4Q25A

Crystal structure of phou from pseudomonas aeruginosa
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
211
structure length
211
Chain Sequence
b'SQQFNAELEDVRSHLLAMGGLVEKQVNDAVNALIDADSGLAQQVREIDDQINQMERNIDEECVRILARRQPAASDLRLIISISKSVIDLERIGDEASKVARRAIQLCEEGESPRGYVEVRHIGSQVQKMVQEALDAFARFDADLALSVAQYDKTVDREYKTALRELVTYMMEDPRAISRVLNIIWALRSLERIGDHARNIAELVIYLVRGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate-specific transport system accessory protein PhoU h
molecule tags Unknown function
source organism Pseudomonas aeruginosa
publication title Crystal structure of PhoU from Pseudomonas aeruginosa, a negative regulator of the Pho regulon.
pubmed doi rcsb
total genus 106
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A01
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A02
3L39A 2BKPA 1T72A 2OLTA 1VCTA 1SUMB 4Q25A 2IIUA 2I0MA 1XWMA 2BKOA 1T8BA 2BKNA
chains in the Genus database with same CATH superfamily
5FY1A 3O1JA 2MOZA 4ISTA 4OX9T 2AE9A 3ZEFB 3LJCA 3ZN1B 4H9QC 1CUNA 3B57A 4DV1T 3PUAA 4DV5T 4JV5T 2RPAA 1E7PA 3O1IA 3PUSA 3U3IA 5KXJA 4ZI7E 4YT0A 4DIDB 4AI6A 2K48A 2KINB 4ILCA 2WP9A 2IUBA 3CVRA 2K9AA 3IF8B 4ADZA 5FVLA 2XM1A 4IDNA 3RRCA 4H63V 3LDQB 4H9OC 1LKXA 3MZKB 4PJLA 2UXDT 5L47A 3J9X1 5AQNB 5AQTB 3RIUA 3AEAA 2LE8A 1AJ3A 1HX8A 3ZYLA 1MIVA 2W63A 3KDSE 1BR2A 4WNKA 4PJNA 2EHOD 5FL0A 3UUBA 5J2TE 4DV7T 2DHRA 4JI5T 3ZMTB 3FB2A 5JDLA 4Z90A 3RGLA 3FZMB 1Y01A 4OFZA 3AE4A 5LG3A 5EK3A 2XQ5A 1FMWA 2CWYA 2DWKA 4U7IA 5A1LA 5ABHA 5CJ5A 5FMNA 2E5LT 2PBIA 2W4XA 2PG8A 2CHOA 3ZT5A 1J5ET 2CXLA 5ETWA 2WU2A 5ABFB 1OEDA 5HEHA 2NTYA 4U3CA 2ACXA 5C8YE 4DR1T 5LGNB 1S94A 4K0UA 4ZS3A 5FP3A 4UR9A 3I9WA 2XAJB 2XPKA 5JDFA 2CXFA 5AQPB 5IWAT 2OA5A 4HTEA 4O2AE 4QKNA 1KEYA 1D1CA 1MMNA 3K3QC 3KVAA 4ILUA 3FZFB 4LF5T 5ADXL 2Q9QC 4N78D 3FZHB 2XQ7A 4CXXA 3FZLB 5FXZA 2NTXA 5LHHB 3AXJB 2ODUA 2XASB 4NPPA 2WCAA 5L2LA 3KBTA 2VQET 4GKJT 1WR6A 4HWDA 4I50E 3WAKA 4LF9T 1UX5A 3FBLA 3HL6A 2YU1A 5LOVE 3NWIA 3Q2MA 5LYJE 2LKGA 2EHOB 2E2AA 3ZPOA 1XDOA 5HCMA 3VRAA 4UF0A 3EUHA 1IZNB 5AQKB 5HAXA 2BG9B 2ODVA 3PJAA 4V1Av 3I0OA 5AQMB 3UUXB 3W15B 4HWFA 1ZP0A 3IHRA 2VL8A 2Y8DA 4H63H 1XNQT 3AEBA 4X62T 2WB5A 3NKZA 4DR3T 3LBXA 1HNXT 2WZIA 1MIWA 2LT3A 4IE6A 4YSXA 3EI0A 3ZT6A 3P8CD 1G73A 5LBMA 1W9RA 2C0SA 4JBWF 4UV9B 2FBWA 4L5GA 3N9QA 4DR7T 1T98A 2XSAA 2XQAA 5AQQB 2V5DA 3Q9DA 2QGSA 2I59A 2XAHB 2CLYC 1BR4A 2XQ8A 2UUAT 3H3AA 4KHZF 4PFPA 4ZI2D 1UGOA 2CA5A 2M6BA 1NENA 1N32T 3LBXB 3L09A 5L3CB 1DU2A 4H9NC 4DUZT 3PJAJ 5FY0A 5JDNA 4X65T 1OXZA 4TN7B 5CA0E 2KWIB 4F6RC 3CWZB 1O3XA 2H89A 2LEHA 3MKDA 4F8HA 2HHHT 3ESLA 5JQGE 4YJ3E 1D1AA 2E9XC 2CLYB 2LRKA 1LVKA 1OEDC 3JCFA 4HE8A 4P0BA 5HXRA 2CBJA 1KNRA 3EAMA 2V7IA 4YTMA 3I9YA 3X1DA 5F3JA 2X51A 2CEAA 4JUYA 