1WR0A

Structural characterization of the mit domain from human vps4b
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
GSDHMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the MIT domain from human Vps4b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords SKD1 protein
total genus 28
structure length 81
sequence length 81
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1wr0A01
2K3WA 4IT4A 4U3CA 5FVKA 3ZT6A 4NIQA 1WR0A 2CPTA 2DL1A 4P1NA 4U2YA 2XZEA 4CN1A 2V6XA 4CN4A 2JQKA 1WFDA 3ZSSA 4A5XA 3K1SA 3ZSTA 2MPKA 3ZT7A 2A9UA 5CJ5A 3ZT5A 5LB7B 2LRLA 2V6YB 4ZEYA 1YXRA 3EABA 2CRBA 4U31A 4U7YA 5FVLA 2WWVA 5CGMA 2V6YA 2JQHA 4WZXA 1WCRA 4U7IA 2LRKA 4U33A 4CN6A 2RPAA 4U2ZA 2W2UA 2JQ9A 2WY2A
chains in the Genus database with same CATH superfamily
2WDVA 4JBWF 4DUZT 5JH7E 5HWXA 2XQ4A 2W67A 3FBZA 2HN1A 3P4RA 4HFVA 4P1NA 5ETWA 4BJNA 3OYXA 2VQET 4CN4A 2JQQA 2XJ7A 2ZM2A 2JQKA 3QOFA 2WAUA 4UVCB 2VKJA 4BJMA 1I6ZA 4OK0A 4IE7A 2EHOC 3A7MA 3KBTA 3ZYLA 4WYVA 4XAXB 4ZI7E 1D1BA 4BA9A 2VQFT 2A9UA 1XNRT 2W0GA 2WZIA 2PG8A 4ILUA 5FY1A 5C8YE 4DR1T 2X0LB 3Q5WA 3AE7A 4UEMA 2K5BB 2WU5A 1N32T 3PU3A 3UU8A 5ABEA 2WS3A 4EYUA 5AFUL 2CEAA 2W4XA 4U7YA 2BKOA 1Z8UA 5DQVA 5C2TA 4CXYA 5HAXA 1YKHB 5LNKA 4H9RC 3RKGA 3C51A 3CVRA 3OPCA 1IJ6A 1FMWA 3QUJA 4H9QC 4H9SE 1ZOYA 1MMGA 2K9AA 4HFIA 4DBQA 2B76A 5FXVA 3HR0A 4QX8B 5F8PA 3N5LA 2LLYA 4Z90A 3H37A 4COFA 2C5KT 3AA0B 4HEAA 5JQGE 4LF7T 4LF9T 1VOMA 3EHZA 4ZXLA 5L3BB 4AKIA 5ABGA 1LVFA 5AQPB 2LKGA 4H9PC 5IUXA 3X1DA 2NTXA 5HXCA 2IAKA 3RHWA 2YOEA 4HTEA 3VKGA 1ZKEA 4WBOA 2XAQB 4B3MT 3KFWX 2CHOA 5JRCB 2BG9E 2PJQA 3AEBA 1KNRA 4H63V 2CMRA 5ABFB 3KVAA 2VKDA 2F4VT 4AQFC 5A1LA 2XQ7A 2CWOA 4IDPA 5JTGA 3CX7B 3EDVA 1SA0E 1AJ3A 3IHRA 4IDZA 1FIOA 4ZI3D 2VASA 2XSBA 4P0AA 3GN5A 3WAJA 5LHGB 3I1AA 4TNWA 5LHHB 1J5ET 5FY7A 3D0TA 2V7KA 3ANWB 2C5IT 4EGWA 1WR6A 1GQEA 3QNUA 3AAIA 4O4LE 5LA6E 4X62T 5AQQB 2JPFA 2Q9QB 4QH5A 4BAYB 4Z8XA 5FXXA 4UIGA 4DR4T 4IL9A 1G73A 2MPKA 4P0BA 4Q25A 3CX6B 3EUHA 5AQUB 3ZT7A 4B6XA 2M6BA 4LF4T 3RYFE 1BR0A 1J1JA 3PUZF 2JIWA 5LP6E 4JI3T 5AQNB 2N2NA 2XQYA 3AAEB 3P4SA 2ZM6T 4PAGA 2E9XD 4AKGA 4AKHA 4IE5A 3UFGA 4O8SA 5JRCA 3TLUA 2BVMA 5ADXL 2Y48B 1HG2A 3HI2A 2W00A 3ZEFB 2LOSA 2ACZA 2E9XC 2X67A 4ZS3A 4UVAB 5LGNB 2CM0A 3P8CD 5FXWA 3O1HA 3PUAA 4H63H 2LRKA 3W15B 3O9XA 2HH7A 4B3TT 2ZM0A 2XQ3A 2XAGB 1ZHCA 3RF1A 4L5GA 3UU3A 1OXZA 3FZMB 3L39A 5AQJB 4KUMB 3UU4A 1SE7A 5J2UE 4A97A 2X9HA 5FMNA 4DR3T 2X9WA 3VRBA 2QA7A 4ZZCA 1M62A 4KP3C 3Q2MA 4WNKA 3UUXB 2X66A 3A8YC 3P4QA 4K0UA 2XUEA 5LCYA 5KMGP 3GA8A 1IBLT 1N36T 4GOUA 4C90A 3AVSA 3E0ZA 5HEOA 4YTNA 4ZZBA 3L8RA 4LF8T 1FEWA 2R6GF 2X9YA 5L3CB 1NENA 2VURA 4L0RA 2KLQA 4HFCA 1YXRA 2YEVC 2FJAA 4QWNB 4GYSA 3AE9A 4X1YE 3NVOA 3Q5EA 4CXXA 2DNXA 4CN6A 4EEDA 3RIAA 1IJ5A 1T98A 2YDRA 3MKDA 3ZJ2A 4ANJA 1XMOT 4AI6A 2XM1A 3V5UA 2D5UA 4LMLA 5AQSB 5HEUA 4DBRA 