4Q25A

Crystal structure of phou from pseudomonas aeruginosa
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
211
structure length
211
Chain Sequence
SQQFNAELEDVRSHLLAMGGLVEKQVNDAVNALIDADSGLAQQVREIDDQINQMERNIDEECVRILARRQPAASDLRLIISISKSVIDLERIGDEASKVARRAIQLCEEGESPRGYVEVRHIGSQVQKMVQEALDAFARFDADLALSVAQYDKTVDREYKTALRELVTYMMEDPRAISRVLNIIWALRSLERIGDHARNIAELVIYLVRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate-specific transport system accessory protein PhoU h
publication title Crystal structure of PhoU from Pseudomonas aeruginosa, a negative regulator of the Pho regulon.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
total genus 106
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A01
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A02
1VCTA 1SUMB 3L39A 2BKNA 1T8BA 2BKPA 4Q25A 2I0MA 1XWMA 2BKOA 2IIUA 2OLTA 1T72A
chains in the Genus database with same CATH superfamily
4YSXA 3KV4A 2XAHB 3TLVA 4H9OC 5AQSB 1ZHCA 2V6YA 3OPCA 5JRCB 4GYRA 4UVAB 1IBKT 1X79A 4OFZA 2MPKA 4LMLA 2K48A 2E8IA 3HKEE 3ZJ2A 2WMOA 3ZT5A 3UFEA 4Z90A 2BS4A 4GKJT 3AVRA 2YDRA 2L8KA 2YN6A 2BG9E 3GA8A 4AKRB 5IYZE 3UU6A 4KP3C 5L4HA 3ONLC 5JVDE 2CWOA 2ZM0A 3JCFA 5JR9C 4QXHB 3I9WA 4ISTA 1NWMX 4UVBB 4LFBT 3CX8B 3ZMUB 5FXWA 4AQGA 2BS2A 3CMLA 4JEUB 3GWHA 4U74A 5DJQC 2LE8A 3AXJB 4YTNA 1H7CA 2PJQA 3U3IA 1XNQT 4UEMA 1W9RA 2VURA 3UUNA 4DV4T 2YOEA 1XDPA 1MNEA 2ES0A 3NKZA 3RF1A 4IE4A 2IAKA 3AEAA 4LFCT 3QNUA 4B3RT 5LJNA 2VKHA 5LA6E 2W00A 2XQ7A 3MZKB 4A5XA 4CXYA 4GKKT 5F5WA 2ZM8A 3P4PA 2EHOD 5ETWA 3F31A 2YDQA 4LMJA 3OYXA 3LJCA 4ZXLA 4DV0T 3F57A 3UUXB 4HWDA 3QB5K 5JR9B 1VCTA 3A7MA 1YQ4A 5H6QB 2E5LT 2FBWA 4X1YE 2N1GA 2X9XA 2KT9A 1W0AA 1CHUA 1IAPA 1YKEB 5ADXL 4HE8A 3IF8B 3P4RA 3CWZB 3QOFA 5HAXA 3RQWA 2RP4A 1B7TA 3SFEA 5FY7A 2K24A 2VWAA 4O2BE 3KBUA 4IHJE 4H9SE 3TKLB 1YKHB 5LGTB 2FJDA 2CXLA 3AEEA 3LSVA 2DNXA 2LKGA 2LSKA 4TNVA 3VKGA 4PJMA 2LHNA 2YEVC 5DQVA 5HEGA 2R6GF 3ONXA 4DV6T 3I0QA 2XHEB 3AE9A 4B3TT 5HXCA 3EHZA 3QUJA 4X62T 5LHIB 3JAEA 3BQKA 3E0ZA 4PAGA 4QHOA 5HYAA 4UIGA 4GYSA 4AISA 2BVMA 3N9OA 2JQHA 2KNDA 2WWVA 3PTRB 3QB5A 2VKDA 3RIUC 4BJNA 3AE4A 4V1Av 2VVSA 5HCJA 3AE8A 4A98A 1MNDA 5LNKA 2WB5A 3UQ4A 3UU3A 2LSJA 4GIWA 2DL1A 3CK6A 2LM2A 2JQKA 2Q9QD 5J2TE 3FZHB 3PJAA 4ZI3D 2XM2A 2CBIA 4EV6A 2VL8A 3Q2MA 3NZQA 2YU2A 4KMCA 5J0ZA 2NR4A 4IE7A 4PJLA 3P8CD 4B3ST 1T8BA 2IIUA 4YY3T 4ZS3A 1XMOT 5AQVB 2KLQA 5HWXA 3VRAA 4EIWA 1LVKA 3KDSE 3RC8A 3GN5A 3PJAJ 3ANWA 4JLEA 5KXJA 3PUYF 2CM0A 4HEAA 4IDNA 2B76A 1LKXA 4KUMB 2V7IA 3HKDE 4CXWA 2KMFA 3AEDA 2D5UA 4H63V 3PUAA 5LBMA 4EXTA 1R8IA 1D1AA 5JRCA 4X5TA 5CA0E 2XTLA 4CI3B 4ISSA 4NXMT 3IHRA 1LRZA 4PJJA 3CX7B 3CQGB 3N9PA 3UUMA 1MMAA 5FL0A 5EZYE 2RPAA 3T1HT 3LG7A 4U2ZA 3SOLA 2WDRA 3FXEB 3OJAA 3ZC1A 