4Q25A

Crystal structure of phou from pseudomonas aeruginosa
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
211
structure length
211
Chain Sequence
SQQFNAELEDVRSHLLAMGGLVEKQVNDAVNALIDADSGLAQQVREIDDQINQMERNIDEECVRILARRQPAASDLRLIISISKSVIDLERIGDEASKVARRAIQLCEEGESPRGYVEVRHIGSQVQKMVQEALDAFARFDADLALSVAQYDKTVDREYKTALRELVTYMMEDPRAISRVLNIIWALRSLERIGDHARNIAELVIYLVRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate-specific transport system accessory protein PhoU h
publication title Crystal structure of PhoU from Pseudomonas aeruginosa, a negative regulator of the Pho regulon.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
total genus 106
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A01
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A02
4Q25A 1T72A 2I0MA 1XWMA 1T8BA 2BKPA 2BKNA 2OLTA 1VCTA 1SUMB 2BKOA 2IIUA 3L39A
chains in the Genus database with same CATH superfamily
2LSKA 3O9XA 4YLHA 1LKXA 3AVRA 4K0UA 3Q5WA 4JI2T 4AXPA 4A5XA 4K0KT 3VRAA 2C5IT 4DV1T 2CPTA 5FVLA 1Y64B 3CK6A 4CN4A 3HL6A 4C90A 4DR1T 3LG7A 3ZC0A 4O4JE 5HEOA 4P0BA 4JYAT 3P4SA 4TWHA 3MZKB 1OEDB 2YKSA 4EZ4A 4LMLA 3FZHB 3CX6B 4UR9A 5C2TA 2DLRA 1QLBA 3AE5A 4DV7T 3N9QA 3UU5A 2Q9QC 2H7OA 4ZI2C 3RQWA 1I6ZA 2EHOB 3D0TA 4WYVA 4O8SA 5FP3A 2K9AA 3AE6A 3PUSA 3IHRA 3AEBA 4YJ2E 2JMKA 5HEUA 2WZIA 2JRKA 2D2SA 3W15B 2BG9C 3VRBA 2A2FX 3LDQB 1D1CA 1YQ3A 5LBMA 4U72A 1MIWA 4JI3T 3AECA 1M62A 1MIVA 3RQUA 5LJNA 3KBTA 4QHOA 3ZT6A 5JH7E 2DL1A 1UCUA 2X0YA 3QNUA 3RYHE 3J7Yq 4CI2B 5AQGB 3LBXA 5FYMA 3JAEA 2XAHB 1IZNB 2WDQA 2X9HA 2A3DA 2CWOA 3Q5XA 1DU2A 4EGWA 4QX7B 5IUXA 4DV4T 3B13A 2YDRA 3ONJA 2B1EA 4U74A 2ZM0A 4LF7T 4IHJE 3PDYA 3UU4A 1B7TA 3LK3B 5HEGA 1E7PA 4OK0A 5ABFA 2E9XB 3RC8A 2KZ7B 4UXNB 3MKDA 3ANWA 4O4HE 4HFBA 4Z90A 2W4XA 5LCYA 2WS3A 4KBMB 4X1IE 1FIOA 3ZPOA 1LRZA 1YKHB 3P4QA 4DV5T 4DR5T 2EHOC 1XNRT 2V6YB 5LNKA 2K48A 4O2BE 2BG9E 2FJDA 1G73A 3KVBA 2MPKA 2XJ7A 4UF0A 2XZEA 4LMJA 4HKAA 4OYKA 3UUBA 1HG2A 3DP7A 3BK9A 4A98A 4HEAA 4YSXA 2CXLA 2ES0A 5JDFA 3F31A 2YDQA 2ZM6T 5JR9A 2LLYA 3L09A 2XTLA 3HKEE 4YJ3E 1KFYA 2BS2A 2VQFT 2JJ9A 5ABEA 3PUAA 4U2ZA 2Y8DA 4NXNT 5AQLB 3HA4A 1WCRA 4ZS2A 4U31A 1FJGT 3PTRB 4LMKA 3ZMSB 4HFEA 3ONXA 1SHZC 5J0ZA 3I0OA 4LF6T 2LKHA 3PJAJ 1Z0PA 2DWKA 3TLSA 3M65A 3UT5E 2V1DB 4F8HA 3O1JA 4BAYB 3OYZA 2UXDT 4TV9E 3CKDA 5H6RB 2XHEB 3NRXA 3EAMA 5E0OA 2W63A 4AQFA 5L3GB 4CXXA 4YFSA 2CWYA 2V5CA 2ZLYA 4ILBA 5HXHA 4JI6T 3N2OA 3LK2B 3A8YC 5CJ5A 1AJ3A 4AQGA 1OXZA 2RPAA 4H63V 4AI6A 2MBGA 3SFEA 4H9QC 3GA8A 4E7SA 1NWMX 1HS7A 3RLFF 3PJAA 1N32T 3CMLA 2WQYA 4WZXA 5HEHA 3QB5K 4B6XA 4H63H 4XBFB 1D0XA 4LFAT 4JLEA 4IDQA 4IL4A 4DR2T 5AQFB 2NW8A 1WYBA 1MMAA 2WM9A 3FBZA 2CRBA 1E1HB 1YW0A 5LYJE 2W62A 2V7IA 2VK9A 5ABFB 3RIFA 1V9DA 2LKGA 1O3XA 