4Q25A

Crystal structure of phou from pseudomonas aeruginosa
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
211
structure length
211
Chain Sequence
SQQFNAELEDVRSHLLAMGGLVEKQVNDAVNALIDADSGLAQQVREIDDQINQMERNIDEECVRILARRQPAASDLRLIISISKSVIDLERIGDEASKVARRAIQLCEEGESPRGYVEVRHIGSQVQKMVQEALDAFARFDADLALSVAQYDKTVDREYKTALRELVTYMMEDPRAISRVLNIIWALRSLERIGDHARNIAELVIYLVRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PhoU from Pseudomonas aeruginosa, a negative regulator of the Pho regulon.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
molecule keywords Phosphate-specific transport system accessory protein PhoU h
total genus 106
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A01
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A02
2BKOA 2BKNA 2I0MA 2IIUA 2OLTA 1SUMB 1XWMA 2BKPA 4Q25A 1T72A 1VCTA 1T8BA 3L39A
chains in the Genus database with same CATH superfamily
4TV8E 4UXNB 5JDNA 3KV9A 2NTXA 3RRCA 3Q5XA 4L0RA 2UXCT 4V1Av 2NW9A 5J2UE 3ETVA 2JMHA 2JMKA 4HN9A 4DV0T 2UXNB 4WNKA 2KZ7B 4PJNA 2W67A 1IBKT 2VK9A 1X79A 3SS1A 2A2FX 1NAFA 1ZP0A 3MK7C 5LBMA 2L3LA 2LJLA 3AEFA 3PJAA 4MHCA 3AE6A 2XQ4A 4AQFA 3ZN1B 4CI2B 4HFVA 1NWMX 3IHRA 4LF7T 1FEWA 4U7YA 4QHOA 4CZZB 3IF8B 2LEHA 1KFYA 5FL0A 2CHOA 3CPZA 4CXWA 4DUYT 4H9PC 3UU4A 4TX5A 1L0VA 2BG9C 4ADZA 2XHEB 2LKGA 5AQMB 2ODUA 2WZHA 2DWGA 2I0MA 3NZPA 3RC3A 4O2AE 3AEBA 2DHRA 4CQIA 5KXJA 4NUUA 3UU3A 1N33T 3ZMTB 2GK9A 5CB4E 3PUVF 3K3NA 2WU2A 3L39A 2E5VA 4K0UA 4YJ3E 5AQKB 2LRLA 3G06A 3PUWF 2YOEA 2DLRA 4GKJT 1ZEEA 3C4WA 3U78A 2MOZA 2JJ9A 5CA0E 1HS7A 2XAFB 4C90A 4OX9T 3WI3A 3KVBA 4CI1B 1G73A 4UF0A 3HKDE 4KMCA 1D0XA 4YHJA 2P9BA 4IL4A 5LG4A 4DBQA 2UXBT 4U3CA 3VKHA 1HTJF 2XSBA 3AE3A 4OYKA 4IL9A 5JDQA 2J62A 3VU7H 3HKEE 3N9PA 2XASB 5FXZA 3KV6A 2L9QA 1IZNB 2IUBA 2BKPA 2W62A 3K3OA 4CXYA 1HF8A 3PURA 4DV6T 2WMNA 3K8PC 3JAFA 1FMVA 2LHRA 2WM9A 2IC9A 3KV5A 4YT0A 4H9OC 2NW8A 1YKHB 4N78D 2VB6A 1XDPA 1Z8UA 3CQGB 3RYHE 4XBFB 4EAHA 2X9XA 3NBXX 4WW0A 4B3RT 3AE7A 5EK4A 4JV5T 2Q9QB 2QVAA 4JI5T 2VVNA 2VVSA 3DJBA 4X5TA 1VOMA 5AQHB 3J9X1 2VKJA 4CI3B 4DV5T 1KNZA 4PK6A 3PE0A 2M6IA 2MAWA 3C4XA 4X64T 4ANJA 3AEEA 4ILBA 4JBWF 4NIQA 4TWDA 3HA4A 1J1JA 1ZOYA 3JCFA 2Q9QD 3BQIA 1XZYA 2VKOA 2XQYA 2N1GA 1KNRA 2FBWA 1NENA 2Z6EA 3A7MA 1VCTA 4TV9E 4AKRB 5CJ5A 3QUJA 2RA1A 3F31A 4IE6A 4MLKA 3AE8A 4YFSA 3C50A 2X9HA 3EUHA 3MKDA 3RYFE 3SFEA 4DMWA 4QWNB 3O1HA 4UVBB 4YTPA 1HNWT 5JRCB 2XAJB 5LGUB 2CRBA 4P1NA 2ODVA 2WP9A 3Q2MA 2XJ7A 4TZ4C 2AXDS 2LSGA 5BR8T 1I6ZA 1EZ3A 4DV3T 3ZYKA 5LGTB 3CIRA 3E08A 4IDZA 3HKCE 4UELA 2MYSA 4Z8XA 5HEHA 3ONLC 1J5WA 3AE9A 2H7VC 4LF4T 3RGLA 3FHNA 5AQNB 5HXEA 1HX8A 2Q9QC 5HAXA 1OWAA 3N9LA 5ABEA 3N9NA 5HWXA 1T98A 5ABFB 3RX6A 1IJ6A 3RIFA 4Z90A 3ZN0B 1JNZA 4ZS2A 2ZM6T 2IMLA 