2WDQA 4AXPA 5FP3A 1J5WA 3RI5A 4L0RA 1IZNB 2XY8B 4YTPA 3PUVF 3UUBA 2BBJA 4GOUA 4ILUA 5AQOB 3I1AA 1U4QA 4WNKA 2V8SV 2JIWA 2E9XC 3NRYA 4ANJA 3PU8A 1YXRA 2CBJA 4QXCB 4EEBA 1SE7A 2M6BA 1KEYA 4ILAA 1LVFA 4IE0A 4JYAT 2WZIA 5LHHB 2WBLA 3ZT6A 1D0YA 4LF9T 3N2OA 2PBIA 3C64A 5HXSA 1E7PA 1VRBA 2YU1A 3N5LA 1N36T 4DR7T 4HFCA 5AQIB 3ZN0B 3Q5EA 4Z91A 2NTYA 3UU4A 4L9IA 4EB6E 2PG8A 1OEDE 3AEGA 2H89A 3C4XA 1MIYA 3HKCE 1OEDA 3CVRA 4X1IE 1EZ3A 5EK2A 1FIOA 5HEOA 4O8SA 2MYSA 2NW7A 4PK4A 1IBMT 1XNRT 2BZBA 2PFVA 1HCIA 3HR0A 3EUHA 4Z8XA 2V7MA 5LHGB 4AQFA 4HTEA 4COFA 1KK7A 2I0MA 5JR9A 3CX6B 1D1CA 2E9XB 3I0OA 2IHR1 3H3MA 3CPZA 3HKBE 4IE5A 2XZEA 4AKIA 3CQCB 3P4QA 3IA3A 3N9LA 4QH4A 3L8RA 5AQQB 3W15B 3ZKRA 2BKNA 5EK4A 4BJMA 2VB6A 2B1EA 3VR8A 4HFIA 3AA1B 4P0BA 5AQHB 2CA5A 2ZM2A 2DWGA 3AE7A 1IJ6A 4O4IE 5L3GB 2LSYA 2X68A 1D0ZA 2CEAA 4HWCA 2C0SA 2UUCT 3FZMB 2CXDA 2OV9A 3ZJ1A 4GK5E 1G73A 3U78A 1T7SA 5FXXA 4JBWF 2IC9A 3S4UA 4DR1T 2CHNA 3PURA 3ZYKA 4DO0A 5JQGE 2V1DB 3N2GE 3HI2A 1FMWA 4DBQA 3C4ZA 3J7Yq 4HFHA 5JTGA 4YT0A 2E2AA 3RPUA 4ZI7E 3AE6A 1UCUA 2J62A 4WW0A 4TNWA 2XQ3A 4HGAA 4NUVA 2CCQA 4DR3T 2EHOA 5LGNB 2VVNA 3RKOA 1HX8A 2X66A 2A3DA 3UFGA 4C90A 3AA6B 2ZM6T 3ZSTA 4MHCA 2KZ7B 3N2KE 2MBGA 1UK5A 5C2TA 2JQQA 3UU8A 4BAYB 3KFWX 1HTJF 2M6IA 2CRBA 5IWAT 1VCSA 2LSIA 4CZZB 2C5JA 3EDUA 4OYKA 5HWYA 1FMVA 3RHWA 4HFEA 5AQKB 1J5ET 2Y6XA 5ABFB 2MAWA 4O4JE 5AQMB 1MIVA 4I55E 2H88A 5J1GA 4HFVA 5LG4A 4EOZB 2HN2A 3FBZA 4GK0E 2F4VT 2H7VC 1KF6A 4ZZBA 3LK2B 4UF0B 3O1JA 5HEHA 2XSAA 4ZI2C 2NW8A 3OVUA 3UU5A 3RIUA 3TLWA 2X0HA 1YW0A 4J2CA 4YHHT 3ZLIA 4JI4T 5LXTE 3EDVA 3M65A 2CPTA 3KINB 1XMQT 4TWDA 3CIRA 4B3MT 2XSBA 1X9BA 5FNVE 3E08A 3JADA 2CMRA 3V5UA 2BG9C 4H9QC 4OX9T 3GMIA 3PV0F 2ZMAA 4DR6T 4DV1T 2L3LA 2W61A 2JPFA 4PK6A 2WAUA 4LF5T 1IJ5A 5L47A 4MBQA 4X66T 4TWHA 2W63A 3Q5DA 1HNZT 5L3BB 4UVCB 2KWIB 4K0KT 2QYWA 2A2FX 3PUGA 5AQPB 5FL1A 2LJLA 2Q9QA 3L3PA 4IREA 1XWMA 3H37A 2LT3A 4YXDA 2XQAA 4JI7T 1OWAA 2I59A 4QH5A 2WZHA 3G06A 3ABVA 1S94A 3ONJA 3UULA 2N9DA 5DQWA 2Y8DA 4EZ4A 1QSDA 3RYCE 1BR1A 4LMKA 3RIAA 1N34T 4IDQA 2V6YB 3C4WA 4X64T 5JH7E 4ASKA 1HR0T 3SRZA 1BR0A 3C50A 1D1BA 4DV7T 1OXZA 1MMGA 3ETVA 3R84B 5M4YA 3T8OA 3ZCIA 2Y48B 1WYCA 3Q5WA 4AKHA 4WZXA 1J1JA 3E22E 2X9WA 5ABHA 4C91A 3NRXA 3UT5E 2XAGB 2BG9B 2K9AA 5IHYA 2QVAA 1GQEA 4XAXB 1CUNA 3NWIA 3ZMSB 5CGMA 4A97A 3Q9DA 1KFYA 4OHFA 4DR5T 5EK3A 1SA0E 3PU3A 1MMDA 3P7IA 3PUZF 5LBQB 1T72A 3K1SA 2H7OA 4NUUA 4AQYT 2UXCT 3TLUA 5JDFA 4PW8A 2NWBA 3KV6A 2V6XA 2V7LA 1BR4A 3EI0A 4H9NC 2BVLA 3KBTA 4EGWA 3MACA 4PFPA 5LGUB 3R6NA 4DUYT 1YD8G 5J2UE 4QKNA 2V7JA 4CI1B 3K3OA 3RLFF 3DP7A 3K3QC 3TLTA 4KX6A 4E7SA 4I43B 2WU5A 3EABA 3ZEFB 2E9XD 2BKPA 2E5VA 2LHRA 3IBPA 4DNDA 2W0GA 3AE5A 4B6XA 2WSSV 1Y64B 5FXZA 2N2NA 4O2AE 4U7YA 1WR6A 5FYMA 