1WR0A

Structural characterization of the mit domain from human vps4b
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
GSDHMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords SKD1 protein
publication title Structural characterization of the MIT domain from human Vps4b
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 81
sequence length 81
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1wr0A01
4ZEYA 4CN1A 2K3WA 2LRKA 4P1NA 4A5XA 2CRBA 5LB7B 4IT4A 4U33A 5CGMA 4U2ZA 3ZSSA 3ZT7A 4U31A 5FVKA 4CN6A 2V6XA 2LRLA 2V6YA 2JQHA 2V6YB 2JQ9A 1WCRA 4WZXA 3K1SA 2JQKA 5CJ5A 1WFDA 4U3CA 3ZT6A 3EABA 2W2UA 2A9UA 1YXRA 2WWVA 3ZSTA 2WY2A 4U2YA 1WR0A 4NIQA 5FVLA 2DL1A 2XZEA 4U7YA 2MPKA 4U7IA 3ZT5A 4CN4A 2CPTA 2RPAA
chains in the Genus database with same CATH superfamily
5HCJA 4TNWA 4YSYA 1U4QA 4ILAA 5HEHA 3NZPA 4A98A 5KDMC 2JQHA 5AQUB 2I59A 3ANWB 3EABA 3UU4A 3JAFA 2MBGA 2Q9QD 3E22E 3IEEA 3RIUA 1WYBA 4U7IA 1MNDA 1W09A 2LRKA 5DJQC 3L09A 2IDOB 4AI6A 2ACZA 2VQET 3UU8A 4HFIA 3PUWF 3E08A 2KWHA 5HWYA 2VURA 1B7TA 2YU1A 3GA8A 5JRCA 4EYYR 4JI1T 4TUYE 2H7VC 4O2AE 1HFAA 2AXDS 1FIOA 2I0MA 5JDFA 4YTMA 3J7Yq 2R6GF 3VKHA 4KHZF 4IDQA 3X1DA 2X67A 4UVAB 5FY1A 1T7SA 4UELA 1KNRA 4H63V 4IIJE 3JAEA 3ZSSA 5CB4E 1YQ4A 4BJNA 2MTQA 3V5SA 2NP9A 3PUQA 3U78A 2CA5A 2MAWA 4NIQA 3OYZA 5JREA 2V7JA 4IE5A 3F57A 3LG7A 4ZZBA 3ONLC 4QXHB 2YU2A 3IHRA 4JUYA 1FMWA 4AQFA 5LHHB 2XQ3A 3OBVE 2FBWA 3AAIA 3NRXA 1NEKA 4DIDB 2XUEA 2ES0A 3L39A 3RH3A 4PFPA 5TAOA 3RLFF 5FXWA 1BR1A 2PG8A 3ZN0B 1BR4A 4LFBT 2NW8A 2WWVA 4KP3C 3AE1A 2XHEB 2MPKA 3ZJ1A 2EHOC 1MNEA 1HR0T 2ZM8A 1D0XA 3WAKA 1YXRA 4CXXA 1LKXA 4AKHA 2DL1A 4OYJA 3IA3A 3ZT5A 3CX7B 4EGWA 4ZHQE 3N5LA 3O1HA 3ZMSB 3VR9A 3AE6A 2M6IA 2LM2A 2CMRA 1D1CA 5AQNB 2K24A 1IAPA 1D0ZA 3RQUA 1ZV4X 2KT9A 2M67A 4H63H 5KX5E 3N9LA 2WU2A 3PUSA 3BQLA 3P4SA 1BR2A 2CRBA 3HKDE 2LHRA 5H6QB 5L3BB 1OEDE 2UXNB 2HH7A 5LXTE 2ACXA 4WBNE 1UK5A 2PTFA 5FKYA 3DTOA 5FMNA 1IBLT 2Q9QC 4G63A 4EIWA 3U3IA 2J62A 1OEDA 4IDPA 3C50A 4UIGA 3CX6B 2CHNA 2XQ9A 3H37A 2Y8DA 4CN1A 4ZZCA 3VRAA 5CGMA 4PJLA 3UULA 3KINB 4TV8E 4YHHT 3QK6A 2PJQA 3AAEB 4YXDA 2BG9C 5JTGA 4DV1T 2UXDT 2EHOB 4DR1T 4KX6A 2XQ8A 4P1NA 5LBMA 2JMHA 4YHJA 3ABVA 2H7OA 2J47A 4JEUB 4ZI2C 4HGAA 2Z6EA 3LJCA 4B3RT 4J2CA 3HR0A 3QNUA 1ZHCA 3PUVF 4JI6T 3ZMUB 5LMUT 3UUBA 5L47A 2NW7A 3S4UA 4OK0A 1Z8UA 3AXJA 4FI5A 5FXVA 4H9SE 2V6YB 3L8RA 2XAHB 4IE4A 3AE2A 3CPZA 4UV8B 4NXMT 4HWDA 3PUYF 2FJBA 2H88A 3N2KE 2KINB 2MOZA 4Z91A 3SFDA 3ZT7A 1S94A 2Q9QB 4GKJT 1KF6A 4UF0A 2K9AA 2LT3A 3PUZF 4MFRA 5FP3A 3LK42 4JI8T 3ZYKA 4PK4A 3AB3B 2WQYA 2VB6A 4I0UA 2YOEA 2LJLA 5LHGB 3UFGA 4G2AA 3F2EA 2E9XA 2C0SA 3AE9A 5AQRB 3EDUA 