1MMDA 3E08A 4LF6T 1HTJF 2L9QA 2NOXA 2LSGA 4AISA 2V6YA 3UT5E 2A2FX 1M7KA 3AE3A 3QNUA 3UULA 2A72A 4COFA 3T1HT 2I6HA 3K8PC 1MIYA 2IC9A 3PV0F 1D0YA 2Q9QA 3N9NA 4LMLA 4U72A 5DABA 4ASKA 3PE0A 4X64T 3T1YT 1UCUA 4YHJA 4EZHA 2X0HA 4O2BE 3RRWA 2VK9A 3RYFE 2UUCT 2K24A 1HX1B 2FJDA 2G0UA 3RLFF 4B6XA 2JMKA 2X68A 2XAGB 1UURA 4HWCA 3P4SA 4IE4A 4QH4A 2WDRA 2PFVA 2X67A 3SFEA 5FNVE 3Q5DA 1W0AA 3BK9A 4HFDA 3ZLIA 3ZC0A 1W0BA 3ANWB 5JREA 1I6ZA 1OEDB 4U7YA 5HXEA 3CQCB 3MXZA 2E9XB 2I0MA 2WU5A 3TLTA 5EK2A 2QVAA 3JADA 2A9UA 2UXXB 5ABFA 2KWHA 1YQ3A 2V6XA 3KV6A 4QXBB 5L3DB 3GMIA 3PUYF 2FJBA 4H9PC 4A5XA 4CN1A 1IBMT 3PUXF 4JI4T 4LF7T 4LFAT 2XAQB 2ZM8A 1HS7A 4TV9E 4EGWA 4UELA 1IJ5A 1KNPA 3C50A 2V7KA 4TWFA 4EEDA 4X5TA 4CQIA 3SWHA 2WWVA 4KMCA 3QOFA 2CBIA 4JEHB 3QK6A 1HR0T 3UU8A 2DNXA 3FBZA 2MAWA 5AQFB 1B7TA 3EDVA 3FXDB 4UIGA 4G63A 3ETVA 4WW0A 4JLEA 2W0GA 4X1YE 3T8OA 4KI0F 4JYAT 1SA0E 2BDEA 2FUPA 4UEMA 5LBQB 3N2GE 1YXRA 2XM2A 1J1JA 4OYKA 2J47A 3PUWF 1VCTA 4A97A 2BS2A 3QUJA 4K0KT 2BG9C 4J2CA 4OK0A 2XSBA 5LP6E 3O9XA 3DTOA 2BS4A 3TKLB 4YFSA 3P50A 4DR6T 1YD8G 2EHOC 3KV4A 5DJQC 2CCQA 4JI2T 2WMNA 2WSSV 5BR8T 1X9BA 1US7B 2GK9A 2X66A 2IAKA 2N2NA 3SFDA 4HFEA 4E7ZA 5JTGA 3QB5A 2LSKA 3PU8A 5HEOA 3ZJ2A 4LFCT 1U4QA 2M6IA 3TLUA 2VURA 5FL1A 3OYXA 1X79A 2X9YA 1FEWA 1T8BA 2AXDS 2BBHA 2V7LA 3OYZA 4IL9A 3ONLC 4PK5A 3ONJA 4TZ4C 2D2SA 2D5UA 1MMGA 1MNEA 4X1KE 4BJMA 2Z6EA 4EZ4A 2KSRA 4AQYT 2BVMA 1NWMX 3CQGB 3L3PA 3NZQA 1KFYA 5HWYA 5IHYA 3RYHE 4DV4T 3AVRA 4JI6T 5IYZE 5LGUB 2LLYA 3AAEB 3KVBA 4YSZA 3NVOA 3ONXA 4NIQA 2ACZA 2BS3A 4AKRB 3HA4A 4PK6A 4AQFA 3MJXA 2DI4A 4ILBA 4MLKA 4AIUA 4C91A 2HH7A 3F31A 3GN5A 1R8IA 1ZHCA 3CMLA 4U2ZA 3CX7B 5GONE 4ZI3C 5CA1E 3AE2A 4QH5A 2V7JA 4X66T 2MTQA 4XBFB 3LFMA 4KBMB 1S35A 4UVBB 4C90A 4CN6A 2K5BB 4IHJE 1ZOYA 1EZ3A 1WR0A 4NUVA 4IE5A 4DNDA 1UX4A 2LSJA 4GYRA 4WYVA 2C5KT 2IC6A 1Z8UA 2VKDA 1IAPA 1UK5A 2JRKA 3ETUA 2OV9A 3NRXA 4Q25A 5CB4E 3SRZA 2X9WA 4JI3T 3AE9A 2XHEB 1HG5A 1HCIA 3IA3A 1Y64B 3K3OA 3ZJ1A 2DWGA 5AQUB 3RPUA 4DR4T 4HEAA 1I94T 3PTRB 2NR4A 4OYJA 2J1DG 1SUMB 2W67A 2X9HA 4PJMA 3OTOT 2CWOA 2C5IT 3GWHA 5L4HA 5JR9B 5LXTE 3WAJA 2CHNA 5JDMA 3L39A 1HF8A 3AEFA 4IT4A 4LMJA 4KX6A 2HN2A 5E0OA 5L3BB 1HNWT 2Y48B 4HN9A 1JNZA 4TWDA 5DQWA 4JI8T 3H37A 2H88A 4DMWA 4UVCB 5L3FB 4DV6T 3JC6C 5LCYA 3N9OA 4LF8T 4KHPT 4AKIA 3IBPA 4EXTA 4B3ST 2CM0A 3SOLA 4O4LE 5JRCA 2LSIA 3AEDA 2X0YA 5JRCB 4DV3T 2IIUA 5AQJB 1SE7A 2J62A 4HGAA 3VHLA 4OHFA 3A7MA 2NW8A 5KMGP 2W00A 2W66A 3OKQA 4FJOA 3UUNA 3UU5A 2WY2A 4EAHA 1XZYA 4GK5E 4DUYT 4ZI3D 4IREA 1W09A 1HG2A 2X9XA 3AEGA 4TWHA 1JNRA 2SPCA 3VRBA 3P4WA 1OEDE 5FYMA 2PJQA 1KK7A 5IUXA 2JJ9A 2VL0A 4PW8A 4MFRA 4ZEYA 4I55E 2LKHA 2B1EA 3RYCE 4CI2B 4B3MT 4BJNA 1D0ZA 1U5PA 4KUMB 1L0VA 2PTFA 4IDOA 2NW9A 2JQ9A 1ZKEA 3MA9A 