3KVBA 2PBIA 4JUYA 4QXBB 3UT5E 4K0KT 4I4TE 3FZHB 4LMKA 4U2YA 4X5TA 3UU5A 3Q5XA 3Q5DA 4ASKA 3LBXB 2UXXB 5F5WA 4B3ST 5JR9C 2XQ5A 2E2AA 1WYBA 3AXJA 2XHEB 2H88A 4F8HA 3QB5K 4TWFA 4PFPA 2WMNA 2WBLA 3CX8B 3NZPA 4F6RC 5AQGB 4IE6A 2I59A 3OYZA 5CJ5A 4IE4A 3B5MA 3FB2A 4J2CA 5LGTB 2V7JA 1HFAA 1HS7A 1JNZA 3RPUA 2BBHA 2V5CA 3N2GE 1OEDA 2XAHB 3PUVF 1UURA 1XZYA 3CQCB 2WP9A 3G06A 4ADZA 1D1AA 2CCQA 3FBLA 2KWIB 2A2FX 1Y01A 2L9QA 3IBPA 4OFZA 4PK6A 5LHIB 1N34T 1ZV4X 1EZ3A 4TX5A 3UUBA 5FL0A 4KX6A 3UU6A 2LSJA 4QH4A 4JI0T 2LOPA 3RYIE 3N9LA 4U74A 1U5PA 1HG5A 1BR1A 2RA1A 2OV9A 2MAWA 3HKDE 2D0TA 3C98B 3JADA 3N2KE 5HCMA 3ZMVB 5CA1E 5TAOA 4MALA 4JI7T 2BG9A 3F2EA 3RI5A 2HN2A 2E9XA 4EZ4A 1D1CA 3PUXF 1E7PA 3PE0A 4LF6T 1E2AA 4AKLA 4NPPA 2N9DA 4JI4T 1WRDA 1U4QA 2DHRA 3EAMA 4NUVA 2KWHA 2X68A 4OYJA 5AQLB 5LBMA 3P4WA 3AE5A 3O1IA 3PUQA 3O4XE 3U3IA 4YY3T 2UXCT 1IAPA 2A3DA 4O4IE 2WM9A 4ISTA 3RQWA 5FVLA 5CGMA 4CI2B 3C4WA 4O2AE 2UXBT 4N78D 1WCRA 2CBJA 4DV0T 3MA9A 4EV6A 2DI4A 4EIWA 4LF5T 2W2UA 3AE4A 3TLTA 3N9OA 1BR4A 3NWIA 4GYRA 5DJQC 4CZZB 4ZHQE 2E9XB 5JDFA 5HEJA 1OWAA 3JC6D 5FVKA 1ZP0A 3RLFF 4G2AA 2QGSA 3PJAJ 3E22E 3HKBE 4QHOA 1B7TA 2V5DA 3C64A 1S35A 2DWKA 2KSRA 4CI1B 2IUBA 3JAFA 2ZM8A 3ZN1B 4X65T 5L3EB 3K3OA 5FP3A 4MFRA 5HWYA 4TV8E 2MYSA 3AE2A 4DUYT 3EI0A 2M6IA 3BQKA 5LB7B 4EEBA 3KV6A 2X0HA 3ZLIA 2Q9QC 2V6YB 1UCUA 2WWUA 3S4UA 1CHUA 3J9X1 2FBWA 3LDQB 2L3LA 3ZMUB 4LFBT 2DWGA 1D0YA 2JMKA 4JEUB 4MLKA 3I9YA 2UUBT 1JNRA 4PJMA 1BR2A 1WLXA 2XQAA 1HX1B 3HKCE 3I0QA 3QC9A 4CI3B 5HXSA 3CPZA 4O2BE 3KV4A 2FJDA 3JC6C 4U7IA 4UF0B 4CQIA 3WAKA 3C4ZA 4EXTA 4I55E 4X66T 2GK9A 1MMAA 2HHHT 5AQOB 2LSYA 2IMLA 2CPTA 3LBXA 2DL1A 5HXEA 4JYAT 4JV5T 2V6XA 3CQXC 4HKAA 4E7SA 4NUUA 4I0UA 3MZKB 3ONJA 5FXZA 3RQUA 4DVDA 1KK7A 2LHRA 3JAEA 5CB4E 1UK5A 2WB5A 3WI3A 5J1GA 5AQFB 4ZI2C 2LM2A 1UX4A 1QSDA 2W61A 3PTRB 4PK4A 5FY0A 2XM2A 1XDPA 2LJLA 2ODUA 2PFVA 3NKZA 2JMHA 3ZMTB 3FZLB 4O4JE 3RRWA 3TLWA 2YINA 4DIDB 4ZI2D 3ONXA 1UX5A 4DR7T 3AA1B 3K8PC 2NW9A 2W62A 2Q9QD 2VK9A 4IREA 4UV8B 2BS2A 2J47A 4HFHA 4ISSA 3KINB 5L47A 3Q9DA 4AXPA 1IBMT 3AEDA 1UUSA 2YDQA 3AE8A 3AE3A 2OLTA 3AEEA 3EVYA 3K3NA 4HFBA 1KFYA 2K3WA 2J4GA 3PJAA 4IHJE 2Y8DA 5IHYA 3RC8A 4NIQA 1WR0A 2WSSV 3HL6A 4HWFA 1LVKA 1W9RA 5DABA 4YHHT 4OYKA 1V9DA 2JRKA 2H89A 3ZSSA 3ZMSB 2C5JA 4A5XA 2NTYA 3RKOA 3OTOT 5J2TE 2RP4A 4KHPT 2W66A 2NWBA 3VRAA 2CHNA 1UGOA 2AE9A 2WDRA 3HA4A 3V5SA 5J0ZA 2V7LA 3F57A 5JR9B 4AIUA 3SWHA 2EHOD 4YSZA 1SHZC 4TWHA 1LKXA 5ABFA 3FZFB 3PV0F 4JI1T 3N9QA 1KEYA 4I43B 5JDLA 5LG3A 1X9BA 5AQTB 3F31A 4X64T 2E5LT 1NAFA 2LKHA 2LEHA 4CXWA 5KXJA 1YQ3A 1FJGT 5IYZE 2WMOA 2XQ6A 2JQHA 2WZHA 3K3QC 4U33A 5EZYE 2EHOA 3LSVA 4EB6E 5FYMA 2RPAA 4EAHA 1XWMA 2YDSA 4V1Av 3A5XA 1W0BA 3B57A 3VU7H 4AISA 4E7ZA 2MOZA 4G63A 1MNDA 4TWDA 3ZJ1A 5HYAA 1ZEEA 2DCFA 4MHCA 2BBJA 2PTFA 3ESLA 3ETUA 4C91A 4CN1A 2WU2A 4JI8T 2M67A 2NW8A 