1N33 T;  3QNU A;  3GN5 B;  4HWH A;  1HCI A;  1WR0 A;  1ZV4 X;  4TV8 E;  3I1A A;  4G63 A;  4JBW F;  4JI3 T;  4JEH B;  4P0B A;  2EHO A;  3R84 B;  1I94 T;  5KMG P;  4DBQ A;  2W00 A;  3SWH A;  3BQI A;  2A3D A;  2QRX A;  3N5L A;  5LGT B;  3ZMV B;  2LRL A;  3G06 A;  2B76 A;  1X9B A;  4EV6 A;  4COF A;  3P4R A;  4F52 A;  4B3R T;  4IE7 A;  3ZST A;  1B7T A;  1HNW T;  4H9P C;  3NZQ A;  4B3S T;  3AEB A;  4C90 A;  5AQV B;  4WZX A;  1BR1 A;  2AXD S;  3KIN B;  3RYH E;  2DCF A;  5LHI B;  4QH5 A;  3DQV C;  3L09 A;  2HN1 A;  5LG4 A;  5HXE A;  3HR0 A;  4MAL A;  3CVR A;  2D0T A;  3AE7 A;  3L3P A;  4UEM A;  2VQF T;  3O1I A;  3RIU C;  3ZC1 A;  2BKP A;  2W61 A;  2VVN A;  3H3M A;  4GKJ T;  1VRB A;  3NWI A;  2I0M A;  2V26 A;  4DMW A;  2WWV A;  3ZJ1 A;  1X79 A;  4FJO A;  3AA0 B;  4EYY R;  1ZHC A;  5AQR B;  1N32 T;  2CWY A;  5BMV E;  2ZM2 A;  1XDP A;  1U5P A;  3KDS E;  1HG5 A;  1WYC A;  1NWM X;  3MZK B;  4LF9 T;  3AED A;  5JRE A;  4YXD A;  4YJ3 E;  3LBX A;  2H89 A;  1W0B A;  5IUX A;  3P4S A;  2J4G A;  2VK9 A;  2LM2 A;  5L3F B;  2ACZ A;  2FJA A;  3UTK A;  2VQE T;  4BAY B;  3HA4 A;  2DHR A;  2WZH A;  3C98 B;  2CXL A;  3KV5 A;  1KNZ A;  2VKD A;  2BDE A;  5E0O A;  3U78 A;  2A9U A;  5JRC A;  3C4W A;  4I43 B;  3UUB A;  4ZHQ E;  4QX8 B;  1EZ3 A;  2GK9 A;  5HAX A;  1KNR A;  4LMJ A;  2IC9 A;  3WAK A;  2XQ8 A;  4DV0 T;  1IAP A;  3CQX C;  3AEA A;  2IUB A;  3ONL C;  2CM0 A;  4IDO A;  2WZI A;  1UCU A;  5AQI B;  2WCA A;  2RP4 A;  5ETW A;  2E9X B;  2IML A;  2YK0 A;  3CWZ B;  5F3J A;  4WBN E;  4JI8 T;  2MBG A;  4IGU A;  5AQH B;  3ANW B;  3F57 A;  2W4X A;  1GQE A;  4CXY A;  2E8I A;  2M67 A;  2QA7 A;  1ZOY A;  4DV1 T;  4ZS2 A;  2MTQ A;  4XAX B;  2CHN A;  4O4L E;  4X64 T;  5CB4 E;  2B1E A;  4MBQ A;  1VCT A;  2XY8 B;  5CA1 E;  3FZF B;  3HKE E;  4CI1 B;  2E5V A;  4BJM A;  3FZH B;  2Q9Q D;  4DMV A;  3HKD E;  5L4E A;  2YU1 A;  1D0X A;  5EK3 A;  2V6Y A;  2K5B B;  2H7O A;  2H88 A;  2XAQ B;  2KWH A;  4QH4 A;  3AXJ B;  4DR2 T;  3SOL A;  3D0T A;  3OTO T;  2MPK A;  3LK2 B;  2Q9Q C;  3LFM A;  2ZMA A;  3KV9 A;  4X1Y E;  3AE5 A;  2NTY A;  3QUJ A;  1MND A;  3KVB A;  4J2C A;  5EZY E;  5IHY A;  4IDN