4Q25A

Crystal structure of phou from pseudomonas aeruginosa
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
211
structure length
211
Chain Sequence
SQQFNAELEDVRSHLLAMGGLVEKQVNDAVNALIDADSGLAQQVREIDDQINQMERNIDEECVRILARRQPAASDLRLIISISKSVIDLERIGDEASKVARRAIQLCEEGESPRGYVEVRHIGSQVQKMVQEALDAFARFDADLALSVAQYDKTVDREYKTALRELVTYMMEDPRAISRVLNIIWALRSLERIGDHARNIAELVIYLVRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Phosphate-specific transport system accessory protein PhoU h
publication title Crystal structure of PhoU from Pseudomonas aeruginosa, a negative regulator of the Pho regulon.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 106
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A01
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 4q25A02
2I0MA 2BKNA 4Q25A 2IIUA 3L39A 1XWMA 2BKOA 2OLTA 2BKPA 1T72A 1SUMB 1VCTA 1T8BA
chains in the Genus database with same CATH superfamily
3P4WA 3IA3A 4JEUB 2HHHT 2DI4A 5AFUL 5AQSB 3WAJA 4COFA 4ISSA 3UUNA 1IZNB 3K3QC 3CMLA 4OHFA 1JNRA 1T7SA 2HN2A 1FEWA 5AQMB 4ZHQE 5AQPB 3SFDA 3AE3A 3UU8A 2LT3A 5LCYA 1WRDA 4GKJT 4KMCA 2WZIA 5AQKB 2XUEA 5HEJA 3AAAB 3KBTA 2YINA 1T98A 2LKGA 4IHJE 2L9QA 3RRWA 4PK6A 4NPPA 5LP6E 3PJAJ 4HWFA 3UU4A 4ZI3D 4DIDB 3PUQA 2WZHA 3AE2A 4IDOA 5KMGP 4YFSA 4U2YA 2WBLA 3CK6A 4UVBB 3RIFA 3RLFF 5ABGA 4C91A 2CA5A 4L0RA 3L8RA 2ACZA 2XQ4A 2H7OA 3QOFA 4HWIB 3ZCIA 4IDNA 3W15B 3LJCA 5AQRB 5L4HA 2A2FX 2CHOA 1D1BA 1G8XA 2W62A 3WI3A 4K0UA 3VKGA 2WDQA 5JH7E 3N2GE 2LSJA 1G73A 3VKHA 5JDQA 3RQUA 3NZPA 3VRAA 4O2AE 5IWAT 2YEVC 3G06A 4F8HA 4QXBB 4B3MT 3P4SA 3PJAA 5GONE 4DR2T 5JDNA 4DV4T 2BVMA 3UFGA 2LSIA 1IBLT 3FZHB 3EHZA 1OEDB 1WYCA 4IDZA 4DR1T 3AE8A 4QH4A 2BS3A 3AAEB 4WYVA 3NVOA 3ZPOA 4TX5A 4KHPT 2XM1A 2LRKA 2IDOB 3TLWA 4ZXLA 2I6HA 5JR9B 5HYAA 5LJMA 2E9XC 4ZOLE 2YU1A 2IUBA 4H9SE 1ZKEA 2YK0A 3PTRB 1DU2A 2LM2A 1B7TA 3RIUA 4IL9A 4ZZCA 2ZM6T 4HE8A 4JI5T 4DV1T 2KNDA 1NENA 5BMVE 3N9MA 5JQGE 4I0UA 5AQTB 1YD8G 1WCRA 4IDQA 2MYSA 4AKIA 3NRXA 3RIUC 4B3RT 2XAQB 3JCFA 3PUYF 3AXJB 3RKOA 4JYAT 3GWHA 2CLYB 4DR7T 3H3AA 3PDYA 1IJ5A 4HFCA 2FBWA 4ZI2C 1T72A 3Q9DA 4O4JE 2D0UA 1X79A 2EHOA 1LKXA 1JNZA 4P0BA 4U72A 5L3FB 2I59A 2LHNA 4JV5T 3ZJ2A 2JQKA 5FY0A 3GMIA 4ZS2A 4EYYR 2NW8A 2UUAT 2V6YB 2JMHA 1M7KA 2LSKA 4DV0T 2EHOC 1EZ3A 2W66A 2UUCT 2AE9A 3K8PC 1L0VA 4DV5T 4DR4T 1IAPA 3MKDA 3QNUA 3RRCA 3I9YA 2J1DG 2CBIA 3LK3B 2CCQA 3KV4A 3Q5DA 3F31A 5M4YA 3FB2A 3LBXB 5KDMC 3GN5B 3JC6C 3N9PA 4PFOA 2DHRA 5FXZA 4JI4T 4DV2T 1UUSA 1MMAA 2UXBT 3OKQA 4QH1A 5LMUT 4BAYB 2QA7A 3K3NA 4QXCB 3CQGB 1N33T 1H7CA 5ETWA 4WBNE 3LDQB 3P7IA 4Z8XA 2V8SV 1XNRT 4LF7T 3FZLB 4PW8A 2I0MA 1XDPA 3H3MA 5FXXA 4CXYA 2E2AA 3DTOA 3JADA 3SRZA 1AJ3A 2H88A 2K48A 1FMWA 2XAGB 4DV7T 2X0YA 4JI7T 5HXRA 1CUNA 2M6BA 2E9XD 