1G8XA 3PUYF 1WFDA 4PW8A 1M7KA 4YSXA 3K1SA 3RRCA 4YHJA 5E0OA 2BVLA 5AQHB 5LOVE 4OX9T 3AA6B 2IHR1 2NP9A 3P4PA 4FJOA 4U72A 4UVBB 4WBNE 2V7IA 5CFBA 2VVSA 2NOXA 4XBFB 4DMVA 5L2LA 3SOLA 3MXZA 3N9NA 2VL8A 2H7OA 3VR8A 3ONLC 2VL0A 4AQYT 2UXNB 3KV9A 3OJAA 3ZCJA 4DV2T 2CBIA 1VCTA 4UR9A 2QRXA 2LSGA 4KMCA 1HTJF 2XAJB 4M1PA 4KHZF 2BS3A 3N2OA 2FJEA 3KBUA 3CQGB 4HWIB 3T8OA 4HWCA 1IZNB 2Y6XA 5LJNA 3UQ4A 5JDNA 4DV7T 4LFCT 2CE7A 1W0AA 4L9IA 3NBXX 2BZBA 2LSKA 2W63A 5AQKB 5JDHA 1I94T 4DR6T 3ZN0B 4ILAA 3QK6A 4MBQA 3OKQA 4AQFA 1N33T 2D9DA 3CWZB 3AECA 3OVUA 2IC9A 2J1DG 5LG4A 4PFOA 4NXMT 2KINB 4KBMB 1XDOA 4GK0E 4JLEA 4QX7B 3M3ZB 2LRLA 3RH3A 4DR5T 4TUYE 2ZMAA 3MK7C 3L3PA 4PJNA 3TLVA 4A98A 4JI2T 3RYHE 3UQ7A 5AQVB 3AVRA 2WDQA 4A56A 4HWHA 5DQWA 4X1IE 4ERRA 3TLSA 4GKJT 1KF6A 2L8KA 2XY8B 1L0VA 4JI5T 3T1YT 2V6YA 4DO0A 2ACXA 3GMIA 1NWMX 4WZXA 1R8IA 3AA7B 2KMFA 4TZ4C 1NEKA 4Z91A 3RYCE 5JDGA 4IGUA 1KNZA 1MIWA 2BG9B 2JQ9A 2WY2A 2VKOA 5KX5E 2XASB 5HEGA 1FMVA 3PU8A 3DP7A 1S94A 5EK2A 2FJBA 5H6RB 4EZHA 3RGLA 2V7MA 1HF8A 2OA5A 4UV9B 4YJ3E 4IIJE 2H3RA 2NR4A 2ODVA 2LE8A 5LXTE 2KZ7B 5HEHA 3ZCIA 2XAFB 2XPKA 5FNVE 4AKRB 4AQGA 2CXDA 3BQIA 5M4YA 1MIVA 2NW7A 3I9WA 3IEEA 5FKYA 2E8IA 5F3JA 3LFMA 5JVDE 3AAAB 4HGAA 3P50A 2E5VA 3HKEE 3ZC0A 3CMLA 3N9MA 4U31A 2VB6A 5HXRA 5JR9A 3RX6A 2CXLA 3EDUA 3FXDB 4FI5A 4EOZB 3IF8B 3AEGA 3L09A 5FL1A 4DV5T 4U2ZA 3I0OA 3P7IA 3LK42 2V26A 2BDEA 2UU9T 2UUAT 5JDQA 1OEDC 5AQMB 3SFEA 5JREA 3ZYKA 5LYJE 1MMNA 5EK4A 4JI6T 2DLRA 2CXFA 3R6NA 2K24A 2P9BA 2B1EA 3ETVA 3NZQA 3OBVE 1KNPA 4HN9A 1HCIA 4ZOLE 4HWDA 2D2SA 4DV6T 2ZLYA 2HPLA 3RIUA 2Z6EA 1HNXT 2EHOB 3VHLA 3AB3B 4UXNB 3LK2B 3PDYA 1MMDA 3LK3B 5AQIB 1XMQT 1T8BA 5LBQB 4NXNT 2IDOB 1E1HB 1QLBA 4DV3T 2AXDS 1OEDB 4YJ2E 3AE6A 4IE0A 2LT3A 5KDMC 4P09A 3ZMZB 3DTOA 4PJLA 4DNDA 4YTPA 2YN6A 3C4XA 4JEHB 3AXJB 4PNIA 2G0UA 2XQ9A 4IT4A 4U3CA 3DJBA 3ZT6A 5C3JA 4WW0A 1IBKT 2LSIA 1H7CA 2CLYC 4H9OC 1VRBA 2J62A 3AE1A 2H7VC 2CWYA 4HFEA 3UUNA 4HFDA 1O3XA 2A72A 1YW0A 2IIUA 2YU1A 3E08A 4O4HE 4ZI3C 4IL4A 5CA0E 5IWAT 2MBGA 2I6HA 1US7B 3UUMA 2YKSA 3ZSTA 4DR2T 4QXHB 1QUUA 5BMVE 2VVNA 1HR0T 1MNEA 2V1DB 1YKEB 3FZKB 2C0SA 4YTMA 2V8SV 4TN7B 5BR8T 2ES0A 5L3FB 4LMJA 3T1HT 4ILBA 5LGUB 3BK9A 4X1KE 3EABA 2HPJA 3MACA 2WCAA 3AEFA 4H9NC 1J5WA 3CIRA 2LHNA 2VKHA 3PURA 3SFDA 3B13A 2KNDA 3CKDA 2BG9C 5H6QB 4YXDA 3VR9A 5ABHA 2IC6A 5HXHA 2YU2A 1D0XA 2XSAA 4IDOA 3UFEA 3VKHA 4YLHA 4YSYA 2Q9QA 2QVAA 4LFAT 1HNZT 4B3RT 1W09A 3C50A 3QB5A 4DMWA 2XZEA 2UUCT 3O1JA 2MTQA 3RC3A 5LJMA 5L3DB 3KDSE 3ZPOA 3R84B 4GKKT 4GK5E 3ABVA 3LG7A 3N9PA 3SRZA 2UXDT 1VCSA 3KV5A 1HNWT 5HCJA 4OHFA 4ILCA 4UF0A 5GONE 2I0MA 2XQ8A 4TV9E 4PJJA 5EK3A 5LMUT 4KI0F 3M65A 1X79A 2BKPA 2WQYA 2BS4A 2KT9A 4HE8A 3PUGA 2SPCA 1SUMB 2CA5A 3JCFA 2N1GA 4GIWA 3MJXA 1D0ZA 3RIUC 2KXPB 3ZYMA 1CUNA 4IDQA 5L4EA 3IA3A 2X0YA 3UTKA 3CK6A 5LMNT 3FXEB 2D0UA 1T7SA 5L4HA 1HX8A 4EYYR 4YT0A 2X9XA 4X20E 3ANWA 3H3MA 5AQRB 1YQ4A 2JJ9A 3J7Yq 4YFSA 4DV1T 1Z0PA 3LJCA 2VWAA 3GN5B 1XNQT 4ZS2A 2BKNA 3ZT5A 2XTLA 3H3AA 2FUPA 1MIYA 2LM9A 2X51A 3BQLA 3PUWF 3TKLB 2IW5B 3ZC1A 2CLYB 4ZEYA 2YK0A 1T72A 4XZCA 3PUSA 3GWHA 1Y64B 1WYCA 2CRBA 2K48A 4PK5A 4QKNA 2QYWA 2WWVA 1DU2A 3ZKRA 4QH1A 3NRXA 3SS1A 1LRZA 4I50E 3RIFA 3UULA 4IDNA 1OEDE 4TNVA 3NRYA 3AEAA 3U78A 5JDMA 4DV4T 4UELA 3FHNA 5L3GB 1YD8G 4QXCB