3PUSA 4PW8A 4WYVA 5DQVA 5FMNA 5FY7A 3V5SA 1HNXT 1IBLT 2EHOB 1IJ5A 3ESLA 3AA0B 2QA7A 2HH7A 3FZKB 3GMIA 3EHZA 2K9AA 3Q5WA 4KHZF 3RF1A 2SPCA 2BKNA 3N2GE 2WDVA 4L5GA 2LSIA 4HKAA 4I50E 1XNRT 3AEGA 3TLUA 5DABA 1FJGT 1JNRA 5LB7B 2XQ9A 3ANWB 2HN2A 5FVLA 4HWDA 2XM1A 3FZLB 4DR1T 3AXJA 3P4PA 5AQVB 1SA0E 4U7IA 4CN4A 2DI4A 2E5LT 2UUBT 3NWIA 4GK5E 5IYZE 4B3ST 5AQIB 1WRDA 2H88A 5AQQB 4F8HA 4B3MT 4GOUA 3O9XA 3WAKA 3UUMA 2NTYA 3KINB 2EHOC 3FXEB 4AIUA 4EZ4A 3I0OA 2V7MA 5LGNB 1IBMT 4DR4T 4DV1T 4B3TT 2C5JA 5LXTE 2WU5A 1WR6A 3ZT5A 3CQCB 1I94T 2UU9T 5LYJE 2ZM8A 4ZI3D 3KDSE 3RYCE 4AKLA 1T8BA 2LSJA 2BVLA 1KEYA 4WZXA 2MPKA 3HL6A 5ABGA 2NW7A 2D2SA 3L8RA 4U72A 2BDEA 3PUZF 1CUNA 2BG9E 2E8IA 2OV9A 2CMRA 2PBIA 4X1IE 5E0OA 4XAXB 1BR2A 4JI1T 1VRBA 3RKOA 2WCAA 3SOLA 4DR6T 3AE1A 2IAKA 3RC8A 5CFBA 3P4RA 3PU8A 2BS4A 2DL1A 3EAMA 3IBPA 1MMNA 3I9WA 1QLBA 2D0TA 1N32T 3AE2A 3GA8A 5AQSB 3LFMA 5AQJB 4YXDA 3KFWX 3PU3A 2KT9A 4UV8B 5J0ZA 2FJAA 3UQ4A 3ANWA 3D0TA 2NR4A 4QXBB 2HPJA 2LOSA 3P50A 1SHZC 2E9XA 3NZQA 2K5BB 4IDPA 2BG9A 4OYJA 4TWHA 4UVCB 2LOPA 3TLSA 4DV7T 1YQ4A 5M4YA 1XWMA 2K3WA 3QC9A 4MFRA 1HFAA 5FXWA 2QGSA 3QB5A 5DQWA 3ZMSB 4C91A 4ZOLE 2JIWA 4PJJA 5LP6E 4LFCT 2EHOA 4H9QC 2X0YA 4ISTA 4HFIA 2W0GA 2KINB 4U31A 1QUUA 1XNQT 4OHFA 3VRAA 2X51A 4HFDA 3T1YT 3ONJA 3EABA 2CA5A 5JR9A 3MXZA 5JDLA 2NOXA 1OEDC 4MALA 3ZCIA 1W0BA 3PTRB 2YDRA 4LF8T 5F3JA 3AAEB 4QXCB 1E2AA 4O4IE 3R84B 4F6RC 5LBQB 5J1GA 3UU5A 1D1AA 5HXRA 4TWFA 4X66T 1DU2A 4DR2T 2F4VT 3P4WA 4OFZA 1HG2A 2B76A 4A98A 2CWYA 4IE7A 2E9XD 2KWIB 3OKQA 4GKKT 1OXZA 3LJCA 4LFBT 3HI2A 2CLYC 2H7OA 1W0AA 1MMDA 3VR9A 3Q9DA 3KVAA 3PUXF 4DR3T 4KX6A 4UF0B 4ZZBA 3LBXB 2EHOD 1AJ3A 1D0ZA 2V7IA 2E9XC 3OVUA 4IDOA 4IE0A 1XMQT 1KNPA 3UUNA 1D1CA 3FBZA 2ACXA 2V1DB 4KP3C 3FXDB 4HWIB 2IW5B 4YSXA 3HKBE 1VCSA 3EDUA 2XQ8A 3UTKA 1T72A 3UU8A 5LHGB 5AQLB 3EVYA 4BA9A 4TN7B 4PJLA 5AQTB 4HFEA 5FKYA 3RRWA 5HEJA 1US7B 3OPCA 3SRZA 2UXXB 4UVAB 5F8PA 2XQ5A 4IT4A 2B1EA 1NEKA 1OEDA 4PK5A 4JI7T 2JPFA 2WWUA 2I6HA 3AA6B 1UURA 4JI6T 2BS2A 2XAQB 2X0HA 4NXMT 3LK3B 3LK2B 5KX5E 4ZZCA 3ZT7A 2YU1A 4H9SE 4I4TE 5HEUA 2D5UA 3FBLA 4AQFC 1ZHCA 1H7CA 2VL0A 2CBJA 5LOVE 3RKGA 1MIYA 3ZJ1A 3KBUA 5CGMA 4AKHA 4JI8T 5FY1A 1T7SA 4PJMA 4BAYB 4QH1A 4EYYR 3P4SA 2JRKA 2LHNA 1XDOA 3PUAA 2HPLA 4I0UA 3UUXB 3N9OA 3ZYMA 1KF6A 3DTOA 2G0UA 5HWYA 3ZSSA 2LM2A 3A8YC 4EGWA 2WS3A 4QH4A 5HXCA 4WBNE 5KDMC 5AQUB 1V9DA 1BR4A 1IAPA 2WAUA 3SWHA 1UX5A 3C51A 2LKHA 5GONE 1E7PA 1MMGA 2LRKA 4E7ZA 4ZEYA 3C64A 4ILUA 2BZBA 4PAGA 5LMNT 4YTNA 2E9XB 5L4HA 2D0UA 2X9WA 2RPAA 4HE8A 4JI4T 3LG7A 3N2OA 1SUMB 1HR0T 3LDQB 1E1HB 2VL8A 2QYWA 3L3PA 5L47A 3NRXA 1WCRA 2V5CA 3BK9A 4QX8B 2H89A 3ETUA 5EZYE 1LVFA 2IHR1 3PDYA 4IE5A 3VRBA 1N36T 4ILCA 1ZKEA 2XM2A 1MMAA 2J47A 5HXSA 5L3BB 4HTEA 2X9YA 