3KV5A 2KLQA 2IMLA 3OPCA 4YTPA 3DP7A 2XAFB 4EV6A 3PUZF 2ZMAA 3HR0A 3N5LA 4HFCA 4EYYR 5HEJA 3AE7A 4BAYB 2YINA 3C98B 5C2TA 3OBVE 4JI7T 4TNWA 5ABGA 2ZM6T 1FMVA 2YDQA 4ANJA 4ZI2C 2XTLA 3N9MA 3TLWA 4AQGA 4LFBT 4ZZCA 2RP4A 3BQIA 2XQ6A 3HKCE 4PJJA 3C51A 3OVUA 4E7SA 4HKAA 3LSVA 5EZYE 3UUMA 3ZSTA 4P09A 4DR5T 4P1NA 2IHR1 2ZM0A 3LG7A 4CXYA 1YW0A 3AECA 2UXCT 2A3DA 2B76A 2FJEA 1ZEEA 2P9BA 2W61A 2WWUA 3Q5XA 2XJ7A 2LJLA 3P7IA 4IDPA 4QXHB 3A5XA 5AQRB 5F5WA 5TAOA 3R84B 2C5JA 3CX6B 4U2YA 3ZMZB 4UXNB 4NXNT 2LOPA 3I1AA 1BR1A 4I43B 2YDSA 1IBKT 1WLXA 1YKHB 2D0TA 2E8IA 2F4VT 4I4TE 1D0XA 2LRLA 3LK2B 3VR8A 1NEKA 4AXPA 2BKNA 3LK42 4YXDA 5LJNA 1KNZA 2ZLYA 3FXEB 3DJBA 3RYIE 1M62A 1WFDA 3TLSA 4B3TT 5AQVB 2VVNA 4ZZBA 2YKSA 4FI5A 3OJAA 2Y6XA 2WS3A 4ERRA 4GKKT 3CK6A 4CXWA 3RC8A 4H9SE 3CX8B 5EK4A 1XNRT 3C64A 5FY7A 2VB6A 2UU9T 4TV8E 2LHRA 5AQOB 3ZCIA 4YTNA 5HEGA 3J7Yq 1XMQT 1V9DA 1G8XA 5C3JA 3ZMUB 1YQ4A 4DV0T 3IEEA 4X1IE 4CZZB 3RKGA 1VCSA 4WZXA 3PUGA 2W2UA 4P0AA 2YN6A 1XWMA 1N36T 2ZM2A 4MBQA 2RA1A 5JDHA 3RIFA 3RIAA 1H7CA 2D9DA 2J4GA 3KBUA 5CFBA 4CI1B 4EEBA 5H6RB 4YLHA 2VASA 3E22E 4H9RC 2DL1A 2Q9QD 2QA7A 5JVDE 2QRXA 3C4WA 1E1HB 5LB7B 4ZHQE 1LRZA 5LHGB 3LK3B 4YJ2E 2CE7A 4G2AA 4GYSA 2BG9E 5LHIB 3F57A 3AE5A 4PK4A 1ZV4X 4WBOA 1N33T 4EYUA 2OLTA 2K3WA 4GOUA 3CIRA 3RF1A 3R6NA 2HPLA 2V7MA 2CRBA 3G06A 4X20E 2E9XA 2H7OA 3BQKA 3EVYA 3PURA 1WYCA 2BKPA 2JPFA 2VKJA 1VOMA 2UUBT 3ANWA 3K3NA 4MALA 4QXCB 3KFWX 3AVSA 3KV9A 2HN1A 3U78A 3RQUA 4DBQA 1QUUA 4U31A 5J2UE 4DR2T 3AE8A 4DBRA 2WDVA 3AE1A 5FVKA 1WRDA 2MBGA 3L8RA 4PFOA 5FXWA 3AA7B 3M3ZB 4I0UA 2XY8B 3UTKA 4ZXLA 3AB3B 3UU3A 5L4EA 5LJMA 1VRBA 5H6QB 5J0ZA 2Q9QB 2YEVC 4DMVA 2YOEA 3RHWA 2V1DB 4HWHA 3A8YC 5FKYA 5LG4A 4UV8B 2XUEA 1IJ6A 2V6YB 1SHZC 3FZKB 4O4IE 5JH7E 4LF4T 1J5WA 4JEUB 2JQKA 2D0UA 2WZHA 4L0RA 4XAXB 3VU7H 2N1GA 5L3EB 3O1HA 5HEUA 3UQ4A 4AKLA 1N34T 4O4JE 3JAFA 3MACA 5LA6E 1T72A 4GIWA 3M65A 4DV2T 4JI0T 3SS1A 2LM9A 3JAEA 1MMAA 4TNVA 1WCRA 1D1BA 3CKDA 3JC6D 3PU3A 4PNIA 5HCJA 5KDMC 4IDQA 5AQIB 3ABVA 3ZYMA 1E2AA 1MNDA 4YHHT 2E5VA 2JMHA 1WYBA 1HNZT 5DQVA 2UXBT 4HFVA 2XQYA 2CXDA 3F2EA 2R6GF 2IDOB 2NW7A 2UXNB 3N2OA 2WQYA 3QB5K 4HFHA 3ZCJA 2H7VC 2DLRA 3ZN0B 5HXSA 1KF6A 3Q5EA 2YDRA 4ISSA 4BA9A 4UVAB 2CMRA 4YSYA 5LMNT 5FXVA 3S4UA 5LGTB 4IDZA 2M67A 5JDGA 1FIOA 3PUQA 4L9IA 4O4HE 3AA6B 3ZKRA 3NRYA 2WAUA 3CPZA 5LMUT 3RX6A 1OWAA 4QWNB 3N2KE 5FXXA 3BQLA 4HWIB 3WI3A 3H3MA 3NZPA 3N9PA 2BG9A 2YU2A 2VKOA 5BMVE 4IE7A 4IE0A 4Z91A 2MYSA 4EB6E 3UQ7A 4UF0B 5HXHA 3UU4A 2EHOA 3KINB 4XZCA 1QSDA 5L3GB 3PDYA 4B3RT 1FJGT 4HFBA 3RH3A 3HKBE 4DO0A 5CGMA 3ZSSA 4AKHA 2WMOA 2FJAA 4Z8XA 3PUVF 2JIWA 4PAGA 3HKDE 3AXJA 2DCFA 4M1PA 4O8SA 1QLBA 4DVDA 2XZEA 2XQ9A 4NXMT 4TX5A 3UFGA 2JQHA 4HFIA 2HPJA 4IGUA 2WM9A 4IL4A 3UU6A 1BR0A 5AQLB 