2Q9QA 4ZZBA 4IE7A 1HCIA 2LKHA 1ZEEA 4O4LE 3ETVA 3I0OA 4BJMA 3HA4A 4JI6T 4BJNA 4AXPA 3O9XA 3ZMZB 4QXHB 2Q9QC 1ZHCA 4HFEA 1MMGA 3TLVA 5L4EA 1XZYA 3EI0A 3I9WA 4TWDA 1X9BA 2C0SA 2WDVA 3ANWA 3BK9A 4CZZB 5JRCA 3N9QA 3T8OA 3SFEA 2E9XB 4EYUA 3AA7B 2WY2A 1WR6A 4JLEA 2H3RA 2Y48B 4JBWF 2V26A 3AB3B 4ZI2D 4AKGA 3MZKB 4HTEA 4EZ4A 2LSGA 2J4GA 2MOZA 2FJEA 3AEGA 1BR4A 3CX8B 4ILAA 5HWYA 2CEAA 3C4ZA 4PJNA 4P0AA 3PUGA 5C3JA 3A7MA 5ABEA 3PURA 2K9AA 4NUVA 3HKBE 4KUMB 3KV5A 2EHOD 5FVKA 1HNXT 2UXDT 1UK5A 1Y01A 3V5SA 2UU9T 1QUUA 1KNRA 3TLUA 2A72A 3ZYKA 3VRBA 1I94T 2BG9E 4UIGA 2QRXA 2NTXA 3J7Yq 3CPZA 2V7JA 4TZ4C 3QK6A 1UURA 2Z6EA 5FNVE 2PFVA 2WDRA 5HEUA 4X64T 3JC6D 3N5LA 3P4RA 3ZJ1A 3SWHA 4A5XA 3VU7H 3N9LA 3IBPA 4YSYA 3F57A 2JPFA 4U33A 4AIUA 3RYIE 3AEBA 4AI6A 3NRYA 5HEOA 3FZFB 1R8IA 2FJAA 3RF1A 1IJ6A 1XDOA 3IF8B 5FKYA 2HH7A 5AQIB 1D1CA 3RHWA 5KX5E 4KI0F 3UFEA 1LVKA 3ESLA 4PJJA 3UQ4A 3VR8A 1N34T 4OFZA 4ISTA 3ZN0B 1KNPA 5HXHA 3PUWF 3DJBA 3CIRA 4QH5A 4UEMA 4WBOA 3OTOT 4AISA 5F5WA 5L47A 4DR6T 5ABFA 1S35A 2XM2A 1MIVA 3JAFA 4TWHA 1SUMB 2NW9A 2XTLA 4PJMA 4JI3T 2BKPA 5F8PA 2KSRA 3D0TA 2WS3A 4AKRB 2Q9QD 4ZS3A 2CBJA 1YXRA 2B1EA 4HGAA 3PUSA 2AXDS 4PNIA 2IW5B 1KF6A 2XQAA 4TNVA 3AEAA 4H63H 1KK7A 2JJ9A 3KVBA 2VVNA 2IAKA 3NZQA 1XMQT 4U7IA 2CM0A 2LLYA 2V6XA 2W61A 2LSYA 3AEDA 2JQHA 2H7VC 1BR1A 4X62T 2PBIA 3WAKA 4CXWA 3AE4A 1W0BA 4OYKA 3AE9A 5LNKA 3TKLB 4EEDA 2ODVA 3KV9A 3P8CD 4HKAA 5C2TA 3LG7A 4ILUA 1BR2A 1W9RA 2WWVA 3M65A 2L3LA 2MPKA 3CQXC 4ILCA 4DVDA 4WW0A 3SOLA 5LA6E 4CN6A 4A97A 2W4XA 4X65T 3ZC0A 4HWCA 4UF0A 5EK3A 3ZMUB 2X9XA 4CN4A 2QVAA 3KFWX 5LHHB 1N32T 3HL6A 4DR5T 3ZMSB 2KWIB 3ZT5A 2LM9A 2C5IT 2CXLA 3N2OA 3Q5XA 4I43B 3QUJA 5IHYA 4TWFA 5HEGA 4YTNA 4U3CA 3UU6A 5JREA 3EUHA 4N78D 4GK5E 3MXZA 4AQGA 5AQUB 2Y6XA 3AEEA 3N9NA 5JDMA 3SS1A 4DMWA 5IYZE 1OEDE 4MBQA 5HCJA 1XNQT 3AEFA 4HWHA 5ADXL 2V7MA 1FJGT 2BG9A 5HCMA 2LEHA 4O8SA 3RYFE 2HN1A 2LJLA 2LOPA 1HX8A 4GK0E 4XZCA 1CHUA 3U78A 5LMNT 4YXDA 3OYXA 4AKLA 2YDQA 3UUMA 4LF6T 1WR0A 5H6RB 2PG8A 3ZT6A 3RX6A 1D0XA 2LOSA 4TV9E 4AQYT 1M62A 2VKJA 4FJOA 4O2BE 4OYJA 3EDVA 5CJ5A 2CWYA 2JRKA 3ZLIA 1HS7A 4ZEYA 2WMOA 2N9DA 1MIWA 2LHRA 4TUYE 2LE8A 3UTKA 2E8IA 4UXNB 4O4HE 5FL1A 4KBMB 3UU5A 3ZYMA 2V5CA 1Z0PA 2YDRA 4LMKA 2JIWA 2XQ3A 4DMVA 2MAWA 5DJQC 4H9NC 4A98A 2VWAA 4LMLA 3N2KE 4KHZF 4TN7B 5J2TE 1HNZT 1N36T 2WSSV 3PU3A 3R84B 3RYHE 4EAHA 4DO0A 4YJ3E 4Q25A 4LFAT 3FHNA 2XJ7A 2V1DB 3TLSA 3BQIA 4HFDA 3C64A 3AE6A 3UT5E 5LYJE 1V9DA 3S4UA 4YHJA 4B6XA 2ZLYA 1W09A 3RC3A 1OWAA 2UXCT 2XZEA 2BKOA 3E22E 2ZM2A 3HKCE 2WU2A 3AVSA 2QYWA 4X1KE 2GK9A 1E7PA 4LF5T 3C4XA 3N9OA 5J2UE 3K1SA 4IE6A 5EK2A 4H63V 2JQ9A 2X66A 3UU3A 2OV9A 4EIWA 2W0GA 4DNDA 4UV9B 3QC9A 3UQ7A 5AQQB 1VOMA 5LXTE 1E1HB 1MIYA 3TLTA 2W67A 3KV6A 4I4TE 4NIQA 2XQ8A 