2J1DG 1YXRA 2LT3A 5H6QB 3J7Yq 2C0SA 4PFPA 3VKGA 3LK42 1O3XA 4X62T 3H37A 3ZMZB 4WBOA 3GWHA 2YINA 2W63A 4QXHB 2MBGA 5JQGE 2V8SV 5A1LA 4DO0A 3LSVA 3I9YA 2HHHT 4JUYA 2CXLA 4HFBA 3S4UA 4LF6T 2WDQA 3I0QA 1WR0A 4IIJE 5IHYA 3TLTA 1SE7A 1KK7A 1OEDB 4ZI3C 3RIUC 1UX4A 3OYXA 3A5XA 2A9UA 2V6YB 4H63H 4HWCA 2Y6XA 4CN1A 3RIAA 5L3CB 4PNIA 2YKSA 2PTFA 2W66A 3AEAA 4GYSA 4O2BE 3ZT6A 1WLXA 5TAOA 4M1PA 3ZSTA 4EEDA 2JQKA 1ZV4X 3N2KE 3TKLB 4IE4A 5AQOB 3GN5B 3TLWA 5AFUL 5ETWA 2ZM2A 5JDFA 5JREA 2YDSA 4LMLA 4FI5A 4DR7T 4YJ2E 5AQGB 2BBHA 4A97A 1UUSA 3KBTA 5ABHA 4AI6A 2VQFT 2BG9B 3ZKRA 4EYUA 2XPKA 3H3MA 1LVKA 2XTLA 3ZC0A 3UUBA 2Y8DA 2CBIA 1M7KA 5LHHB 3CQXC 1FMWA 4X1YE 4COFA 3ZPOA 2V7KA 4NUVA 2N9DA 4QH5A 3OTOT 2XSAA 2AE9A 5L2LA 2V6XA 4B6XA 2OLTA 4EEBA 1J5ET 2R6GF 3QOFA 3F57A 1N34T 4LF9T 3H3AA 2Y48B 5FL1A 3BQLA 3L09A 4YHHT 3AE4A 3M65A 4DNDA 2LLYA 5C8YE 3RIUA 3CX8B 2ZLYA 2N2NA 5JTGA 1BR0A 3UULA 3C98B 2WY2A 3N9QA 4H63V 1HCIA 1UK5A 3B13A 2LSKA 1U5PA 3IEEA 4KUMB 4LMJA 5DJQC 5JDMA 3JC6D 5AQFB 2NP9A 3P7IA 4IDQA 2KWHA 4E7SA 5LNKA 2VURA 3HR0A 3FZHB 5KMGP 2BS3A 4HWFA 2X67A 3DP7A 3R6NA 5LMUT 2XZEA 4KBMB 3RQWA 3UT5E 2I59A 4K0KT 3ONXA 4U2YA 2CLYB 4X1KE 2WBLA 5AQRB 2WB5A 3ZEFB 4U33A 1CHUA 1FIOA 1M62A 5FXVA 4LF5T 3CK6A 3I1AA 5FNVE 4DV2T 1BR1A 4J2CA 5L3DB 4ZI7E 4PK4A 2IIUA 3ZJ2A 4A56A 3OJAA 3RYIE 4A5XA 5IUXA 4YSZA 4AQGA 3K3QC 5EK2A 3QB5K 2X0LB 4IHJE 2CE7A 5ADXL 2JQHA 3F2EA 1LRZA 2CWOA 2WMOA 3CX7B 3M3ZB 4IREA 3RH3A 2V7LA 3AB3B 2ZM0A 3CWZB 3JC6C 4EB6E 2BBJA 1Z0PA 1HG5A 3AVRA 4Q25A 4U74A 5EK3A 2V5DA 4G2AA 2XY8B 2CCQA 3W15B 1UCUA 5L4EA 2MTQA 4HEAA 5HCJA 3UFGA 2YDQA 3P4QA 3ZCJA 1B7TA 3AEDA 3FZMB 4JEHB 2W61A 5H6RB 5HEOA 1W9RA 1Y64B 2NWBA 5JVDE 4BJMA 1D1BA 2HN1A 3NVOA 4P0AA 2X68A 1MNEA 5LA6E 4AQYT 2XQ7A 3MA9A 3OBVE 3AECA 4YLHA 2RP4A 1W09A 4ILAA 3RLFF 2KSRA 4ZXLA 2D9DA 3ZYLA 3U3IA 4G63A 4DR5T 2BKOA 3RI5A 2ACZA 2M6BA 2XQ3A 2DCFA 2FJBA 2CEAA 1MIWA 2LE8A 4QX7B 1R8IA 2C5KT 2KMFA 3AXJB 3FZFB 3NRYA 3FB2A 4MBQA 5JDHA 3PUYF 5FY0A 4YY3T 4UV9B 2J4GA 2VASA 3IA3A 4KI0F 4P09A 2C5IT 4IDNA 4LMKA 5HCMA 1X9BA 2CXDA 1MIVA 3MJXA 4I55E 1GQEA 2KNDA 4O4HE 3UU6A 3B5MA 3ZMUB 4AISA 3P8CD 3MACA 2V7JA 1OEDE 2PJQA 1QSDA 3B57A 4ZS3A 4EIWA 5JH7E 4EZHA 2WDRA 3OYZA 4JI2T 1UGOA 5LHIB 3PJAJ 4HFCA 2K48A 2V6YA 1WFDA 2KLQA 2L8KA 2YEVC 3C4ZA 5JR9C 2W2UA 1S94A 2BVMA 3RPUA 3PUQA 2M67A 2WZIA 2YU2A 3K1SA 2H3RA 2PFVA 2PG8A 2IC6A 3Q5EA 4EV6A 3CVRA 4GIWA 4CXXA 4AKIA 5C2TA 4HGAA 5HYAA 2FUPA 3RHWA 3CMLA 2K24A 2VKHA 1Y01A 2VWAA 2XQ6A 2XQAA 3NKZA 4PFOA 4ZI2D 3LBXA 5JDGA 4JYAT 3N5LA 4L9IA 2ZMAA 4Z91A 3ZLIA 1HNZT 1XMOT 4QKNA 4ZI2C 5JRCA 1YKEB 2FJDA 3CX6B 3E22E 3KV4A 2DWKA 4O8SA 2LM9A 4GK0E 5AQPB 4AXPA 1YQ3A 5CA1E 3UQ7A 4JLEA 5C3JA 2JQ9A 2W00A 3AE5A 3EDVA 4I43B 2JQQA 5HEGA 4P0BA 4EXTA 2XAHB 3AA7B 