2NWBA 3AAIA 3HKEE 3V5SA 2JQQA 5HXCA 2H3RA 2E9XD 5HYAA 2XQ4A 1T7SA 4GK0E 3P4RA 4LMKA 3ZC1A 3P4QA 4U74A 2VWAA 3ZYKA 4QH1A 3N9LA 2MPKA 2KZ7B 2V8SV 5ABEA 3I0QA 5AQSB 3EHZA 3MK7C 2WDQA 2V5CA 3B13A 2BKOA 4U33A 5JR9A 3VKGA 1NAFA 3RIUC 4AQFC 2X0LB 3AA1B 5F8PA 1GQEA 3FHNA 2NP9A 4QX7B 2ES0A 4EIWA 2IW5B 2LM2A 3EDUA 3CQXC 2YK0A 3V5UA 1YKEB 3Q5WA 3VKHA 1XDPA 3RC3A 2LHNA 3P4PA 4IIJE 4WBNE 2BZBA 4CN4A 1IBLT 3TLVA 2V26A 4QHOA 3AE6A 5AQHB 4EOZB 4MHCA 2CPTA 3EABA 1Z0PA 2L8KA 5JR9C 3QC9A 1HFAA 5AFUL 2KMFA 3C4ZA 5M4YA 2XQ3A 3GN5B 4CI3B 4YY3T 4NUUA 2KXPB 3AAAB 3B5MA 4AKGA 3RI5A 3E0ZA 3NBXX 2LSYA 2BVLA 3RQWA 3O4XE 3RKOA 5LNKA 5KX5E 3AEEA 3ZMSB 3ZT7A 3ZMVB 4ILAA 2VVSA 2KT9A 3UFEA 2VQFT 2LOSA 2QYWA 3D0TA 4ZS2A 3GA8A 4A56A 4TUYE 2WBLA 2KNDA 2W62A 5HWXA 2N9DA 4KP3C 4JI1T 1CHUA 2L3LA 1UUSA 3AA0B 2VKHA 1LVFA 4QX8B 5AQGB 3C4XA 4ZOLE 3VR9A 5JDQA 4A98A 1XMOT 3K1SA 5J1GA 3HI2A 2BBJA
chains in the Genus database with same CATH topology
3L39A 2BKPA 1T72A 2OLTA 1VCTA 1SUMB 4Q25A 2IIUA 2I0MA 1XWMA 2BKOA 1T8BA 2BKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L39 A;  2BKP A;  1T72 A;  2OLT A;  1VCT A;  1SUM B;  4Q25 A;  2IIU A;  2I0M A;  1XWM A;  2BKO A;  1T8B A;  2BKN A; 
#chains in the Genus database with same CATH topology
 5FY1 A;  3O1J A;  2MOZ A;  4IST A;  4OX9 T;  2AE9 A;  3ZEF B;  3LJC A;  3ZN1 B;  4H9Q C;  1CUN A;  3B57 A;  4DV1 T;  3PUA A;  4DV5 T;  4JV5 T;  2RPA A;  1E7P A;  3O1I A;  3PUS A;  3U3I A;  5KXJ A;  4ZI7 E;  4YT0 A;  4DID B;  4AI6 A;  2K48 A;  2KIN B;  4ILC A;  2WP9 A;  2IUB A;  3CVR A;  2K9A A;  3IF8 B;  4ADZ A;  5FVL A;  2XM1 A;  4IDN A;  3RRC A;  4H63 V;  3LDQ B;  4H9O C;  1LKX A;  3MZK B;  4PJL A;  2UXD T;  5L47 A;  3J9X 1;  5AQN B;  5AQT B;  3RIU A;  3AEA A;  2LE8 A;  1AJ3 A;  1HX8 A;  3ZYL A;  1MIV A;  2W63 A;  3KDS E;  1BR2 A;  4WNK A;  4PJN A;  2EHO D;  5FL0 A;  3UUB A;  5J2T E;  4DV7 T;  2DHR A;  4JI5 T;  3ZMT B;  3FB2 A;  5JDL A;  4Z90 A;  3RGL A;  3FZM B;  1Y01 A;  4OFZ A;  3AE4 A;  5LG3 A;  5EK3 A;  2XQ5 A;  1FMW A;  2CWY A;  2DWK A;  4U7I A;  5A1L A;  5ABH A;  5CJ5 A;  5FMN A;  2E5L T;  2PBI A;  2W4X A;  2PG8 A;  2CHO A;  3ZT5 A;  1J5E T;  2CXL A;  5ETW A;  2WU2 A;  5ABF B;  1OED A;  5HEH A;  2NTY A;  4U3C A;  2ACX A;  5C8Y E;  4DR1 T;  5LGN B;  1S94 A;  4K0U A;  4ZS3 A;  5FP3 A;  4UR9 A;  3I9W A;  2XAJ B;  2XPK A;  5JDF A;  2CXF A;  5AQP B;  5IWA T;  2OA5 A;  4HTE A;  4O2A E;  4QKN A;  1KEY A;  1D1C A;  1MMN A;  3K3Q C;  3KVA A;  4ILU A;  3FZF B;  4LF5 T;  5ADX L;  2Q9Q C;  4N78 D;  3FZH B;  2XQ7 A;  4CXX A;  3FZL B;  5FXZ A;  2NTX A;  5LHH B;  3AXJ B;  2ODU A;  2XAS B;  4NPP A;  2WCA A;  5L2L A;  3KBT A;  2VQE T;  4GKJ T;  1WR6 A;  4HWD A;  4I50 E;  3WAK A;  4LF9 T;  1UX5 A;  3FBL A;  3HL6 