3RYCE 3FBLA 4HFBA 3CQCB 4U74A 4QKNA 2CWOA 4DV6T 2D9DA 2CXDA 3R6NA 4A56A 4JUYA 3AAIA 5FVLA 4L5GA 3UUXB 3UUBA 5L3BB 4YHHT 5FXWA 5FMNA 1QLBA 2ES0A 5HAXA 4YSZA 3HKEE 4NUUA 4IE5A 2CMRA 5TAOA 5FXVA 2KMFA 1ZP0A 2OA5A 4YTMA 4PAGA 2N2NA 5L3EB 4CN1A 4IE0A 4QX7B 1VCTA 3E0ZA 5L3GB 2X9YA 1KFYA 4IL4A 3LK2B 4LF4T 3C50A 1HFAA 3AA1B 2RPAA 2XY8B 5CGMA 4I50E 4G2AA 3ABVA 4KP3C 4L9IA 3DP7A 4JI0T 4YLHA 2XSBA 1W0AA 3PUZF 1OEDA 5FY7A 2L8KA 1QSDA 4DR3T 1J5WA 2QGSA 4GYSA 2PTFA 3HKDE 5LJNA 2A3DA 4TNWA 4JI2T 5JR9A 2XASB 2X0LB 2PJQA 3AECA 1ZV4X 4Z91A 3K3OA 4IREA 4HN9A 2ODUA 3ZMVB 4UELA 2F4VT 2CE7A 3OPCA 4XAXB 4AKHA 4H9QC 2KINB 5JR9C 5JDHA 4E7SA 2WWUA 2CRBA 4IDPA 4EV6A 4F6RC 3CVRA 2IC6A 5JVDE 2BBJA 4CI2B 5AQLB 1IBKT 3AXJA 3H37A 4PK4A 2EHOB 4ERRA 1YKEB 3RIAA 2YDSA 2NW7A 4DUZT 5L2LA 5LG3A 5DQVA 3AE5A 5AQNB 4LMJA 2BKNA 5CA0E 3QB5K 5HXCA 2WCAA 3L39A 4EGWA 4B3ST 4HFHA 2CLYC 2VKHA 3MK7C 2WQYA 1MMNA 2NWBA 2E5LT 3PV0F 2B76A 5FL0A 2ZMAA 1D0YA 2C5KT 4DBQA 3KBUA 2V6YA 2VQET 4ASKA 2SPCA 2VQFT 2XAJB 3CX6B 2V7LA 2W00A 5JDGA 2JMKA 3ZSTA 2Y8DA 2N1GA 5LGUB 5KXJA 1GQEA 2WM9A 1D1AA 1YQ3A 5AQGB 5HWXA 4UVCB 4EZHA 5J0ZA 3LBXA 2A9UA 3GN5A 3BQLA 1LVFA 4X66T 3I1AA 4LFBT 5FYMA 4HFIA 3ZC1A 3FZMB 1IBMT 1HG5A 1WFDA 3OVUA 4QHOA 1OXZA 1U5PA 1HX1B 4H9RC 5LG4A 5LB7B 4QX8B 2JQQA 3FXDB 3JAEA 4FI5A 4GOUA 4X5TA 2XQ5A 4UR9A 4LF8T 2X68A 2Q9QB 2D0TA 4MALA 5HXEA 4E7ZA 5DABA 5E0OA 4UVAB 3CKDA 4U2ZA 4XBFB 3F2EA 2ZM8A 2WMNA 3T1YT 4Z90A 5EZYE 5JDFA 3T1HT 5F3JA 5C8YE 2DNXA 3ANWB 2RP4A 4IT4A 1KNZA 3KVAA 5JRCB 1J5ET 3M3ZB 3J9X1 4WNKA 4EB6E 4JI8T 1YKHB 2DLRA 3ZMTB 1Z8UA 2XQ9A 3RI5A 4PFPA 4TV8E 2BVLA 5BR8T 3OJAA 2VL8A 2NR4A 4P1NA 3ZSSA 3ONJA 4ILBA 2WP9A 3EABA 4H9OC 4B3TT 2E9XA 2M6IA 5CA1E 3KINB 4IGUA 2VURA 2KXPB 2K3WA 3AVRA 4NXMT 4MFRA 5LGTB 3BQKA 2IIUA 3O1IA 3GA8A 5CB4E 3IEEA 5FP3A 3O4XE 4LFCT 1J1JA 4C90A 2OLTA 5IUXA 2K24A 1VCSA 2YKSA 3ONXA 3PUAA 2VKDA 3ETUA 2UXXB 4EEBA 2X9HA 3Q5EA 2UXNB 4ANJA 2BS4A 3P50A 3ZT7A 4AQFA 4K0KT 3CWZB 2NP9A 3AE1A 3L3PA 2BG9C 5DQWA 2W2UA 1Y64B 2CXFA 2X0HA 1HTJF 1MMDA 2VASA 2YOEA 5AQOB 2DCFA 1E2AA 5FY1A 4CI1B 5LOVE 4GKKT 3L09A 2R6GF 4WZXA 4AQFC 2X51A 3NKZA 4DBRA 3AA0B 2YN6A 3LFMA 2D2SA 3X1DA 4EOZB 2V7IA 4U31A 4V1Av 4HWDA 1UX4A 1NWMX 2DWGA 3MACA 4IE4A 4GIWA 5EK4A 3FXEB 3ONLC 5H6QB 1UCUA 2X9WA 3Q5WA 2YU2A 2XQ6A 3LSVA 1US7B 3OBVE 5LHIB 2HPJA 4X20E 4DUYT 2CPTA 5ABHA 4MHCA 5AQVB 2XAHB 3OYZA 5ABFB 3RQWA 4HFVA 3PUXF 3P4QA 4JI1T 2XPKA 2KZ7B 3EAMA 3O1JA 2VVSA 4ADZA 1SE7A 4ZI7E 3AA6B 1SHZC 3ZYLA 5A1LA 2VK9A 2X67A 2IMLA 3PUVF 3FBZA 2J62A 2G0UA 3KDSE 2W63A 2RA1A 3RPUA 1KEYA 3O1HA 1T8BA 2FJBA 4YJ2E 1HR0T 3RGLA 2M67A 1NEKA 2XAFB 5CFBA 2E5VA 3B5MA 1VRBA 3C98B 5LHGB 4KX6A 1MNEA 2MBGA 3RC8A 2VB6A 4NXNT 2HPLA 1U4QA 2XQ7A 3ZEFB 3UULA 4QWNB 5LBQB 2VL0A 2V5DA 