5HXHA 2ACXA 3N9NA 3FBLA 5LMUT 2AE9A 2W62A 3N9QA 4JI8T 1N33T 4DV2T 4NPPA 4PNIA 1ZP0A 5AQJB 3K3NA 2DI4A 1DU2A 2WM9A 3AXJA 4HWIB 2UXNB 3WI3A 2YKSA 3LDQB 2CWYA 4IDZA 5HCMA 5JDLA 2LLYA 4LF8T 1XDOA 2CXFA 2IW5B 4G2AA 1G8XA 5JREA 4UV8B 5F3JA 3ZMTB 4G63A 5ABFA 1I94T 3X1DA 3VR9A 3LBXB 2VKOA 3PUQA 2JQ9A 3L39A 3ZYLA 5L2LA 1L0VA 4AKLA 4IE6A 1ZKEA 1O3XA 4JI5T 2AXDS 1VOMA 4HN9A 3CKDA 2OLTA 3FXDB 5LP6E 1UURA 3C98B 4U2YA 2ZLYA 2HPJA 4DIDB 3V5SA 2WQYA 5HEJA 2NP9A 2VK9A 4QWNB 5FKYA 2ODVA 3EVYA 3C51A 1U5PA 4JUYA 4U72A 3AEBA 2J1DG 3L09A 3O1HA 2UUBT 2J47A 2DCFA 4TV9E 5ABEA 5AQGB 3BK9A 4CN6A 3J9X1 3SFDA 2WY2A 2XAQB 4IDOA 2V26A 2DLRA 3FHNA 2K5BB 2VKJA 2X9HA 4N78D 4X65T 4TN7B 5JDNA 3KV5A 3AE3A 1Z8UA 2ACZA 4JEHB 4O4LE 3ANWB 4DV5T 2CLYC 2FJAA 1N32T 1SHZC 2XASB 3ZMZB 1UUSA 3JC6C 5LJMA 4NXNT 3T1YT 2V5DA 3BQIA 5LB7B 4ILBA 1JNZA 3Q5XA 1Y01A 4P0AA 1UX4A 5L3DB 4ZHQE 3QC9A 3RRWA 4HFDA 1OEDC 1XZYA 4CN1A 2X0YA 4DMVA 4MLKA 3AA7B 3ZN1B 3JAFA 4IGUA 4TX5A 2UXDT 1MIWA 3MK7C 1BR2A 1FEWA 5L3FB 1HNXT 4A56A 4HKAA 2BG9A 4MFRA 3LK3B 4U3CA 4FJOA 4EAHA 4AQFC 5FMNA 2IDOB 2KINB 2L9QA 4HWHA 4ERRA 5L4EA 3UQ7A 1ZEEA 4KBMB 2HHHT 4YHJA 3O4XE 5CJ5A 5FVKA 3K8PC 2BKOA 3TLSA 2JMHA 2UUAT 5HXRA 4PJNA 4IT4A 2W2UA 3LFMA 4TV8E 2WP9A 2CLYB 5BMVE 3PE0A 4ZOLE 4X1KE 2SPCA 5GONE 4EEDA 3B5MA 4ZI2D 5FY1A 3VU7H 2G0UA 3OYZA 4JI3T 4UR9A 3ZPOA 4ILCA 2JJ9A 3OKQA 3AAAB 3A5XA 2OA5A 1OEDB 3VHLA 2LEHA 4JI2T 5LCYA 2FJEA 2W67A 4WBOA 2XAJB 3KVBA 3FZFB 3KV9A 2UXBT 3SWHA 3PUWF 3RGLA 4KHPT 2XPKA 3AECA 2C5IT 5CA1E 2I6HA 5AQTB 3M3ZB 2X51A 2WCAA 2CE7A 2VQFT 4IL9A 4TZ4C 2V7KA 5TAOA 4H63H 3RYFE 4IL4A 5FVLA 4O4HE 3NZPA 3F2EA 2EHOC 4MALA 2LRLA 1SUMB 3VKHA 1KNRA 4IDPA 3DJBA 4H9PC 2X0LB 1HF8A 4JV5T 5KMGP 5BR8T 1V9DA 1US7B 4YJ3E 4I4TE 4OK0A 2WU2A 3FB2A 5CB4E 4KHZF 5JDGA 5E0OA 3B13A 4TUYE 2X67A 5LMNT 2KSRA 5C8YE 4DV3T 2LSGA 1WYBA 5KX5E 5C3JA 5AQRB 1IBLT 4CXXA 5HEUA 2BS3A 3I9YA 4QX8B 2KWHA 2D0TA 2XQ5A 3PUXF 3AB3B 2A72A 3PUSA 1KNPA 1WCRA 1WFDA 3LBXA 4LF6T 3AEFA 2HN1A 5AQLB 2KXPB 1UGOA 5AQUB 4JI0T 2QRXA 2W66A 3A8YC 4JI1T 1NEKA 1W09A 1HG5A 4I50E 2WS3A 3P4WA 4YLHA 4U7IA 2XQYA 5FXVA 3MXZA 5IUXA 2ODUA 2DWKA 2EHOB 4YJ2E 3AAIA 1NAFA 4YSYA 4U31A 4WBNE 2E9XA 2J4GA 4PFOA 3FZKB 5A1LA 1KNZA 1NENA 2YDSA 2K3WA 4ZZCA 3AA0B 4ADZA 2D9DA 2PTFA 3ZSSA 3AE2A 4JI6T 4UV9B 3AE1A 4F8HA 1ZV4X 4TWFA 4NIQA 4DR4T 2IMLA 2VQET 3D0TA 2NOXA 1FJGT 4LF4T 3RKGA 5AQFB 1QLBA 1MMNA 5KDMC 4HFBA 4QH1A 2Q9QC 3LK42 1E1HB 2XJ7A 2D2SA 4ZI3C 4AKGA 2M67A 2LKHA 2GK9A 4EYUA 5JDMA 5ABGA 3VRBA 4EYYR 3RRCA 4IIJE 5JDHA 4YTMA 5LOVE 2A9UA 4ZEYA 1WRDA 4DR2T 5FY0A 2YK0A 4CN4A 2LOPA 5DABA 1HX1B 2QA7A 4I0UA 3FZLB 1I6ZA 3H3AA 4LFAT 1Z0PA 3RX6A 2WWUA 4HWFA 2LM9A 3KVAA 4WYVA 3HA4A 3ETUA 3ZCJA 5H6RB 2WMNA 3ZC0A 2QGSA 3HL6A 2FJBA 4CI2B 4QXBB 3O1IA 