A;  2YU1 A;  5LOV E;  3NWI A;  3Q2M A;  5LYJ E;  2LKG A;  2EHO B;  2E2A A;  3ZPO A;  1XDO A;  5HCM A;  3VRA A;  4UF0 A;  3EUH A;  1IZN B;  5AQK B;  5HAX A;  2BG9 B;  2ODV A;  3PJA A;  4V1A v;  3I0O A;  5AQM B;  3UUX B;  3W15 B;  4HWF A;  1ZP0 A;  3IHR A;  2VL8 A;  2Y8D A;  4H63 H;  1XNQ T;  3AEB A;  4X62 T;  2WB5 A;  3NKZ A;  4DR3 T;  3LBX A;  1HNX T;  2WZI A;  1MIW A;  2LT3 A;  4IE6 A;  4YSX A;  3EI0 A;  3ZT6 A;  3P8C D;  1G73 A;  5LBM A;  1W9R A;  2C0S A;  4JBW F;  4UV9 B;  2FBW A;  4L5G A;  3N9Q A;  4DR7 T;  1T98 A;  2XSA A;  2XQA A;  5AQQ B;  2V5D A;  3Q9D A;  2QGS A;  2I59 A;  2XAH B;  2CLY C;  1BR4 A;  2XQ8 A;  2UUA T;  3H3A A;  4KHZ F;  4PFP A;  4ZI2 D;  1UGO A;  2CA5 A;  2M6B A;  1NEN A;  1N32 T;  3LBX B;  3L09 A;  5L3C B;  1DU2 A;  4H9N C;  4DUZ T;  3PJA J;  5FY0 A;  5JDN A;  4X65 T;  1OXZ A;  4TN7 B;  5CA0 E;  2KWI B;  4F6R C;  3CWZ B;  1O3X A;  2H89 A;  2LEH A;  3MKD A;  4F8H A;  2HHH T;  3ESL A;  5JQG E;  4YJ3 E;  1D1A A;  2E9X C;  2CLY B;  2LRK A;  1LVK A;  1OED C;  3JCF A;  4HE8 A;  4P0B A;  5HXR A;  2CBJ A;  1KNR A;  3EAM A;  2V7I A;  4YTM A;  3I9Y A;  3X1D A;  5F3J A;  2X51 A;  2CEA A;  4JUY A;  1MMD A;  3E08 A;  4LF6 T;  1HTJ F;  2L9Q A;  2NOX A;  2LSG A;  4AIS A;  2V6Y A;  3UT5 E;  2A2F X;  1M7K A;  3AE3 A;  3QNU A;  3UUL A;  2A72 A;  4COF A;  3T1H T;  2I6H A;  3K8P C;  1MIY A;  2IC9 A;  3PV0 F;  1D0Y A;  2Q9Q A;  3N9N A;  4LML A;  4U72 A;  5DAB A;  4ASK A;  3PE0 A;  4X64 T;  3T1Y T;  1UCU A;  4YHJ A;  4EZH A;  2X0H A;  4O2B E;  3RRW A;  2VK9 A;  3RYF E;  2UUC T;  2K24 A;  1HX1 B;  2FJD A;  2G0U A;  3RLF F;  4B6X A;  2JMK A;  2X68 A;  2XAG B;  1UUR A;  4HWC A;  3P4S A;  4IE4 A;  4QH4 A;  2WDR A;  2PFV A;  2X67 A;  3SFE A;  5FNV E;  3Q5D A;  1W0A A;  3BK9 A;  4HFD A;  3ZLI A;  3ZC0 A;  1W0B A;  3ANW B;  5JRE A;  1I6Z A;  1OED B;  4U7Y A;  5HXE A;  3CQC B;  3MXZ A;  2E9X B;  2I0M A;  2WU5 A;  3TLT A;  5EK2 A;  2QVA A;  3JAD A;  2A9U A;  2UXX B;  5ABF A;  2KWH A;  1YQ3 A;  2V6X A;  3KV6 A;  4QXB B;  5L3D B;  3GMI A;  3PUY F;  2FJB A;  4H9P C;  4A5X A;  4CN1 A;  1IBM T;  3PUX F;  4JI4 T;  4LF7 T;  4LFA T;  2XAQ B;  2ZM8 A;  1HS7 A;  4TV9 E;  4EGW A;  4UEL A;  1IJ5 A;  1KNP A;  3C50 A;  2V7K A;  4TWF A;  4EED A;  4X5T A;  4CQI A;  3SWH A;  2WWV A;  4KMC A;  3QOF A;  2CBI A;  4JEH B;  3QK6 A;  1HR0 T;  3UU8 A;  2DNX A;  3FBZ A;  2MAW A;  5AQF B;  1B7T A;  3EDV A;  3FXD B;  4UIG A;  4G63 A;  3ETV A;  4WW0 A;  4JLE A;  2W0G A;  4X1Y E;  3T8O A;  4KI0 F;  4JYA T;  1SA0 E;  2BDE A;  2FUP A;  4UEM A;  5LBQ B;  3N2G E;  1YXR A;  2XM2 A;  1J1J A;  4OYK A;  2J47 A;  3PUW F;  1VCT A;  4A97 A;  2BS2 A;  3QUJ A;  4K0K T;  2BG9 C;  4J2C A;  4OK0 A;  2XSB A;  5LP6 E;  3O9X A;  3DTO A;  2BS4 A;  