5LGNB 1LRZA 3LK42 5AQHB 2DWKA 3NWIA 1YW0A 3ZKRA 3V5UA 4M1PA 2ACXA 2KLQA 3P4PA 3PU8A 4OK0A 2XSAA 1HNWT 4YT0A 2NTYA 2P9BA 4P09A 2WAUA 2BBHA 2WU5A 3ZN1B 2FUPA 4UF0B 4CXXA 2KWHA 4DV3T 4HEAA 2V7KA 4O4IE 4H9PC 4MLKA 4GYRA 5J1GA 1HF8A 2XHEB 5HXSA 2VKOA 2BZBA 2H89A 3MA9A 4ZI3C 4LF9T 3C4WA 4G63A 2BDEA 3ZCJA 4J2CA 4YSXA 2MTQA 1XMOT 1HG2A 2DL1A 4YTPA 1BR0A 4JEHB 2NOXA 3B13A 3HR0A 2IC9A 2ZM0A 1UX5A 1I6ZA 2CHNA 4X1IE 4U7YA 4CI3B 5L3DB 5JTGA 2J47A 2BG9B 1OEDC 5JDLA 3C51A 3FZKB 4PK5A 1FIOA 4BA9A 2K5BB 1NAFA 3EDUA 4X1YE 4EXTA 3MJXA 3VHLA 2FJDA 1SA0E 3PE0A 3HI2A 1ZOYA 1XWMA 3RKGA 2WB5A 2BS2A 3NBXX 4IIJE 2C5JA 4I55E 5AQJB 3E08A 4YY3T 2KT9A 1S94A 2UUBT 3CX7B 1MNDA 5HEHA 3EVYA 3AE7A 3IHRA 3I0QA 2D5UA 3QB5A 3RH3A 3Q2MA 5AQFB 1YQ4A 2IHR1 3U3IA 2XQYA 4CQIA 5LBMA 3VR9A 1FMVA 1WYBA 4PJLA 3A8YC 2LRLA 3A5XA 1WLXA 1O3XA 1D0ZA 5L3CB 4UV8B 4OX9T 3B57A 1UGOA
chains in the Genus database with same CATH topology
2I0MA 2BKNA 4Q25A 2IIUA 3L39A 1XWMA 2BKOA 2OLTA 2BKPA 1T72A 1SUMB 1VCTA 1T8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0M A;  2BKN A;  4Q25 A;  2IIU A;  3L39 A;  1XWM A;  2BKO A;  2OLT A;  2BKP A;  1T72 A;  1SUM B;  1VCT A;  1T8B A; 
#chains in the Genus database with same CATH topology
 3P4W A;  3IA3 A;  4JEU B;  2HHH T;  2DI4 A;  5AFU L;  5AQS B;  3WAJ A;  4COF A;  4ISS A;  3UUN A;  1IZN B;  3K3Q C;  3CML A;  4OHF A;  1JNR A;  1T7S A;  2HN2 A;  1FEW A;  5AQM B;  4ZHQ E;  5AQP B;  3SFD A;  3AE3 A;  3UU8 A;  2LT3 A;  5LCY A;  1WRD A;  4GKJ T;  4KMC A;  2WZI A;  5AQK B;  2XUE A;  5HEJ A;  3AAA B;  3KBT A;  2YIN A;  1T98 A;  2LKG A;  4IHJ E;  2L9Q A;  3RRW A;  4PK6 A;  4NPP A;  5LP6 E;  3PJA J;  4HWF A;  3UU4 A;  4ZI3 D;  4DID B;  3PUQ A;  2WZH A;  3AE2 A;  4IDO A;  5KMG P;  4YFS A;  4U2Y A;  2WBL A;  3CK6 A;  4UVB B;  3RIF A;  3RLF F;  5ABG A;  4C91 A;  2CA5 A;  4L0R A;  3L8R A;  2ACZ A;  2XQ4 A;  2H7O A;  3QOF A;  4HWI B;  3ZCI A;  4IDN A;  3W15 B;  3LJC A;  5AQR B;  5L4H A;  2A2F X;  2CHO A;  1D1B A;  1G8X A;  2W62 A;  3WI3 A;  4K0U A;  3VKG A;  2WDQ A;  5JH7 E;  3N2G E;  2LSJ A;  1G73 A;  3VKH A;  5JDQ A;  3RQU A;  3NZP A;  3VRA A;  4O2A E;  5IWA T;  2YEV C;  3G06 A;  4F8H A;  4QXB B;  4B3M T;  3P4S A;  3PJA A;  5GON E;  4DR2 T;  5JDN A;  4DV4 T;  2BVM A;  3UFG A;  2LSI A;  1IBL T;  3FZH B;  3EHZ A;  1OED B;  1WYC A;  4IDZ A;  4DR1 T;  3AE8 A;  4QH4 A;  2BS3 A;  3AAE B;  4WYV A;  3NVO A;  3ZPO A;  4TX5 A;  4KHP T;  2XM1 A;  2LRK A;  2IDO B;  3TLW A;  4ZXL A;  2I6H A;  5JR9 B;  5HYA A;  5LJM A;  2E9X C;  4ZOL E;  2YU1 A;  2IUB A;  4H9S E;  1ZKE A;  2YK0 A;  3PTR B;  1DU2 A;  2LM2 A;  1B7T A;  3RIU A;  4IL9 A;  4ZZC A;  2ZM6 T;  4HE8 A;  4JI5 T;  4DV1 T;  2KND A;  1NEN A;  5BMV E;  3N9M A;  5JQG E;  4I0U