1WR0A

Structural characterization of the mit domain from human vps4b
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
GSDHMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SKD1 protein
publication title Structural characterization of the MIT domain from human Vps4b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 28
structure length 81
sequence length 81
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1wr0A01
4CN4A 4U31A 2V6YB 4ZEYA 4A5XA 2K3WA 4U33A 3ZT6A 5LB7B 2MPKA 3EABA 2WWVA 4IT4A 1WR0A 4U2YA 2JQKA 2CRBA 2V6YA 4U7IA 2JQHA 1WCRA 4U3CA 4U2ZA 2WY2A 3ZT5A 3ZT7A 1WFDA 3K1SA 2A9UA 5CGMA 5CJ5A 2JQ9A 4CN6A 2DL1A 4NIQA 4CN1A 4WZXA 2W2UA 2LRLA 5FVKA 5FVLA 2RPAA 4U7YA 4P1NA 2CPTA 1YXRA 2LRKA 2XZEA 2V6XA 3ZSSA 3ZSTA
chains in the Genus database with same CATH superfamily
2FJBA 1M7KA 4O4LE 4EV6A 2CE7A 2IIUA 2JJ9A 2LHRA 2XQ7A 3M65A 2WCAA 4IE4A 2EHOA 2KNDA 2RPAA 3EUHA 3UTKA 3JC6D 3N9QA 3VRBA 2YN6A 4PJMA 5ETWA 3KVAA 4UVBB 5F8PA 3AEAA 3CQXC 3N2GE 3AXJB 1WCRA 4HKAA 3PU3A 2XTLA 1HG5A 4EEBA 2VURA 3MXZA 3PTRB 2E9XB 2UUBT 4MLKA 2CPTA 2WM9A 2LRKA 1LVFA 4YSYA 4U31A 3RX6A 3BK9A 2X0LB 4CXWA 2JPFA 4YSXA 4GKJT 1YKHB 2FJAA 5BR8T 4O8SA 3FZLB 4UIGA 2ACXA 1NENA 2CXDA 5AQUB 4I4TE 4IL4A 3ZMUB 2X0YA 3UUBA 4QX7B 3R6NA 4CXXA 2V5DA 2V26A 4B3RT 2H89A 5JREA 4A56A 5L3CB 4GKKT 3NZPA 5FVKA 2WZHA 4QXCB 1UCUA 1XDPA 1BR4A 3JCFA 3FHNA 4ZOLE 4AQYT 4LF7T 3ONXA 1U4QA 3P7IA 4OFZA 2DHRA 3QK6A 2M6IA 3LJCA 4XZCA 3ANWB 4F6RC 5LHIB 2CBJA 4B3ST 4EIWA 1MMAA 3VRAA 3VKGA 2FBWA 3PDYA 2IC6A 2CA5A 4AXPA 4A98A 5AQOB 3C98B 4LFBT 4YJ3E 3NKZA 4YFSA 4NUUA 3KV6A 4X65T 3ZT7A 2XAHB 4MALA 4U74A 5FY1A 3W15B 5LGNB 2LKHA 5HXEA 3E08A 4DR4T 4DV7T 1OEDA 3ZLIA 2QGSA 5JDMA 4UR9A 3O1IA 5H6RB 2D0TA 3N9LA 3OPCA 5AQPB 2WZIA 5JH7E 5CFBA 4JI7T 2LJLA 2AXDS 5LOVE 4X5TA 1VCTA 3SWHA 1HCIA 2H7OA 2VKDA 3PE0A 4DV0T 5BMVE 4MHCA 1MIWA 2ZM0A 4EAHA 4N78D 1WYCA 3AEGA 2XPKA 2CRBA 2WY2A 3ETUA 3ESLA 2LLYA 1BR1A 5JRCB 2W61A 3RKOA 4JI6T 3AAEB 4L9IA 2LSYA 4H9QC 3I1AA 2PFVA 5KX5E 4XAXB 5CA1E 5FY0A 2KSRA 3A5XA 3K3OA 2WB5A 1JNRA 4CN6A 4IE6A 3UU8A 2C5IT 4LF6T 2E5VA 5JDFA 1X79A 3HA4A 2VKOA 5LG4A 2ZLYA 4CXYA 2R6GF 3L8RA 3UU3A 2WS3A 2G0UA 4E7SA 3L39A 4NUVA 2IAKA 3P50A 2Q9QB 5L3EB 2H3RA 4O2BE 5DQVA 3OYZA 2HPLA 3LK42 3QUJA 2NTXA 2CWYA 5LP6E 5EZYE 4COFA 4AKHA 4LMJA 1HNZT 3LFMA 1KF6A 3ONJA 4NXNT 4KHPT 2XQAA 4PJNA 2W62A 2XQ3A 3ZT6A 2WDQA 2X9WA 1HF8A 5J1GA 1QUUA 3JAFA 4H9SE 2JQHA 4BA9A 4X62T 2X9YA 4HWCA 2VL8A 3IEEA 2YDQA 4KI0F 1D1BA 4U7YA 4HFHA 4DUYT 1HG2A 3GN5A 5L2LA 3RC8A 2BZBA 4UXNB 4Z90A 3AVRA 3ZYMA 3U3IA 5F3JA 1WR0A 4PJJA 4BJMA 2A2FX 4HWIB 3Q5EA 1MNEA 1IJ5A 4HFEA 4TV9E 4DR6T 4ILCA 3C50A 4GYSA 4KHZF 2VQET 4JI3T 2WMNA 3ZKRA 3AVSA 2CHOA 3UU5A 2CWOA 2ZM2A 2UXNB 5HCMA 3F57A 3PUXF 1S94A 2HN2A 1N33T 4LFCT 3JC6C 3PURA 3LK2B 2X9HA 5IUXA 3OVUA 1ZKEA 2I6HA 2JMHA 3PUVF 5LJMA 4ZI7E 3AE5A 