A;  2WBL A;  3SS1 A;  4U3C A;  2K9A A;  2UXB T;  2A2F X;  1BR4 A;  2VWA A;  2DLR A;  4EYU A;  3DJB A;  2DI4 A;  1IZN B;  5AQL B;  4IT4 A;  4E7Z A;  5FY7 A;  1WFD A;  2JQQ A;  3MAC A;  3E22 E;  2KND A;  3TKL B;  1XNQ T;  2M6B A;  1HX1 B;  2JIW A;  4LFC T;  3PUG A;  1HFA A;  4CN6 A;  2M6I A;  5EK2 A;  2V8S V;  2Y8D A;  4ZXL A;  4LMK A;  4GIW A;  3PUS A;  3M65 A;  1Y64 B;  4ISS A;  1D0Z A;  1OED A;  4CI2 B;  4JI2 T;  4CXW A;  2N9D A;  1XNR T;  3GN5 A;  1LDK B;  1IJ5 A;  4ASK A;  3RTR A;  5HXR A;  2CWO A;  4PK4 A;  2NW9 A;  3JAF A;  2Y6X A;  4KHP T;  3UQ7 A;  1I6Z A;  5HEG A;  4JGH D;  4MHC A;  5HXH A;  2KIN B;  2FJD A;  4A64 A;  5LNK A;  2W62 A;  4YFS A;  4IDZ A;  2XAJ B;  2R6G F;  2RA1 A;  2IW5 B;  3ZPO A;  2WDQ A;  2C5K T;  5ABH A;  2LSY A;  4YTM A;  5JTG A;  4HGA A;  1FIO A;  2MAW A;  3EDV A;  2X9X A;  5HXC A;  5CFB A;  1WR6 A;  5DQV A;  3VR8 A;  4IL4 A;  2LSI A;  3JAE A;  5LGU B;  5ADX L;  3J7Y q;  2LEH A;  3BQL A;  4YLH A;  5JDQ A;  5LBQ B;  3AEC A;  5AQK B;  4AQF A;  3UQ4 A;  3ETU A;  3UT5 E;  3MA9 A;  4KHZ F;  1E1H B;  3RYI E;  3RF1 A;  2LSK A; 
#chains in the Genus database with same CATH homology
 4WW0 A;  2V1D B;  4HN9 A;  1HCI A;  4PJL A;  2KLQ A;  1ZV4 X;  4TV8 E;  4TUY E;  4L0R A;  2A72 A;  2XUE A;  3I1A A;  4G63 A;  4ADZ A;  3ZCJ A;  4JEH B;  2YIN A;  4P0B A;  4M1P A;  5LGN B;  2EHO A;  3LK3 B;  3BK9 A;  4O8S A;  3R84 B;  5JQG E;  2Y48 B;  2PG8 A;  5KMG P;  1G8X A;  4N78 D;  4DBQ A;  3C50 A;  5FY0 A;  1U4Q A;  2W00 A;  3SWH A;  3BQI A;  1FEW A;  3FHN A;  2A3D A;  3N5L A;  2VAS A;  3ZMV B;  5LGT B;  2Q9Q A;  3AAA B;  3UUM A;  2L3L A;  4U74 A;  2V7L A;  4HTE A;  2X0L B;  2SPC A;  3EUH A;  4UEL A;  2L8K A;  3AB3 B;  2LHN A;  2NTX A;  4JEU B;  4DND A;  2VL8 A;  4IE7 A;  1B7T A;  1UX5 A;  4H9P C;  3NZQ A;  3ETV A;  2V7J A;  5H6Q B;  4EAH A;  1MMG A;  5IYZ E;  3K3Q C;  3K3N A;  2E9X D;  2KT9 A;  2ODU A;  4IST A;  5FYM A;  4C90 A;  3BQK A;  4IE6 A;  1BR1 A;  5J2T E;  1D1B A;  3KIN B;  3RYH E;  3PUR A;  3ZMU B;  2CCQ A;  3MK7 C;  2X9Y A;  2DCF A;  2XQY A;  4X20 E;  5LHI B;  3L09 A;  3RYF E;  1HX8 A;  1Z0P A;  4GOU A;  4PAG A;  3ZJ2 A;  