A;  5AQT B;  1YD8 G;  1WCR A;  4IDQ A;  2MYS A;  4AKI A;  3NRX A;  3RIU C;  4B3R T;  2XAQ B;  3JCF A;  3PUY F;  3AXJ B;  3RKO A;  4JYA T;  3GWH A;  2CLY B;  4DR7 T;  3H3A A;  3PDY A;  1IJ5 A;  4HFC A;  2FBW A;  4ZI2 C;  1T72 A;  3Q9D A;  4O4J E;  2D0U A;  1X79 A;  2EHO A;  1LKX A;  1JNZ A;  4P0B A;  4U72 A;  5L3F B;  2I59 A;  2LHN A;  4JV5 T;  3ZJ2 A;  2JQK A;  5FY0 A;  3GMI A;  4ZS2 A;  4EYY R;  2NW8 A;  2UUA T;  2V6Y B;  2JMH A;  1M7K A;  2LSK A;  4DV0 T;  2EHO C;  1EZ3 A;  2W66 A;  2UUC T;  2AE9 A;  3K8P C;  1L0V A;  4DV5 T;  4DR4 T;  1IAP A;  3MKD A;  3QNU A;  3RRC A;  3I9Y A;  2J1D G;  2CBI A;  3LK3 B;  2CCQ A;  3KV4 A;  3Q5D A;  3F31 A;  5M4Y A;  3FB2 A;  3LBX B;  5KDM C;  3GN5 B;  3JC6 C;  3N9P A;  4PFO A;  2DHR A;  5FXZ A;  4JI4 T;  4DV2 T;  1UUS A;  1MMA A;  2UXB T;  3OKQ A;  4QH1 A;  5LMU T;  4BAY B;  2QA7 A;  3K3N A;  4QXC B;  3CQG B;  1N33 T;  1H7C A;  5ETW A;  4WBN E;  3LDQ B;  3P7I A;  4Z8X A;  2V8S V;  1XNR T;  4LF7 T;  3FZL B;  4PW8 A;  2I0M A;  1XDP A;  3H3M A;  5FXX A;  4CXY A;  2E2A A;  3DTO A;  3JAD A;  3SRZ A;  1AJ3 A;  2H88 A;  2K48 A;  1FMW A;  2XAG B;  4DV7 T;  2X0Y A;  4JI7 T;  5HXR A;  1CUN A;  2M6B A;  2E9X D;  2Q9Q A;  4ZZB A;  4IE7 A;  1HCI A;  2LKH A;  1ZEE A;  4O4L E;  3ETV A;  3I0O A;  4BJM A;  3HA4 A;  4JI6 T;  4BJN A;  4AXP A;  3O9X A;  3ZMZ B;  4QXH B;  2Q9Q C;  1ZHC A;  4HFE A;  1MMG A;  3TLV A;  5L4E A;  1XZY A;  3EI0 A;  3I9W A;  4TWD A;  1X9B A;  2C0S A;  2WDV A;  3ANW A;  3BK9 A;  4CZZ B;  5JRC A;  3N9Q A;  3T8O A;  3SFE A;  2E9X B;  4EYU A;  3AA7 B;  2WY2 A;  1WR6 A;  4JLE A;  2H3R A;  2Y48 B;  4JBW F;  2V26 A;  3AB3 B;  4ZI2 D;  4AKG A;  3MZK B;  4HTE A;  4EZ4 A;  2LSG A;  2J4G A;  2MOZ A;  2FJE A;  3AEG A;  1BR4 A;  3CX8 B;  4ILA A;  5HWY A;  2CEA A;  3C4Z A;  4PJN A;  4P0A A;  3PUG A;  5C3J A;  3A7M A;  5ABE A;  3PUR A;  2K9A A;  4NUV A;  3HKB E;  4KUM B;  3KV5 A;  2EHO D;  5FVK A;  1HNX T;  2UXD T;  1UK5 A;  1Y01 A;  3V5S A;  2UU9 T;  1QUU A;  1KNR A;  3TLU A;  2A72 A;  3ZYK A;  3VRB A;  1I94 T;  2BG9 E;  4UIG A;  2QRX A;  2NTX A;  3J7Y q;  3CPZ A;  2V7J A;  4TZ4 C;  3QK6 A;  1UUR A;  2Z6E A;  5FNV E;  2PFV A;  2WDR A;  5HEU A;  4X64 T;  3JC6 D;  3N5L A;  3P4R A;  3ZJ1 A;  3SWH A;  4A5X A;  3VU7 H;  3N9L A;  3IBP A;  4YSY A;  3F57 A;  2JPF A;  4U33 A;  4AIU A;  3RYI E;  3AEB A;  4AI6 A;  3NRY A;  5HEO A;  3FZF B;  1R8I A;  2FJA A;  3RF1 A;  1IJ6 A;  1XDO A;  3IF8 B;  5FKY A;  2HH7 A;  5AQI B;  1D1C A;  3RHW A;  5KX5 E;  4KI0 F;  3UFE A;  1LVK A;  3ESL A;  4PJJ A;  3UQ4 A;  3VR8 A;  1N34 T;  4OFZ A;  4IST A;  3ZN0 B;  1KNP A;  5HXH A;  3PUW F;  3DJB A;  3CIR A;  4QH5 A;  4UEM A;  4WBO A;  3OTO T;  4AIS A;  5F5W A;  5L47 A;  4DR6 T;  5ABF A;  1S35 