3ANWB 3EHZA 4PNIA 5LP6E 2L9QA 2QVAA 5LGTB 1IBMT 2X66A 4QXBB 5F5WA 4DO0A 4P0AA 2XQ5A 4EOZB 1KK7A 4JI1T 4IE6A 4CXYA 2NOXA 4U33A 4B3RT 2X9YA 1VCSA 3A5XA 3ZN0B 2WAUA 4JBWF 5BMVE 5HAXA 4I0UA 3RYFE 2Y48B 3SRZA 2ACZA 4DV2T 2H7VC 2UUAT 3JC6C 2I6HA 2BKNA 1YD8G 2VVNA 4GYSA 4EYUA 4UF0B 1L0VA 1W09A 3ZMVB 2LM9A 5LMUT 1UX5A 3L8RA 1MNEA 2BS3A 5KMGP 1US7B 5JR9B 2IC9A 3MXZA 4H9RC 1N34T 2JIWA 4YHHT 2MAWA 1D0ZA 1FMVA 3N9LA 4ZI3D 3ESLA 2W66A 2BVMA 4CI1B 2CXDA 4X66T 5FY0A 1HR0T 3I9YA 5IYZE 3P4PA 4UVAB 4TUYE 3PU3A 3H3MA 2YK0A 5H6QB 3B5MA 4ERRA 2K5BB 4Q25A 5EK3A 4NXMT 2CHNA 2J47A 3T1HT 2RA1A 4PAGA 4TX5A 4DMWA 3JADA 1N36T 1VRBA 4COFA 5FL1A 2HPJA 4DBQA 2LE8A 4GK5E 2X67A 3VR8A 5AQOB 3C4XA 1NAFA 3LK42 4KI0F 2YDSA 3ETVA 5DQVA 2J62A 2E8IA 2NTYA 4QWNB 3O4XE 2Y6XA 4H9NC 3AE1A 3NBXX 5LHGB 4IE4A 4IE7A 2WMOA 2KWHA 3VKHA 2LOPA 2YEVC 3HKBE 5CB4E 4IGUA 3ETUA 3L3PA 4ADZA 1JNZA 3AVSA 3OVUA 5AQHB 5FL0A 2A72A 1W9RA 1MMNA 2UUCT 2ODVA 2WSSV 1ZHCA 5FXWA 2H89A 5LGNB 1HFAA 2KLQA 2UXXB 4JUYA 2FJBA 1FMWA 1MIYA 1WLXA 5AQSB 4EEDA 3ZKRA 3V5SA 2OA5A 1ZV4X 3SOLA 3SWHA 5JR9C 1HNXT 3FHNA 4IL9A 2LRKA 1S94A 5L3EB 4DR7T 3K8PC 3NZPA 3PURA 4U7IA 2CBJA 4ISSA 4PJJA 3NRYA 3TLUA 1M7KA 1HCIA 4JI8T 5BR8T 2IAKA 1YQ4A 4X20E 2X9XA 4HFVA 3KV9A 5L3DB 2D9DA 3FZKB 3TLTA 2UXNB 2OLTA 4XZCA 4LF5T 3AEDA 3PU8A 4AQFC 5L2LA 4BJMA 2BVLA 3FB2A 3UFGA 2G0UA 3K3QC 2C5KT 3AE3A 2LSYA 2UXBT 5LG3A 1ZKEA 4DV0T 2NTXA 4FI5A 5ADXL 5LG4A 1IBLT 2QYWA 4UV9B 5AQKB 4GIWA 3TLVA 1I94T 4ZZBA 1T8BA 3IF8B 2CMRA 3CQGB 4IT4A 4OFZA 2CHOA 2XPKA 5KX5E 4L5GA 4IREA 3AB3B 3EDVA 4LFCT 3OTOT 2J1DG 3EABA 3ZT7A 3TLWA 2KSRA 2XSBA 3UULA 5FVKA 3LSVA 3UUMA 1YKEB 4PJMA 3MJXA 4TNVA 2IMLA 1J5WA 2MOZA 2CEAA 3ZN1B 4ANJA 1OEDC 1OWAA 4YY3T 5L4EA 3AXJA 3F2EA 4QX8B 1ZEEA 3NVOA 1WR6A 3FZLB 4GKJT 4NUUA 3K1SA 3RGLA 3ABVA 2V5DA 3ZLIA 2LJLA 2IIUA 3ZYMA 4TN7B 4JEUB 3AE2A 2V7LA 5CA0E 1SE7A 2D0TA 3RIUC 1XDPA 2ZMAA 2IUBA 3P8CD 2UU9T 3KV6A 1E2AA 4X65T 3OYXA 5FMNA 2VQET 4KUMB 2CLYB 3IA3A 4CI3B 3P50A 3AEAA 3GN5B 3ZMZB 2N1GA 2XUEA 1WRDA 3IEEA 4KHPT 2FBWA 3H37A 3SS1A 1QSDA 1UGOA 2X9WA 2Q9QA 1H7CA 4GK0E 3C4ZA 2KWIB 1WR0A 3CWZB 3UUXB 4EZHA 3E0ZA 5AQRB 2WY2A 1N33T 3CX8B 2WBLA 3N2KE 3O1IA 2YU2A 1X9BA 3QB5A 2WCAA 1KEYA 5FXZA 3G06A 4KX6A 2XM1A 2GK9A 4P09A 3IBPA 2Q9QD 2HN2A 2E9XC 3KVAA 5GONE 2HN1A 4ZI2D 3ZSSA 1HG5A 1OEDE 3PUWF 4JI5T 2PG8A 3VU7H 5ABHA 3HR0A 4Z91A 4MLKA 1ZP0A 4X1KE 2E5VA 3AEGA 3RKGA 3ZMTB 3E08A 2XAFB 2XASB 5FKYA 4KHZF 5FY7A 3C51A 2W67A 4YHJA 5F8PA 2WMNA 3ZCJA 3QUJA 4AKGA 2VASA 3AE7A 3FZMB 1KNZA 5AQTB 4TWFA 1KNPA 3RI5A 3C50A 2V7KA 4GYRA 3R6NA 2WWVA 3E22E 2YINA 1FEWA 4UEMA 3PV0F 2JPFA 5AQQB 4O4LE 5IWAT 4YXDA 5CFBA 4GOUA 5HXCA 3B57A 4DR6T 4L9IA 1J1JA 4XAXB 3ZJ1A 4AQYT 1U5PA 2CCQA 3AXJB 3I9WA 4KP3C 3U78A 4DV6T 3ZEFB 4DVDA 3MACA 