chains in the Genus database with same CATH topology
2K3WA 4IT4A 4U3CA 5FVKA 3ZT6A 4NIQA 1WR0A 2CPTA 2DL1A 4P1NA 4U2YA 2XZEA 4CN1A 2V6XA 4CN4A 2JQKA 1WFDA 3ZSSA 4A5XA 3K1SA 3ZSTA 2MPKA 3ZT7A 2A9UA 5CJ5A 3ZT5A 5LB7B 2LRLA 2V6YB 4ZEYA 1YXRA 3EABA 2CRBA 4U31A 4U7YA 5FVLA 2WWVA 5CGMA 2V6YA 2JQHA 4WZXA 1WCRA 4U7IA 2LRKA 4U33A 4CN6A 2RPAA 4U2ZA 2W2UA 2JQ9A 2WY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3W A;  4IT4 A;  4U3C A;  5FVK A;  3ZT6 A;  4NIQ A;  1WR0 A;  2CPT A;  2DL1 A;  4P1N A;  4U2Y A;  2XZE A;  4CN1 A;  2V6X A;  4CN4 A;  2JQK A;  1WFD A;  3ZSS A;  4A5X A;  3K1S A;  3ZST A;  2MPK A;  3ZT7 A;  2A9U A;  5CJ5 A;  3ZT5 A;  5LB7 B;  2LRL A;  2V6Y B;  4ZEY A;  1YXR A;  3EAB A;  2CRB A;  4U31 A;  4U7Y A;  5FVL A;  2WWV A;  5CGM A;  2V6Y A;  2JQH A;  4WZX A;  1WCR A;  4U7I A;  2LRK A;  4U33 A;  4CN6 A;  2RPA A;  4U2Z A;  2W2U A;  2JQ9 A;  2WY2 A; 
#chains in the Genus database with same CATH topology
 2WDV A;  4JBW F;  4DUZ T;  5JH7 E;  5HWX A;  2XQ4 A;  2W67 A;  3FBZ A;  2HN1 A;  3P4R A;  4HFV A;  4P1N A;  5ETW A;  4BJN A;  3OYX A;  2VQE T;  4CN4 A;  2JQQ A;  2XJ7 A;  2ZM2 A;  2JQK A;  3QOF A;  2WAU A;  4UVC B;  2VKJ A;  4BJM A;  1I6Z A;  4OK0 A;  4IE7 A;  2EHO C;  3A7M A;  3KBT A;  3ZYL A;  4WYV A;  4XAX B;  4ZI7 E;  1D1B A;  4BA9 A;  2VQF T;  2A9U A;  1XNR T;  2W0G A;  2WZI A;  2PG8 A;  4ILU A;  5FY1 A;  5C8Y E;  4DR1 T;  2X0L B;  3Q5W A;  3AE7 A;  4UEM A;  2K5B B;  2WU5 A;  1N32 T;  3PU3 A;  3UU8 A;  5ABE A;  2WS3 A;  4EYU A;  5AFU L;  2CEA A;  2W4X A;  4U7Y A;  2BKO A;  1Z8U A;  5DQV A;  5C2T A;  4CXY A;  5HAX A;  1YKH B;  5LNK A;  4H9R C;  3RKG A;  3C51 A;  3CVR A;  3OPC A;  1IJ6 A;  1FMW A;  3QUJ A;  4H9Q C;  4H9S E;  1ZOY A;  1MMG A;  2K9A A;  4HFI A;  4DBQ A;  2B76 A;  5FXV A;  3HR0 A;  4QX8 B;  5F8P A;  3N5L A;  2LLY A;  4Z90 A;  3H37 A;  4COF A;  2C5K T;  3AA0 B;  4HEA A;  5JQG E;  4LF7 T;  4LF9 T;  1VOM A;  3EHZ A;  4ZXL A;  5L3B B;  4AKI A;  5ABG A;  1LVF A;  5AQP B;  2LKG A;  4H9P C;  5IUX A;  3X1D A;  2NTX A;  5HXC A;  2IAK A;  3RHW A;  2YOE A;  4HTE A;  3VKG A;  1ZKE A;  4WBO A;  2XAQ B;  4B3M T;  3KFW X;  2CHO A;  5JRC B;  2BG9 E;  2PJQ A;  3AEB A;  1KNR A;  4H63 V;  2CMR A;  5ABF B;  3KVA A;  2VKD A;  2F4V T;  4AQF C;  5A1L A;  2XQ7 A;  2CWO A;  4IDP A;  5JTG A;  3CX7 B;  3EDV A;  1SA0 E;  1AJ3 A;  3IHR A;  4IDZ A;  1FIO A;  4ZI3 D;  2VAS A;  2XSB A;  4P0A A;  