A;  2XM2 A;  1MIV A;  3JAF A;  4TWH A;  1SUM B;  2NW9 A;  2XTL A;  4PJM A;  4JI3 T;  2BKP A;  5F8P A;  2KSR A;  3D0T A;  2WS3 A;  4AKR B;  2Q9Q D;  4ZS3 A;  2CBJ A;  1YXR A;  2B1E A;  4HGA A;  3PUS A;  2AXD S;  4PNI A;  2IW5 B;  1KF6 A;  2XQA A;  4TNV A;  3AEA A;  4H63 H;  1KK7 A;  2JJ9 A;  3KVB A;  2VVN A;  2IAK A;  3NZQ A;  1XMQ T;  4U7I A;  2CM0 A;  2LLY A;  2V6X A;  2W61 A;  2LSY A;  3AED A;  2JQH A;  2H7V C;  1BR1 A;  4X62 T;  2PBI A;  3WAK A;  4CXW A;  3AE4 A;  1W0B A;  4OYK A;  3AE9 A;  5LNK A;  3TKL B;  4EED A;  2ODV A;  3KV9 A;  3P8C D;  4HKA A;  5C2T A;  3LG7 A;  4ILU A;  1BR2 A;  1W9R A;  2WWV A;  3M65 A;  2L3L A;  2MPK A;  3CQX C;  4ILC A;  4DVD A;  4WW0 A;  3SOL A;  5LA6 E;  4CN6 A;  4A97 A;  2W4X A;  4X65 T;  3ZC0 A;  4HWC A;  4UF0 A;  5EK3 A;  3ZMU B;  2X9X A;  4CN4 A;  2QVA A;  3KFW X;  5LHH B;  1N32 T;  3HL6 A;  4DR5 T;  3ZMS B;  2KWI B;  3ZT5 A;  2LM9 A;  2C5I T;  2CXL A;  3N2O A;  3Q5X A;  4I43 B;  3QUJ A;  5IHY A;  4TWF A;  5HEG A;  4YTN A;  4U3C A;  3UU6 A;  5JRE A;  3EUH A;  4N78 D;  4GK5 E;  3MXZ A;  4AQG A;  5AQU B;  2Y6X A;  3AEE A;  3N9N A;  5JDM A;  3SS1 A;  4DMW A;  5IYZ E;  1OED E;  4MBQ A;  5HCJ A;  1XNQ T;  3AEF A;  4HWH A;  5ADX L;  2V7M A;  1FJG T;  2BG9 A;  5HCM A;  2LEH A;  4O8S A;  3RYF E;  2HN1 A;  2LJL A;  2LOP A;  1HX8 A;  4GK0 E;  4XZC A;  1CHU A;  3U78 A;  5LMN T;  4YXD A;  3OYX A;  4AKL A;  2YDQ A;  3UUM A;  4LF6 T;  1WR0 A;  5H6R B;  2PG8 A;  3ZT6 A;  3RX6 A;  1D0X A;  2LOS A;  4TV9 E;  4AQY T;  1M62 A;  2VKJ A;  4FJO A;  4O2B E;  4OYJ A;  3EDV A;  5CJ5 A;  2CWY A;  2JRK A;  3ZLI A;  1HS7 A;  4ZEY A;  2WMO A;  2N9D A;  1MIW A;  2LHR A;  4TUY E;  2LE8 A;  3UTK A;  2E8I A;  4UXN B;  4O4H E;  5FL1 A;  4KBM B;  3UU5 A;  3ZYM A;  2V5C A;  1Z0P A;  2YDR A;  4LMK A;  2JIW A;  2XQ3 A;  4DMV A;  2MAW A;  5DJQ C;  4H9N C;  4A98 A;  2VWA A;  4LML A;  3N2K E;  4KHZ F;  4TN7 B;  5J2T E;  1HNZ T;  1N36 T;  2WSS V;  3PU3 A;  3R84 B;  3RYH E;  4EAH A;  4DO0 A;  4YJ3 E;  4Q25 A;  4LFA T;  3FHN A;  2XJ7 A;  2V1D B;  3TLS A;  3BQI A;  4HFD A;  3C64 A;  3AE6 A;  3UT5 E;  5LYJ E;  1V9D A;  3S4U A;  4YHJ A;  4B6X A;  2ZLY A;  1W09 A;  3RC3 A;  1OWA A;  2UXC T;  2XZE A;  2BKO A;  3E22 E;  2ZM2 A;  3HKC E;  2WU2 A;  3AVS A;  2QYW A;  4X1K E;  2GK9 A;  1E7P A;  4LF5 T;  3C4X A;  3N9O A;  5J2U E;  3K1S A;  4IE6 A;  5EK2 A;  4H63 V;  2JQ9 A;  2X66 A;  3UU3 A;  2OV9 A;  4EIW A;  2W0G A;  4DND A;  4UV9 B;  3QC9 A;  3UQ7 A;  5AQQ B;  1VOM A;  5LXT E;  1E1H B;  1MIY A;  3TLT A;  2W67 A;  3KV6 A;  4I4T E;  4NIQ A;  2XQ8 A;  3RYC E;  3FBL A;  4HFB A;  3CQC B;  4U74 A;  4QKN A;  2CWO A;  4DV6 T;  2D9D A;  2CXD A;  3R6N A;  4A56 A;  4JUY A;  3AAI A;  5FVL A;  4L5G A;  3UUX B;  3UUB