4Z8XA 4ZZCA 2CXFA 5ABGA 1J5ET 2Z6EA 2KMFA 4KBMB 2V5CA 2DNXA 5AQQB 3RGLA 3ZMZB 4UVCB 2NWBA 4ZEYA 3AE4A 4ANJA 3AA7B 1OWAA 3IBPA 4YHJA 3E22E 5L3DB 3C4ZA 5FL1A 1UGOA 4H9RC 5LA6E 1XNRT 2EHOD 3VHLA 2P9BA 4GK5E 4UEMA 3CX7B 2JQKA 3AA1B 1KNPA 3PU8A 1VCSA 4JI2T 3N9NA 2BBJA 2BKNA 3KBUA 5EK3A 4H9NC 1UX5A 2XSBA 3CX8B 3H3MA 1YD8G 2XJ7A 3PUQA 2WWVA 3F31A 5AQNB 2A9UA 3PUGA 4PNIA 1Y01A 3FZHB 3SOLA 4OX9T 3ZYLA 4JI5T 5ABEA 4DUZT 1ZEEA 3LG7A 3WAKA 4ZI2D 1O3XA 2VVSA 1OXZA 1IZNB 3AXJA 2KINB 4CN4A 2BS2A 3RHWA 4ILUA 1V9DA 2V6YB 3KV5A 2E9XA 4HTEA 2V7KA 1Y64B 2KWIB 2F4VT 2WDVA 5LGUB 1GQEA 2BG9E 4H63H 3AE6A 4OYKA 2KXPB 2UXBT 1W9RA 1FMVA 1T7SA 2LOPA 4BJNA 1XMOT 3JAEA 5AQVB 3VKHA 2RP4A 2VKJA 3HR0A 3RKGA 3Q5WA 4PFOA 5CA0E 3ZSTA 2OV9A 2V7IA 5AQTB 3TLVA 2VWAA 5AQIB 4CI2B 3RQUA 5L3BB 5FMNA 1E7PA 2VASA 1BR0A 5JDLA 3UUXB 4IDNA 4YLHA 3HKBE 1HR0T 4CI3B 5M4YA 2XASB 3O1JA 2V6XA 4QH5A 1XZYA 3ANWA 4DMVA 3M3ZB 1IJ6A 2VVNA 3SRZA 4DR1T 2W4XA 3Q5XA 2IW5B 2NR4A 3HL6A 1N32T 5CB4E 4F8HA 2HH7A 2WU5A 2YEVC 4DBRA 2CXLA 2K24A 5AQKB 2NW8A 2VB6A 4AKGA 4IDPA 2A72A 3C4XA 4QHOA 4LF5T 4TWFA 4BAYB 2W66A 1SUMB 4NIQA 5JDNA 2MAWA 5HWYA 3UT5E 2D2SA 2GK9A 2JRKA 3CVRA 2LSKA 2J1DG 2QVAA 4DR7T 2EHOB 1FJGT 5HXHA 2KLQA 2A3DA 4JI0T 4U2YA 3AA6B 4EZ4A 4WZXA 1KNRA 4DR5T 2YK0A 2XQ8A 1FEWA 3A8YC 5LBMA 4KUMB 2ZMAA 3PUSA 5JRCA 3PJAJ 4PW8A 3RIUA 4DR2T 1YQ4A 2WMOA 4JI8T 3T8OA 4K0KT 2C5KT 4HFBA 2I59A 4U3CA 5LMUT 1X9BA 2FUPA 2YDRA 4IE0A 5AQHB 2N2NA 3AECA 3ZMSB 3RYIE 5LHGB 3N9PA 4OHFA 4DVDA 2XAJB 1L0VA 1HFAA 2K48A 2H88A 2MTQA 1ZOYA 2IC9A 4P0BA 3RIAA 4P0AA 3N9OA 5JTGA 4G2AA 2E2AA 4C90A 2ODVA 3OBVE 2UU9T 1YKEB 2LE8A 4HFVA 3O9XA 3LK3B 2Q9QA 1NWMX 3FZFB 5LG3A 1I6ZA 2XQ5A 2XM1A 2WAUA 3UUMA 5JDGA 3HKEE 3A7MA 3ZEFB 1D0XA 2XZEA 3MJXA 3RIFA 3I0QA 2J47A 2B1EA 3NWIA 3ZN1B 4OYJA 3IA3A 5JDHA 3AAIA 5KDMC 4EYYR 5HEGA 2X67A 4ASKA 2YINA 4PAGA 4LMKA 3N2OA 2W67A 4EXTA 2IDOB 5IHYA 3AA0B 3EABA 4YXDA 4IT4A 3CQCB 3S4UA 3SFEA 1NAFA 2C5JA 4DV6T 2EHOC 3VR9A 2ZM8A 2IMLA 3KV9A 3BQLA 4O2AE 5IWAT 3MA9A 4A97A 3SS1A 2LEHA 4GIWA 3E0ZA 4CN1A 4AIUA 4H63V 4Q25A 3I9YA 5ABFB 1E2AA 3ZC0A 3KDSE 5LB7B 5HEOA 3OKQA 2L8KA 2D0UA 2J4GA 3AE3A 1LKXA 1U5PA 2CEAA 3OTOT 2BKPA 3F2EA 3J7Yq 4KX6A 5CGMA 4L5GA 2BG9A 3K8PC 4DV4T 4GOUA 3X1DA 4HFDA 3WAJA 2UXCT 4U33A 1S35A 1HTJF 3EDVA 4CQIA 4O4JE 3QOFA 3ZCJA 2E5LT 3WI3A 1IBLT 3QC9A 4ISSA 3UQ4A 4P1NA 2XAQB 1SE7A 5A1LA 2LM2A 4AKRB 3MK7C 3FZKB 4AQGA 4LF4T 2MPKA 2IUBA 3FBLA 4UF0A 3RLFF 4L0RA 5FKYA 2NP9A 5C8YE 1Z8UA 2CM0A 3RQWA 3HKDE 3UFGA 3KINB 3AAAB 4B6XA 1IBMT 1FIOA 4TUYE 4WW0A 2NOXA 4HE8A 3AE1A 4ZZBA 5HEJA 2ES0A 4HFCA 2E9XD 1W0AA 4V1Av 3ETVA 2XY8B 5JR9B 4HGAA 2W00A 2XQ4A 5IYZE 2N9DA 4NPPA 4YY3T 4IL9A 3B13A 4IE5A 5J0ZA 3T1HT 1QLBA 3UU6A 3NBXX 4QWNB 2M67A 3J9X1 2W2UA 4HWFA 1WLXA 1YW0A 4DV5T 2PTFA 2KT9A 4WYVA 3P4WA 5AQMB 4M1PA 5F5WA 5EK4A 2PBIA 2V6YA 4DV1T 3O4XE 3KVBA 2H7VC 3V5UA 