3GN5 A;  3WAJ A;  5LHG B;  3I1A A;  4TNW A;  5LHH B;  1J5E T;  5FY7 A;  3D0T A;  2V7K A;  3ANW B;  2C5I T;  4EGW A;  1WR6 A;  1GQE A;  3QNU A;  3AAI A;  4O4L E;  5LA6 E;  4X62 T;  5AQQ B;  2JPF A;  2Q9Q B;  4QH5 A;  4BAY B;  4Z8X A;  5FXX A;  4UIG A;  4DR4 T;  4IL9 A;  1G73 A;  2MPK A;  4P0B A;  4Q25 A;  3CX6 B;  3EUH A;  5AQU B;  3ZT7 A;  4B6X A;  2M6B A;  4LF4 T;  3RYF E;  1BR0 A;  1J1J A;  3PUZ F;  2JIW A;  5LP6 E;  4JI3 T;  5AQN B;  2N2N A;  2XQY A;  3AAE B;  3P4S A;  2ZM6 T;  4PAG A;  2E9X D;  4AKG A;  4AKH A;  4IE5 A;  3UFG A;  4O8S A;  5JRC A;  3TLU A;  2BVM A;  5ADX L;  2Y48 B;  1HG2 A;  3HI2 A;  2W00 A;  3ZEF B;  2LOS A;  2ACZ A;  2E9X C;  2X67 A;  4ZS3 A;  4UVA B;  5LGN B;  2CM0 A;  3P8C D;  5FXW A;  3O1H A;  3PUA A;  4H63 H;  2LRK A;  3W15 B;  3O9X A;  2HH7 A;  4B3T T;  2ZM0 A;  2XQ3 A;  2XAG B;  1ZHC A;  3RF1 A;  4L5G A;  3UU3 A;  1OXZ A;  3FZM B;  3L39 A;  5AQJ B;  4KUM B;  3UU4 A;  1SE7 A;  5J2U E;  4A97 A;  2X9H A;  5FMN A;  4DR3 T;  2X9W A;  3VRB A;  2QA7 A;  4ZZC A;  1M62 A;  4KP3 C;  3Q2M A;  4WNK A;  3UUX B;  2X66 A;  3A8Y C;  3P4Q A;  4K0U A;  2XUE A;  5LCY A;  5KMG P;  3GA8 A;  1IBL T;  1N36 T;  4GOU A;  4C90 A;  3AVS A;  3E0Z A;  5HEO A;  4YTN A;  4ZZB A;  3L8R A;  4LF8 T;  1FEW A;  2R6G F;  2X9Y A;  5L3C B;  1NEN A;  2VUR A;  4L0R A;  2KLQ A;  4HFC A;  1YXR A;  2YEV C;  2FJA A;  4QWN B;  4GYS A;  3AE9 A;  4X1Y E;  3NVO A;  3Q5E A;  4CXX A;  2DNX A;  4CN6 A;  4EED A;  3RIA A;  1IJ5 A;  1T98 A;  2YDR A;  3MKD A;  3ZJ2 A;  4ANJ A;  1XMO T;  4AI6 A;  2XM1 A;  3V5U A;  2D5U A;  4LML A;  5AQS B;  5HEU A;  4DBR A;  3KVB A;  2PBI A;  4JUY A;  4QXB B;  3UT5 E;  4K0K T;  4I4T E;  3FZH B;  4LMK A;  4U2Y A;  4X5T A;  3UU5 A;  3Q5X A;  3Q5D A;  4ASK A;  3LBX B;  2UXX B;  5F5W A;  4B3S T;  5JR9 C;  2XQ5 A;  2E2A A;  1WYB A;  3AXJ A;  2XHE B;  2H88 A;  4F8H A;  3QB5 K;  4TWF A;  4PFP A;  2WMN A;  2WBL A;  3CX8 B;  3NZP A;  4F6R C;  5AQG B;  4IE6 A;  2I59 A;  3OYZ A;  5CJ5 A;  4IE4 A;  3B5M A;  3FB2 A;  4J2C A;  5LGT B;  2V7J A;  1HFA A;  1HS7 A;  1JNZ A;  3RPU A;  2BBH A;  2V5C A;  3N2G E;  1OED A;  2XAH B;  3PUV F;  1UUR A;  1XZY A;  3CQC B;  2WP9 A;  3G06 A;  4ADZ A;  1D1A A;  2CCQ A;  3FBL A;  2KWI B;  2A2F X;  1Y01 A;  2L9Q A;  3IBP A;  4OFZ A;  4PK6 A;  5LHI B;  1N34 T;  1ZV4 X;  1EZ3 A;  4TX5 A;  3UUB A;  5FL0 A;  4KX6 A;  3UU6 A;  2LSJ A;  4QH4 A;  4JI0 T;  2LOP A;  3RYI E;  3N9L A;  4U74 A;  1U5P A;  1HG5 A;  1BR1 A;  2RA1 A;  2OV9 A;  2MAW A;  3HKD E;  2D0T A;  3C98 B;  3JAD A;  3N2K E;  5HCM A;  3ZMV B;  5CA1 E;  5TAO A;  4MAL A;  4JI7 T;  2BG9 A;  3F2E A;  3RI5 A;  2HN2 A;  2E9X A;  4EZ4 A;  1D1C A;  3PUX F;  1E7P A;  3PE0 A;  4LF6 T;  1E2A A;  4AKL A;  4NPP A;  2N9D A;  4JI4 T;  1WRD A;  1U4Q A;  2DHR A;  3EAM A;  4NUV A;  2KWH A;  2X68 A;  4OYJ A;  5AQL B;  5LBM