5A1LA 2VURA 1Z8UA 4PK6A 2HPLA 3QC9A 5AQPB 4X1YE 1SA0E 3Q9DA 3RX6A 4JI4T 2RP4A 5JDNA 3ZMUB 3HKCE 4JI0T 4DV3T 2DNXA 4HE8A 2C5JA 5CA1E 5JDQA 4A56A 2OV9A 1NEKA 1T7SA 3KINB 5AQUB 2SPCA 4CN6A 3PE0A 4E7ZA 3CQCB 1UURA 2DHRA 3AE8A 4IE0A 3C98B 4I50E 3P4RA 2AXDS 1VOMA 5JQGE 2FUPA 2EHOD 2E2AA 2M6BA 3SFDA 4L0RA 5DQWA 2VL0A 4DNDA 3UUNA 2JQ9A 5F3JA 4JV5T 2LT3A 3CPZA 3N9MA 4PK5A 3DTOA 2L8KA 3NZQA 2MTQA 1HNWT 2Q9QB 2N9DA 5FXVA 4QH5A 3L39A 3PUYF 5AFUL 3N2GE 3OPCA 3N9NA 3AAIA 1QUUA 2N2NA 4U2YA 3AAAB 4HFIA 2NP9A 2BZBA 4N78D 3T8OA 1WFDA 2V7JA 1HF8A 1SUMB 2M6IA 2BKOA 4O2AE 3FXDB 2VWAA 1UUSA 3J9X1 3H3AA 3BQKA 2E5LT 1BR4A 3N9OA 4X5TA 5AQVB 4HFHA 5JTGA 3CIRA 2CA5A 2J4GA 3RH3A 5J2TE 1ZOYA 3F57A 5JDLA 3GWHA 3T1YT 2NR4A 3M3ZB 1U4QA 5FNVE 4LF8T 3AA1B 3K3OA 4DUYT 2LRLA 2V6XA 2YOEA 4NPPA 2LHNA 2HH7A 4EB6E 2WDVA 5J2UE 4I43B 4QXHB 3WAJA 2WP9A 4FJOA 2IC6A 4YTMA 3BQIA 3AEEA 5LMNT 1IJ6A 5JREA 3ZSTA 3GN5A 4X62T 2XAQB 3RRCA 4ILCA 5JVDE 2XAGB 3AA7B 2JQQA 4JEHB 2H3RA 2VKDA 5CGMA 2NW7A 4B3ST 5AQIB 1BR0A 3X1DA 5HCMA 2X0HA 4C91A 4F6RC 2XM2A 4DR3T 4EV6A 5EZYE 5TAOA 3JAFA 4NIQA 5JDHA 3O1HA 4ZXLA 4PFPA 2VKHA 1D1AA 5HYAA 3QOFA 3KBUA 2CBIA 3A7MA 3N5LA 5FXXA 3RKOA 4UVBB 2P9BA 2PTFA 4HFCA 4ZOLE 3P4WA 5M4YA 2L3LA 3WI3A 3UFEA 5C8YE 3PUGA 5DJQC 3ZYLA 5L3CB 3ZJ2A 4PFOA 4DBRA 1MMGA 4KMCA 2ZM8A 4ILAA 2KINB 2HHHT 5LBQB 4QXCB 3S4UA 3LFMA 1LVFA 1UX4A 3ZCIA 4HWFA 3JC6D 2KMFA 2WDRA 4YSZA 5HWYA 4ZEYA 4B3TT 3NWIA 4HWDA 2NW9A 5JDGA 4H9SE 1T72A 4EYYR 4OYJA 5HXRA 1YXRA 4MHCA 4PK4A 3FZFB 2LEHA 2KXPB 2W2UA 2B76A 1T98A 4TNWA 1W0AA 3AAEB 4I55E 4AISA 4IDNA 2UXCT 2D0UA 2BBHA 5L3FB 3VKGA 5IHYA 4H9OC 5HCJA 4B3MT 3ZT5A 2AE9A 2XQ8A 2W0GA 2YU1A 3FXEB 5HEJA 2LSGA 3KV5A 3EUHA 3LJCA 1IAPA 4EAHA 4V1Av 1LVKA 3Q2MA 5JRCA 3UU8A 4PJLA 3DJBA 2XY8B 2LOSA 1D1BA 3HI2A 3EI0A 3HKDE 3KDSE 5L3BB 5LHIB 4OX9T 4ZZCA 4IDOA 5HXEA 4U7YA 1XNQT 2M67A 4ZI3C 4AKIA 4IDZA 3VHLA 5LXTE 3AE9A 1Y01A 2PBIA 3RPUA 2WU2A 2ZM2A 1CHUA 2PFVA 4TZ4C 2BS4A 1XWMA 2R6GF 2PJQA 3AA0B 4WNKA 3RIAA 2XQ9A 3UU3A 2CE7A 5ETWA 3MA9A 5L4HA 3OJAA 2MYSA 4JI7T 2IDOB 3ZC1A 4NUVA 3UQ4A 4HWCA 4UELA 3AEFA 4WW0A 1S35A 3K3NA 5AQJB 2QA7A 4IDPA 4PJNA 5LOVE 4AIUA 4AKRB 4IIJE 3UTKA 4EIWA 5LHHB 3N9PA 4YTPA 1J5ET 5J1GA 2BG9A 3RRWA 4X64T 2DI4A 3EDUA 2JQKA 1HX1B 1NENA 3RHWA 3I0QA 1HX8A 2LSIA 1MNDA 1EZ3A 4QH4A 4H9PC 2QRXA 1IJ5A 2KNDA 4P1NA 1BR2A 2LHRA 2VB6A 4MALA 1XZYA 3PUQA 4CXWA 4GKKT 3ZYKA 4CN1A 2XQAA 2K3WA 2X51A 4DMVA 4G63A 3C64A 2WU5A 3LBXB 3NKZA 4UV8B 3VR9A 5HWXA 2V7MA 4HTEA 1XMOT 4ZI7E 3WAKA 5ABGA 5JDMA 3Q5DA 3RF1A 3OBVE 3AE4A 4EEBA 1XMQT 2VKJA 5KDMC 5LA6E 1HTJF 2WZHA 3UU6A 4M1PA 5KXJA 2CLYC 3MK7C 1UK5A 4BA9A 3RYCE 4TV8E 4HFDA 2XQ7A 1CUNA 2BBJA 1GQEA 1KF6A 4Z8XA 4YTNA 2VL8A 2IHR1 2W61A 4J2CA 4ISTA 2QGSA 5DABA 2I0MA 3U3IA 2FJEA 