A;  5L3B B;  4YHH T;  5FXW A;  5FMN A;  1QLB A;  2ES0 A;  5HAX A;  4YSZ A;  3HKE E;  4NUU A;  4IE5 A;  2CMR A;  5TAO A;  5FXV A;  2KMF A;  1ZP0 A;  2OA5 A;  4YTM A;  4PAG A;  2N2N A;  5L3E B;  4CN1 A;  4IE0 A;  4QX7 B;  1VCT A;  3E0Z A;  5L3G B;  2X9Y A;  1KFY A;  4IL4 A;  3LK2 B;  4LF4 T;  3C50 A;  1HFA A;  3AA1 B;  2RPA A;  2XY8 B;  5CGM A;  4I50 E;  4G2A A;  3ABV A;  4KP3 C;  4L9I A;  3DP7 A;  4JI0 T;  4YLH A;  2XSB A;  1W0A A;  3PUZ F;  1OED A;  5FY7 A;  2L8K A;  1QSD A;  4DR3 T;  1J5W A;  2QGS A;  4GYS A;  2PTF A;  3HKD E;  5LJN A;  2A3D A;  4TNW A;  4JI2 T;  5JR9 A;  2XAS B;  2X0L B;  2PJQ A;  3AEC A;  1ZV4 X;  4Z91 A;  3K3O A;  4IRE A;  4HN9 A;  2ODU A;  3ZMV B;  4UEL A;  2F4V T;  2CE7 A;  3OPC A;  4XAX B;  4AKH A;  4H9Q C;  2KIN B;  5JR9 C;  5JDH A;  4E7S A;  2WWU A;  2CRB A;  4IDP A;  4EV6 A;  4F6R C;  3CVR A;  2IC6 A;  5JVD E;  2BBJ A;  4CI2 B;  5AQL B;  1IBK T;  3AXJ A;  3H37 A;  4PK4 A;  2EHO B;  4ERR A;  1YKE B;  3RIA A;  2YDS A;  2NW7 A;  4DUZ T;  5L2L A;  5LG3 A;  5DQV A;  3AE5 A;  5AQN B;  4LMJ A;  2BKN A;  5CA0 E;  3QB5 K;  5HXC A;  2WCA A;  3L39 A;  4EGW A;  4B3S T;  4HFH A;  2CLY C;  2VKH A;  3MK7 C;  2WQY A;  1MMN A;  2NWB A;  2E5L T;  3PV0 F;  2B76 A;  5FL0 A;  2ZMA A;  1D0Y A;  2C5K T;  4DBQ A;  3KBU A;  2V6Y A;  2VQE T;  4ASK A;  2SPC A;  2VQF T;  2XAJ B;  3CX6 B;  2V7L A;  2W00 A;  5JDG A;  2JMK A;  3ZST A;  2Y8D A;  2N1G A;  5LGU B;  5KXJ A;  1GQE A;  2WM9 A;  1D1A A;  1YQ3 A;  5AQG B;  5HWX A;  4UVC B;  4EZH A;  5J0Z A;  3LBX A;  2A9U A;  3GN5 A;  3BQL A;  1LVF A;  4X66 T;  3I1A A;  4LFB T;  5FYM A;  4HFI A;  3ZC1 A;  3FZM B;  1IBM T;  1HG5 A;  1WFD A;  3OVU A;  4QHO A;  1OXZ A;  1U5P A;  1HX1 B;  4H9R C;  5LG4 A;  5LB7 B;  4QX8 B;  2JQQ A;  3FXD B;  3JAE A;  4FI5 A;  4GOU A;  4X5T A;  2XQ5 A;  4UR9 A;  4LF8 T;  2X68 A;  2Q9Q B;  2D0T A;  4MAL A;  5HXE A;  4E7Z A;  5DAB A;  5E0O A;  4UVA B;  3CKD A;  4U2Z A;  4XBF B;  3F2E A;  2ZM8 A;  2WMN A;  3T1Y T;  4Z90 A;  5EZY E;  5JDF A;  3T1H T;  5F3J A;  5C8Y E;  2DNX A;  3ANW B;  2RP4 A;  4IT4 A;  1KNZ A;  3KVA A;  5JRC B;  1J5E T;  3M3Z B;  3J9X 1;  4WNK A;  4EB6 E;  4JI8 T;  1YKH B;  2DLR A;  3ZMT B;  1Z8U A;  2XQ9 A;  3RI5 A;  4PFP A;  4TV8 E;  2BVL A;  5BR8 T;  3OJA A;  2VL8 A;  2NR4 A;  4P1N A;  3ZSS A;  3ONJ A;  4ILB A;  2WP9 A;  3EAB A;  4H9O C;  4B3T T;  2E9X A;  2M6I A;  5CA1 E;  3KIN B;  4IGU A;  2VUR A;  2KXP B;  2K3W A;  3AVR A;  4NXM T;  4MFR A;  5LGT B;  3BQK A;  2IIU A;  3O1I A;  3GA8 A;  5CB4 E;  3IEE A;  5FP3 A;  3O4X E;  4LFC T;  1J1J A;  4C90 A;  2OLT A;  5IUX A;  2K24 A;  1VCS A;  2YKS A;  3ONX A;  3PUA A;  2VKD A;  3ETU A;  2UXX B;  4EEB A;  2X9H A;  3Q5E A;  2UXN B;  4ANJ A;  2BS4 A;  3P50 A;  3ZT7 