5L3E B;  3FXD B;  3J9X 1;  5LG4 A;  4IE0 A;  5HXE A;  3HR0 A;  4UF0 B;  5A1L A;  1WRD A;  2D0U A;  3PDY A;  2JPF A;  3AAE B;  3I9W A;  4MAL A;  3CVR A;  3ZCI A;  3N9N A;  2D0T A;  3ZYL A;  3MKD A;  2NWB A;  4MLK A;  3L3P A;  4UEM A;  2OA5 A;  4L9I A;  2Z6E A;  2XAF B;  3IBP A;  1LVK A;  2WSS V;  4AKR B;  3A5X A;  4G2A A;  2X66 A;  3O1I A;  2ZM8 A;  5F8P A;  3ZC1 A;  3IEE A;  2W61 A;  5KX5 E;  5HWY A;  3KFW X;  1VRB A;  3CKD A;  3RC3 A;  3V5S A;  5LJM A;  2V26 A;  3U3I A;  2HPJ A;  4DMW A;  3P8C D;  4NUV A;  4QHO A;  1S35 A;  2EHO B;  4E7S A;  4XBF B;  4XZC A;  3C51 A;  4ZI7 E;  3ZJ1 A;  3RYC E;  1X79 A;  4FJO A;  3AA0 B;  4EYY R;  1ZHC A;  1LKX A;  2LHR A;  1LVF A;  4H9R C;  5JVD E;  4BA9 A;  2H3R A;  2Q9Q B;  3N2K E;  4CXX A;  3ZMS B;  1AJ3 A;  2LOS A;  3NBX X;  2CWY A;  2CXF A;  5BMV E;  2C5J A;  2ZM2 A;  2E9X A;  1MMD A;  4GK5 E;  3O1H A;  3PU8 A;  1U5P A;  3KDS E;  4OYJ A;  1HG5 A;  1WYC A;  5LBM A;  3RX6 A;  1MIW A;  4UIG A;  1NWM X;  3MZK B;  4I4T E;  5JRE A;  1HG2 A;  4YJ3 E;  3O9X A;  2YEV C;  3LBX A;  3I0O A;  3ZMT B;  3RRW A;  3ANW A;  3N9Q A;  3N9L A;  4O4H E;  2CLY B;  2WMO A;  4PJM A;  3AVR A;  4IIJ E;  4HEA A;  3MXZ A;  3ZMZ B;  3ZEF B;  1WLX A;  5FNV E;  1YKE B;  3ZYM A;  5JR9 C;  3CPZ A;  3I0Q A;  5FXX A;  2VK9 A;  3GMI A;  4O2B E;  5FP3 A;  3KV4 A;  5L3F B;  2JMK A;  4K0U A;  4PK5 A;  3QC9 A;  5JDN A;  3Q9D A;  1SA0 E;  3UTK A;  3ZLI A;  3CQG B;  4KUM B;  4BAY B;  4KMC A;  1MNE A;  2X67 A;  3HA4 A;  2H7V C;  2DHR A;  3E0Z A;  3C98 B;  2CXL A;  3KV5 A;  1KNZ A;  2NW8 A;  2VKD A;  2BDE A;  3SRZ A;  4QXC B;  5E0O A;  3LJC A;  3U78 A;  2X9H A;  1QUU A;  2P9B A;  4U72 A;  2WAU A;  5JRC A;  2BZB A;  2JRK A;  3OYZ A;  4HKA A;  3C4W A;  2C0S A;  3IF8 B;  2BVM A;  5LYJ E;  4I43 B;  2K24 A;  4DVD A;  3OBV E;  2XAS B;  4UXN B;  4ZHQ E;  3O1J A;  2JJ9 A;  2ODV A;  4QX8 B;  5LA6 E;  5H6R B;  1EZ3 A;  2GK9 A;  1NAF A;  5HAX A;  2V7K A;  2IC9 A;  4OFZ A;  3GA8 A;  4TZ4 C;  3WAK A;  4L5G A;  5LXT E;  2G0U A;  3ZC0 A;  4QX7 B;  3AAI A;  4OYK A;  2NW7 A;  4IE4 A;  3MJX A;  1IAP A;  3CQX C;  2LJL A;  2VKO A;  3H37 A;  1LRZ A;  2CM0 A;  3Q5X A;  5FXV A;  4BJN A;  3IHR A;  3OYX A;  4ZI3 C;  1UCU A;  2CEA A;  5HYA A;  5L3G B;  2IAK A;  2DWK A;  5FMN A;  2RP4 A;  5ETW A;  2VKJ A;  2E9X B;  4TN7 B;  2YK0 A;  3CWZ B;  4AKH A;  3HKB E;  5F3J A;  2VB6 A;  5L3C B;  1D1C A;  3OJA A;  4DO0 A;  3HKC E;  4NUU A;  3Q5W A;  4I55 E;  4WBN E;  3R6N A;  3LBX B;  2MBG A;  4IGU A;  4EIW A;  3ANW B;  4AXP A;  3F57 A;  5L3B B;  4YJ2 E;  4H9N C;  2VKH A;  4CXY A;  3VKH A;  3AA7 B;  4PJN A;  2E8I A;  2M67 A;  2QA7 A;  2JMH A;  4ZS2 A;  2BVL A;  2D2S A;  3HI2 A;  2L9Q A;  2MTQ A;  3JC6 D;  1ZKE A;  4XAX B;  2HPL A;  4O4L E;  4QKN A;  3UUX B;  5CB4 E;  2EHO D;  4C91 A;  2ES0 A;  2WM9 A;  2B1E A;  1ZEE A;  2LSG A;  4CZZ B;  4MBQ A;  3AVS A;  4O2A E;  3RPU A;  3PUQ A;  5CA1 E;  3HKE E;  4CI1 B;  2CA5 A;  2HH7 A;  4P09 A;  4ZI2 D;  3NRY A;  4BJM A;  5FXZ A;  2Q9Q D;  4AQF C;  3C64 A;  3HKD E;  4DMV A;  2CXD A;  3OKQ A;  1WYB A;  3VKG A;  5JRC B;  2N2N A;  3F2E A;  3UFE A;  3KBU A;  4JLE A;  3UUN A;  2YU1 A;  1D0X A;  5EK3 A;  4PJJ A;  3JC6 C;  3RRC A;  2K5B B;  2H7O A;  5JDH A;  5DJQ C;  2ZLY A;  4UV8 B;  2XAQ B;  5LCY A;  4PK6 A;  2EHO C;  4QXB B;  4CI3 B;  2KWH A;  4OK0 A;  3DTO A;  4IE5 A;  4H9Q C;  2CE7 A;  4GK0 E;  3F31 A;  2LE8 A;  5J1G A;  5JDG A;  3SOL A;  3D0T A;  1T98 A;  5C8Y E;  2KWI B;  4ZI2 C;  4WNK A;  3EDU A;  3LK2 B;  3Q2M A;  3S4U A;  2Q9Q C;  4P0A A;  1IJ6 A;  4PNI A;  2W63 A;  2X68 A;  2J1D G;  3N9M A;  3LFM A;  3K8P C;  4I50 E;  3RC8 A;  4H63 H;  2ZMA A;  3KV9 A;  5CA0 E;  5EK4 A;  1YKH B;  3WI3 A;  4DBR A;  4TV9 E;  1MIY A;  4YHJ A;  3FXE B;  4X1Y E;  2K48 A;  3KVA A;  2NTY A;  5LP6 E;  3QUJ A;  1FMW A;  3LG7 A;  1MND A;  2XTL A;  3KVB A;  4J2C A;  5EZY E;  5IHY A;  5HXS A;  5LHG B;  3ZN0 B;  2WBL A;  3SS1 A;  1QSD A;  4ZI3 D;  5DAB A;  2K9A A;  3CML A;  2A2F X;  1BR4 A;  2VWA A;  3AA6 B;  2MYS A;  2V7M A;  5M4Y A;  2UXX B;  2DLR A;  4EOZ B;  2CLY C;  3DJB A;  2DI4 A;  4EYU A;  4ANJ A;  3C4X A;  2XAH B;  1IZN B;  1OWA A;  3ONX A;  3K3O A;  2LOP A;  1US7 B;  3FBZ A;  3FB2 A;  3H3A A;  4E7Z A;  5FY7 A;  1D0Y A;  4UVB B;  1HS7 A;  2JQQ A;  1D1A A;  3I9Y A;  1SHZ C;  3HL6 A;  5L2L A;  