1G8XA 2JQHA 1IBKT 1OEDA 1D0YA 2WWUA 2XQ6A 5LGUB 1WYCA 2CXFA 4HN9A 2KT9A 4CQIA 5JRCB 2NWBA 3KV4A 4TWDA 4AKLA 5AQMB 3Q5EA 4WBNE 2EHOA 4UIGA 4YT0A 4HGAA 3CQXC 4ILUA 1KNRA 4YSYA 4ZHQE 1JNRA 4MFRA 4O4IE 3PUZF 4BJNA 3KFWX 2ODUA 4EXTA 2XAJB 3PUVF 1R8IA 2XSAA 3CX7B 3RIUA 4PW8A 2BDEA 4DR4T 4U3CA 3TKLB 2Z6EA 3JCFA 4IE5A 4MBQA 2K24A 4DIDB 2XQ4A 3V5UA 5LJMA 3EVYA 1X79A 3QK6A 4WBOA 2I59A 2V8SV 3C4WA 3I1AA 2WB5A 5C3JA 2XQ3A 3BQLA 3P7IA 2LM2A 1XDOA 4ASKA 5FY1A 3FBLA 2DCFA 1BR1A 2IW5B 2JMHA 2A9UA 2F4VT 5LB7B 3UQ7A 3ONLC 5HXSA 2VVSA 5AQNB 4HWIB 2W00A 2BG9B 2BKPA 4AKHA 3GMIA 2X68A 2FJAA 4CZZB 4DUZT 4A97A 1W0BA 3CVRA 2UUBT 3PUXF 4QKNA 2E9XA 2YN6A 2V26A 4QH1A 1HNZT 4OHFA 1VCTA 2DWGA 5EK4A 2H88A 4UVCB 4I4TE 3RYIE 3RC3A 5L47A 2C0SA 2VKOA 2V6YA 2XQYA 1MMDA 3OKQA 4G2AA 4HWHA 5EK2A 4LFBT 2E9XD 3R84B 4LF9T 2CM0A 2ACXA 2X0LB 3AA6B 4LF4T 2LSJA 4ZS3A 2D5UA
chains in the Genus database with same CATH topology
4Q25A 1T72A 2I0MA 1XWMA 1T8BA 2BKPA 2BKNA 2OLTA 1VCTA 1SUMB 2BKOA 2IIUA 3L39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q25 A;  1T72 A;  2I0M A;  1XWM A;  1T8B A;  2BKP A;  2BKN A;  2OLT A;  1VCT A;  1SUM B;  2BKO A;  2IIU A;  3L39 A; 
#chains in the Genus database with same CATH topology
 2LSK A;  3O9X A;  4YLH A;  1LKX A;  3AVR A;  4K0U A;  3Q5W A;  4JI2 T;  4AXP A;  4A5X A;  4K0K T;  3VRA A;  2C5I T;  4DV1 T;  2CPT A;  5FVL A;  1Y64 B;  3CK6 A;  4CN4 A;  3HL6 A;  4C90 A;  4DR1 T;  3LG7 A;  3ZC0 A;  4O4J E;  5HEO A;  4P0B A;  4JYA T;  3P4S A;  4TWH A;  3MZK B;  1OED B;  2YKS A;  4EZ4 A;  4LML A;  3FZH B;  3CX6 B;  4UR9 A;  5C2T A;  2DLR A;  1QLB A;  3AE5 A;  4DV7 T;  3N9Q A;  3UU5 A;  2Q9Q C;  2H7O A;  4ZI2 C;  3RQW A;  1I6Z A;  2EHO B;  3D0T A;  4WYV A;  4O8S A;  5FP3 A;  2K9A A;  3AE6 A;  3PUS A;  3IHR A;  3AEB A;  4YJ2 E;  2JMK A;  5HEU A;  2WZI A;  2JRK A;  2D2S A;  3W15 B;  2BG9 C;  3VRB A;  2A2F X;  3LDQ B;  1D1C A;  1YQ3 A;  5LBM A;  4U72 A;  1MIW A;  4JI3 T;  3AEC A;  1M62 A;  1MIV A;  3RQU A;  5LJN A;  3KBT A;  4QHO A;  3ZT6 A;  5JH7 E;  2DL1 A;  1UCU A;  2X0Y A;  3QNU A;  3RYH E;  3J7Y q;  4CI2 B;  5AQG B;  3LBX A;  5FYM A;  3JAE A;  2XAH B;  1IZN B;  2WDQ A;  2X9H A;  2A3D A;  2CWO A;  3Q5X A;  1DU2 A;  4EGW A;  4QX7 B;  5IUX A;  4DV4 T;  3B13 A;  2YDR A;  3ONJ A;  2B1E A;  4U74 A;  2ZM0 A;  4LF7 T;  4IHJ E;  3PDY A;  3UU4 A;  1B7T A;  3LK3 B;  5HEG A;  1E7P A;  4OK0 A;  5ABF A;  2E9X B;  3RC8 A;  2KZ7 B;  4UXN B;  3MKD A;  3ANW A;  4O4H E;  4HFB A;  4Z90 A;  2W4X A;  5LCY A;  2WS3 A;  4KBM B;  4X1I E;  1FIO A;  3ZPO A;  1LRZ A;  1YKH B;  3P4Q A;  4DV5 T;  4DR5 T;  2EHO C;  1XNR T;  2V6Y B;  5LNK A;  2K48 A;  4O2B E;  2BG9 E;  2FJD A;  1G73 A;  3KVB A;  2MPK A;  2XJ7 A;  4UF0 A;  2XZE A;  4LMJ A;  4HKA A;  4OYK A;  3UUB A;  1HG2 A;  3DP7 A;  3BK9 A;  4A98 A;  4HEA A;  4YSX A;  2CXL A;  2ES0 A;  5JDF A;  3F31 A;  2YDQ A;  2ZM6 T;  5JR9 A;  2LLY A;  3L09 A;  2XTL A;  3HKE E;  4YJ3 E;  1KFY A;  2BS2 A;  2VQF T;  2JJ9 A;  5ABE A;  3PUA A;  4U2Z A;  2Y8D A;  4NXN T;  5AQL B;  3HA4 A;  1WCR A;  4ZS2 A;  4U31 A;  1FJG T;  3PTR B;  4LMK A;  3ZMS B;  4HFE A;  3ONX A;  1SHZ C;  5J0Z A;  3I0O A;  4LF6 T;  2LKH A;  3PJA J;  1Z0P A;  2DWK A;  3TLS A;  3M65 A;  3UT5 E;  2V1D B;  4F8H A;  3O1J A;  4BAY B;  3OYZ A;  2UXD T;  4TV9 E;  3CKD A;  5H6R B;  2XHE B;  3NRX A;  3EAM A;  5E0O A;  2W63 A;  4AQF A;  5L3G B;  4CXX A;  4YFS A;  2CWY A;  2V5C A;  2ZLY A;  4ILB A;  5HXH A;  4JI6 T;  3N2O A;  3LK2 B;  3A8Y C;  5CJ5 A;  1AJ3 A;  4AQG A;  1OXZ A;  2RPA A;  4H63 V;  4AI6 A;  2MBG A;  3SFE A;  4H9Q C;  3GA8 A;  4E7S A;  1NWM X;  1HS7 A;  3RLF F;  3PJA A;  1N32 T;  3CML A;  2WQY A;  4WZX A;  5HEH A;  3QB5 K;  4B6X A;  4H63 H;  4XBF B;  1D0X A;  4LFA T;  4JLE A;  4IDQ A;  4IL4 A;  4DR2 T;  5AQF B;  2NW8 A;  1WYB A;  1MMA A;  2WM9 A;  3FBZ A;  2CRB A;  1E1H B;  1YW0 A;  5LYJ E;  2W62 A;  2V7I A;  2VK9 A;  5ABF B;  3RIF A;  1V9D A;  2LKG A;  1O3X A;  3ANW B;  3EHZ A;  4PNI A;  5LP6 E;  2L9Q A;  2QVA A;  5LGT B;  1IBM T;  2X66 A;  4QXB B;  5F5W A;  4DO0 A;  4P0A A;  2XQ5 A;  4EOZ B;  1KK7 A;  4JI1 T;  4IE6 A;  4CXY A;  2NOX A;  4U33 A;  4B3R T;  2X9Y A;  1VCS A;  3A5X A;  3ZN0 B;  2WAU A;  4JBW F;  5BMV E;  5HAX A;  4I0U A;  3RYF E;  2Y48 B;  3SRZ A;  2ACZ A;  4DV2 T;  2H7V C;  2UUA T;  3JC6 C;  2I6H A;  2BKN A;  1YD8 G;  2VVN A;  4GYS A;  4EYU A;  4UF0 B;  1L0V A;  1W09 A;  3ZMV B;  2LM9 A;  5LMU T;  1UX5 A;  3L8R A;  1MNE A;  2BS3 A;  5KMG P;  1US7 B;  5JR9 B;  2IC9 A;  3MXZ A;  4H9R C;  1N34 T;  2JIW A;  4YHH T;  2MAW A;  1D0Z A;  1FMV A;  3N9L A;  4ZI3 D;  3ESL A;  2W66 A;  2BVM A;  4CI1 B;  2CXD A;  4X66 T;  5FY0 A;  1HR0 T;  3I9Y A;  5IYZ E;  3P4P A;  4UVA B;  4TUY E;  3PU3 A;  3H3M A;  2YK0 A;  5H6Q B;  3B5M A;  4ERR A;  2K5B B;  4Q25 A;  5EK3 A;  4NXM T;  2CHN A;  2J47 A;  3T1H T;  2RA1 A;  4PAG A;  4TX5 A;  4DMW A;  3JAD A;  1N36 T;  1VRB A;  4COF A;  5FL1 A;  2HPJ A;  4DBQ A;  2LE8 A;  4GK5 E;  2X67 A;  3VR8 A;  5AQO B;  3C4X A;  1NAF A;  3LK4 2;  4KI0 F;  2YDS A;  3ETV A;  5DQV A;  2J62 A;  2E8I A;  2NTY A;  4QWN B;  3O4X E;  2Y6X A;  4H9N C;  3AE1 A;  3NBX X;  5LHG B;  4IE4 A;  4IE7 A;  2WMO A;  2KWH A;  3VKH A;  2LOP A;  2YEV C;  3HKB E;  5CB4 E;  4IGU A;  3ETU A;  3L3P A;  4ADZ A;  1JNZ A;  3AVS A;  3OVU A;  5AQH B;  5FL0 A;  2A72 A;  1W9R A;  1MMN A;  2UUC T;  2ODV A;  2WSS V;  1ZHC A;  5FXW A;  2H89 A;  5LGN B;  1HFA A;  2KLQ A;  2UXX B;  4JUY A;  2FJB A;  1FMW A;  1MIY A;  1WLX A;  5AQS