4YLHA 5H6RB 3PTRB 3QOFA 2XQ7A 4ASKA 4U7YA 2VKHA 3K3NA 3O9XA 2CWOA 5AQPB 3AECA 5ABFB 2X9WA 4HFVA 5JDQA 4CQIA 2W4XA 1HS7A 5LJNA 3PU8A 2A72A 3PJAJ 3VHLA 2JRKA 2FUPA 5AQMB 4B3MT 4XZCA 3OJAA 4JI4T 3LBXA 1VCTA 2J1DG 3AA1B 4TX5A 3EI0A 4QXCB 5C8YE 2ZM0A 2BZBA 4IHJE 3A5XA 4CZZB 4DV3T 3AEDA 2XASB 5CA0E 2A2FX 2WWUA 1LRZA 2QGSA 3EAMA 2CEAA 4LF9T 4DO0A 1MMGA 3RYHE 2UUAT 2XAQB 2N1GA 3FZKB 2V26A 3KV9A 5CA1E 4QH5A 3ANWA 1VCSA 3FHNA 3UU6A 1SA0E 3ONJA 3AA6B 3QUJA 1YD8G 2VKJA 2W61A 4O4HE 4ERRA 4O4LE 1WYCA 5FNVE 4MHCA 4I4TE 5FL0A 3FZHB 4KMCA 4K0UA 4JI3T 2W66A 5AFUL 4XBFB 2HHHT 3NWIA 3K3OA 3N9PA 1ZEEA 3R84B 5AQGB 2WZIA 2IMLA 1QSDA 5IUXA 1HNWT 2D9DA 1XMOT 4ILUA 4DBRA 3HI2A 5AQTB 4LF4T 3ZCIA 4O2BE 3H3MA 4I43B 1MIVA 4F8HA 4B6XA 1MIYA 2FJDA 3RIFA 2M6BA 3UFEA 4QKNA 4H9OC 4ZI3C 2OV9A 4PJJA 3KV5A 5A1LA 4L9IA 1IBKT 2X0HA 2LHNA 2NWBA 3UTKA 5FL1A 3OYXA 3AVSA 4DNDA 2C5IT 2HN1A 5LYJE 3VU7H 1HF8A 2JQ9A 4CXWA 2MYSA 4LF7T 4DBQA 2XSAA 2VL0A 1J5WA 3WI3A 1FEWA 3ZMVB 5EK4A 5AQOB 4CI2B 1FJGT 3OPCA 3Q9DA 2GK9A 2W0GA 2WZHA 2X9XA 1HNXT 4TWDA 2F4VT 2IC6A 4U2ZA 4DMWA 1Z0PA 2XJ7A 3MXZA 1T72A 2X68A 3AEAA 5LP6E 3NZQA 1WLXA 3NVOA 4L0RA 3P4RA 5HEOA 1E7PA 1WR6A 1XNRT 3ZJ2A 5M4YA 4AKGA 1I6ZA 1IJ6A 4GOUA 1X79A 4LF8T 4NUVA 4HEAA 4I55E 3DP7A 3NBXX 3C51A 4EEDA 3TLSA 3GN5B 4CXYA 4DUYT 3EUHA 4YSZA 4L5GA 3Q2MA 4WW0A 5J2UE 3JCFA 5HEUA 3QB5K 4IDZA 3TKLB 2E2AA 3I0QA 1J1JA 3CQXC 4ANJA 1KNZA 4Z8XA 2BKOA 4CI1B 5LHIB 2YDSA 3ESLA 2LLYA 2FJAA 4AKLA 5AQVB 4JEHB 1HX8A 4IE0A 5JDLA 3ZKRA 3HL6A 1IJ5A 4DV2T 4Q25A 2XQ5A 3FXEB 4EZHA 2X9YA 2VASA 4TNVA 4ZXLA 2RA1A 4YTPA 4DMVA 2V6XA 3C4XA 4IDNA 4NXNT 4JI5T 3RYFE 4ZS3A 1T8BA 4PJNA 3V5UA 2EHOA 5C3JA 2X0YA 1G73A 3JADA 4C90A 5HXSA 3L3PA 4N78D 2BBJA 4JV5T 1L0VA 2WB5A 3P50A 5AQKB 4EEBA 3ZMZB 3D0TA 3KDSE 3EHZA 2DHRA 3B5MA 3O4XE 3PUAA 2V6YA 1UCUA 3FZLB 3K1SA 3RX6A 4UXNB 3C4ZA 4NUUA 5ABHA 3ZSTA 1QUUA 1S35A 2IAKA 3OVUA 4OFZA 2Q9QA 5LGTB 3UT5E 4PAGA 3AE5A 2NTXA 5HWXA 5LG4A 2BG9E 4U72A 2YN6A 3AE7A 3BQIA 2UUCT 2V5DA 4MLKA 1LVKA 3ZC1A 2BG9A 4HFBA 5HXCA 2UXXB 4IL4A 4WZXA 3Q5XA 3MACA 4QXBB 4U2YA 3IBPA 1T98A 2XZEA 1HG2A 4GYSA 5F8PA 2XAFB 5ABFA 4X1IE 4U31A 2VK9A 4TZ4C 2XY8B 4WYVA 4EOZB 5F3JA 3FXDB 2ZM6T 3RYIE 1DU2A 5EK3A 2BDEA 2P9BA 1D1AA 1KEYA 3TLUA 4AXPA 2YDRA 5AQFB 1ZP0A 2DI4A 1H7CA 3QC9A 4DV5T 4QX8B 5L3GB 3G06A 3RC3A 2UXBT 4I50E 4DR5T 4LF5T 5LOVE 2KNDA 1UGOA 3GWHA 2BVMA 3PURA 3Q5WA 5EK2A 3I9WA 2CBJA 2K3WA 2VKDA 3RRWA 5L3FB 4HWIB 3ETUA 4YJ2E 4PK6A 2CWYA 5JDHA 1M7KA 1HG5A 3HKEE 4DV0T 2VL8A 3AE8A 2L3LA 2WSSV 3ZYMA 2YK0A 2H89A 3TLTA 4A97A 4AQYT 3KV4A 1SUMB 3CQGB 2X0LB 3KBTA 1W9RA 4GYRA 4YT0A 3P7IA 2UUBT 1J5ET 1EZ3A 2XQYA 4AKIA 3A8YC 3UQ4A 4YY3T 5AQSB 