3TKL B;  4YFS A;  3P50 A;  4DR6 T;  1YD8 G;  2EHO C;  3KV4 A;  5DJQ C;  2CCQ A;  4JI2 T;  2WMN A;  2WSS V;  5BR8 T;  1X9B A;  1US7 B;  2GK9 A;  2X66 A;  2IAK A;  2N2N A;  3SFD A;  4HFE A;  4E7Z A;  5JTG A;  3QB5 A;  2LSK A;  3PU8 A;  5HEO A;  3ZJ2 A;  4LFC T;  1U4Q A;  2M6I A;  3TLU A;  2VUR A;  5FL1 A;  3OYX A;  1X79 A;  2X9Y A;  1FEW A;  1T8B A;  2AXD S;  2BBH A;  2V7L A;  3OYZ A;  4IL9 A;  3ONL C;  4PK5 A;  3ONJ A;  4TZ4 C;  2D2S A;  2D5U A;  1MMG A;  1MNE A;  4X1K E;  4BJM A;  2Z6E A;  4EZ4 A;  2KSR A;  4AQY T;  2BVM A;  1NWM X;  3CQG B;  3L3P A;  3NZQ A;  1KFY A;  5HWY A;  5IHY A;  3RYH E;  4DV4 T;  3AVR A;  4JI6 T;  5IYZ E;  5LGU B;  2LLY A;  3AAE B;  3KVB A;  4YSZ A;  3NVO A;  3ONX A;  4NIQ A;  2ACZ A;  2BS3 A;  4AKR B;  3HA4 A;  4PK6 A;  4AQF A;  3MJX A;  2DI4 A;  4ILB A;  4MLK A;  4AIU A;  4C91 A;  2HH7 A;  3F31 A;  3GN5 A;  1R8I A;  1ZHC A;  3CML A;  4U2Z A;  3CX7 B;  5GON E;  4ZI3 C;  5CA1 E;  3AE2 A;  4QH5 A;  2V7J A;  4X66 T;  2MTQ A;  4XBF B;  3LFM A;  4KBM B;  1S35 A;  4UVB B;  4C90 A;  4CN6 A;  2K5B B;  4IHJ E;  1ZOY A;  1EZ3 A;  1WR0 A;  4NUV A;  4IE5 A;  4DND A;  1UX4 A;  2LSJ A;  4GYR A;  4WYV A;  2C5K T;  2IC6 A;  1Z8U A;  2VKD A;  1IAP A;  1UK5 A;  2JRK A;  3ETU A;  2OV9 A;  3NRX A;  4Q25 A;  5CB4 E;  3SRZ A;  2X9W A;  4JI3 T;  3AE9 A;  2XHE B;  1HG5 A;  1HCI A;  3IA3 A;  1Y64 B;  3K3O A;  3ZJ1 A;  2DWG A;  5AQU B;  3RPU A;  4DR4 T;  4HEA A;  1I94 T;  3PTR B;  2NR4 A;  4OYJ A;  2J1D G;  1SUM B;  2W67 A;  2X9H A;  4PJM A;  3OTO T;  2CWO A;  2C5I T;  3GWH A;  5L4H A;  5JR9 B;  5LXT E;  3WAJ A;  2CHN A;  5JDM A;  3L39 A;  1HF8 A;  3AEF A;  4IT4 A;  4LMJ A;  4KX6 A;  2HN2 A;  5E0O A;  5L3B B;  1HNW T;  2Y48 B;  4HN9 A;  1JNZ A;  4TWD A;  5DQW A;  4JI8 T;  3H37 A;  2H88 A;  4DMW A;  4UVC B;  5L3F B;  4DV6 T;  3JC6 C;  5LCY A;  3N9O A;  4LF8 T;  4KHP T;  4AKI A;  3IBP A;  4EXT A;  4B3S T;  2CM0 A;  3SOL A;  4O4L E;  5JRC A;  2LSI A;  3AED A;  2X0Y A;  5JRC B;  4DV3 T;  2IIU A;  5AQJ B;  1SE7 A;  2J62 A;  4HGA A;  3VHL A;  4OHF A;  3A7M A;  2NW8 A;  5KMG P;  2W00 A;  2W66 A;  3OKQ A;  4FJO A;  3UUN A;  3UU5 A;  2WY2 A;  4EAH A;  1XZY A;  4GK5 E;  4DUY T;  4ZI3 D;  4IRE A;  1W09 A;  1HG2 A;  2X9X A;  3AEG A;  4TWH A;  1JNR A;  2SPC A;  3VRB A;  3P4W A;  1OED E;  5FYM A;  2PJQ A;  1KK7 A;  5IUX A;  2JJ9 A;  2VL0 A;  4PW8 A;  4MFR A;  4ZEY A;  4I55 E;  2LKH A;  2B1E A;  3RYC E;  4CI2 B;  4B3M T;  4BJN A;  1D0Z A;  1U5P A;  4KUM B;  1L0V A;  2PTF A;  4IDO A;  2NW9 A;  2JQ9 A;  1ZKE A;  3MA9 A;  3KV5 A;  2KLQ A;  2IML A;  3OPC A;  4YTP A;  3DP7 A;  2XAF B;  4EV6 A;  3PUZ F;  2ZMA A;  3HR0 A;  3N5L A;  4HFC A;  4EYY R;  5HEJ A;  3AE7 A;  4BAY B;  2YIN A;  3C98 B;  5C2T A;  3OBV E;  4JI7 