3FZMB 5FXWA 3K3NA 5FXVA 3ZT5A 3ZCIA 5FY7A 4J2CA 4JUYA 2Y8DA 2BBHA 2BKOA 4B3TT 1M62A 5DQWA 2WU2A 4TWDA 3AEFA 5HYAA 2NW9A 2K3WA 2X0HA 5HAXA 3RH3A 3H37A 2ZM6T 3RC3A 1SHZC 4X1KE 4QXBB 1H7CA 4YSZA 4YHHT 2ACZA 3DP7A 5H6QB 3RRWA 2LSJA 1G8XA 1D0ZA 1WR6A 2OA5A 5HXCA 5HWXA 1N34T 3JADA 5LBQB 1W09A 3L09A 4WNKA 4JV5T 2NTYA 4QXHB 3Q9DA 1HNXT 4ZXLA 2CBIA 3U78A 4ILBA 5L4HA 3AE2A 2K9AA 3ABVA 3ZMVB 1AJ3A 2L9QA 2XUEA 2HHHT 4DBQA 2JMKA 4UV9B 4TV8E 5JR9C 3KV4A 3CIRA 4NXMT 2K5BB 4JBWF 4PK6A 3QB5A 1EZ3A 1LVKA 4YTMA 5FP3A 3TLSA 4U72A 4E7ZA 5FL0A 2N1GA 3SFDA 2AE9A 2B76A 5AQGB 3N2KE 2UUAT 4LMLA 1US7B 3PUAA 1BR2A 2ODUA 3GWHA 4IDQA 3N9MA 1LRZA 1UK5A 3P4PA 4YJ2E 1ZV4X 4O4IE 4EGWA 2HN1A 2DI4A 4GYRA 2V7JA 4U2ZA 5FXZA 3LBXB 4YTPA 4AKLA 2LM9A 2WSSV 2Q9QD 5LYJE 3LSVA 4KMCA 4ZI3D 5GONE 4K0UA 3I0OA 1VRBA 4FJOA 3T1YT 3B57A 4XBFB 1XNQT 1WYBA 1QSDA 2LKGA 5HCJA 2BVMA 2M6BA 3V5SA 4FI5A 5LHHB 4EZHA 2X51A 1MNDA 2DWKA 4EOZB 4AKIA 2WP9A 3IF8B 5CJ5A 5J2UE 1D1CA 1JNZA 2I0MA 4AI6A 4EB6E 4UELA 1YXRA 4JI4T 1HX8A 3FBZA 3ZYKA 2SPCA 3KFWX 3AE7A 2KWHA 2V1DB 3UULA 1ZP0A 4LF9T 1XMQT 3EI0A 3EAMA 2XQ6A 2VQFT 5J2TE 5JVDE 3PV0F 4X1IE 5AQRB 1T98A 3FXDB 3CWZB 3ZSSA 4IHJE 3CQGB 2J62A 3ZJ1A 3AE9A 2RA1A 2C0SA 2BVLA 5JQGE 2HPJA 4ZS3A 1MIVA 3EVYA 1KEYA 4TWHA 4ILAA 2MBGA 4PJLA 1ZHCA 5L47A 2UXXB 4X64T 2LOSA 5FNVE 2QYWA 2CCQA 3VR8A 4MFRA 3R84B 1MMNA 1MMGA 4PK4A 3ZPOA 2WQYA 3P4QA 2QRXA 3C51A 5ADXL 5KXJA 2YU1A 2W63A 4AQFC 1IBKT 4JYAT 4PFPA 3P4SA 3NVOA 2L3LA 5AQFB 5HEUA 3DJBA 3UQ7A 1B7TA 2E9XC 2XHEB 5LMNT 3UFEA 2DLRA 3Q2MA 5ABFA 3L3PA 2V8SV 1CHUA 4JI1T 5E0OA 2VL0A 3PJAA 3CKDA 2XAGB 5AQJB 3H3AA 3PUYF 4LFAT 4DV2T 3NZQA 5L4EA 2OLTA 1UX4A 1SA0E 1HX1B 2XQYA 3BQIA 4HN9A 1OEDB 2Y48B 3UU4A 4JEUB 4PK5A 4YT0A 5L3FB 2X68A 1UURA 3TKLB 4I50E 3CMLA 4G63A 3CPZA 1FMWA 2IHR1 5TAOA 2JQ9A 3GMIA 2CLYB 3N5LA 2BDEA 2XQ9A 1MIYA 2MYSA 4JEHB 4A5XA 4IIJE 4MBQA 3RI5A 2YU2A 3AEDA 3PUWF 4UV8B 2BS4A 4IGUA 5LNKA 2VK9A 4X20E 4ERRA 3TLUA 3I9WA 2X66A 4O4HE 3BQKA 4ZI2C 3P4RA 5KMGP 1R8IA 4HWHA 1G73A 5ABHA 4DV3T 2X9XA 1N36T 5C3JA 3MACA 3ONLC 3FB2A 5FXXA 2LHNA 4DO0A 5HXSA 2Y6XA 1J5WA 5JR9A 3RRCA 2YKSA 2YDSA 1KNZA 2D5UA 3MZKB 5LGTB 3D0TA 5FVLA 3MKDA 2UUCT 3QNUA 3P8CD 1UUSA 3RIUC 4QX8B 4CZZB 1J1JA 3NRYA 2D9DA 4HFIA 4AISA 3UUNA 2BS3A 1KK7A 3EDUA 2JIWA 4ZS2A 2DCFA 3CX6B 2XSAA 3KBTA 5EK2A 1HS7A 1OEDC 1OEDE 3OYXA 1T72A 3GA8A 4I0UA 4HEAA 4H9PC 2UXDT 2V7LA 3RYFE 2VKHA 4Z91A 2QA7A 4ISTA 4EYUA 4IE7A 2JQQA 1I94T 1T8BA 1WFDA 1WRDA 3TLWA 3GN5B 1XWMA 5DABA 2LSGA 2CLYC 4DIDB 2BG9B 1CUNA 4GK0E 2Q9QC 4QKNA 4UVAB 2WDRA 4ZI3C 2MOZA 2V7MA 3RYHE 3O1HA 3IHRA 5DJQC 4DR3T 5C2TA 4DMWA 3AB3B 4JLEA 1D1AA 1XDOA 3C4WA 4B3MT 4TN7B 5LCYA 3ZC1A 2W0GA 3HKCE 3K3QC 3AEBA 3VU7H 2LSIA 3RPUA 3AE8A 4QH4A 4C91A 1W0BA 3ZMTB 1Z0PA 4UF0B 2KZ7B 3ZJ2A 4H9OC 4WBNE 2CMRA 5LJNA 4YTNA 3K1SA 2E8IA 3RF1A 1VOMA 2XAFB 3Q5DA 2XM2A 5AQLB 4HWDA 3TLTA 