1JNRA 2C5JA 3UU3A 2FJEA 3FBLA 5ABEA 3RPUA 3N2GE 3P4PA 3EDVA 3CVRA 4HWCA 2XSBA 4Z90A 2VWAA 3CQCB 4O4JE 1E1HB 1ZKEA 3LSVA 5DQWA 5L2LA 3MKDA 3Q5EA 2WP9A 5L4EA 3PUGA 4P0BA 3F31A 4LFAT 4KI0F 4UR9A 2CXDA 4CI3B 2UU9T 5HAXA 4DR7T 2XM2A 2N9DA 4PK5A 3K3QC 5AQQB 1V9DA 3ZN1B 2I6HA 1XZYA 1YKHB 2WDRA 2QYWA 4F6RC 3I1AA 1HNZT 5IHYA 3KBUA 2XPKA 4ADZA 3AE4A 4IGUA 4LMJA 5E0OA 2SPCA 4YTNA 1NENA 5J2TE 3PU3A 3LDQB 2K48A 3HKBE 3H3AA 1Y01A 3TLVA 5JVDE 1UUSA 3GN5A 3I9YA 3RRCA 3ZCJA 3N2OA 2BS3A 2IIUA 2WBLA 1UX5A 5LGNB 3RYCE 1O3XA 3T1YT 4TN7B 2IW5B 1IBMT 2VKOA 2UXCT 4UEMA 3PE0A 3ZPOA 4BAYB 4LMKA 5BR8T 4KUMB 2XQ6A 4DR6T 2RP4A 5HCMA 4A5XA 1N36T 3PV0F 4H9RC 2A3DA 5CJ5A 2LE8A 1XDOA 3GMIA 5FY0A 2OLTA 5IYZE 3PDYA 2KZ7B 3ZMTB 2A9UA 4M1PA 2LOSA 5FXXA 5LNKA 3IF8B 4MBQA 2E5VA 3MK7C 4XAXB 4AIUA 2K5BB 3SFEA 4X1YE 5C2TA 1HTJF 2LRLA 2QVAA 4QH1A 2JMKA 4EXTA 4EV6A 2BS4A 3KV6A 2LSJA 3AAAB 4PFOA 5FY7A 3RIAA 2D0TA 2CLYC 5LBQB 1Y64B 3LK2B 5GONE 1XMQT 3N9NA 5J1GA 4DVDA 2WM9A 1E2AA 4PNIA 2NTYA 5JR9C 2JQQA 5JH7E 4TV9E 4JI7T 4DV7T 1MMNA 3AEEA 1W0AA 4KHPT 4GKKT 2YDQA 5AQJB 3B13A 2DWGA 2JJ9A 4ZOLE 5AQHB 3AEFA 2WMOA 1SHZC 1UX4A 2YKSA 4DR4T 3HA4A 2YINA 3EVYA 3OTOT 5LB7B 3SS1A 4GIWA 1D0YA 1R8IA 2H3RA 1D1BA 2VQFT 3VKGA 2WAUA 3AVRA 5FVLA 3CX8B 3ZC0A 4KBMB 5JDGA 1YW0A 2QA7A 3HKCE 1OWAA 5IWAT 3JC6D 3RIUC 4ZI2D 4UVBB 5JQGE 4PW8A 4DV6T 4DUZT 2CLYB 1JNZA 3RF1A 3UU5A 3RGLA 3P4WA 3ZEFB 2X66A 3RC8A 2XTLA 2DCFA 1XNQT 3AEBA 2DNXA 4TWFA 2Y48B 5JR9B 4MALA 2HPJA 1ZOYA 3M65A 4C91A 3FBZA 2WDQA 1WRDA 2CCQA 2W63A 1NWMX 5HXHA 1KNPA 2KLQA 2ZM2A 2LKGA 2CM0A 3O1JA 3J9X1 1XWMA 2BKNA 3QB5A 4WBOA 5HEJA 2BBHA 4PJMA 4QWNB 2E8IA 2IHR1 2WMNA 2D5UA 3P4QA 2CPTA 1OXZA 1W0BA 2WCAA 4TWHA 2J4GA 3VRBA 4EAHA 3UUNA 5L4HA 2BKPA 2V7LA 4X20E 3ZYLA 3CK6A 3W15B 4YFSA 3MA9A 3BQKA 5L3DB 1M62A 4AQFC 5CFBA 2V1DB 3MJXA 4EZ4A 5FXZA 2W62A 2E9XD 5JRCB 3N9MA 4IT4A 3RHWA 4A56A 3N9OA 5ADXL 4ZS2A 2NR4A 2B76A 3DJBA 2XAGB 3PUXF 3FB2A 3I0OA 4AKRB 3UUXB 2IUBA 3SRZA 2AE9A 2KXPB 3C4WA 3CKDA 3FZFB 3KVBA 3ZLIA 4YSXA 4O4IE 3T8OA 3P8CD 1YKEB 2Y6XA 2WDVA 1N33T 5J0ZA 1N32T 2LSIA 4LF6T 4OX9T 3VR8A 5LGUB 1MMAA 3BK9A 3FZMB 3E0ZA 4HFEA 1I94T 2NW9A 4HFCA 1KK7A 2PBIA 5DABA 2DLRA 3KVAA 2XAJB 4BA9A 4U74A 1XDPA 2IC9A 2L9QA 3AA0B 5KMGP 1SE7A 2B1EA 2LSGA 2KSRA 3JC6C 2KMFA 2W00A 1OEDC 2XM1A 4V1Av 5HXRA 4JI2T 1WFDA 3MZKB 2CBIA 4HKAA 1VRBA 3TLWA 2LSYA 4GK0E 1MMDA 4ILBA 2V8SV 2X9HA 2V7MA 4IREA 4EYUA 4ZI3D 4O8SA 4HE8A 4ISSA 3RKOA 5ABGA 2C5KT 1GQEA 1IZNB 2XQAA 4HTEA 4QX7B 4COFA 5LJMA 3C64A 2XQ4A 4LMLA 4WNKA 4X62T 5HEGA 2KWIB 1HX1B 2D2SA 5HYAA 5FVKA 4HWHA 2X51A 1HCIA 4E7ZA 2CHOA 5EZYE 3Q5DA 3AEGA 4GK5E 4OHFA 3LK3B 3CIRA 4H9PC 3RQWA 2W67A 2BG9B 