2FJEA 2ES0A 3PV0F 2LSYA 4DVDA 4YSYA 5BMVE 4DUZT 5FP3A 4ZHQE 3VHLA 1U4QA 4BJNA 2UUCT 1HX1B 3AAIA 4TNVA 1S35A 3JADA 5FXXA 2E2AA 3N9MA 3O1IA 4X65T 2WSSV 4DV4T 4NXNT 2XUEA 1MNDA 3Q5DA 1D0YA 3AVSA 3O4XE 2Q9QA 4O4JE 3ZC1A 4HFHA 2X66A 5LJMA 3CKDA 4X20E 3WAJA 5ABFA 4DIDB 4JI0T 4TUYE 3QK6A 4H9NC 5IWAT 4AKGA 3AAAB 3X1DA 5F5WA 3JAEA 1WYBA 3T8OA 4DMVA 4IGUA 2VQET 5LCYA 1LKXA 2CXFA 2KXPB 2W4XA 3UFEA 3ABVA 3O1JA 2YK0A 4JEUB 1G8XA 4XZCA 3T1HT 4H9RC 3TLVA 2XAGB 4DBRA 3E0ZA 4ASKA 4JI3T 2IDOB 4YTMA 4CN6A 2VKDA 5FVKA 3MZKB 4OK0A 1WYCA 2WQYA 4TNWA 5FYMA 5HXHA 3RQUA 2QRXA 2YN6A 3VR8A 5L3FB 2CHNA 4EOZB 5L3GB 4HWHA 5J2TE 1YD8G 4NPPA 4UEMA 5LG3A 1YW0A 2A3DA 4KHPT 2CM0A 4GYRA 3ZMVB 5JR9B 5LJNA 2CPTA 4ISSA 4O4LE 4U2ZA 3BQKA 3QNUA 4UR9A 2WWVA 3V5UA 3GN5A 3PUGA 4ERRA 4LFAT 2V26A 3AA1B 3SFDA 2DNXA 2OA5A 4UIGA 5L3EB 2UXDT 2A72A 3EI0A 4FJOA 2UUAT
chains in the Genus database with same CATH topology
2BKOA 2BKNA 2I0MA 2IIUA 2OLTA 1SUMB 1XWMA 2BKPA 4Q25A 1T72A 1VCTA 1T8BA 3L39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKO A;  2BKN A;  2I0M A;  2IIU A;  2OLT A;  1SUM B;  1XWM A;  2BKP A;  4Q25 A;  1T72 A;  1VCT A;  1T8B A;  3L39 A; 
#chains in the Genus database with same CATH topology
 4TV8 E;  4UXN B;  5JDN A;  3KV9 A;  2NTX A;  3RRC A;  3Q5X A;  4L0R A;  2UXC T;  4V1A v;  2NW9 A;  5J2U E;  3ETV A;  2JMH A;  2JMK A;  4HN9 A;  4DV0 T;  2UXN B;  4WNK A;  2KZ7 B;  4PJN A;  2W67 A;  1IBK T;  2VK9 A;  1X79 A;  3SS1 A;  2A2F X;  1NAF A;  1ZP0 A;  3MK7 C;  5LBM A;  2L3L A;  2LJL A;  3AEF A;  3PJA A;  4MHC A;  3AE6 A;  2XQ4 A;  4AQF A;  3ZN1 B;  4CI2 B;  4HFV A;  1NWM X;  3IHR A;  4LF7 T;  1FEW A;  4U7Y A;  4QHO A;  4CZZ B;  3IF8 B;  2LEH A;  1KFY A;  5FL0 A;  2CHO A;  3CPZ A;  4CXW A;  4DUY T;  4H9P C;  3UU4 A;  4TX5 A;  1L0V A;  2BG9 C;  4ADZ A;  2XHE B;  2LKG A;  5AQM B;  2ODU A;  2WZH A;  2DWG A;  2I0M A;  3NZP A;  3RC3 A;  4O2A E;  3AEB A;  2DHR A;  4CQI A;  5KXJ A;  4NUU A;  3UU3 A;  1N33 T;  3ZMT B;  2GK9 A;  5CB4 E;  3PUV F;  3K3N A;  2WU2 A;  3L39 A;  2E5V A;  4K0U A;  4YJ3 E;  5AQK B;  2LRL A;  3G06 A;  3PUW F;  2YOE A;  2DLR A;  4GKJ T;  1ZEE A;  3C4W A;  3U78 A;  2MOZ A;  2JJ9 A;  5CA0 E;  1HS7 A;  2XAF B;  4C90 A;  4OX9 T;  3WI3 A;  3KVB A;  4CI1 B;  1G73 A;  4UF0 A;  3HKD E;  4KMC A;  1D0X A;  4YHJ A;  2P9B A;  4IL4 A;  5LG4 A;  4DBQ A;  2UXB T;  4U3C A;  3VKH A;  1HTJ F;  2XSB A;  3AE3 A;  4OYK A;  4IL9 A;  5JDQ A;  2J62 A;  3VU7 H;  3HKE E;  3N9P A;  2XAS B;  5FXZ A;  3KV6 A;  2L9Q A;  1IZN B;  2IUB A;  2BKP A;  2W62 A;  3K3O A;  4CXY A;  1HF8 A;  3PUR A;  4DV6 T;  2WMN A;  3K8P C;  3JAF A;  1FMV A;  2LHR A;  2WM9 A;  2IC9 A;  3KV5 A;  4YT0 A;  4H9O C;  2NW8 A;  1YKH B;  4N78 D;  2VB6 A;  1XDP A;  1Z8U