2FJDA 1DU2A 5HXRA 1MMDA 2LT3A 4U7IA 5HEHA 3PUZF 2WWUA 2WBLA 2DL1A 1IAPA 3AEEA 4KP3C 3FXEB 4TX5A 4IREA 5JDQA 2NW7A 1D0YA 4IDZA 5AFUL 4EEDA 5L3GB 2CHNA 4CI1B 3B5MA 3ZN0B 1NEKA 2FJEA 4OK0A 4P09A 3C64A 4WBOA 4TNWA 4LF8T 2LRLA 3G06A 4IDOA 3NRXA 2YOEA 4TNVA 1HNWT 4ZHQE 4AQFA 4ADZA 3LBXA 4X1YE 3CK6A 4X66T 4QH1A 5FYMA 2PJQA 4DNDA 5AQSB 3HI2A 5LXTE 3EHZA 2DWGA 1E1HB 2PG8A 3OJAA 4I55E 4I43B 4TZ4C 3RYCE 3QB5K 3DTOA 2BG9C 3LDQB 1KFYA 1YQ3A
chains in the Genus database with same CATH topology
4CN4A 4U31A 2V6YB 4ZEYA 4A5XA 2K3WA 4U33A 3ZT6A 5LB7B 2MPKA 3EABA 2WWVA 4IT4A 1WR0A 4U2YA 2JQKA 2CRBA 2V6YA 4U7IA 2JQHA 1WCRA 4U3CA 4U2ZA 2WY2A 3ZT5A 3ZT7A 1WFDA 3K1SA 2A9UA 5CGMA 5CJ5A 2JQ9A 4CN6A 2DL1A 4NIQA 4CN1A 4WZXA 2W2UA 2LRLA 5FVKA 5FVLA 2RPAA 4U7YA 4P1NA 2CPTA 1YXRA 2LRKA 2XZEA 2V6XA 3ZSSA 3ZSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CN4 A;  4U31 A;  2V6Y B;  4ZEY A;  4A5X A;  2K3W A;  4U33 A;  3ZT6 A;  5LB7 B;  2MPK A;  3EAB A;  2WWV A;  4IT4 A;  1WR0 A;  4U2Y A;  2JQK A;  2CRB A;  2V6Y A;  4U7I A;  2JQH A;  1WCR A;  4U3C A;  4U2Z A;  2WY2 A;  3ZT5 A;  3ZT7 A;  1WFD A;  3K1S A;  2A9U A;  5CGM A;  5CJ5 A;  2JQ9 A;  4CN6 A;  2DL1 A;  4NIQ A;  4CN1 A;  4WZX A;  2W2U A;  2LRL A;  5FVK A;  5FVL A;  2RPA A;  4U7Y A;  4P1N A;  2CPT A;  1YXR A;  2LRK A;  2XZE A;  2V6X A;  3ZSS A;  3ZST A; 
#chains in the Genus database with same CATH topology
 2FJB A;  1M7K A;  4O4L E;  4EV6 A;  2CE7 A;  2IIU A;  2JJ9 A;  2LHR A;  2XQ7 A;  3M65 A;  2WCA A;  4IE4 A;  2EHO A;  2KND A;  2RPA A;  3EUH A;  3UTK A;  3JC6 D;  3N9Q A;  3VRB A;  2YN6 A;  4PJM A;  5ETW A;  3KVA A;  4UVB B;  5F8P A;  3AEA A;  3CQX C;  3N2G E;  3AXJ B;  1WCR A;  4HKA A;  3PU3 A;  2XTL A;  1HG5 A;  4EEB A;  2VUR A;  3MXZ A;  3PTR B;  2E9X B;  2UUB T;  4MLK A;  2CPT A;  2WM9 A;  2LRK A;  1LVF A;  4YSY A;  4U31 A;  3RX6 A;  3BK9 A;  2X0L B;  4CXW A;  2JPF A;  4YSX A;  4GKJ T;  1YKH B;  2FJA A;  5BR8 T;  4O8S A;  3FZL B;  4UIG A;  2ACX A;  1NEN A;  2CXD A;  5AQU B;  4I4T E;  4IL4 A;  3ZMU B;  2X0Y A;  3UUB A;  4QX7 B;  3R6N A;  4CXX A;  2V5D A;  2V26 A;  4B3R T;  2H89 A;  5JRE A;  4A56 A;  5L3C B;  4GKK T;  3NZP A;  5FVK A;  2WZH A;  4QXC B;  1UCU A;  1XDP A;  1BR4 A;  3JCF A;  3FHN A;  4ZOL E;  4AQY T;  4LF7 T;  3ONX A;  1U4Q A;  3P7I A;  4OFZ A;  2DHR A;  3QK6 A;  2M6I A;  3LJC A;  4XZC A;  3ANW B;  4F6R C;  5LHI B;  2CBJ A;  4B3S T;  4EIW A;  1MMA A;  3VRA A;  3VKG A;  2FBW A;  3PDY A;  2IC6 A;  2CA5 A;  4AXP A;  4A98 A;  5AQO B;  3C98 B;  4LFB T;  4YJ3 E;  3NKZ A;  4YFS A;  4NUU A;  3KV6 A;  4X65 T;  3ZT7 A;  2XAH B;  4MAL A;  4U74 A;  5FY1 A;  3W15 B;  5LGN B;  2LKH A;  5HXE A;  3E08 A;  4DR4 T;  4DV7 T;  1OED A;  3ZLI A;  2QGS A;  5JDM A;  4UR9 A;  3O1I A;  5H6R B;  2D0T A;  3N9L A;  3OPC A;  5AQP B;  2WZI A;  5JH7 E;  5CFB A;  4JI7 T;  2LJL A;  