2XQ6A 3B57A 5CFBA 3OBVE 3RYHE 3MKDA 1M62A 3UTKA 5LG3A 1D0XA 5HXEA 3NBXX 3P50A 1W0BA 4EZHA 2X9YA 2XM1A 2LRKA 4E7ZA 4X20E 2HPLA 3AVSA 3RQUA 3SS1A 2H3RA 2RA1A 1E2AA 1WLXA 2VASA 4FI5A 2Q9QB 2DHRA 2XAFB 3IEEA 4M1PA 4XBFB 4AIUA 3P4SA 2XQ4A 5F8PA 4XZCA 2BDEA 2WDVA 3N9MA 2XQ9A 3ZMVB 4DMWA 4CQIA 4YSZA 1T98A 4AI6A 2NTXA 1M7KA 3CQXC 1ZOYA 2XQ8A 2Z6EA 1HNWT 1HG2A 4UELA 4KI0F 4ZS2A 2IUBA 2VL0A 4UF0A 5LYJE 2CHOA 4OYJA 2JRKA 1QUUA 4K0UA 3AAEB 1HS7A 3DTOA 2IC6A 2LOSA 3ZT7A 2MTQA 1HFAA 2JMKA 3MA9A 3ZYMA 3OTOT 3RYIE 5AFUL 3EAMA 3WAKA 4U33A 5L3CB 3WAJA 1WR0A 4H9RC 4DUZT 3ESLA 3O9XA 4PK5A 3RH3A 2UU9T 2MOZA 5AQNB 4LF7T 1S35A 4L5GA 2XUEA 4P09A 4F6RC 3RC3A 1UX5A 3PDYA 4BA9A 1AJ3A 4DBRA 4QX7B 3JC6D 2P9BA 3MJXA 2C5KT 2HH7A 5JDQA 2D0UA 3QK6A 3GN5B 4DVDA 2V5CA 2FUPA 2YINA 5L3EB 2BBHA 4Q25A 4P1NA 2W4XA 2UXXB 3NVOA 4YFSA 2NW9A 1YQ3A 3BQLA 1JNRA 3RIFA 4UXNB
chains in the Genus database with same CATH topology
1VCTA 1SUMB 3L39A 2BKNA 1T8BA 2BKPA 4Q25A 2I0MA 1XWMA 2BKOA 2IIUA 2OLTA 1T72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCT A;  1SUM B;  3L39 A;  2BKN A;  1T8B A;  2BKP A;  4Q25 A;  2I0M A;  1XWM A;  2BKO A;  2IIU A;  2OLT A;  1T72 A; 
#chains in the Genus database with same CATH topology
 4YSX A;  3KV4 A;  2XAH B;  3TLV A;  4H9O C;  5AQS B;  1ZHC A;  2V6Y A;  3OPC A;  5JRC B;  4GYR A;  4UVA B;  1IBK T;  1X79 A;  4OFZ A;  2MPK A;  4LML A;  2K48 A;  2E8I A;  3HKE E;  3ZJ2 A;  2WMO A;  3ZT5 A;  3UFE A;  4Z90 A;  2BS4 A;  4GKJ T;  3AVR A;  2YDR A;  2L8K A;  2YN6 A;  2BG9 E;  3GA8 A;  4AKR B;  5IYZ E;  3UU6 A;  4KP3 C;  5L4H A;  3ONL C;  5JVD E;  2CWO A;  2ZM0 A;  3JCF A;  5JR9 C;  4QXH B;  3I9W A;  4IST A;  1NWM X;  4UVB B;  4LFB T;  3CX8 B;  3ZMU B;  5FXW A;  4AQG A;  2BS2 A;  3CML A;  4JEU B;  3GWH A;  4U74 A;  5DJQ C;  2LE8 A;  3AXJ B;  4YTN A;  1H7C A;  2PJQ A;  3U3I A;  1XNQ T;  4UEM A;  1W9R A;  2VUR A;  3UUN A;  4DV4 T;  2YOE A;  1XDP A;  1MNE A;  2ES0 A;  3NKZ A;  3RF1 A;  4IE4 A;  2IAK A;  3AEA A;  4LFC T;  3QNU A;  4B3R T;  5LJN A;  2VKH A;  5LA6 E;  2W00 A;  2XQ7 A;  3MZK B;  4A5X A;  4CXY A;  4GKK T;  5F5W A;  2ZM8 A;  3P4P A;  2EHO D;  5ETW A;  3F31 A;  2YDQ A;  4LMJ A;  3OYX A;  3LJC A;  4ZXL A;  4DV0 T;  3F57 A;  3UUX B;  4HWD A;  3QB5 K;  5JR9 B;  1VCT A;  3A7M A;  1YQ4 A;  5H6Q B;  2E5L T;  2FBW A;  4X1Y E;  2N1G A;  2X9X A;  2KT9 A;  1W0A A;  1CHU A;  1IAP A;  1YKE B;  5ADX L;  4HE8 A;  3IF8 B;  3P4R A;  3CWZ B;  3QOF A;  5HAX A;  3RQW A;  2RP4 A;  1B7T A;  3SFE A;  5FY7 A;  2K24 A;  2VWA A;  4O2B E;  3KBU A;  4IHJ E;  4H9S E;  3TKL B;  1YKH B;  5LGT B;  2FJD A;  2CXL A;  3AEE A;  3LSV A;  2DNX A;  2LKG A;  2LSK A;  4TNV A;  3VKG A;  4PJM A;  2LHN A;  2YEV C;  5DQV A;  5HEG A;  2R6G F;  3ONX