A;  3CQG B;  3RYH E;  4XBF B;  4EAH A;  2X9X A;  3NBX X;  4WW0 A;  4B3R T;  3AE7 A;  5EK4 A;  4JV5 T;  2Q9Q B;  2QVA A;  4JI5 T;  2VVN A;  2VVS A;  3DJB A;  4X5T A;  1VOM A;  5AQH B;  3J9X 1;  2VKJ A;  4CI3 B;  4DV5 T;  1KNZ A;  4PK6 A;  3PE0 A;  2M6I A;  2MAW A;  3C4X A;  4X64 T;  4ANJ A;  3AEE A;  4ILB A;  4JBW F;  4NIQ A;  4TWD A;  3HA4 A;  1J1J A;  1ZOY A;  3JCF A;  2Q9Q D;  3BQI A;  1XZY A;  2VKO A;  2XQY A;  2N1G A;  1KNR A;  2FBW A;  1NEN A;  2Z6E A;  3A7M A;  1VCT A;  4TV9 E;  4AKR B;  5CJ5 A;  3QUJ A;  2RA1 A;  3F31 A;  4IE6 A;  4MLK A;  3AE8 A;  4YFS A;  3C50 A;  2X9H A;  3EUH A;  3MKD A;  3RYF E;  3SFE A;  4DMW A;  4QWN B;  3O1H A;  4UVB B;  4YTP A;  1HNW T;  5JRC B;  2XAJ B;  5LGU B;  2CRB A;  4P1N A;  2ODV A;  2WP9 A;  3Q2M A;  2XJ7 A;  4TZ4 C;  2AXD S;  2LSG A;  5BR8 T;  1I6Z A;  1EZ3 A;  4DV3 T;  3ZYK A;  5LGT B;  3CIR A;  3E08 A;  4IDZ A;  3HKC E;  4UEL A;  2MYS A;  4Z8X A;  5HEH A;  3ONL C;  1J5W A;  3AE9 A;  2H7V C;  4LF4 T;  3RGL A;  3FHN A;  5AQN B;  5HXE A;  1HX8 A;  2Q9Q C;  5HAX A;  1OWA A;  3N9L A;  5ABE A;  3N9N A;  5HWX A;  1T98 A;  5ABF B;  3RX6 A;  1IJ6 A;  3RIF A;  4Z90 A;  3ZN0 B;  1JNZ A;  4ZS2 A;  2ZM6 T;  2IML A;  3PUS A;  4PW8 A;  4WYV A;  5DQV A;  5FMN A;  5FY7 A;  3V5S A;  1HNX T;  1IBL T;  2EHO B;  1IJ5 A;  3ESL A;  3AA0 B;  2QA7 A;  2HH7 A;  3FZK B;  3GMI A;  3EHZ A;  2K9A A;  3Q5W A;  4KHZ F;  3RF1 A;  2SPC A;  2BKN A;  3N2G E;  2WDV A;  4L5G A;  2LSI A;  4HKA A;  4I50 E;  1XNR T;  3AEG A;  3TLU A;  5DAB A;  1FJG T;  1JNR A;  5LB7 B;  2XQ9 A;  3ANW B;  2HN2 A;  5FVL A;  4HWD A;  2XM1 A;  3FZL B;  4DR1 T;  3AXJ A;  3P4P A;  5AQV B;  1SA0 E;  4U7I A;  4CN4 A;  2DI4 A;  2E5L T;  2UUB T;  3NWI A;  4GK5 E;  5IYZ E;  4B3S T;  5AQI B;  1WRD A;  2H88 A;  5AQQ B;  4F8H A;  4B3M T;  4GOU A;  3O9X A;  3WAK A;  3UUM A;  2NTY A;  3KIN B;  2EHO C;  3FXE B;  4AIU A;  4EZ4 A;  3I0O A;  2V7M A;  5LGN B;  1IBM T;  4DR4 T;  4DV1 T;  4B3T T;  2C5J A;  5LXT E;  2WU5 A;  1WR6 A;  3ZT5 A;  3CQC B;  1I94 T;  2UU9 T;  5LYJ E;  2ZM8 A;  4ZI3 D;  3KDS E;  3RYC E;  4AKL A;  1T8B A;  2LSJ A;  2BVL A;  1KEY A;  4WZX A;  2MPK A;  3HL6 A;  5ABG A;  2NW7 A;  2D2S A;  3L8R A;  4U72 A;  2BDE A;  3PUZ F;  1CUN A;  2BG9 E;  2E8I A;  2OV9 A;  2CMR A;  2PBI A;  4X1I E;  5E0O A;  4XAX B;  1BR2 A;  4JI1 T;  1VRB A;  3RKO A;  2WCA A;  3SOL A;  4DR6 T;  3AE1 A;  2IAK A;  3RC8 A;  5CFB A;  3P4R A;  3PU8 A;  2BS4 A;  2DL1 A;  3EAM A;  3IBP A;  1MMN A;  3I9W A;  1QLB A;  2D0T A;  1N32 T;  3AE2 A;  3GA8 A;  5AQS B;  3LFM A;  5AQJ B;  4YXD A;  3KFW X;  3PU3 A;  2KT9 A;  4UV8 B;  5J0Z A;  2FJA A;  3UQ4 A;  3ANW A;  3D0T A;  2NR4 A;  4QXB B;  2HPJ A;  2LOS A;  3P50 A;  1SHZ C;  2E9X A;  3NZQ A;  2K5B