2AXD S;  5LOV E;  4X5T A;  1VCT A;  3SWH A;  1HCI A;  2H7O A;  2VKD A;  3PE0 A;  4DV0 T;  5BMV E;  4MHC A;  1MIW A;  2ZM0 A;  4EAH A;  4N78 D;  1WYC A;  3AEG A;  2XPK A;  2CRB A;  2WY2 A;  3ETU A;  3ESL A;  2LLY A;  1BR1 A;  5JRC B;  2W61 A;  3RKO A;  4JI6 T;  3AAE B;  4L9I A;  2LSY A;  4H9Q C;  3I1A A;  2PFV A;  5KX5 E;  4XAX B;  5CA1 E;  5FY0 A;  2KSR A;  3A5X A;  3K3O A;  2WB5 A;  1JNR A;  4CN6 A;  4IE6 A;  3UU8 A;  2C5I T;  4LF6 T;  2E5V A;  5JDF A;  1X79 A;  3HA4 A;  2VKO A;  5LG4 A;  2ZLY A;  4CXY A;  2R6G F;  3L8R A;  3UU3 A;  2WS3 A;  2G0U A;  4E7S A;  3L39 A;  4NUV A;  2IAK A;  3P50 A;  2Q9Q B;  5L3E B;  2H3R A;  4O2B E;  5DQV A;  3OYZ A;  2HPL A;  3LK4 2;  3QUJ A;  2NTX A;  2CWY A;  5LP6 E;  5EZY E;  4COF A;  4AKH A;  4LMJ A;  1HNZ T;  3LFM A;  1KF6 A;  3ONJ A;  4NXN T;  4KHP T;  2XQA A;  4PJN A;  2W62 A;  2XQ3 A;  3ZT6 A;  2WDQ A;  2X9W A;  1HF8 A;  5J1G A;  1QUU A;  3JAF A;  4H9S E;  2JQH A;  4BA9 A;  4X62 T;  2X9Y A;  4HWC A;  2VL8 A;  3IEE A;  2YDQ A;  4KI0 F;  1D1B A;  4U7Y A;  4HFH A;  4DUY T;  1HG2 A;  3GN5 A;  5L2L A;  3RC8 A;  2BZB A;  4UXN B;  4Z90 A;  3AVR A;  3ZYM A;  3U3I A;  5F3J A;  1WR0 A;  4PJJ A;  4BJM A;  2A2F X;  4HWI B;  3Q5E A;  1MNE A;  1IJ5 A;  4HFE A;  4TV9 E;  4DR6 T;  4ILC A;  3C50 A;  4GYS A;  4KHZ F;  2VQE T;  4JI3 T;  2WMN A;  3ZKR A;  3AVS A;  2CHO A;  3UU5 A;  2CWO A;  2ZM2 A;  2UXN B;  5HCM A;  3F57 A;  3PUX F;  1S94 A;  2HN2 A;  1N33 T;  4LFC T;  3JC6 C;  3PUR A;  3LK2 B;  2X9H A;  5IUX A;  3OVU A;  1ZKE A;  2I6H A;  2JMH A;  3PUV F;  5LJM A;  4ZI7 E;  3AE5 A;  4Z8X A;  4ZZC A;  2CXF A;  5ABG A;  1J5E T;  2Z6E A;  2KMF A;  4KBM B;  2V5C A;  2DNX A;  5AQQ B;  3RGL A;  3ZMZ B;  4UVC B;  2NWB A;  4ZEY A;  3AE4 A;  4ANJ A;  3AA7 B;  1OWA A;  3IBP A;  4YHJ A;  3E22 E;  5L3D B;  3C4Z A;  5FL1 A;  1UGO A;  4H9R C;  5LA6 E;  1XNR T;  2EHO D;  3VHL A;  2P9B A;  4GK5 E;  4UEM A;  3CX7 B;  2JQK A;  3AA1 B;  1KNP A;  3PU8 A;  1VCS A;  4JI2 T;  3N9N A;  2BBJ A;  2BKN A;  3KBU A;  5EK3 A;  4H9N C;  1UX5 A;  2XSB A;  3CX8 B;  3H3M A;  1YD8 G;  2XJ7 A;  3PUQ A;  2WWV A;  3F31 A;  5AQN B;  2A9U A;  3PUG A;  4PNI A;  1Y01 A;  3FZH B;  3SOL A;  4OX9 T;  3ZYL A;  4JI5 T;  5ABE A;  4DUZ T;  1ZEE A;  3LG7 A;  3WAK A;  4ZI2 D;  1O3X A;  2VVS A;  1OXZ A;  1IZN B;  3AXJ A;  2KIN B;  4CN4 A;  2BS2 A;  3RHW A;  4ILU A;  1V9D A;  2V6Y B;  3KV5 A;  2E9X A;  4HTE A;  2V7K A;  1Y64 B;  2KWI B;  2F4V T;  2WDV A;  5LGU B;  1GQE A;  2BG9 E;  4H63 H;  3AE6 A;  4OYK A;  2KXP B;  2UXB T;  1W9R A;  1FMV A;  1T7S A;  2LOP A;  4BJN A;  1XMO T;  3JAE A;  5AQV B;  3VKH A;  2RP4 A;  2VKJ A;  3HR0 A;  3RKG A;  3Q5W A;  4PFO A;  5CA0 E;  3ZST A;  2OV9 A;  2V7I A;  5AQT B;  3TLV A;  2VWA A;  5AQI B;  4CI2 B;  3RQU A;  5L3B B;  5FMN A;  1E7P A;  2VAS A;  1BR0 A;  5JDL A;  3UUX B;  4IDN A;  