B;  4EED A;  3ZKR A;  3V5S A;  2OA5 A;  1ZV4 X;  3SOL A;  3SWH A;  5JR9 C;  1HNX T;  3FHN A;  4IL9 A;  2LRK A;  1S94 A;  5L3E B;  4DR7 T;  3K8P C;  3NZP A;  3PUR A;  4U7I A;  2CBJ A;  4ISS A;  4PJJ A;  3NRY A;  3TLU A;  1M7K A;  1HCI A;  4JI8 T;  5BR8 T;  2IAK A;  1YQ4 A;  4X20 E;  2X9X A;  4HFV A;  3KV9 A;  5L3D B;  2D9D A;  3FZK B;  3TLT A;  2UXN B;  2OLT A;  4XZC A;  4LF5 T;  3AED A;  3PU8 A;  4AQF C;  5L2L A;  4BJM A;  2BVL A;  3FB2 A;  3UFG A;  2G0U A;  3K3Q C;  2C5K T;  3AE3 A;  2LSY A;  2UXB T;  5LG3 A;  1ZKE A;  4DV0 T;  2NTX A;  4FI5 A;  5ADX L;  5LG4 A;  1IBL T;  2QYW A;  4UV9 B;  5AQK B;  4GIW A;  3TLV A;  1I94 T;  4ZZB A;  1T8B A;  3IF8 B;  2CMR A;  3CQG B;  4IT4 A;  4OFZ A;  2CHO A;  2XPK A;  5KX5 E;  4L5G A;  4IRE A;  3AB3 B;  3EDV A;  4LFC T;  3OTO T;  2J1D G;  3EAB A;  3ZT7 A;  3TLW A;  2KSR A;  2XSB A;  3UUL A;  5FVK A;  3LSV A;  3UUM A;  1YKE B;  4PJM A;  3MJX A;  4TNV A;  2IML A;  1J5W A;  2MOZ A;  2CEA A;  3ZN1 B;  4ANJ A;  1OED C;  1OWA A;  4YY3 T;  5L4E A;  3AXJ A;  3F2E A;  4QX8 B;  1ZEE A;  3NVO A;  1WR6 A;  3FZL B;  4GKJ T;  4NUU A;  3K1S A;  3RGL A;  3ABV A;  2V5D A;  3ZLI A;  2LJL A;  2IIU A;  3ZYM A;  4TN7 B;  4JEU B;  3AE2 A;  2V7L A;  5CA0 E;  1SE7 A;  2D0T A;  3RIU C;  1XDP A;  2ZMA A;  2IUB A;  3P8C D;  2UU9 T;  3KV6 A;  1E2A A;  4X65 T;  3OYX A;  5FMN A;  2VQE T;  4KUM B;  2CLY B;  3IA3 A;  4CI3 B;  3P50 A;  3AEA A;  3GN5 B;  3ZMZ B;  2N1G A;  2XUE A;  1WRD A;  3IEE A;  4KHP T;  2FBW A;  3H37 A;  3SS1 A;  1QSD A;  1UGO A;  2X9W A;  2Q9Q A;  1H7C A;  4GK0 E;  3C4Z A;  2KWI B;  1WR0 A;  3CWZ B;  3UUX B;  4EZH A;  3E0Z A;  5AQR B;  2WY2 A;  1N33 T;  3CX8 B;  2WBL A;  3N2K E;  3O1I A;  2YU2 A;  1X9B A;  3QB5 A;  2WCA A;  1KEY A;  5FXZ A;  3G06 A;  4KX6 A;  2XM1 A;  2GK9 A;  4P09 A;  3IBP A;  2Q9Q D;  2HN2 A;  2E9X C;  3KVA A;  5GON E;  2HN1 A;  4ZI2 D;  3ZSS A;  1HG5 A;  1OED E;  3PUW F;  4JI5 T;  2PG8 A;  3VU7 H;  5ABH A;  3HR0 A;  4Z91 A;  4MLK A;  1ZP0 A;  4X1K E;  2E5V A;  3AEG A;  3RKG A;  3ZMT B;  3E08 A;  2XAF B;  2XAS B;  5FKY A;  4KHZ F;  5FY7 A;  3C51 A;  2W67 A;  4YHJ A;  5F8P A;  2WMN A;  3ZCJ A;  3QUJ A;  4AKG A;  2VAS A;  3AE7 A;  3FZM B;  1KNZ A;  5AQT B;  4TWF A;  1KNP A;  3RI5 A;  3C50 A;  2V7K A;  4GYR A;  3R6N A;  2WWV A;  3E22 E;  2YIN A;  1FEW A;  4UEM A;  3PV0 F;  2JPF A;  5AQQ B;  4O4L E;  5IWA T;  4YXD A;  5CFB A;  4GOU A;  5HXC A;  3B57 A;  4DR6 T;  4L9I A;  1J1J A;  4XAX B;  3ZJ1 A;  4AQY T;  1U5P A;  2CCQ A;  3AXJ B;  3I9W A;  4KP3 C;  3U78 A;  4DV6 T;  3ZEF B;  4DVD A;  3MAC A;  5A1L A;  2VUR A;  1Z8U A;  4PK6 A;  2HPL A;  3QC9 A;  5AQP B;  4X1Y E;  1SA0 E;  3Q9D A;  3RX6 A;  4JI4 T;  2RP4 A;  5JDN A;  3ZMU B;  3HKC E;  4JI0 T;  4DV3 