A;  4DV6 T;  3I0Q A;  2XHE B;  3AE9 A;  4B3T T;  5HXC A;  3EHZ A;  3QUJ A;  4X62 T;  5LHI B;  3JAE A;  3BQK A;  3E0Z A;  4PAG A;  4QHO A;  5HYA A;  4UIG A;  4GYS A;  4AIS A;  2BVM A;  3N9O A;  2JQH A;  2KND A;  2WWV A;  3PTR B;  3QB5 A;  2VKD A;  3RIU C;  4BJN A;  3AE4 A;  4V1A v;  2VVS A;  5HCJ A;  3AE8 A;  4A98 A;  1MND A;  5LNK A;  2WB5 A;  3UQ4 A;  3UU3 A;  2LSJ A;  4GIW A;  2DL1 A;  3CK6 A;  2LM2 A;  2JQK A;  2Q9Q D;  5J2T E;  3FZH B;  3PJA A;  4ZI3 D;  2XM2 A;  2CBI A;  4EV6 A;  2VL8 A;  3Q2M A;  3NZQ A;  2YU2 A;  4KMC A;  5J0Z A;  2NR4 A;  4IE7 A;  4PJL A;  3P8C D;  4B3S T;  1T8B A;  2IIU A;  4YY3 T;  4ZS3 A;  1XMO T;  5AQV B;  2KLQ A;  5HWX A;  3VRA A;  4EIW A;  1LVK A;  3KDS E;  3RC8 A;  3GN5 A;  3PJA J;  3ANW A;  4JLE A;  5KXJ A;  3PUY F;  2CM0 A;  4HEA A;  4IDN A;  2B76 A;  1LKX A;  4KUM B;  2V7I A;  3HKD E;  4CXW A;  2KMF A;  3AED A;  2D5U A;  4H63 V;  3PUA A;  5LBM A;  4EXT A;  1R8I A;  1D1A A;  5JRC A;  4X5T A;  5CA0 E;  2XTL A;  4CI3 B;  4ISS A;  4NXM T;  3IHR A;  1LRZ A;  4PJJ A;  3CX7 B;  3CQG B;  3N9P A;  3UUM A;  1MMA A;  5FL0 A;  5EZY E;  2RPA A;  3T1H T;  3LG7 A;  4U2Z A;  3SOL A;  2WDR A;  3FXE B;  3OJA A;  3ZC1 A;  2WDQ A;  4AXP A;  5FP3 A;  1J5W A;  3RI5 A;  4L0R A;  1IZN B;  2XY8 B;  4YTP A;  3PUV F;  3UUB A;  2BBJ A;  4GOU A;  4ILU A;  5AQO B;  3I1A A;  1U4Q A;  4WNK A;  2V8S V;  2JIW A;  2E9X C;  3NRY A;  4ANJ A;  3PU8 A;  1YXR A;  2CBJ A;  4QXC B;  4EEB A;  1SE7 A;  2M6B A;  1KEY A;  4ILA A;  1LVF A;  4IE0 A;  4JYA T;  2WZI A;  5LHH B;  2WBL A;  3ZT6 A;  1D0Y A;  4LF9 T;  3N2O A;  2PBI A;  3C64 A;  5HXS A;  1E7P A;  1VRB A;  2YU1 A;  3N5L A;  1N36 T;  4DR7 T;  4HFC A;  5AQI B;  3ZN0 B;  3Q5E A;  4Z91 A;  2NTY A;  3UU4 A;  4L9I A;  4EB6 E;  2PG8 A;  1OED E;  3AEG A;  2H89 A;  3C4X A;  1MIY A;  3HKC E;  1OED A;  3CVR A;  4X1I E;  1EZ3 A;  5EK2 A;  1FIO A;  5HEO A;  4O8S A;  2MYS A;  2NW7 A;  4PK4 A;  1IBM T;  1XNR T;  2BZB A;  2PFV A;  1HCI A;  3HR0 A;  3EUH A;  4Z8X A;  2V7M A;  5LHG B;  4AQF A;  4HTE A;  4COF A;  1KK7 A;  2I0M A;  5JR9 A;  3CX6 B;  1D1C A;  2E9X B;  3I0O A;  2IHR 1;  3H3M A;  3CPZ A;  3HKB E;  4IE5 A;  2XZE A;  4AKI A;  3CQC B;  3P4Q A;  3IA3 A;  3N9L A;  4QH4 A;  3L8R A;  5AQQ B;  3W15 B;  3ZKR A;  2BKN A;  5EK4 A;  4BJM A;  2VB6 A;  2B1E A;  3VR8 A;  4HFI A;  3AA1 B;  4P0B A;  5AQH B;  2CA5 A;  2ZM2 A;  2DWG A;  3AE7 A;  1IJ6 A;  4O4I E;  5L3G B;  2LSY A;  2X68 A;  1D0Z A;  2CEA A;  4HWC A;  2C0S A;  2UUC T;  3FZM B;  2CXD A;  2OV9 A;  3ZJ1 A;  4GK5 E;  1G73 A;  3U78 A;  1T7S A;  5FXX A;  4JBW F;  2IC9 A;  3S4U A;  4DR1 T;  2CHN A;  3PUR A;  3ZYK A;  4DO0 A;  5JQG E;  2V1D B;  3N2G E;  3HI2 A;  1FMW A;  4DBQ A;  3C4Z A;  3J7Y q;  4HFH A;  5JTG