4YLH A;  3HKB E;  1HR0 T;  4CI3 B;  5M4Y A;  2XAS B;  3O1J A;  2V6X A;  4QH5 A;  1XZY A;  3ANW A;  4DMV A;  3M3Z B;  1IJ6 A;  2VVN A;  3SRZ A;  4DR1 T;  2W4X A;  3Q5X A;  2IW5 B;  2NR4 A;  3HL6 A;  1N32 T;  5CB4 E;  4F8H A;  2HH7 A;  2WU5 A;  2YEV C;  4DBR A;  2CXL A;  2K24 A;  5AQK B;  2NW8 A;  2VB6 A;  4AKG A;  4IDP A;  2A72 A;  3C4X A;  4QHO A;  4LF5 T;  4TWF A;  4BAY B;  2W66 A;  1SUM B;  4NIQ A;  5JDN A;  2MAW A;  5HWY A;  3UT5 E;  2D2S A;  2GK9 A;  2JRK A;  3CVR A;  2LSK A;  2J1D G;  2QVA A;  4DR7 T;  2EHO B;  1FJG T;  5HXH A;  2KLQ A;  2A3D A;  4JI0 T;  4U2Y A;  3AA6 B;  4EZ4 A;  4WZX A;  1KNR A;  4DR5 T;  2YK0 A;  2XQ8 A;  1FEW A;  3A8Y C;  5LBM A;  4KUM B;  2ZMA A;  3PUS A;  5JRC A;  3PJA J;  4PW8 A;  3RIU A;  4DR2 T;  1YQ4 A;  2WMO A;  4JI8 T;  3T8O A;  4K0K T;  2C5K T;  4HFB A;  2I59 A;  4U3C A;  5LMU T;  1X9B A;  2FUP A;  2YDR A;  4IE0 A;  5AQH B;  2N2N A;  3AEC A;  3ZMS B;  3RYI E;  5LHG B;  3N9P A;  4OHF A;  4DVD A;  2XAJ B;  1L0V A;  1HFA A;  2K48 A;  2H88 A;  2MTQ A;  1ZOY A;  2IC9 A;  4P0B A;  3RIA A;  4P0A A;  3N9O A;  5JTG A;  4G2A A;  2E2A A;  4C90 A;  2ODV A;  3OBV E;  2UU9 T;  1YKE B;  2LE8 A;  4HFV A;  3O9X A;  3LK3 B;  2Q9Q A;  1NWM X;  3FZF B;  5LG3 A;  1I6Z A;  2XQ5 A;  2XM1 A;  2WAU A;  3UUM A;  5JDG A;  3HKE E;  3A7M A;  3ZEF B;  1D0X A;  2XZE A;  3MJX A;  3RIF A;  3I0Q A;  2J47 A;  2B1E A;  3NWI A;  3ZN1 B;  4OYJ A;  3IA3 A;  5JDH A;  3AAI A;  5KDM C;  4EYY R;  5HEG A;  2X67 A;  4ASK A;  2YIN A;  4PAG A;  4LMK A;  3N2O A;  2W67 A;  4EXT A;  2IDO B;  5IHY A;  3AA0 B;  3EAB A;  4YXD A;  4IT4 A;  3CQC B;  3S4U A;  3SFE A;  1NAF A;  2C5J A;  4DV6 T;  2EHO C;  3VR9 A;  2ZM8 A;  2IML A;  3KV9 A;  3BQL A;  4O2A E;  5IWA T;  3MA9 A;  4A97 A;  3SS1 A;  2LEH A;  4GIW A;  3E0Z A;  4CN1 A;  4AIU A;  4H63 V;  4Q25 A;  3I9Y A;  5ABF B;  1E2A A;  3ZC0 A;  3KDS E;  5LB7 B;  5HEO A;  3OKQ A;  2L8K A;  2D0U A;  2J4G A;  3AE3 A;  1LKX A;  1U5P A;  2CEA A;  3OTO T;  2BKP A;  3F2E A;  3J7Y q;  4KX6 A;  5CGM A;  4L5G A;  2BG9 A;  3K8P C;  4DV4 T;  4GOU A;  3X1D A;  4HFD A;  3WAJ A;  2UXC T;  4U33 A;  1S35 A;  1HTJ F;  3EDV A;  4CQI A;  4O4J E;  3QOF A;  3ZCJ A;  2E5L T;  3WI3 A;  1IBL T;  3QC9 A;  4ISS A;  3UQ4 A;  4P1N A;  2XAQ B;  1SE7 A;  5A1L A;  2LM2 A;  4AKR B;  3MK7 C;  3FZK B;  4AQG A;  4LF4 T;  2MPK A;  2IUB A;  3FBL A;  4UF0 A;  3RLF F;  4L0R A;  5FKY A;  2NP9 A;  5C8Y E;  1Z8U A;  2CM0 A;  3RQW A;  3HKD E;  3UFG A;  3KIN B;  3AAA B;  4B6X A;  1IBM T;  1FIO A;  4TUY E;  4WW0 A;  2NOX A;  4HE8 A;  3AE1 A;  4ZZB A;  5HEJ A;  2ES0 A;  4HFC A;  2E9X D;  1W0A A;  4V1A v;  3ETV A;  2XY8 B;  5JR9 B;  4HGA A;  2W00 A;  2XQ4 A;  5IYZ E;  2N9D A;  4NPP A;  4YY3 T;  4IL9 A;  3B13 A;  4IE5 A;  5J0Z A;  3T1H T;  1QLB A;  3UU6 A;  3NBX X;  4QWN B;  2M67 A;  3J9X 1;  2W2U A;  4HWF A;  1WLX