B;  4IDP A;  2BG9 A;  4OYJ A;  4TWH A;  4UVC B;  2LOP A;  3TLS A;  4DV7 T;  1YQ4 A;  5M4Y A;  1XWM A;  2K3W A;  3QC9 A;  4MFR A;  1HFA A;  5FXW A;  2QGS A;  3QB5 A;  5DQW A;  3ZMS B;  4C91 A;  4ZOL E;  2JIW A;  4PJJ A;  5LP6 E;  4LFC T;  2EHO A;  4H9Q C;  2X0Y A;  4IST A;  4HFI A;  2W0G A;  2KIN B;  4U31 A;  1QUU A;  1XNQ T;  4OHF A;  3VRA A;  2X51 A;  4HFD A;  3T1Y T;  3ONJ A;  3EAB A;  2CA5 A;  5JR9 A;  3MXZ A;  5JDL A;  2NOX A;  1OED C;  4MAL A;  3ZCI A;  1W0B A;  3PTR B;  2YDR A;  4LF8 T;  5F3J A;  3AAE B;  4QXC B;  1E2A A;  4O4I E;  3R84 B;  4F6R C;  5LBQ B;  5J1G A;  3UU5 A;  1D1A A;  5HXR A;  4TWF A;  4X66 T;  1DU2 A;  4DR2 T;  2F4V T;  3P4W A;  4OFZ A;  1HG2 A;  2B76 A;  4A98 A;  2CWY A;  4IE7 A;  2E9X D;  2KWI B;  3OKQ A;  4GKK T;  1OXZ A;  3LJC A;  4LFB T;  3HI2 A;  2CLY C;  2H7O A;  1W0A A;  1MMD A;  3VR9 A;  3Q9D A;  3KVA A;  3PUX F;  4DR3 T;  4KX6 A;  4UF0 B;  4ZZB A;  3LBX B;  2EHO D;  1AJ3 A;  1D0Z A;  2V7I A;  2E9X C;  3OVU A;  4IDO A;  4IE0 A;  1XMQ T;  1KNP A;  3UUN A;  1D1C A;  3FBZ A;  2ACX A;  2V1D B;  4KP3 C;  3FXD B;  4HWI B;  2IW5 B;  4YSX A;  3HKB E;  1VCS A;  3EDU A;  2XQ8 A;  3UTK A;  1T72 A;  3UU8 A;  5LHG B;  5AQL B;  3EVY A;  4BA9 A;  4TN7 B;  4PJL A;  5AQT B;  4HFE A;  5FKY A;  3RRW A;  5HEJ A;  1US7 B;  3OPC A;  3SRZ A;  2UXX B;  4UVA B;  5F8P A;  2XQ5 A;  4IT4 A;  2B1E A;  1NEK A;  1OED A;  4PK5 A;  4JI7 T;  2JPF A;  2WWU A;  2I6H A;  3AA6 B;  1UUR A;  4JI6 T;  2BS2 A;  2XAQ B;  2X0H A;  4NXM T;  3LK3 B;  3LK2 B;  5KX5 E;  4ZZC A;  3ZT7 A;  2YU1 A;  4H9S E;  4I4T E;  5HEU A;  2D5U A;  3FBL A;  4AQF C;  1ZHC A;  1H7C A;  2VL0 A;  2CBJ A;  5LOV E;  3RKG A;  1MIY A;  3ZJ1 A;  3KBU A;  5CGM A;  4AKH A;  4JI8 T;  5FY1 A;  1T7S A;  4PJM A;  4BAY B;  4QH1 A;  4EYY R;  3P4S A;  2JRK A;  2LHN A;  1XDO A;  3PUA A;  2HPL A;  4I0U A;  3UUX B;  3N9O A;  3ZYM A;  1KF6 A;  3DTO A;  2G0U A;  5HWY A;  3ZSS A;  2LM2 A;  3A8Y C;  4EGW A;  2WS3 A;  4QH4 A;  5HXC A;  4WBN E;  5KDM C;  5AQU B;  1V9D A;  1BR4 A;  1IAP A;  2WAU A;  3SWH A;  1UX5 A;  3C51 A;  2LKH A;  5GON E;  1E7P A;  1MMG A;  2LRK A;  4E7Z A;  4ZEY A;  3C64 A;  4ILU A;  2BZB A;  4PAG A;  5LMN T;  4YTN A;  2E9X B;  5L4H A;  2D0U A;  2X9W A;  2RPA A;  4HE8 A;  4JI4 T;  3LG7 A;  3N2O A;  1SUM B;  1HR0 T;  3LDQ B;  1E1H B;  2VL8 A;  2QYW A;  3L3P A;  5L47 A;  3NRX A;  1WCR A;  2V5C A;  3BK9 A;  4QX8 B;  2H89 A;  3ETU A;  5EZY E;  1LVF A;  2IHR 1;  3PDY A;  4IE5 A;  3VRB A;  1N36 T;  4ILC A;  1ZKE A;  2XM2 A;  1MMA A;  2J47 A;  5HXS A;  5L3B B;  4HTE A;  2X9Y A;  2J1D G;  1YXR A;  2LT3 A;  5H6Q B;  3J7Y q;  2C0S A;  4PFP A;  3VKG A;  3LK4 2;  1O3X A;  4X62 T;  3H37 A;  3ZMZ B;  4WBO A;  3GWH A;  2YIN A;  2W63 A;  