3MAC A;  5AFU L;  1YW0 A;  1VOM A;  2WMN A;  3CX7 B;  3E22 E;  2KND A;  5FY1 A;  2WWU A;  1BR0 A;  3QK6 A;  1MMN A;  5TAO A;  3TKL B;  4CQI A;  5JR9 A;  2DWG A;  2PBI A;  5JDF A;  1OXZ A;  1G73 A;  5HWX A;  5FXW A;  3PUG A;  4IHJ E;  2MOZ A;  1HFA A;  4F6R C;  5EK2 A;  4GYR A;  2ZM0 A;  2Y8D A;  3AA1 B;  3PTR B;  5L3D B;  3VHL A;  4ERR A;  3ZN1 B;  4GIW A;  3P7I A;  2NP9 A;  3CQC B;  4PFO A;  4Z8X A;  3PUS A;  1S94 A;  3M65 A;  4H9O C;  1Y64 B;  4ISS A;  1D0Z A;  4GYS A;  3CX6 B;  3N2G E;  3B57 A;  4AKL A;  4QWN B;  4AKI A;  4CI2 B;  5GON E;  4CXW A;  2N9D A;  3GN5 A;  5LJN A;  4HFV A;  4EXT A;  1IJ5 A;  1CUN A;  4ZS3 A;  4EB6 E;  3ZYK A;  1BR2 A;  2PJQ A;  4ASK A;  2V7I A;  2I59 A;  4X1I E;  5HXR A;  2CWO A;  4PK4 A;  4TX5 A;  2KMF A;  1MMA A;  4PFP A;  2NW9 A;  4O4I E;  2Y6X A;  3B13 A;  3KBT A;  1O3X A;  1HTJ F;  4KP3 C;  1V9D A;  2N1G A;  4EZ4 A;  3RKO A;  4MHC A;  5HXH A;  5JH7 E;  4V1A v;  1MIV A;  2E9X C;  5JDM A;  2KIN B;  4UVA B;  5LNK A;  4QXH B;  2UXN B;  3WAJ A;  2QGS A;  3GWH A;  2W62 A;  3EVY A;  4YFS A;  4IDZ A;  3LK4 2;  2XAJ B;  3NRX A;  3RH3 A;  5KDM C;  4B6X A;  4WBO A;  2CMR A;  2D5U A;  2LM9 A;  2RA1 A;  3N9P A;  2IW5 B;  3T8O A;  3DP7 A;  3ZPO A;  5LOV E;  2NOX A;  5LHH B;  4AKG A;  2C5K T;  4X1K E;  2LSY A;  4A56 A;  2XAG B;  3N9O A;  3PU3 A;  2YU2 A;  1FMV A;  3PUA A;  4HGA A;  2C5I T;  2PFV A;  3FBL A;  1FIO A;  3W15 B;  4JUY A;  1UX4 A;  4HE8 A;  4MFR A;  5JDL A;  4H63 V;  3EDV A;  2X9X A;  3CX8 B;  3UUL A;  5HXC A;  2DNX A;  1H7C A;  1WR6 A;  2XHE B;  3N2O A;  2ACX A;  5DQV A;  4O4J E;  5JR9 B;  4ZOL E;  1KK7 A;  3NZP A;  2W0G A;  2KXP B;  2LSI A;  4UV9 B;  3VU7 H;  4AQG A;  4H9S E;  4ILU A;  2LT3 A;  4UF0 A;  5LGU B;  5ADX L;  3O4X E;  4AI6 A;  3J7Y q;  4FI5 A;  2LEH A;  4KBM B;  3BQL A;  4YLH A;  4PW8 A;  5DQW A;  5LBQ B;  5JDQ A;  1YD8 G;  4UVC B;  1HF8 A;  3PE0 A;  2IC6 A;  2KZ7 B;  2X51 A;  3V5U A;  4EZH A;  4AQF A;  3KV6 A;  3ETU A;  4OHF A;  3UT5 E;  3C4Z A;  3ESL A;  3MA9 A;  3E08 A;  2LSJ A;  1E1H B;  2X9W A;  3RYI E;  2XU0 A;  5J2U E;  2LSK A;  3GN5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...