A;  1YW0 A;  4DV5 T;  2PTF A;  2KT9 A;  4WYV A;  3P4W A;  5AQM B;  4M1P A;  5F5W A;  5EK4 A;  2PBI A;  2V6Y A;  4DV1 T;  3O4X E;  3KVB A;  2H7V C;  3V5U A;  3FZM B;  5FXW A;  3K3N A;  5FXV A;  3ZT5 A;  3ZCI A;  5FY7 A;  4J2C A;  4JUY A;  2Y8D A;  2BBH A;  2BKO A;  4B3T T;  1M62 A;  5DQW A;  2WU2 A;  4TWD A;  3AEF A;  5HYA A;  2NW9 A;  2K3W A;  2X0H A;  5HAX A;  3RH3 A;  3H37 A;  2ZM6 T;  3RC3 A;  1SHZ C;  4X1K E;  4QXB B;  1H7C A;  4YSZ A;  4YHH T;  2ACZ A;  3DP7 A;  5H6Q B;  3RRW A;  2LSJ A;  1G8X A;  1D0Z A;  1WR6 A;  2OA5 A;  5HXC A;  5HWX A;  1N34 T;  3JAD A;  5LBQ B;  1W09 A;  3L09 A;  4WNK A;  4JV5 T;  2NTY A;  4QXH B;  3Q9D A;  1HNX T;  4ZXL A;  2CBI A;  3U78 A;  4ILB A;  5L4H A;  3AE2 A;  2K9A A;  3ABV A;  3ZMV B;  1AJ3 A;  2L9Q A;  2XUE A;  2HHH T;  4DBQ A;  2JMK A;  4UV9 B;  4TV8 E;  5JR9 C;  3KV4 A;  3CIR A;  4NXM T;  2K5B B;  4JBW F;  4PK6 A;  3QB5 A;  1EZ3 A;  1LVK A;  4YTM A;  5FP3 A;  3TLS A;  4U72 A;  4E7Z A;  5FL0 A;  2N1G A;  3SFD A;  2AE9 A;  2B76 A;  5AQG B;  3N2K E;  2UUA T;  4LML A;  1US7 B;  3PUA A;  1BR2 A;  2ODU A;  3GWH A;  4IDQ A;  3N9M A;  1LRZ A;  1UK5 A;  3P4P A;  4YJ2 E;  1ZV4 X;  4O4I E;  4EGW A;  2HN1 A;  2DI4 A;  4GYR A;  2V7J A;  4U2Z A;  5FXZ A;  3LBX B;  4YTP A;  4AKL A;  2LM9 A;  2WSS V;  2Q9Q D;  5LYJ E;  3LSV A;  4KMC A;  4ZI3 D;  5GON E;  4K0U A;  3I0O A;  1VRB A;  4FJO A;  3T1Y T;  3B57 A;  4XBF B;  1XNQ T;  1WYB A;  1QSD A;  2LKG A;  5HCJ A;  2BVM A;  2M6B A;  3V5S A;  4FI5 A;  5LHH B;  4EZH A;  2X51 A;  1MND A;  2DWK A;  4EOZ B;  4AKI A;  2WP9 A;  3IF8 B;  5CJ5 A;  5J2U E;  1D1C A;  1JNZ A;  2I0M A;  4AI6 A;  4EB6 E;  4UEL A;  1YXR A;  4JI4 T;  1HX8 A;  3FBZ A;  3ZYK A;  2SPC A;  3KFW X;  3AE7 A;  2KWH A;  2V1D B;  3UUL A;  1ZP0 A;  4LF9 T;  1XMQ T;  3EI0 A;  3EAM A;  2XQ6 A;  2VQF T;  5J2T E;  5JVD E;  3PV0 F;  4X1I E;  5AQR B;  1T98 A;  3FXD B;  3CWZ B;  3ZSS A;  4IHJ E;  3CQG B;  2J62 A;  3ZJ1 A;  3AE9 A;  2RA1 A;  2C0S A;  2BVL A;  5JQG E;  2HPJ A;  4ZS3 A;  1MIV A;  3EVY A;  1KEY A;  4TWH A;  4ILA A;  2MBG A;  4PJL A;  1ZHC A;  5L47 A;  2UXX B;  4X64 T;  2LOS A;  5FNV E;  2QYW A;  2CCQ A;  3VR8 A;  4MFR A;  3R84 B;  1MMN A;  1MMG A;  4PK4 A;  3ZPO A;  2WQY A;  3P4Q A;  2QRX A;  3C51 A;  5ADX L;  5KXJ A;  2YU1 A;  2W63 A;  4AQF C;  1IBK T;  4JYA T;  4PFP A;  3P4S A;  3NVO A;  2L3L A;  5AQF B;  5HEU A;  3DJB A;  3UQ7 A;  1B7T A;  2E9X C;  2XHE B;  5LMN T;  3UFE A;  2DLR A;  3Q2M A;  5ABF A;  3L3P A;  2V8S V;  1CHU A;  4JI1 T;  5E0O A;  2VL0 A;  3PJA A;  3CKD A;  2XAG B;  5AQJ B;  3H3A A;  3PUY F;  4LFA T;  4DV2 T;  3NZQ A;  5L4E A;  2OLT A;  1UX4 A;  1SA0 E;  1HX1 B;  2XQY A;  3BQI A;  4HN9 A;  1OED B;  2Y48 B;  3UU4 A;  4JEU B;  4PK5 A;  4YT0 A;  5L3F B;  2X68 A;  1UUR A;  3TKL B;  4I50 E;  3CML A;  4G63 A;  3CPZ A;  1FMW A;  2IHR 1;  5TAO