A;  3P4W A;  3AE5 A;  3O1I A;  3PUQ A;  3O4X E;  3U3I A;  4YY3 T;  2UXC T;  1IAP A;  2A3D A;  4O4I E;  2WM9 A;  4IST A;  3RQW A;  5FVL A;  5CGM A;  4CI2 B;  3C4W A;  4O2A E;  2UXB T;  4N78 D;  1WCR A;  2CBJ A;  4DV0 T;  3MA9 A;  4EV6 A;  2DI4 A;  4EIW A;  4LF5 T;  2W2U A;  3AE4 A;  3TLT A;  3N9O A;  1BR4 A;  3NWI A;  4GYR A;  5DJQ C;  4CZZ B;  4ZHQ E;  2E9X B;  5JDF A;  5HEJ A;  1OWA A;  3JC6 D;  5FVK A;  1ZP0 A;  3RLF F;  4G2A A;  2QGS A;  3PJA J;  3E22 E;  3HKB E;  4QHO A;  1B7T A;  2V5D A;  3C64 A;  1S35 A;  2DWK A;  2KSR A;  4CI1 B;  2IUB A;  3JAF A;  2ZM8 A;  3ZN1 B;  4X65 T;  5L3E B;  3K3O A;  5FP3 A;  4MFR A;  5HWY A;  4TV8 E;  2MYS A;  3AE2 A;  4DUY T;  3EI0 A;  2M6I A;  3BQK A;  5LB7 B;  4EEB A;  3KV6 A;  2X0H A;  3ZLI A;  2Q9Q C;  2V6Y B;  1UCU A;  2WWU A;  3S4U A;  1CHU A;  3J9X 1;  2FBW A;  3LDQ B;  2L3L A;  3ZMU B;  4LFB T;  2DWG A;  1D0Y A;  2JMK A;  4JEU B;  4MLK A;  3I9Y A;  2UUB T;  1JNR A;  4PJM A;  1BR2 A;  1WLX A;  2XQA A;  1HX1 B;  3HKC E;  3I0Q A;  3QC9 A;  4CI3 B;  5HXS A;  3CPZ A;  4O2B E;  3KV4 A;  2FJD A;  3JC6 C;  4U7I A;  4UF0 B;  4CQI A;  3WAK A;  3C4Z A;  4EXT A;  4I55 E;  4X66 T;  2GK9 A;  1MMA A;  2HHH T;  5AQO B;  2LSY A;  2IML A;  2CPT A;  3LBX A;  2DL1 A;  5HXE A;  4JYA T;  4JV5 T;  2V6X A;  3CQX C;  4HKA A;  4E7S A;  4NUU A;  4I0U A;  3MZK B;  3ONJ A;  5FXZ A;  3RQU A;  4DVD A;  1KK7 A;  2LHR A;  3JAE A;  5CB4 E;  1UK5 A;  2WB5 A;  3WI3 A;  5J1G A;  5AQF B;  4ZI2 C;  2LM2 A;  1UX4 A;  1QSD A;  2W61 A;  3PTR B;  4PK4 A;  5FY0 A;  2XM2 A;  1XDP A;  2LJL A;  2ODU A;  2PFV A;  3NKZ A;  2JMH A;  3ZMT B;  3FZL B;  4O4J E;  3RRW A;  3TLW A;  2YIN A;  4DID B;  4ZI2 D;  3ONX A;  1UX5 A;  4DR7 T;  3AA1 B;  3K8P C;  2NW9 A;  2W62 A;  2Q9Q D;  2VK9 A;  4IRE A;  4UV8 B;  2BS2 A;  2J47 A;  4HFH A;  4ISS A;  3KIN B;  5L47 A;  3Q9D A;  4AXP A;  1IBM T;  3AED A;  1UUS A;  2YDQ A;  3AE8 A;  3AE3 A;  2OLT A;  3AEE A;  3EVY A;  3K3N A;  4HFB A;  1KFY A;  2K3W A;  2J4G A;  3PJA A;  4IHJ E;  2Y8D A;  5IHY A;  3RC8 A;  4NIQ A;  1WR0 A;  2WSS V;  3HL6 A;  4HWF A;  1LVK A;  1W9R A;  5DAB A;  4YHH T;  4OYK A;  1V9D A;  2JRK A;  2H89 A;  3ZSS A;  3ZMS B;  2C5J A;  4A5X A;  2NTY A;  3RKO A;  3OTO T;  5J2T E;  2RP4 A;  4KHP T;  2W66 A;  2NWB A;  3VRA A;  2CHN A;  1UGO A;  2AE9 A;  2WDR A;  3HA4 A;  3V5S A;  5J0Z A;  2V7L A;  3F57 A;  5JR9 B;  4AIU A;  3SWH A;  2EHO D;  4YSZ A;  1SHZ C;  4TWH A;  1LKX A;  5ABF A;  3FZF B;  3PV0 F;  4JI1 T;  3N9Q A;  1KEY A;  4I43 B;  5JDL A;  5LG3 A;  1X9B A;  5AQT B;  3F31 A;  4X64 T;  2E5L T;  1NAF A;  2LKH A;  2LEH A;  4CXW A;  5KXJ A;  1YQ3 A;  1FJG T;  5IYZ E;  2WMO A;  2XQ6 A;  2JQH A;  2WZH A;  3K3Q C;  4U33 A;  5EZY E;  2EHO A;  3LSV A;  4EB6 E;  5FYM A;  2RPA A;  4EAH A;  1XWM A;  2YDS A;  4V1A v;  3A5X A;  1W0B A;  3B57 A;  3VU7 H;  