4QXH B;  2MBG A;  5JQG E;  2V8S V;  5A1L A;  4DO0 A;  3LSV A;  3I9Y A;  2HHH T;  4JUY A;  2CXL A;  4HFB A;  3S4U A;  4LF6 T;  2WDQ A;  3I0Q A;  1WR0 A;  4IIJ E;  5IHY A;  3TLT A;  1SE7 A;  1KK7 A;  1OED B;  4ZI3 C;  3RIU C;  1UX4 A;  3OYX A;  3A5X A;  2A9U A;  2V6Y B;  4H63 H;  4HWC A;  2Y6X A;  4CN1 A;  3RIA A;  5L3C B;  4PNI A;  2YKS A;  2PTF A;  2W66 A;  3AEA A;  4GYS A;  4O2B E;  3ZT6 A;  1WLX A;  5TAO A;  4M1P A;  3ZST A;  4EED A;  2JQK A;  1ZV4 X;  3N2K E;  3TKL B;  4IE4 A;  5AQO B;  3GN5 B;  3TLW A;  5AFU L;  5ETW A;  2ZM2 A;  5JDF A;  5JRE A;  2YDS A;  4LML A;  4FI5 A;  4DR7 T;  4YJ2 E;  5AQG B;  2BBH A;  4A97 A;  1UUS A;  3KBT A;  5ABH A;  4AI6 A;  2VQF T;  2BG9 B;  3ZKR A;  4EYU A;  2XPK A;  3H3M A;  1LVK A;  2XTL A;  3ZC0 A;  3UUB A;  2Y8D A;  2CBI A;  1M7K A;  5LHH B;  3CQX C;  1FMW A;  4X1Y E;  4COF A;  3ZPO A;  2V7K A;  4NUV A;  2N9D A;  4QH5 A;  3OTO T;  2XSA A;  2AE9 A;  5L2L A;  2V6X A;  4B6X A;  2OLT A;  4EEB A;  1J5E T;  2R6G F;  3QOF A;  3F57 A;  1N34 T;  4LF9 T;  3H3A A;  2Y48 B;  5FL1 A;  3BQL A;  3L09 A;  4YHH T;  3AE4 A;  3M65 A;  4DND A;  2LLY A;  5C8Y E;  3RIU A;  3CX8 B;  2ZLY A;  2N2N A;  5JTG A;  1BR0 A;  3UUL A;  3C98 B;  2WY2 A;  3N9Q A;  4H63 V;  1HCI A;  1UK5 A;  3B13 A;  2LSK A;  1U5P A;  3IEE A;  4KUM B;  4LMJ A;  5DJQ C;  5JDM A;  3JC6 D;  5AQF B;  2NP9 A;  3P7I A;  4IDQ A;  2KWH A;  4E7S A;  5LNK A;  2VUR A;  3HR0 A;  3FZH B;  5KMG P;  2BS3 A;  4HWF A;  2X67 A;  3DP7 A;  3R6N A;  5LMU T;  2XZE A;  4KBM B;  3RQW A;  3UT5 E;  2I59 A;  4K0K T;  3ONX A;  4U2Y A;  2CLY B;  4X1K E;  2WBL A;  5AQR B;  2WB5 A;  3ZEF B;  4U33 A;  1CHU A;  1FIO A;  1M62 A;  5FXV A;  4LF5 T;  3CK6 A;  3I1A A;  5FNV E;  4DV2 T;  1BR1 A;  4J2C A;  5L3D B;  4ZI7 E;  4PK4 A;  2IIU A;  3ZJ2 A;  4A56 A;  3OJA A;  3RYI E;  4A5X A;  5IUX A;  4YSZ A;  4AQG A;  3K3Q C;  5EK2 A;  3QB5 K;  2X0L B;  4IHJ E;  2CE7 A;  5ADX L;  2JQH A;  3F2E A;  1LRZ A;  2CWO A;  2WMO A;  3CX7 B;  3M3Z B;  4IRE A;  3RH3 A;  2V7L A;  3AB3 B;  2ZM0 A;  3CWZ B;  3JC6 C;  4EB6 E;  2BBJ A;  1Z0P A;  1HG5 A;  3AVR A;  4Q25 A;  4U74 A;  5EK3 A;  2V5D A;  4G2A A;  2XY8 B;  2CCQ A;  3W15 B;  1UCU A;  5L4E A;  2MTQ A;  4HEA A;  5HCJ A;  3UFG A;  2YDQ A;  3P4Q A;  3ZCJ A;  1B7T A;  3AED A;  3FZM B;  4JEH B;  2W61 A;  5H6R B;  5HEO A;  1W9R A;  1Y64 B;  2NWB A;  5JVD E;  4BJM A;  1D1B A;  2HN1 A;  3NVO A;  4P0A A;  2X68 A;  1MNE A;  5LA6 E;  4AQY T;  2XQ7 A;  3MA9 A;  3OBV E;  3AEC A;  4YLH A;  2RP4 A;  1W09 A;  4ILA A;  3RLF F;  2KSR A;  4ZXL A;  2D9D A;  3ZYL A;  3U3I A;  4G63 A;  4DR5 T;  2BKO A;  3RI5 A;  2ACZ A;  2M6B A;  2XQ3 A;  2DCF A;  2FJB A;  2CEA A;  1MIW A;  2LE8 A;  4QX7 B;  1R8I A;  2C5K T;  2KMF A;  3AXJ B;  