A;  2JQ9 A;  3GMI A;  2CLY B;  3N5L A;  2BDE A;  2XQ9 A;  1MIY A;  2MYS A;  4JEH B;  4A5X A;  4IIJ E;  4MBQ A;  3RI5 A;  2YU2 A;  3AED A;  3PUW F;  4UV8 B;  2BS4 A;  4IGU A;  5LNK A;  2VK9 A;  4X20 E;  4ERR A;  3TLU A;  3I9W A;  2X66 A;  4O4H E;  3BQK A;  4ZI2 C;  3P4R A;  5KMG P;  1R8I A;  4HWH A;  1G73 A;  5ABH A;  4DV3 T;  2X9X A;  1N36 T;  5C3J A;  3MAC A;  3ONL C;  3FB2 A;  5FXX A;  2LHN A;  4DO0 A;  5HXS A;  2Y6X A;  1J5W A;  5JR9 A;  3RRC A;  2YKS A;  2YDS A;  1KNZ A;  2D5U A;  3MZK B;  5LGT B;  3D0T A;  5FVL A;  3MKD A;  2UUC T;  3QNU A;  3P8C D;  1UUS A;  3RIU C;  4QX8 B;  4CZZ B;  1J1J A;  3NRY A;  2D9D A;  4HFI A;  4AIS A;  3UUN A;  2BS3 A;  1KK7 A;  3EDU A;  2JIW A;  4ZS2 A;  2DCF A;  3CX6 B;  2XSA A;  3KBT A;  5EK2 A;  1HS7 A;  1OED C;  1OED E;  3OYX A;  1T72 A;  3GA8 A;  4I0U A;  4HEA A;  4H9P C;  2UXD T;  2V7L A;  3RYF E;  2VKH A;  4Z91 A;  2QA7 A;  4IST A;  4EYU A;  4IE7 A;  2JQQ A;  1I94 T;  1T8B A;  1WFD A;  1WRD A;  3TLW A;  3GN5 B;  1XWM A;  5DAB A;  2LSG A;  2CLY C;  4DID B;  2BG9 B;  1CUN A;  4GK0 E;  2Q9Q C;  4QKN A;  4UVA B;  2WDR A;  4ZI3 C;  2MOZ A;  2V7M A;  3RYH E;  3O1H A;  3IHR A;  5DJQ C;  4DR3 T;  5C2T A;  4DMW A;  3AB3 B;  4JLE A;  1D1A A;  1XDO A;  3C4W A;  4B3M T;  4TN7 B;  5LCY A;  3ZC1 A;  2W0G A;  3HKC E;  3K3Q C;  3AEB A;  3VU7 H;  2LSI A;  3RPU A;  3AE8 A;  4QH4 A;  4C91 A;  1W0B A;  3ZMT B;  1Z0P A;  4UF0 B;  2KZ7 B;  3ZJ2 A;  4H9O C;  4WBN E;  2CMR A;  5LJN A;  4YTN A;  3K1S A;  2E8I A;  3RF1 A;  1VOM A;  2XAF B;  3Q5D A;  2XM2 A;  5AQL B;  4HWD A;  3TLT A;  2FJD A;  1DU2 A;  5HXR A;  1MMD A;  2LT3 A;  4U7I A;  5HEH A;  3PUZ F;  2WWU A;  2WBL A;  2DL1 A;  1IAP A;  3AEE A;  4KP3 C;  3FXE B;  4TX5 A;  4IRE A;  5JDQ A;  2NW7 A;  1D0Y A;  4IDZ A;  5AFU L;  4EED A;  5L3G B;  2CHN A;  4CI1 B;  3B5M A;  3ZN0 B;  1NEK A;  2FJE A;  4OK0 A;  4P09 A;  3C64 A;  4WBO A;  4TNW A;  4LF8 T;  2LRL A;  3G06 A;  4IDO A;  3NRX A;  2YOE A;  4TNV A;  1HNW T;  4ZHQ E;  4AQF A;  4ADZ A;  3LBX A;  4X1Y E;  3CK6 A;  4X66 T;  4QH1 A;  5FYM A;  2PJQ A;  4DND A;  5AQS B;  3HI2 A;  5LXT E;  3EHZ A;  2DWG A;  1E1H B;  2PG8 A;  3OJA A;  4I55 E;  4I43 B;  4TZ4 C;  3RYC E;  3QB5 K;  3DTO A;  2BG9 C;  3LDQ B;  1KFY A;  1YQ3 A; 
#chains in the Genus database with same CATH homology
 4CN4 A;  4U31 A;  2V6Y B;  4ZEY A;  4A5X A;  2K3W A;  4U33 A;  3ZT6 A;  5LB7 B;  2MPK A;  3EAB A;  2WWV A;  4IT4 A;  1WR0 A;  4U2Y A;  2JQK A;  2CRB A;  2V6Y A;  4U7I A;  2JQH A;  1WCR A;  4U3C A;  4U2Z A;  2WY2 A;  3ZT5 A;  3ZT7 A;  1WFD A;  3K1S A;  2A9U A;  5CGM A;  5CJ5 A;  2JQ9 A;  4CN6 A;  2DL1 A;  4NIQ A;  4CN1 A;  4WZX A;  2W2U A;  2LRL A;  5FVK A;  5FVL A;  2RPA A;  4U7Y A;  4P1N A;  2CPT A;  1YXR A;  2LRK A;  2XZE A;  2V6X A;  3ZSS A;  3ZST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...