4AIS A;  4E7Z A;  2MOZ A;  4G63 A;  1MND A;  4TWD A;  3ZJ1 A;  5HYA A;  1ZEE A;  2DCF A;  4MHC A;  2BBJ A;  2PTF A;  3ESL A;  3ETU A;  4C91 A;  4CN1 A;  2WU2 A;  4JI8 T;  2M67 A;  2NW8 A;  1G8X A;  3PUY F;  1WFD A;  4PW8 A;  1M7K A;  4YSX A;  3K1S A;  3RRC A;  4YHJ A;  5E0O A;  2BVL A;  5AQH B;  5LOV E;  4OX9 T;  3AA6 B;  2IHR 1;  2NP9 A;  3P4P A;  4FJO A;  4U72 A;  4UVB B;  4WBN E;  2V7I A;  5CFB A;  2VVS A;  2NOX A;  4XBF B;  4DMV A;  5L2L A;  3SOL A;  3MXZ A;  3N9N A;  2VL8 A;  2H7O A;  3VR8 A;  3ONL C;  2VL0 A;  4AQY T;  2UXN B;  3KV9 A;  3OJA A;  3ZCJ A;  4DV2 T;  2CBI A;  1VCT A;  4UR9 A;  2QRX A;  2LSG A;  4KMC A;  1HTJ F;  2XAJ B;  4M1P A;  4KHZ F;  2BS3 A;  3N2O A;  2FJE A;  3KBU A;  3CQG B;  4HWI B;  3T8O A;  4HWC A;  1IZN B;  2Y6X A;  5LJN A;  3UQ4 A;  5JDN A;  4DV7 T;  4LFC T;  2CE7 A;  1W0A A;  4L9I A;  3NBX X;  2BZB A;  2LSK A;  2W63 A;  5AQK B;  5JDH A;  1I94 T;  4DR6 T;  3ZN0 B;  4ILA A;  3QK6 A;  4MBQ A;  3OKQ A;  4AQF A;  1N33 T;  2D9D A;  3CWZ B;  3AEC A;  3OVU A;  2IC9 A;  2J1D G;  5LG4 A;  4PFO A;  4NXM T;  2KIN B;  4KBM B;  1XDO A;  4GK0 E;  4JLE A;  4QX7 B;  3M3Z B;  2LRL A;  3RH3 A;  4DR5 T;  4TUY E;  2ZMA A;  3MK7 C;  3L3P A;  4PJN A;  3TLV A;  4A98 A;  4JI2 T;  3RYH E;  3UQ7 A;  5AQV B;  3AVR A;  2WDQ A;  4A56 A;  4HWH A;  5DQW A;  4X1I E;  4ERR A;  3TLS A;  4GKJ T;  1KF6 A;  2L8K A;  2XY8 B;  1L0V A;  4JI5 T;  3T1Y T;  2V6Y A;  4DO0 A;  2ACX A;  3GMI A;  1NWM X;  4WZX A;  1R8I A;  3AA7 B;  2KMF A;  4TZ4 C;  1NEK A;  4Z91 A;  3RYC E;  5JDG A;  4IGU A;  1KNZ A;  1MIW A;  2BG9 B;  2JQ9 A;  2WY2 A;  2VKO A;  5KX5 E;  2XAS B;  5HEG A;  1FMV A;  3PU8 A;  3DP7 A;  1S94 A;  5EK2 A;  2FJB A;  5H6R B;  4EZH A;  3RGL A;  2V7M A;  1HF8 A;  2OA5 A;  4UV9 B;  4YJ3 E;  4IIJ E;  2H3R A;  2NR4 A;  2ODV A;  2LE8 A;  5LXT E;  2KZ7 B;  5HEH A;  3ZCI A;  2XAF B;  2XPK A;  5FNV E;  4AKR B;  4AQG A;  2CXD A;  3BQI A;  5M4Y A;  1MIV A;  2NW7 A;  3I9W A;  3IEE A;  5FKY A;  2E8I A;  5F3J A;  3LFM A;  5JVD E;  3AAA B;  4HGA A;  3P50 A;  2E5V A;  3HKE E;  3ZC0 A;  3CML A;  3N9M A;  4U31 A;  2VB6 A;  5HXR A;  5JR9 A;  3RX6 A;  2CXL A;  3EDU A;  3FXD B;  4FI5 A;  4EOZ B;  3IF8 B;  3AEG A;  3L09 A;  5FL1 A;  4DV5 T;  4U2Z A;  3I0O A;  3P7I A;  3LK4 2;  2V26 A;  2BDE A;  2UU9 T;  2UUA T;  5JDQ A;  1OED C;  5AQM B;  3SFE A;  5JRE A;  3ZYK A;  5LYJ E;  1MMN A;  5EK4 A;  4JI6 T;  2DLR A;  2CXF A;  3R6N A;  2K24 A;  2P9B A;  2B1E A;  3ETV A;  3NZQ A;  3OBV E;  1KNP A;  4HN9 A;  1HCI A;  4ZOL E;  4HWD A;  2D2S A;  4DV6 T;  2ZLY A;  2HPL A;  3RIU A;  2Z6E A;  1HNX T;  2EHO B;  3VHL A;  3AB3 B;  4UXN B;  3LK2 B;  3PDY A;  1MMD A;  3LK3 B;  5AQI B;  1XMQ T;  1T8B A;  5LBQ B;  4NXN T;  2IDO B;  1E1H B;  1QLB A;  4DV3 T;  2AXD S;  1OED B;  4YJ2 E;  3AE6 A;  4IE0 A;  2LT3 A;  5KDM C;  4P09 A;  3ZMZ B;  