T;  4TNW A;  5ABG A;  2ZM6 T;  1FMV A;  2YDQ A;  4ANJ A;  4ZI2 C;  2XTL A;  3N9M A;  3TLW A;  4AQG A;  4LFB T;  4ZZC A;  2RP4 A;  3BQI A;  2XQ6 A;  3HKC E;  4PJJ A;  3C51 A;  3OVU A;  4E7S A;  4HKA A;  3LSV A;  5EZY E;  3UUM A;  3ZST A;  4P09 A;  4DR5 T;  4P1N A;  2IHR 1;  2ZM0 A;  3LG7 A;  4CXY A;  1YW0 A;  3AEC A;  2UXC T;  2A3D A;  2B76 A;  2FJE A;  1ZEE A;  2P9B A;  2W61 A;  2WWU A;  3Q5X A;  2XJ7 A;  2LJL A;  3P7I A;  4IDP A;  4QXH B;  3A5X A;  5AQR B;  5F5W A;  5TAO A;  3R84 B;  2C5J A;  3CX6 B;  4U2Y A;  3ZMZ B;  4UXN B;  4NXN T;  2LOP A;  3I1A A;  1BR1 A;  4I43 B;  2YDS A;  1IBK T;  1WLX A;  1YKH B;  2D0T A;  2E8I A;  2F4V T;  4I4T E;  1D0X A;  2LRL A;  3LK2 B;  3VR8 A;  1NEK A;  4AXP A;  2BKN A;  3LK4 2;  4YXD A;  5LJN A;  1KNZ A;  2ZLY A;  3FXE B;  3DJB A;  3RYI E;  1M62 A;  1WFD A;  3TLS A;  4B3T T;  5AQV B;  2VVN A;  4ZZB A;  2YKS A;  4FI5 A;  3OJA A;  2Y6X A;  2WS3 A;  4ERR A;  4GKK T;  3CK6 A;  4CXW A;  3RC8 A;  4H9S E;  3CX8 B;  5EK4 A;  1XNR T;  3C64 A;  5FY7 A;  2VB6 A;  2UU9 T;  4TV8 E;  2LHR A;  5AQO B;  3ZCI A;  4YTN A;  5HEG A;  3J7Y q;  1XMQ T;  1V9D A;  1G8X A;  5C3J A;  3ZMU B;  1YQ4 A;  4DV0 T;  3IEE A;  4X1I E;  4CZZ B;  3RKG A;  1VCS A;  4WZX A;  3PUG A;  2W2U A;  4P0A A;  2YN6 A;  1XWM A;  1N36 T;  2ZM2 A;  4MBQ A;  2RA1 A;  5JDH A;  3RIF A;  3RIA A;  1H7C A;  2D9D A;  2J4G A;  3KBU A;  5CFB A;  4CI1 B;  4EEB A;  5H6R B;  4YLH A;  2VAS A;  3E22 E;  4H9R C;  2DL1 A;  2Q9Q D;  2QA7 A;  5JVD E;  2QRX A;  3C4W A;  1E1H B;  5LB7 B;  4ZHQ E;  1LRZ A;  5LHG B;  3LK3 B;  4YJ2 E;  2CE7 A;  4G2A A;  4GYS A;  2BG9 E;  5LHI B;  3F57 A;  3AE5 A;  4PK4 A;  1ZV4 X;  4WBO A;  1N33 T;  4EYU A;  2OLT A;  2K3W A;  4GOU A;  3CIR A;  3RF1 A;  3R6N A;  2HPL A;  2V7M A;  2CRB A;  3G06 A;  4X20 E;  2E9X A;  2H7O A;  3BQK A;  3EVY A;  3PUR A;  1WYC A;  2BKP A;  2JPF A;  2VKJ A;  1VOM A;  2UUB T;  3ANW A;  3K3N A;  4MAL A;  4QXC B;  3KFW X;  3AVS A;  3KV9 A;  2HN1 A;  3U78 A;  3RQU A;  4DBQ A;  1QUU A;  4U31 A;  5J2U E;  4DR2 T;  3AE8 A;  4DBR A;  2WDV A;  3AE1 A;  5FVK A;  1WRD A;  2MBG A;  3L8R A;  4PFO A;  5FXW A;  3AA7 B;  3M3Z B;  4I0U A;  2XY8 B;  3UTK A;  4ZXL A;  3AB3 B;  3UU3 A;  5L4E A;  5LJM A;  1VRB A;  5H6Q B;  5J0Z A;  2Q9Q B;  2YEV C;  4DMV A;  2YOE A;  3RHW A;  2V1D B;  4HWH A;  3A8Y C;  5FKY A;  5LG4 A;  4UV8 B;  2XUE A;  1IJ6 A;  2V6Y B;  1SHZ C;  3FZK B;  4O4I E;  5JH7 E;  4LF4 T;  1J5W A;  4JEU B;  2JQK A;  2D0U A;  2WZH A;  4L0R A;  4XAX B;  3VU7 H;  2N1G A;  5L3E B;  3O1H A;  5HEU A;  3UQ4 A;  4AKL A;  1N34 T;  4O4J E;  3JAF A;  3MAC A;  5LA6 E;  1T72 A;  4GIW A;  3M65 A;  4DV2 T;  4JI0 T;  3SS1 A;  2LM9 A;  3JAE A;  1MMA A;  4TNV A;  1WCR A;  1D1B A;  3CKD A;  3JC6 D;  