A;  4YT0 A;  2E2A A;  3RPU A;  4ZI7 E;  3AE6 A;  1UCU A;  2J62 A;  4WW0 A;  4TNW A;  2XQ3 A;  4HGA A;  4NUV A;  2CCQ A;  4DR3 T;  2EHO A;  5LGN B;  2VVN A;  3RKO A;  1HX8 A;  2X66 A;  2A3D A;  3UFG A;  4C90 A;  3AA6 B;  2ZM6 T;  3ZST A;  4MHC A;  2KZ7 B;  3N2K E;  2MBG A;  1UK5 A;  5C2T A;  2JQQ A;  3UU8 A;  4BAY B;  3KFW X;  1HTJ F;  2M6I A;  2CRB A;  5IWA T;  1VCS A;  2LSI A;  4CZZ B;  2C5J A;  3EDU A;  4OYK A;  5HWY A;  1FMV A;  3RHW A;  4HFE A;  5AQK B;  1J5E T;  2Y6X A;  5ABF B;  2MAW A;  4O4J E;  5AQM B;  1MIV A;  4I55 E;  2H88 A;  5J1G A;  4HFV A;  5LG4 A;  4EOZ B;  2HN2 A;  3FBZ A;  4GK0 E;  2F4V T;  2H7V C;  1KF6 A;  4ZZB A;  3LK2 B;  4UF0 B;  3O1J A;  5HEH A;  2XSA A;  4ZI2 C;  2NW8 A;  3OVU A;  3UU5 A;  3RIU A;  3TLW A;  2X0H A;  1YW0 A;  4J2C A;  4YHH T;  3ZLI A;  4JI4 T;  5LXT E;  3EDV A;  3M65 A;  2CPT A;  3KIN B;  1XMQ T;  4TWD A;  3CIR A;  4B3M T;  2XSB A;  1X9B A;  5FNV E;  3E08 A;  3JAD A;  2CMR A;  3V5U A;  2BG9 C;  4H9Q C;  4OX9 T;  3GMI A;  3PV0 F;  2ZMA A;  4DR6 T;  4DV1 T;  2L3L A;  2W61 A;  2JPF A;  4PK6 A;  2WAU A;  4LF5 T;  1IJ5 A;  5L47 A;  4MBQ A;  4X66 T;  4TWH A;  2W63 A;  3Q5D A;  1HNZ T;  5L3B B;  4UVC B;  2KWI B;  4K0K T;  2QYW A;  2A2F X;  3PUG A;  5AQP B;  5FL1 A;  2LJL A;  2Q9Q A;  3L3P A;  4IRE A;  1XWM A;  3H37 A;  2LT3 A;  4YXD A;  2XQA A;  4JI7 T;  1OWA A;  2I59 A;  4QH5 A;  2WZH A;  3G06 A;  3ABV A;  1S94 A;  3ONJ A;  3UUL A;  2N9D A;  5DQW A;  2Y8D A;  4EZ4 A;  1QSD A;  3RYC E;  1BR1 A;  4LMK A;  3RIA A;  1N34 T;  4IDQ A;  2V6Y B;  3C4W A;  4X64 T;  5JH7 E;  4ASK A;  1HR0 T;  3SRZ A;  1BR0 A;  3C50 A;  1D1B A;  4DV7 T;  1OXZ A;  1MMG A;  3ETV A;  3R84 B;  5M4Y A;  3T8O A;  3ZCI A;  2Y48 B;  1WYC A;  3Q5W A;  4AKH A;  4WZX A;  1J1J A;  3E22 E;  2X9W A;  5ABH A;  4C91 A;  3NRX A;  3UT5 E;  2XAG B;  2BG9 B;  2K9A A;  5IHY A;  2QVA A;  1GQE A;  4XAX B;  1CUN A;  3NWI A;  3ZMS B;  5CGM A;  4A97 A;  3Q9D A;  1KFY A;  4OHF A;  4DR5 T;  5EK3 A;  1SA0 E;  3PU3 A;  1MMD A;  3P7I A;  3PUZ F;  5LBQ B;  1T72 A;  3K1S A;  2H7O A;  4NUU A;  4AQY T;  2UXC T;  3TLU A;  5JDF A;  4PW8 A;  2NWB A;  3KV6 A;  2V6X A;  2V7L A;  1BR4 A;  3EI0 A;  4H9N C;  2BVL A;  3KBT A;  4EGW A;  3MAC A;  4PFP A;  5LGU B;  3R6N A;  4DUY T;  1YD8 G;  5J2U E;  4QKN A;  2V7J A;  4CI1 B;  3K3O A;  3RLF F;  3DP7 A;  3K3Q C;  3TLT A;  4KX6 A;  4E7S A;  4I43 B;  2WU5 A;  3EAB A;  3ZEF B;  2E9X D;  2BKP A;  2E5V A;  2LHR A;  3IBP A;  4DND A;  2W0G A;  3AE5 A;  4B6X A;  2WSS V;  1Y64 B;  5FXZ A;  2N2N A;  4O2A E;  4U7Y A;  1WR6 A;  5FYM A;  5HXH A;  2ACX A;  3N9N A;  3FBL A;  5LMU T;  2AE9 A;  2W62 A;  3N9Q A;  4JI8 T;  1N33 T;  4DV2 T;  4NPP A;  4PNI A;  1ZP0 A;  5AQJ B;  3K3N A;  2DI4 A;  1DU2 