3DTO A;  4PJL A;  4DND A;  4YTP A;  2YN6 A;  3C4X A;  4JEH B;  3AXJ B;  4PNI A;  2G0U A;  2XQ9 A;  4IT4 A;  4U3C A;  3DJB A;  3ZT6 A;  5C3J A;  4WW0 A;  1IBK T;  2LSI A;  1H7C A;  2CLY C;  4H9O C;  1VRB A;  2J62 A;  3AE1 A;  2H7V C;  2CWY A;  4HFE A;  3UUN A;  4HFD A;  1O3X A;  2A72 A;  1YW0 A;  2IIU A;  2YU1 A;  3E08 A;  4O4H E;  4ZI3 C;  4IL4 A;  5CA0 E;  5IWA T;  2MBG A;  2I6H A;  1US7 B;  3UUM A;  2YKS A;  3ZST A;  4DR2 T;  4QXH B;  1QUU A;  5BMV E;  2VVN A;  1HR0 T;  1MNE A;  2V1D B;  1YKE B;  3FZK B;  2C0S A;  4YTM A;  2V8S V;  4TN7 B;  5BR8 T;  2ES0 A;  5L3F B;  4LMJ A;  3T1H T;  4ILB A;  5LGU B;  3BK9 A;  4X1K E;  3EAB A;  2HPJ A;  3MAC A;  2WCA A;  3AEF A;  4H9N C;  1J5W A;  3CIR A;  2LHN A;  2VKH A;  3PUR A;  3SFD A;  3B13 A;  2KND A;  3CKD A;  2BG9 C;  5H6Q B;  4YXD A;  3VR9 A;  5ABH A;  2IC6 A;  5HXH A;  2YU2 A;  1D0X A;  2XSA A;  4IDO A;  3UFE A;  3VKH A;  4YLH A;  4YSY A;  2Q9Q A;  2QVA A;  4LFA T;  1HNZ T;  4B3R T;  1W09 A;  3C50 A;  3QB5 A;  4DMW A;  2XZE A;  2UUC T;  3O1J A;  2MTQ A;  3RC3 A;  5LJM A;  5L3D B;  3KDS E;  3ZPO A;  3R84 B;  4GKK T;  4GK5 E;  3ABV A;  3LG7 A;  3N9P A;  3SRZ A;  2UXD T;  1VCS A;  3KV5 A;  1HNW T;  5HCJ A;  4OHF A;  4ILC A;  4UF0 A;  5GON E;  2I0M A;  2XQ8 A;  4TV9 E;  4PJJ A;  5EK3 A;  5LMU T;  4KI0 F;  3M65 A;  1X79 A;  2BKP A;  2WQY A;  2BS4 A;  2KT9 A;  4HE8 A;  3PUG A;  2SPC A;  1SUM B;  2CA5 A;  3JCF A;  2N1G A;  4GIW A;  3MJX A;  1D0Z A;  3RIU C;  2KXP B;  3ZYM A;  1CUN A;  4IDQ A;  5L4E A;  3IA3 A;  2X0Y A;  3UTK A;  3CK6 A;  5LMN T;  3FXE B;  2D0U A;  1T7S A;  5L4H A;  1HX8 A;  4EYY R;  4YT0 A;  2X9X A;  4X20 E;  3ANW A;  3H3M A;  5AQR B;  1YQ4 A;  2JJ9 A;  3J7Y q;  4YFS A;  4DV1 T;  1Z0P A;  3LJC A;  2VWA A;  3GN5 B;  1XNQ T;  4ZS2 A;  2BKN A;  3ZT5 A;  2XTL A;  3H3A A;  2FUP A;  1MIY A;  2LM9 A;  2X51 A;  3BQL A;  3PUW F;  3TKL B;  2IW5 B;  3ZC1 A;  2CLY B;  4ZEY A;  2YK0 A;  1T72 A;  4XZC A;  3PUS A;  3GWH A;  1Y64 B;  1WYC A;  2CRB A;  2K48 A;  4PK5 A;  4QKN A;  2QYW A;  2WWV A;  1DU2 A;  3ZKR A;  4QH1 A;  3NRX A;  3SS1 A;  1LRZ A;  4I50 E;  3RIF A;  3UUL A;  4IDN A;  1OED E;  4TNV A;  3NRY A;  3AEA A;  3U78 A;  5JDM A;  4DV4 T;  4UEL A;  3FHN A;  5L3G B;  1YD8 G;  4QXC B; 
#chains in the Genus database with same CATH homology
 2K3W A;  4IT4 A;  4U3C A;  5FVK A;  3ZT6 A;  4NIQ A;  1WR0 A;  2CPT A;  2DL1 A;  4P1N A;  4U2Y A;  2XZE A;  4CN1 A;  2V6X A;  4CN4 A;  2JQK A;  1WFD A;  3ZSS A;  4A5X A;  3K1S A;  3ZST A;  2MPK A;  3ZT7 A;  2A9U A;  5CJ5 A;  3ZT5 A;  5LB7 B;  2LRL A;  2V6Y B;  4ZEY A;  1YXR A;  3EAB A;  2CRB A;  4U31 A;  4U7Y A;  5FVL A;  2WWV A;  5CGM A;  2V6Y A;  2JQH A;  4WZX A;  1WCR A;  4U7I A;  2LRK A;  4U33 A;  4CN6 A;  2RPA A;  4U2Z A;  2W2U A;  2JQ9 A;  2WY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...