3KFWX 2WS3A 2BS2A 5AQIB 4DV4T 2HN2A 4AISA 5HXEA 5LCYA 2ODVA 1NAFA 4JYAT 2OA5A 4YJ3E 2E5LT 5LG3A 2VVNA 1YQ3A 1FMVA 2CE7A 1OEDB 2V7IA 4BJMA 4B3ST 2QRXA 2YEVC 4ZEYA 2LM9A 3LFMA 4H9QC 4HN9A 4HWFA 5AQLB 3UUMA 1N34T 3WAJA 4B3TT 4U3CA 3AE3A 2CXFA 4OYKA 5LMNT 2E9XC 2ZMAA 2RPAA 1QLBA 2CXLA 1US7B 1BR0A 3B57A 5JDNA 2LOPA 5L3CB 4X5TA 3A7MA 4JBWF 3ZT6A 2LEHA 4ZI7E 3N9QA 1X9BA 3ETVA 5KXJA 2N2NA 3UQ7A 3CWZB 1CUNA 3AXJB 2HPLA 3ONXA 1AJ3A 4IE6A 4HFDA 5FYMA 1G8XA 5L3EB 2WY2A 1LVFA 3NKZA 2LKHA 4FJOA 4DR3T 4LFCT 5F5WA 5DQVA 5LA6E 4JLEA 4UF0B 4ILCA 4H9NC 4ISTA 5BMVE 4X64T 3M3ZB 3RKGA 2G0UA 3K8PC 2L8KA 2DWKA 4X65T 4AQGA 2D0UA 2V5CA 4P0AA 3O1IA 3SWHA 3PJAA 2BVLA 2JQKA 1KFYA 2E9XB 1UURA 4EB6E 1MIWA 3R6NA 1U5PA 4HFHA 3T1HT 4JI0T 4U33A 4CN6A 4UVCB 5ETWA 1VOMA 2LSKA 2EHOD 5JR9A 3NRYA 4IDOA 3AA7B 4IL9A 3RI5A 3C98B 3SOLA 2JIWA 1WR0A 2NOXA 4QH4A 2VVSA 4QHOA 2PFVA 3CMLA 4E7SA 4CN4A 1CHUA 3LBXB 4UV9B 4P09A 2WU5A 2ODUA 4DR2T 4NPPA 3OKQA 1WCRA 4K0KT 2W2UA 2V7KA 4X1KE 4IE7A 5JDMA 2JPFA 4X66T 2ZLYA
chains in the Genus database with same CATH topology
4ZEYA 4CN1A 2K3WA 2LRKA 4P1NA 4A5XA 2CRBA 5LB7B 4IT4A 4U33A 5CGMA 4U2ZA 3ZSSA 3ZT7A 4U31A 5FVKA 4CN6A 2V6XA 2LRLA 2V6YA 2JQHA 2V6YB 2JQ9A 1WCRA 4WZXA 3K1SA 2JQKA 5CJ5A 1WFDA 4U3CA 3ZT6A 3EABA 2W2UA 2A9UA 1YXRA 2WWVA 3ZSTA 2WY2A 4U2YA 1WR0A 4NIQA 5FVLA 2DL1A 2XZEA 4U7YA 2MPKA 4U7IA 3ZT5A 4CN4A 2CPTA 2RPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZEY A;  4CN1 A;  2K3W A;  2LRK A;  4P1N A;  4A5X A;  2CRB A;  5LB7 B;  4IT4 A;  4U33 A;  5CGM A;  4U2Z A;  3ZSS A;  3ZT7 A;  4U31 A;  5FVK A;  4CN6 A;  2V6X A;  2LRL A;  2V6Y A;  2JQH A;  2V6Y B;  2JQ9 A;  1WCR A;  4WZX A;  3K1S A;  2JQK A;  5CJ5 A;  1WFD A;  4U3C A;  3ZT6 A;  3EAB A;  2W2U A;  2A9U A;  1YXR A;  2WWV A;  3ZST A;  2WY2 A;  4U2Y A;  1WR0 A;  4NIQ A;  5FVL A;  2DL1 A;  2XZE A;  4U7Y A;  2MPK A;  4U7I A;  3ZT5 A;  4CN4 A;  2CPT A;  2RPA A; 
#chains in the Genus database with same CATH topology
 5HCJ A;  4TNW A;  4YSY A;  1U4Q A;  4ILA A;  5HEH A;  3NZP A;  4A98 A;  5KDM C;  2JQH A;  5AQU B;  2I59 A;  3ANW B;  3EAB A;  3UU4 A;  3JAF A;  2MBG A;  2Q9Q D;  3E22 E;  3IEE A;  3RIU A;  1WYB A;  4U7I A;  1MND A;  1W09 A;  2LRK A;  5DJQ C;  3L09 A;  2IDO B;  4AI6 A;  2ACZ A;  2VQE T;  3UU8 A;  4HFI A;  3PUW F;  3E08 A;  2KWH A;  5HWY A;  2VUR A;  1B7T A;  2YU1 A;  3GA8 A;  5JRC A;  4EYY R;  4JI1 T;  4TUY E;  2H7V C;  4O2A E;  1HFA A;  2AXD S;  1FIO A;  2I0M A;  5JDF A;  4YTM A;  3J7Y q;  2R6G F;  3VKH A;  4KHZ F;  4IDQ A;  3X1D A;  2X67 A;  4UVA B;  5FY1 A;  1T7S A;  4UEL A;  1KNR A;  4H63 V;  4IIJ E;  3JAE A;  3ZSS A;  5CB4 E;  1YQ4 A;  4BJN