3PU3 A;  4PNI A;  5HCJ A;  5KDM C;  4IDQ A;  5AQI B;  3ABV A;  3ZYM A;  1E2A A;  1MND A;  4YHH T;  2E5V A;  2JMH A;  1WYB A;  1HNZ T;  5DQV A;  2UXB T;  4HFV A;  2XQY A;  2CXD A;  3F2E A;  2R6G F;  2IDO B;  2NW7 A;  2UXN B;  3N2O A;  2WQY A;  3QB5 K;  4HFH A;  3ZCJ A;  2H7V C;  2DLR A;  3ZN0 B;  5HXS A;  1KF6 A;  3Q5E A;  2YDR A;  4ISS A;  4BA9 A;  4UVA B;  2CMR A;  4YSY A;  5LMN T;  5FXV A;  3S4U A;  5LGT B;  4IDZ A;  2M67 A;  5JDG A;  1FIO A;  3PUQ A;  4L9I A;  4O4H E;  3AA6 B;  3ZKR A;  3NRY A;  2WAU A;  3CPZ A;  5LMU T;  3RX6 A;  1OWA A;  4QWN B;  3N2K E;  5FXX A;  3BQL A;  4HWI B;  3WI3 A;  3H3M A;  3NZP A;  3N9P A;  2BG9 A;  2YU2 A;  2VKO A;  5BMV E;  4IE7 A;  4IE0 A;  4Z91 A;  2MYS A;  4EB6 E;  3UQ7 A;  4UF0 B;  5HXH A;  3UU4 A;  2EHO A;  3KIN B;  4XZC A;  1QSD A;  5L3G B;  3PDY A;  4B3R T;  1FJG T;  4HFB A;  3RH3 A;  3HKB E;  4DO0 A;  5CGM A;  3ZSS A;  4AKH A;  2WMO A;  2FJA A;  4Z8X A;  3PUV F;  2JIW A;  4PAG A;  3HKD E;  3AXJ A;  2DCF A;  4M1P A;  4O8S A;  1QLB A;  4DVD A;  2XZE A;  2XQ9 A;  4NXM T;  4TX5 A;  3UFG A;  2JQH A;  4HFI A;  2HPJ A;  4IGU A;  2WM9 A;  4IL4 A;  3UU6 A;  1BR0 A;  5AQL B;  2NWB A;  3AAI A;  3HKE E;  3V5S A;  2JQQ A;  5HXC A;  2H3R A;  2E9X D;  5HYA A;  2XQ4 A;  1T7S A;  4GK0 E;  3P4R A;  4LMK A;  3ZC1 A;  3P4Q A;  4U74 A;  2VWA A;  3ZYK A;  4QH1 A;  3N9L A;  2MPK A;  2KZ7 B;  2V8S V;  5ABE A;  3I0Q A;  5AQS B;  3EHZ A;  3MK7 C;  2WDQ A;  2V5C A;  3B13 A;  2BKO A;  4U33 A;  5JR9 A;  3VKG A;  1NAF A;  3RIU C;  4AQF C;  2X0L B;  3AA1 B;  5F8P A;  1GQE A;  3FHN A;  2NP9 A;  4QX7 B;  2ES0 A;  4EIW A;  2IW5 B;  2LM2 A;  3EDU A;  3CQX C;  2YK0 A;  3V5U A;  1YKE B;  3Q5W A;  3VKH A;  1XDP A;  3RC3 A;  2LHN A;  3P4P A;  4IIJ E;  4WBN E;  2BZB A;  4CN4 A;  1IBL T;  3TLV A;  2V26 A;  4QHO A;  3AE6 A;  5AQH B;  4EOZ B;  4MHC A;  2CPT A;  3EAB A;  1Z0P A;  2L8K A;  5JR9 C;  3QC9 A;  1HFA A;  5AFU L;  2KMF A;  3C4Z A;  5M4Y A;  2XQ3 A;  3GN5 B;  4CI3 B;  4YY3 T;  4NUU A;  2KXP B;  3AAA B;  3B5M A;  4AKG A;  3RI5 A;  3E0Z A;  3NBX X;  2LSY A;  2BVL A;  3RQW A;  3O4X E;  3RKO A;  5LNK A;  5KX5 E;  3AEE A;  3ZMS B;  3ZT7 A;  3ZMV B;  4ILA A;  2VVS A;  2KT9 A;  3UFE A;  2VQF T;  2LOS A;  2QYW A;  3D0T A;  4ZS2 A;  3GA8 A;  4A56 A;  4TUY E;  2WBL A;  2KND A;  2W62 A;  5HWX A;  2N9D A;  4KP3 C;  4JI1 T;  1CHU A;  2L3L A;  1UUS A;  3AA0 B;  2VKH A;  1LVF A;  4QX8 B;  5AQG B;  3C4X A;  4ZOL E;  3VR9 A;  5JDQ A;  4A98 A;  1XMO T;  3K1S A;  5J1G A;  3HI2 A;  2BBJ A; 
#chains in the Genus database with same CATH homology
 3L39 A;  2BKP A;  1T72 A;  2OLT A;  1VCT A;  1SUM B;  4Q25 A;  2IIU A;  2I0M A;  1XWM A;  2BKO A;  1T8B A;  2BKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...