A;  2WM9 A;  3AXJ A;  4HWI B;  2UXN B;  3WI3 A;  2YKS A;  3LDQ B;  2CWY A;  4IDZ A;  5HCM A;  5JDL A;  2LLY A;  4LF8 T;  1XDO A;  2CXF A;  2IW5 B;  4G2A A;  1G8X A;  5JRE A;  4UV8 B;  5F3J A;  3ZMT B;  4G63 A;  5ABF A;  1I94 T;  3X1D A;  3VR9 A;  3LBX B;  2VKO A;  3PUQ A;  2JQ9 A;  3L39 A;  3ZYL A;  5L2L A;  1L0V A;  4AKL A;  4IE6 A;  1ZKE A;  1O3X A;  4JI5 T;  2AXD S;  1VOM A;  4HN9 A;  3CKD A;  2OLT A;  3FXD B;  5LP6 E;  1UUR A;  3C98 B;  4U2Y A;  2ZLY A;  2HPJ A;  4DID B;  3V5S A;  2WQY A;  5HEJ A;  2NP9 A;  2VK9 A;  4QWN B;  5FKY A;  2ODV A;  3EVY A;  3C51 A;  1U5P A;  4JUY A;  4U72 A;  3AEB A;  2J1D G;  3L09 A;  3O1H A;  2UUB T;  2J47 A;  2DCF A;  4TV9 E;  5ABE A;  5AQG B;  3BK9 A;  4CN6 A;  3J9X 1;  3SFD A;  2WY2 A;  2XAQ B;  4IDO A;  2V26 A;  2DLR A;  3FHN A;  2K5B B;  2VKJ A;  2X9H A;  4N78 D;  4X65 T;  4TN7 B;  5JDN A;  3KV5 A;  3AE3 A;  1Z8U A;  2ACZ A;  4JEH B;  4O4L E;  3ANW B;  4DV5 T;  2CLY C;  2FJA A;  1N32 T;  1SHZ C;  2XAS B;  3ZMZ B;  1UUS A;  3JC6 C;  5LJM A;  4NXN T;  3T1Y T;  2V5D A;  3BQI A;  5LB7 B;  4ILB A;  1JNZ A;  3Q5X A;  1Y01 A;  4P0A A;  1UX4 A;  5L3D B;  4ZHQ E;  3QC9 A;  3RRW A;  4HFD A;  1OED C;  1XZY A;  4CN1 A;  2X0Y A;  4DMV A;  4MLK A;  3AA7 B;  3ZN1 B;  3JAF A;  4IGU A;  4TX5 A;  2UXD T;  1MIW A;  3MK7 C;  1BR2 A;  1FEW A;  5L3F B;  1HNX T;  4A56 A;  4HKA A;  2BG9 A;  4MFR A;  3LK3 B;  4U3C A;  4FJO A;  4EAH A;  4AQF C;  5FMN A;  2IDO B;  2KIN B;  2L9Q A;  4HWH A;  4ERR A;  5L4E A;  3UQ7 A;  1ZEE A;  4KBM B;  2HHH T;  4YHJ A;  3O4X E;  5CJ5 A;  5FVK A;  3K8P C;  2BKO A;  3TLS A;  2JMH A;  2UUA T;  5HXR A;  4PJN A;  4IT4 A;  2W2U A;  3LFM A;  4TV8 E;  2WP9 A;  2CLY B;  5BMV E;  3PE0 A;  4ZOL E;  4X1K E;  2SPC A;  5GON E;  4EED A;  3B5M A;  4ZI2 D;  5FY1 A;  3VU7 H;  2G0U A;  3OYZ A;  4JI3 T;  4UR9 A;  3ZPO A;  4ILC A;  2JJ9 A;  3OKQ A;  3AAA B;  3A5X A;  2OA5 A;  1OED B;  3VHL A;  2LEH A;  4JI2 T;  5LCY A;  2FJE A;  2W67 A;  4WBO A;  2XAJ B;  3KVB A;  3FZF B;  3KV9 A;  2UXB T;  3SWH A;  3PUW F;  3RGL A;  4KHP T;  2XPK A;  3AEC A;  2C5I T;  5CA1 E;  2I6H A;  5AQT B;  3M3Z B;  2X51 A;  2WCA A;  2CE7 A;  2VQF T;  4IL9 A;  4TZ4 C;  2V7K A;  5TAO A;  4H63 H;  3RYF E;  4IL4 A;  5FVL A;  4O4H E;  3NZP A;  3F2E A;  2EHO C;  4MAL A;  2LRL A;  1SUM B;  3VKH A;  1KNR A;  4IDP A;  3DJB A;  4H9P C;  2X0L B;  1HF8 A;  4JV5 T;  5KMG P;  5BR8 T;  1V9D A;  1US7 B;  4YJ3 E;  4I4T E;  4OK0 A;  2WU2 A;  3FB2 A;  5CB4 E;  4KHZ F;  5JDG A;  5E0O A;  3B13 A;  4TUY E;  2X67 A;  5LMN T;  2KSR A;  5C8Y E;  4DV3 T;  2LSG A;  1WYB A;  5KX5 E;  5C3J A;  5AQR B;  1IBL T;  4CXX A;  5HEU A;  2BS3 A;  3I9Y A;  4QX8 B;  2KWH A;  2D0T A;  2XQ5 A;  3PUX F;  3AB3 B;  2A72 A;  3PUS A;  1KNP