A;  2MTQ A;  3V5S A;  2NP9 A;  3PUQ A;  3U78 A;  2CA5 A;  2MAW A;  4NIQ A;  3OYZ A;  5JRE A;  2V7J A;  4IE5 A;  3F57 A;  3LG7 A;  4ZZB A;  3ONL C;  4QXH B;  2YU2 A;  3IHR A;  4JUY A;  1FMW A;  4AQF A;  5LHH B;  2XQ3 A;  3OBV E;  2FBW A;  3AAI A;  3NRX A;  1NEK A;  4DID B;  2XUE A;  2ES0 A;  3L39 A;  3RH3 A;  4PFP A;  5TAO A;  3RLF F;  5FXW A;  1BR1 A;  2PG8 A;  3ZN0 B;  1BR4 A;  4LFB T;  2NW8 A;  2WWV A;  4KP3 C;  3AE1 A;  2XHE B;  2MPK A;  3ZJ1 A;  2EHO C;  1MNE A;  1HR0 T;  2ZM8 A;  1D0X A;  3WAK A;  1YXR A;  4CXX A;  1LKX A;  4AKH A;  2DL1 A;  4OYJ A;  3IA3 A;  3ZT5 A;  3CX7 B;  4EGW A;  4ZHQ E;  3N5L A;  3O1H A;  3ZMS B;  3VR9 A;  3AE6 A;  2M6I A;  2LM2 A;  2CMR A;  1D1C A;  5AQN B;  2K24 A;  1IAP A;  1D0Z A;  3RQU A;  1ZV4 X;  2KT9 A;  2M67 A;  4H63 H;  5KX5 E;  3N9L A;  2WU2 A;  3PUS A;  3BQL A;  3P4S A;  1BR2 A;  2CRB A;  3HKD E;  2LHR A;  5H6Q B;  5L3B B;  1OED E;  2UXN B;  2HH7 A;  5LXT E;  2ACX A;  4WBN E;  1UK5 A;  2PTF A;  5FKY A;  3DTO A;  5FMN A;  1IBL T;  2Q9Q C;  4G63 A;  4EIW A;  3U3I A;  2J62 A;  1OED A;  4IDP A;  3C50 A;  4UIG A;  3CX6 B;  2CHN A;  2XQ9 A;  3H37 A;  2Y8D A;  4CN1 A;  4ZZC A;  3VRA A;  5CGM A;  4PJL A;  3UUL A;  3KIN B;  4TV8 E;  4YHH T;  3QK6 A;  2PJQ A;  3AAE B;  4YXD A;  2BG9 C;  5JTG A;  4DV1 T;  2UXD T;  2EHO B;  4DR1 T;  4KX6 A;  2XQ8 A;  4P1N A;  5LBM A;  2JMH A;  4YHJ A;  3ABV A;  2H7O A;  2J47 A;  4JEU B;  4ZI2 C;  4HGA A;  2Z6E A;  3LJC A;  4B3R T;  4J2C A;  3HR0 A;  3QNU A;  1ZHC A;  3PUV F;  4JI6 T;  3ZMU B;  5LMU T;  3UUB A;  5L47 A;  2NW7 A;  3S4U A;  4OK0 A;  1Z8U A;  3AXJ A;  4FI5 A;  5FXV A;  4H9S E;  2V6Y B;  3L8R A;  2XAH B;  4IE4 A;  3AE2 A;  3CPZ A;  4UV8 B;  4NXM T;  4HWD A;  3PUY F;  2FJB A;  2H88 A;  3N2K E;  2KIN B;  2MOZ A;  4Z91 A;  3SFD A;  3ZT7 A;  1S94 A;  2Q9Q B;  4GKJ T;  1KF6 A;  4UF0 A;  2K9A A;  2LT3 A;  3PUZ F;  4MFR A;  5FP3 A;  3LK4 2;  4JI8 T;  3ZYK A;  4PK4 A;  3AB3 B;  2WQY A;  2VB6 A;  4I0U A;  2YOE A;  2LJL A;  5LHG B;  3UFG A;  4G2A A;  3F2E A;  2E9X A;  2C0S A;  3AE9 A;  5AQR B;  3EDU A;  4YLH A;  5H6R B;  3PTR B;  3QOF A;  2XQ7 A;  4ASK A;  4U7Y A;  2VKH A;  3K3N A;  3O9X A;  2CWO A;  5AQP B;  3AEC A;  5ABF B;  2X9W A;  4HFV A;  5JDQ A;  4CQI A;  2W4X A;  1HS7 A;  5LJN A;  3PU8 A;  2A72 A;  3PJA J;  3VHL A;  2JRK A;  2FUP A;  5AQM B;  4B3M T;  4XZC A;  3OJA A;  4JI4 T;  3LBX A;  1VCT A;  2J1D G;  3AA1 B;  4TX5 A;  3EI0 A;  4QXC B;  5C8Y E;  2ZM0 A;  2BZB A;  4IHJ E;  3A5X A;  4CZZ B;  4DV3 T;  3AED A;  2XAS B;  5CA0 E;  2A2F X;  2WWU A;  1LRZ A;  2QGS A;  3EAM A;  2CEA A;  4LF9 T;  4DO0 A;  1MMG A;  3RYH E;  2UUA T;  2XAQ B;  