T;  2DNX A;  4HE8 A;  2C5J A;  5CA1 E;  5JDQ A;  4A56 A;  2OV9 A;  1NEK A;  1T7S A;  3KIN B;  5AQU B;  2SPC A;  4CN6 A;  3PE0 A;  4E7Z A;  3CQC B;  1UUR A;  2DHR A;  3AE8 A;  4IE0 A;  3C98 B;  4I50 E;  3P4R A;  2AXD S;  1VOM A;  5JQG E;  2FUP A;  2EHO D;  2E2A A;  2M6B A;  3SFD A;  4L0R A;  5DQW A;  2VL0 A;  4DND A;  3UUN A;  2JQ9 A;  5F3J A;  4JV5 T;  2LT3 A;  3CPZ A;  3N9M A;  4PK5 A;  3DTO A;  2L8K A;  3NZQ A;  2MTQ A;  1HNW T;  2Q9Q B;  2N9D A;  5FXV A;  4QH5 A;  3L39 A;  3PUY F;  5AFU L;  3N2G E;  3OPC A;  3N9N A;  3AAI A;  1QUU A;  2N2N A;  4U2Y A;  3AAA B;  4HFI A;  2NP9 A;  2BZB A;  4N78 D;  3T8O A;  1WFD A;  2V7J A;  1HF8 A;  1SUM B;  2M6I A;  2BKO A;  4O2A E;  3FXD B;  2VWA A;  1UUS A;  3J9X 1;  3H3A A;  3BQK A;  2E5L T;  1BR4 A;  3N9O A;  4X5T A;  5AQV B;  4HFH A;  5JTG A;  3CIR A;  2CA5 A;  2J4G A;  3RH3 A;  5J2T E;  1ZOY A;  3F57 A;  5JDL A;  3GWH A;  3T1Y T;  2NR4 A;  3M3Z B;  1U4Q A;  5FNV E;  4LF8 T;  3AA1 B;  3K3O A;  4DUY T;  2LRL A;  2V6X A;  2YOE A;  4NPP A;  2LHN A;  2HH7 A;  4EB6 E;  2WDV A;  5J2U E;  4I43 B;  4QXH B;  3WAJ A;  2WP9 A;  4FJO A;  2IC6 A;  4YTM A;  3BQI A;  3AEE A;  5LMN T;  1IJ6 A;  5JRE A;  3ZST A;  3GN5 A;  4X62 T;  2XAQ B;  3RRC A;  4ILC A;  5JVD E;  2XAG B;  3AA7 B;  2JQQ A;  4JEH B;  2H3R A;  2VKD A;  5CGM A;  2NW7 A;  4B3S T;  5AQI B;  1BR0 A;  3X1D A;  5HCM A;  2X0H A;  4C91 A;  4F6R C;  2XM2 A;  4DR3 T;  4EV6 A;  5EZY E;  5TAO A;  3JAF A;  4NIQ A;  5JDH A;  3O1H A;  4ZXL A;  4PFP A;  2VKH A;  1D1A A;  5HYA A;  3QOF A;  3KBU A;  2CBI A;  3A7M A;  3N5L A;  5FXX A;  3RKO A;  4UVB B;  2P9B A;  2PTF A;  4HFC A;  4ZOL E;  3P4W A;  5M4Y A;  2L3L A;  3WI3 A;  3UFE A;  5C8Y E;  3PUG A;  5DJQ C;  3ZYL A;  5L3C B;  3ZJ2 A;  4PFO A;  4DBR A;  1MMG A;  4KMC A;  2ZM8 A;  4ILA A;  2KIN B;  2HHH T;  5LBQ B;  4QXC B;  3S4U A;  3LFM A;  1LVF A;  1UX4 A;  3ZCI A;  4HWF A;  3JC6 D;  2KMF A;  2WDR A;  4YSZ A;  5HWY A;  4ZEY A;  4B3T T;  3NWI A;  4HWD A;  2NW9 A;  5JDG A;  4H9S E;  1T72 A;  4EYY R;  4OYJ A;  5HXR A;  1YXR A;  4MHC A;  4PK4 A;  3FZF B;  2LEH A;  2KXP B;  2W2U A;  2B76 A;  1T98 A;  4TNW A;  1W0A A;  3AAE B;  4I55 E;  4AIS A;  4IDN A;  2UXC T;  2D0U A;  2BBH A;  5L3F B;  3VKG A;  5IHY A;  4H9O C;  5HCJ A;  4B3M T;  3ZT5 A;  2AE9 A;  2XQ8 A;  2W0G A;  2YU1 A;  3FXE B;  5HEJ A;  2LSG A;  3KV5 A;  3EUH A;  3LJC A;  1IAP A;  4EAH A;  4V1A v;  1LVK A;  3Q2M A;  5JRC A;  3UU8 A;  4PJL A;  3DJB A;  2XY8 B;  2LOS A;  1D1B A;  3HI2 A;  3EI0 A;  3HKD E;  3KDS E;  5L3B B;  5LHI B;  4OX9 T;  4ZZC A;  4IDO A;  5HXE A;  4U7Y A;  1XNQ T;  2M67 A;  4ZI3 C;  4AKI A;  4IDZ A;  3VHL A;  5LXT E;  3AE9 A;  1Y01 A;  2PBI A;  3RPU A;  2WU2 A;  2ZM2 A;  1CHU A;  2PFV A;  4TZ4 