3FZF B;  3NRY A;  3FB2 A;  4MBQ A;  5JDH A;  3PUY F;  5FY0 A;  4YY3 T;  4UV9 B;  2J4G A;  2VAS A;  3IA3 A;  4KI0 F;  4P09 A;  2C5I T;  4IDN A;  4LMK A;  5HCM A;  1X9B A;  2CXD A;  1MIV A;  3MJX A;  4I55 E;  1GQE A;  2KND A;  4O4H E;  3UU6 A;  3B5M A;  3ZMU B;  4AIS A;  3P8C D;  3MAC A;  2V7J A;  1OED E;  2PJQ A;  1QSD A;  3B57 A;  4ZS3 A;  4EIW A;  5JH7 E;  4EZH A;  2WDR A;  3OYZ A;  4JI2 T;  1UGO A;  5LHI B;  3PJA J;  4HFC A;  2K48 A;  2V6Y A;  1WFD A;  2KLQ A;  2L8K A;  2YEV C;  3C4Z A;  5JR9 C;  2W2U A;  1S94 A;  2BVM A;  3RPU A;  3PUQ A;  2M67 A;  2WZI A;  2YU2 A;  3K1S A;  2H3R A;  2PFV A;  2PG8 A;  2IC6 A;  3Q5E A;  4EV6 A;  3CVR A;  4GIW A;  4CXX A;  4AKI A;  5C2T A;  4HGA A;  5HYA A;  2FUP A;  3RHW A;  3CML A;  2K24 A;  2VKH A;  1Y01 A;  2VWA A;  2XQ6 A;  2XQA A;  3NKZ A;  4PFO A;  4ZI2 D;  3LBX A;  5JDG A;  4JYA T;  3N5L A;  4L9I A;  2ZMA A;  4Z91 A;  3ZLI A;  1HNZ T;  1XMO T;  4QKN A;  4ZI2 C;  5JRC A;  1YKE B;  2FJD A;  3CX6 B;  3E22 E;  3KV4 A;  2DWK A;  4O8S A;  2LM9 A;  4GK0 E;  5AQP B;  4AXP A;  1YQ3 A;  5CA1 E;  3UQ7 A;  4JLE A;  5C3J A;  2JQ9 A;  2W00 A;  3AE5 A;  3EDV A;  4I43 B;  2JQQ A;  5HEG A;  4P0B A;  4EXT A;  2XAH B;  3AA7 B;  2FJE A;  2ES0 A;  3PV0 F;  2LSY A;  4DVD A;  4YSY A;  5BMV E;  4DUZ T;  5FP3 A;  4ZHQ E;  3VHL A;  1U4Q A;  4BJN A;  2UUC T;  1HX1 B;  3AAI A;  4TNV A;  1S35 A;  3JAD A;  5FXX A;  2E2A A;  3N9M A;  3O1I A;  4X65 T;  2WSS V;  4DV4 T;  4NXN T;  2XUE A;  1MND A;  3Q5D A;  1D0Y A;  3AVS A;  3O4X E;  2Q9Q A;  4O4J E;  3ZC1 A;  4HFH A;  2X66 A;  5LJM A;  3CKD A;  4X20 E;  3WAJ A;  5ABF A;  4DID B;  4JI0 T;  4TUY E;  3QK6 A;  4H9N C;  5IWA T;  4AKG A;  3AAA B;  3X1D A;  5F5W A;  3JAE A;  1WYB A;  3T8O A;  4DMV A;  4IGU A;  2VQE T;  5LCY A;  1LKX A;  2CXF A;  2KXP B;  2W4X A;  3UFE A;  3ABV A;  3O1J A;  2YK0 A;  4JEU B;  1G8X A;  4XZC A;  3T1H T;  4H9R C;  3TLV A;  2XAG B;  4DBR A;  3E0Z A;  4ASK A;  4JI3 T;  2IDO B;  4YTM A;  4CN6 A;  2VKD A;  5FVK A;  3MZK B;  4OK0 A;  1WYC A;  2WQY A;  4TNW A;  5FYM A;  5HXH A;  3RQU A;  2QRX A;  2YN6 A;  3VR8 A;  5L3F B;  2CHN A;  4EOZ B;  5L3G B;  4HWH A;  5J2T E;  1YD8 G;  4NPP A;  4UEM A;  5LG3 A;  1YW0 A;  2A3D A;  4KHP T;  2CM0 A;  4GYR A;  3ZMV B;  5JR9 B;  5LJN A;  2CPT A;  4ISS A;  4O4L E;  4U2Z A;  3BQK A;  3QNU A;  4UR9 A;  2WWV A;  3V5U A;  3GN5 A;  3PUG A;  4ERR A;  4LFA T;  2V26 A;  3AA1 B;  3SFD A;  2DNX A;  2OA5 A;  4UIG A;  5L3E B;  2UXD T;  2A72 A;  3EI0 A;  4FJO A;  2UUA T; 
#chains in the Genus database with same CATH homology
 2BKO A;  2BKN A;  2I0M A;  2IIU A;  2OLT A;  1SUM B;  1XWM A;  2BKP A;  4Q25 A;  1T72 A;  1VCT A;  1T8B A;  3L39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...