2N1G A;  3FZK B;  2V26 A;  3KV9 A;  5CA1 E;  4QH5 A;  3ANW A;  1VCS A;  3FHN A;  3UU6 A;  1SA0 E;  3ONJ A;  3AA6 B;  3QUJ A;  1YD8 G;  2VKJ A;  2W61 A;  4O4H E;  4ERR A;  4O4L E;  1WYC A;  5FNV E;  4MHC A;  4I4T E;  5FL0 A;  3FZH B;  4KMC A;  4K0U A;  4JI3 T;  2W66 A;  5AFU L;  4XBF B;  2HHH T;  3NWI A;  3K3O A;  3N9P A;  1ZEE A;  3R84 B;  5AQG B;  2WZI A;  2IML A;  1QSD A;  5IUX A;  1HNW T;  2D9D A;  1XMO T;  4ILU A;  4DBR A;  3HI2 A;  5AQT B;  4LF4 T;  3ZCI A;  4O2B E;  3H3M A;  4I43 B;  1MIV A;  4F8H A;  4B6X A;  1MIY A;  2FJD A;  3RIF A;  2M6B A;  3UFE A;  4QKN A;  4H9O C;  4ZI3 C;  2OV9 A;  4PJJ A;  3KV5 A;  5A1L A;  4L9I A;  1IBK T;  2X0H A;  2LHN A;  2NWB A;  3UTK A;  5FL1 A;  3OYX A;  3AVS A;  4DND A;  2C5I T;  2HN1 A;  5LYJ E;  3VU7 H;  1HF8 A;  2JQ9 A;  4CXW A;  2MYS A;  4LF7 T;  4DBQ A;  2XSA A;  2VL0 A;  1J5W A;  3WI3 A;  1FEW A;  3ZMV B;  5EK4 A;  5AQO B;  4CI2 B;  1FJG T;  3OPC A;  3Q9D A;  2GK9 A;  2W0G A;  2WZH A;  2X9X A;  1HNX T;  4TWD A;  2F4V T;  2IC6 A;  4U2Z A;  4DMW A;  1Z0P A;  2XJ7 A;  3MXZ A;  1T72 A;  2X68 A;  3AEA A;  5LP6 E;  3NZQ A;  1WLX A;  3NVO A;  4L0R A;  3P4R A;  5HEO A;  1E7P A;  1WR6 A;  1XNR T;  3ZJ2 A;  5M4Y A;  4AKG A;  1I6Z A;  1IJ6 A;  4GOU A;  1X79 A;  4LF8 T;  4NUV A;  4HEA A;  4I55 E;  3DP7 A;  3NBX X;  3C51 A;  4EED A;  3TLS A;  3GN5 B;  4CXY A;  4DUY T;  3EUH A;  4YSZ A;  4L5G A;  3Q2M A;  4WW0 A;  5J2U E;  3JCF A;  5HEU A;  3QB5 K;  4IDZ A;  3TKL B;  2E2A A;  3I0Q A;  1J1J A;  3CQX C;  4ANJ A;  1KNZ A;  4Z8X A;  2BKO A;  4CI1 B;  5LHI B;  2YDS A;  3ESL A;  2LLY A;  2FJA A;  4AKL A;  5AQV B;  4JEH B;  1HX8 A;  4IE0 A;  5JDL A;  3ZKR A;  3HL6 A;  1IJ5 A;  4DV2 T;  4Q25 A;  2XQ5 A;  3FXE B;  4EZH A;  2X9Y A;  2VAS A;  4TNV A;  4ZXL A;  2RA1 A;  4YTP A;  4DMV A;  2V6X A;  3C4X A;  4IDN A;  4NXN T;  4JI5 T;  3RYF E;  4ZS3 A;  1T8B A;  4PJN A;  3V5U A;  2EHO A;  5C3J A;  2X0Y A;  1G73 A;  3JAD A;  4C90 A;  5HXS A;  3L3P A;  4N78 D;  2BBJ A;  4JV5 T;  1L0V A;  2WB5 A;  3P50 A;  5AQK B;  4EEB A;  3ZMZ B;  3D0T A;  3KDS E;  3EHZ A;  2DHR A;  3B5M A;  3O4X E;  3PUA A;  2V6Y A;  1UCU A;  3FZL B;  3K1S A;  3RX6 A;  4UXN B;  3C4Z A;  4NUU A;  5ABH A;  3ZST A;  1QUU A;  1S35 A;  2IAK A;  3OVU A;  4OFZ A;  2Q9Q A;  5LGT B;  3UT5 E;  4PAG A;  3AE5 A;  2NTX A;  5HWX A;  5LG4 A;  2BG9 E;  4U72 A;  2YN6 A;  3AE7 A;  3BQI A;  2UUC T;  2V5D A;  4MLK A;  1LVK A;  3ZC1 A;  2BG9 A;  4HFB A;  5HXC A;  2UXX B;  4IL4 A;  4WZX A;  3Q5X A;  3MAC A;  4QXB B;  4U2Y A;  3IBP A;  1T98 A;  2XZE A;  1HG2 A;  4GYS A;  5F8P A;  2XAF B;  5ABF A;  4X1I E;  4U31 A;  2VK9 A;  4TZ4 C;  2XY8 B;  4WYV