A;  1WCR A;  1WFD A;  3LBX A;  4LF6 T;  3AEF A;  2HN1 A;  5AQL B;  2KXP B;  1UGO A;  5AQU B;  4JI0 T;  2QRX A;  2W66 A;  3A8Y C;  4JI1 T;  1NEK A;  1W09 A;  1HG5 A;  4I50 E;  2WS3 A;  3P4W A;  4YLH A;  4U7I A;  2XQY A;  5FXV A;  3MXZ A;  5IUX A;  2ODU A;  2DWK A;  2EHO B;  4YJ2 E;  3AAI A;  1NAF A;  4YSY A;  4U31 A;  4WBN E;  2E9X A;  2J4G A;  4PFO A;  3FZK B;  5A1L A;  1KNZ A;  1NEN A;  2YDS A;  2K3W A;  4ZZC A;  3AA0 B;  4ADZ A;  2D9D A;  2PTF A;  3ZSS A;  3AE2 A;  4JI6 T;  4UV9 B;  3AE1 A;  4F8H A;  1ZV4 X;  4TWF A;  4NIQ A;  4DR4 T;  2IML A;  2VQE T;  3D0T A;  2NOX A;  1FJG T;  4LF4 T;  3RKG A;  5AQF B;  1QLB A;  1MMN A;  5KDM C;  4HFB A;  4QH1 A;  2Q9Q C;  3LK4 2;  1E1H B;  2XJ7 A;  2D2S A;  4ZI3 C;  4AKG A;  2M67 A;  2LKH A;  2GK9 A;  4EYU A;  5JDM A;  5ABG A;  3VRB A;  4EYY R;  3RRC A;  4IIJ E;  5JDH A;  4YTM A;  5LOV E;  2A9U A;  4ZEY A;  1WRD A;  4DR2 T;  5FY0 A;  2YK0 A;  4CN4 A;  2LOP A;  5DAB A;  1HX1 B;  2QA7 A;  4I0U A;  3FZL B;  1I6Z A;  3H3A A;  4LFA T;  1Z0P A;  3RX6 A;  2WWU A;  4HWF A;  2LM9 A;  3KVA A;  4WYV A;  3HA4 A;  3ETU A;  3ZCJ A;  5H6R B;  2WMN A;  3ZC0 A;  2QGS A;  3HL6 A;  2FJB A;  4CI2 B;  4QXB B;  3O1I A;  2XQ6 A;  3B57 A;  5CFB A;  3OBV E;  3RYH E;  3MKD A;  1M62 A;  3UTK A;  5LG3 A;  1D0X A;  5HXE A;  3NBX X;  3P50 A;  1W0B A;  4EZH A;  2X9Y A;  2XM1 A;  2LRK A;  4E7Z A;  4X20 E;  2HPL A;  3AVS A;  3RQU A;  3SS1 A;  2H3R A;  2RA1 A;  1E2A A;  1WLX A;  2VAS A;  4FI5 A;  2Q9Q B;  2DHR A;  2XAF B;  3IEE A;  4M1P A;  4XBF B;  4AIU A;  3P4S A;  2XQ4 A;  5F8P A;  4XZC A;  2BDE A;  2WDV A;  3N9M A;  2XQ9 A;  3ZMV B;  4DMW A;  4CQI A;  4YSZ A;  1T98 A;  4AI6 A;  2NTX A;  1M7K A;  3CQX C;  1ZOY A;  2XQ8 A;  2Z6E A;  1HNW T;  1HG2 A;  4UEL A;  4KI0 F;  4ZS2 A;  2IUB A;  2VL0 A;  4UF0 A;  5LYJ E;  2CHO A;  4OYJ A;  2JRK A;  1QUU A;  4K0U A;  3AAE B;  1HS7 A;  3DTO A;  2IC6 A;  2LOS A;  3ZT7 A;  2MTQ A;  1HFA A;  2JMK A;  3MA9 A;  3ZYM A;  3OTO T;  3RYI E;  5AFU L;  3EAM A;  3WAK A;  4U33 A;  5L3C B;  3WAJ A;  1WR0 A;  4H9R C;  4DUZ T;  3ESL A;  3O9X A;  4PK5 A;  3RH3 A;  2UU9 T;  2MOZ A;  5AQN B;  4LF7 T;  1S35 A;  4L5G A;  2XUE A;  4P09 A;  4F6R C;  3RC3 A;  1UX5 A;  3PDY A;  4BA9 A;  1AJ3 A;  4DBR A;  4QX7 B;  3JC6 D;  2P9B A;  3MJX A;  2C5K T;  2HH7 A;  5JDQ A;  2D0U A;  3QK6 A;  3GN5 B;  4DVD A;  2V5C A;  2FUP A;  2YIN A;  5L3E B;  2BBH A;  4Q25 A;  4P1N A;  2W4X A;  2UXX B;  3NVO A;  4YFS A;  2NW9 A;  1YQ3 A;  3BQL A;  1JNR A;  3RIF A;  4UXN B; 
#chains in the Genus database with same CATH homology
 1VCT A;  1SUM B;  3L39 A;  2BKN A;  1T8B A;  2BKP A;  4Q25 A;  2I0M A;  1XWM A;  2BKO A;  2IIU A;  2OLT A;  1T72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...