C;  2BS4 A;  1XWM A;  2R6G F;  2PJQ A;  3AA0 B;  4WNK A;  3RIA A;  2XQ9 A;  3UU3 A;  2CE7 A;  5ETW A;  3MA9 A;  5L4H A;  3OJA A;  2MYS A;  4JI7 T;  2IDO B;  3ZC1 A;  4NUV A;  3UQ4 A;  4HWC A;  4UEL A;  3AEF A;  4WW0 A;  1S35 A;  3K3N A;  5AQJ B;  2QA7 A;  4IDP A;  4PJN A;  5LOV E;  4AIU A;  4AKR B;  4IIJ E;  3UTK A;  4EIW A;  5LHH B;  3N9P A;  4YTP A;  1J5E T;  5J1G A;  2BG9 A;  3RRW A;  4X64 T;  2DI4 A;  3EDU A;  2JQK A;  1HX1 B;  1NEN A;  3RHW A;  3I0Q A;  1HX8 A;  2LSI A;  1MND A;  1EZ3 A;  4QH4 A;  4H9P C;  2QRX A;  1IJ5 A;  2KND A;  4P1N A;  1BR2 A;  2LHR A;  2VB6 A;  4MAL A;  1XZY A;  3PUQ A;  4CXW A;  4GKK T;  3ZYK A;  4CN1 A;  2XQA A;  2K3W A;  2X51 A;  4DMV A;  4G63 A;  3C64 A;  2WU5 A;  3LBX B;  3NKZ A;  4UV8 B;  3VR9 A;  5HWX A;  2V7M A;  4HTE A;  1XMO T;  4ZI7 E;  3WAK A;  5ABG A;  5JDM A;  3Q5D A;  3RF1 A;  3OBV E;  3AE4 A;  4EEB A;  1XMQ T;  2VKJ A;  5KDM C;  5LA6 E;  1HTJ F;  2WZH A;  3UU6 A;  4M1P A;  5KXJ A;  2CLY C;  3MK7 C;  1UK5 A;  4BA9 A;  3RYC E;  4TV8 E;  4HFD A;  2XQ7 A;  1CUN A;  2BBJ A;  1GQE A;  1KF6 A;  4Z8X A;  4YTN A;  2VL8 A;  2IHR 1;  2W61 A;  4J2C A;  4IST A;  2QGS A;  5DAB A;  2I0M A;  3U3I A;  2FJE A;  1G8X A;  2JQH A;  1IBK T;  1OED A;  1D0Y A;  2WWU A;  2XQ6 A;  5LGU B;  1WYC A;  2CXF A;  4HN9 A;  2KT9 A;  4CQI A;  5JRC B;  2NWB A;  3KV4 A;  4TWD A;  4AKL A;  5AQM B;  3Q5E A;  4WBN E;  2EHO A;  4UIG A;  4YT0 A;  4HGA A;  3CQX C;  4ILU A;  1KNR A;  4YSY A;  4ZHQ E;  1JNR A;  4MFR A;  4O4I E;  3PUZ F;  4BJN A;  3KFW X;  2ODU A;  4EXT A;  2XAJ B;  3PUV F;  1R8I A;  2XSA A;  3CX7 B;  3RIU A;  4PW8 A;  2BDE A;  4DR4 T;  4U3C A;  3TKL B;  2Z6E A;  3JCF A;  4IE5 A;  4MBQ A;  2K24 A;  4DID B;  2XQ4 A;  3V5U A;  5LJM A;  3EVY A;  1X79 A;  3QK6 A;  4WBO A;  2I59 A;  2V8S V;  3C4W A;  3I1A A;  2WB5 A;  5C3J A;  2XQ3 A;  3BQL A;  3P7I A;  2LM2 A;  1XDO A;  4ASK A;  5FY1 A;  3FBL A;  2DCF A;  1BR1 A;  2IW5 B;  2JMH A;  2A9U A;  2F4V T;  5LB7 B;  3UQ7 A;  3ONL C;  5HXS A;  2VVS A;  5AQN B;  4HWI B;  2W00 A;  2BG9 B;  2BKP A;  4AKH A;  3GMI A;  2X68 A;  2FJA A;  4CZZ B;  4DUZ T;  4A97 A;  1W0B A;  3CVR A;  2UUB T;  3PUX F;  4QKN A;  2E9X A;  2YN6 A;  2V26 A;  4QH1 A;  1HNZ T;  4OHF A;  1VCT A;  2DWG A;  5EK4 A;  2H88 A;  4UVC B;  4I4T E;  3RYI E;  3RC3 A;  5L47 A;  2C0S A;  2VKO A;  2V6Y A;  2XQY A;  1MMD A;  3OKQ A;  4G2A A;  4HWH A;  5EK2 A;  4LFB T;  2E9X D;  3R84 B;  4LF9 T;  2CM0 A;  2ACX A;  2X0L B;  3AA6 B;  4LF4 T;  2LSJ A;  4ZS3 A;  2D5U A; 
#chains in the Genus database with same CATH homology
 4Q25 A;  1T72 A;  2I0M A;  1XWM A;  1T8B A;  2BKP A;  2BKN A;  2OLT A;  1VCT A;  1SUM B;  2BKO A;  2IIU A;  3L39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...