A;  4EOZ B;  5F3J A;  3FXD B;  2ZM6 T;  3RYI E;  1DU2 A;  5EK3 A;  2BDE A;  2P9B A;  1D1A A;  1KEY A;  3TLU A;  4AXP A;  2YDR A;  5AQF B;  1ZP0 A;  2DI4 A;  1H7C A;  3QC9 A;  4DV5 T;  4QX8 B;  5L3G B;  3G06 A;  3RC3 A;  2UXB T;  4I50 E;  4DR5 T;  4LF5 T;  5LOV E;  2KND A;  1UGO A;  3GWH A;  2BVM A;  3PUR A;  3Q5W A;  5EK2 A;  3I9W A;  2CBJ A;  2K3W A;  2VKD A;  3RRW A;  5L3F B;  4HWI B;  3ETU A;  4YJ2 E;  4PK6 A;  2CWY A;  5JDH A;  1M7K A;  1HG5 A;  3HKE E;  4DV0 T;  2VL8 A;  3AE8 A;  2L3L A;  2WSS V;  3ZYM A;  2YK0 A;  2H89 A;  3TLT A;  4A97 A;  4AQY T;  3KV4 A;  1SUM B;  3CQG B;  2X0L B;  3KBT A;  1W9R A;  4GYR A;  4YT0 A;  3P7I A;  2UUB T;  1J5E T;  1EZ3 A;  2XQY A;  4AKI A;  3A8Y C;  3UQ4 A;  4YY3 T;  5AQS B;  1JNR A;  2C5J A;  3UU3 A;  2FJE A;  3FBL A;  5ABE A;  3RPU A;  3N2G E;  3P4P A;  3EDV A;  3CVR A;  4HWC A;  2XSB A;  4Z90 A;  2VWA A;  3CQC B;  4O4J E;  1E1H B;  1ZKE A;  3LSV A;  5DQW A;  5L2L A;  3MKD A;  3Q5E A;  2WP9 A;  5L4E A;  3PUG A;  4P0B A;  3F31 A;  4LFA T;  4KI0 F;  4UR9 A;  2CXD A;  4CI3 B;  2UU9 T;  5HAX A;  4DR7 T;  2XM2 A;  2N9D A;  4PK5 A;  3K3Q C;  5AQQ B;  1V9D A;  3ZN1 B;  2I6H A;  1XZY A;  1YKH B;  2WDR A;  2QYW A;  4F6R C;  3I1A A;  1HNZ T;  5IHY A;  3KBU A;  2XPK A;  4ADZ A;  3AE4 A;  4IGU A;  4LMJ A;  5E0O A;  2SPC A;  4YTN A;  1NEN A;  5J2T E;  3PU3 A;  3LDQ B;  2K48 A;  3HKB E;  3H3A A;  1Y01 A;  3TLV A;  5JVD E;  1UUS A;  3GN5 A;  3I9Y A;  3RRC A;  3ZCJ A;  3N2O A;  2BS3 A;  2IIU A;  2WBL A;  1UX5 A;  5LGN B;  3RYC E;  1O3X A;  3T1Y T;  4TN7 B;  2IW5 B;  1IBM T;  2VKO A;  2UXC T;  4UEM A;  3PE0 A;  3ZPO A;  4BAY B;  4LMK A;  5BR8 T;  4KUM B;  2XQ6 A;  4DR6 T;  2RP4 A;  5HCM A;  4A5X A;  1N36 T;  3PV0 F;  4H9R C;  2A3D A;  5CJ5 A;  2LE8 A;  1XDO A;  3GMI A;  5FY0 A;  2OLT A;  5IYZ E;  3PDY A;  2KZ7 B;  3ZMT B;  2A9U A;  4M1P A;  2LOS A;  5FXX A;  5LNK A;  3IF8 B;  4MBQ A;  2E5V A;  3MK7 C;  4XAX B;  4AIU A;  2K5B B;  3SFE A;  4X1Y E;  5C2T A;  1HTJ F;  2LRL A;  2QVA A;  4QH1 A;  2JMK A;  4EXT A;  4EV6 A;  2BS4 A;  3KV6 A;  2LSJ A;  3AAA B;  4PFO A;  5FY7 A;  3RIA A;  2D0T A;  2CLY C;  5LBQ B;  1Y64 B;  3LK2 B;  5GON E;  1XMQ T;  3N9N A;  5J1G A;  4DVD A;  2WM9 A;  1E2A A;  4PNI A;  2NTY A;  5JR9 C;  2JQQ A;  5JH7 E;  4TV9 E;  4JI7 T;  4DV7 T;  1MMN A;  3AEE A;  1W0A A;  4KHP T;  4GKK T;  2YDQ A;  5AQJ B;  3B13 A;  2DWG A;  2JJ9 A;  4ZOL E;  5AQH B;  3AEF A;  2WMO A;  1SHZ C;  1UX4 A;  2YKS A;  4DR4 T;  3HA4 A;  2YIN A;  3EVY A;  3OTO T;  5LB7 B;  3SS1 A;  4GIW A;  1D0Y A;  1R8I A;  2H3R A;  1D1B A;  2VQF T;  3VKG A;  2WAU A;  3AVR A;  5FVL A;  3CX8 B;  3ZC0 A;  4KBM B;  