A;  4AQF A;  4K0K T;  3CWZ B;  2NP9 A;  3AE1 A;  3L3P A;  2BG9 C;  5DQW A;  2W2U A;  1Y64 B;  2CXF A;  2X0H A;  1HTJ F;  1MMD A;  2VAS A;  2YOE A;  5AQO B;  2DCF A;  1E2A A;  5FY1 A;  4CI1 B;  5LOV E;  4GKK T;  3L09 A;  2R6G F;  4WZX A;  4AQF C;  2X51 A;  3NKZ A;  4DBR A;  3AA0 B;  2YN6 A;  3LFM A;  2D2S A;  3X1D A;  4EOZ B;  2V7I A;  4U31 A;  4V1A v;  4HWD A;  1UX4 A;  1NWM X;  2DWG A;  3MAC A;  4IE4 A;  4GIW A;  5EK4 A;  3FXE B;  3ONL C;  5H6Q B;  1UCU A;  2X9W A;  3Q5W A;  2YU2 A;  2XQ6 A;  3LSV A;  1US7 B;  3OBV E;  5LHI B;  2HPJ A;  4X20 E;  4DUY T;  2CPT A;  5ABH A;  4MHC A;  5AQV B;  2XAH B;  3OYZ A;  5ABF B;  3RQW A;  4HFV A;  3PUX F;  3P4Q A;  4JI1 T;  2XPK A;  2KZ7 B;  3EAM A;  3O1J A;  2VVS A;  4ADZ A;  1SE7 A;  4ZI7 E;  3AA6 B;  1SHZ C;  3ZYL A;  5A1L A;  2VK9 A;  2X67 A;  2IML A;  3PUV F;  3FBZ A;  2J62 A;  2G0U A;  3KDS E;  2W63 A;  2RA1 A;  3RPU A;  1KEY A;  3O1H A;  1T8B A;  2FJB A;  4YJ2 E;  1HR0 T;  3RGL A;  2M67 A;  1NEK A;  2XAF B;  5CFB A;  2E5V A;  3B5M A;  1VRB A;  3C98 B;  5LHG B;  4KX6 A;  1MNE A;  2MBG A;  3RC8 A;  2VB6 A;  4NXN T;  2HPL A;  1U4Q A;  2XQ7 A;  3ZEF B;  3UUL A;  4QWN B;  5LBQ B;  2VL0 A;  2V5D A;  5LGN B;  1LRZ A;  3LK4 2;  5AQH B;  2DWK A;  3NWI A;  1YW0 A;  3ZKR A;  3V5U A;  4M1P A;  2ACX A;  2KLQ A;  3P4P A;  3PU8 A;  4OK0 A;  2XSA A;  1HNW T;  4YT0 A;  2NTY A;  2P9B A;  4P09 A;  2WAU A;  2BBH A;  2WU5 A;  3ZN1 B;  2FUP A;  4UF0 B;  4CXX A;  2KWH A;  4DV3 T;  4HEA A;  2V7K A;  4O4I E;  4H9P C;  4MLK A;  4GYR A;  5J1G A;  1HF8 A;  2XHE B;  5HXS A;  2VKO A;  2BZB A;  2H89 A;  3MA9 A;  4ZI3 C;  4LF9 T;  3C4W A;  4G63 A;  2BDE A;  3ZCJ A;  4J2C A;  4YSX A;  2MTQ A;  1XMO T;  1HG2 A;  2DL1 A;  4YTP A;  1BR0 A;  4JEH B;  2NOX A;  3B13 A;  3HR0 A;  2IC9 A;  2ZM0 A;  1UX5 A;  1I6Z A;  2CHN A;  4X1I E;  4U7Y A;  4CI3 B;  5L3D B;  5JTG A;  2J47 A;  2BG9 B;  1OED C;  5JDL A;  3C51 A;  3FZK B;  4PK5 A;  1FIO A;  4BA9 A;  2K5B B;  1NAF A;  3EDU A;  4X1Y E;  4EXT A;  3MJX A;  3VHL A;  2FJD A;  1SA0 E;  3PE0 A;  3HI2 A;  1ZOY A;  1XWM A;  3RKG A;  2WB5 A;  2BS2 A;  3NBX X;  4IIJ E;  2C5J A;  4I55 E;  5AQJ B;  3E08 A;  4YY3 T;  2KT9 A;  1S94 A;  2UUB T;  3CX7 B;  1MND A;  5HEH A;  3EVY A;  3AE7 A;  3IHR A;  3I0Q A;  2D5U A;  3QB5 A;  3RH3 A;  3Q2M A;  5AQF B;  1YQ4 A;  2IHR 1;  3U3I A;  2XQY A;  4CQI A;  5LBM A;  3VR9 A;  1FMV A;  1WYB A;  4PJL A;  3A8Y C;  2LRL A;  3A5X A;  1WLX A;  1O3X A;  1D0Z A;  5L3C B;  4UV8 B;  4OX9 T;  3B57 A;  1UGO A; 
#chains in the Genus database with same CATH homology
 2I0M A;  2BKN A;  4Q25 A;  2IIU A;  3L39 A;  1XWM A;  2BKO A;  2OLT A;  2BKP A;  1T72 A;  1SUM B;  1VCT A;  1T8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...