5JDG A;  1YW0 A;  2QA7 A;  3HKC E;  1OWA A;  5IWA T;  3JC6 D;  3RIU C;  4ZI2 D;  4UVB B;  5JQG E;  4PW8 A;  4DV6 T;  4DUZ T;  2CLY B;  1JNZ A;  3RF1 A;  3UU5 A;  3RGL A;  3P4W A;  3ZEF B;  2X66 A;  3RC8 A;  2XTL A;  2DCF A;  1XNQ T;  3AEB A;  2DNX A;  4TWF A;  2Y48 B;  5JR9 B;  4MAL A;  2HPJ A;  1ZOY A;  3M65 A;  4C91 A;  3FBZ A;  2WDQ A;  1WRD A;  2CCQ A;  2W63 A;  1NWM X;  5HXH A;  1KNP A;  2KLQ A;  2ZM2 A;  2LKG A;  2CM0 A;  3O1J A;  3J9X 1;  1XWM A;  2BKN A;  3QB5 A;  4WBO A;  5HEJ A;  2BBH A;  4PJM A;  4QWN B;  2E8I A;  2IHR 1;  2WMN A;  2D5U A;  3P4Q A;  2CPT A;  1OXZ A;  1W0B A;  2WCA A;  4TWH A;  2J4G A;  3VRB A;  4EAH A;  3UUN A;  5L4H A;  2BKP A;  2V7L A;  4X20 E;  3ZYL A;  3CK6 A;  3W15 B;  4YFS A;  3MA9 A;  3BQK A;  5L3D B;  1M62 A;  4AQF C;  5CFB A;  2V1D B;  3MJX A;  4EZ4 A;  5FXZ A;  2W62 A;  2E9X D;  5JRC B;  3N9M A;  4IT4 A;  3RHW A;  4A56 A;  3N9O A;  5ADX L;  4ZS2 A;  2NR4 A;  2B76 A;  3DJB A;  2XAG B;  3PUX F;  3FB2 A;  3I0O A;  4AKR B;  3UUX B;  2IUB A;  3SRZ A;  2AE9 A;  2KXP B;  3C4W A;  3CKD A;  3FZF B;  3KVB A;  3ZLI A;  4YSX A;  4O4I E;  3T8O A;  3P8C D;  1YKE B;  2Y6X A;  2WDV A;  1N33 T;  5J0Z A;  1N32 T;  2LSI A;  4LF6 T;  4OX9 T;  3VR8 A;  5LGU B;  1MMA A;  3BK9 A;  3FZM B;  3E0Z A;  4HFE A;  1I94 T;  2NW9 A;  4HFC A;  1KK7 A;  2PBI A;  5DAB A;  2DLR A;  3KVA A;  2XAJ B;  4BA9 A;  4U74 A;  1XDP A;  2IC9 A;  2L9Q A;  3AA0 B;  5KMG P;  1SE7 A;  2B1E A;  2LSG A;  2KSR A;  3JC6 C;  2KMF A;  2W00 A;  1OED C;  2XM1 A;  4V1A v;  5HXR A;  4JI2 T;  1WFD A;  3MZK B;  2CBI A;  4HKA A;  1VRB A;  3TLW A;  2LSY A;  4GK0 E;  1MMD A;  4ILB A;  2V8S V;  2X9H A;  2V7M A;  4IRE A;  4EYU A;  4ZI3 D;  4O8S A;  4HE8 A;  4ISS A;  3RKO A;  5ABG A;  2C5K T;  1GQE A;  1IZN B;  2XQA A;  4HTE A;  4QX7 B;  4COF A;  5LJM A;  3C64 A;  2XQ4 A;  4LML A;  4WNK A;  4X62 T;  5HEG A;  2KWI B;  1HX1 B;  2D2S A;  5HYA A;  5FVK A;  4HWH A;  2X51 A;  1HCI A;  4E7Z A;  2CHO A;  5EZY E;  3Q5D A;  3AEG A;  4GK5 E;  4OHF A;  3LK3 B;  3CIR A;  4H9P C;  3RQW A;  2W67 A;  2BG9 B;  3KFW X;  2WS3 A;  2BS2 A;  5AQI B;  4DV4 T;  2HN2 A;  4AIS A;  5HXE A;  5LCY A;  2ODV A;  1NAF A;  4JYA T;  2OA5 A;  4YJ3 E;  2E5L T;  5LG3 A;  2VVN A;  1YQ3 A;  1FMV A;  2CE7 A;  1OED B;  2V7I A;  4BJM A;  4B3S T;  2QRX A;  2YEV C;  4ZEY A;  2LM9 A;  3LFM A;  4H9Q C;  4HN9 A;  4HWF A;  5AQL B;  3UUM A;  1N34 T;  3WAJ A;  4B3T T;  4U3C A;  3AE3 A;  2CXF A;  4OYK A;  5LMN T;  2E9X C;  2ZMA A;  2RPA A;  1QLB A;  2CXL A;  1US7 B;  1BR0 A;  3B57 A;  5JDN A;  2LOP A;  5L3C B;  4X5T A;  3A7M A;  4JBW F;  3ZT6 A;  2LEH A;  4ZI7 E;  3N9Q A;  1X9B A;  3ETV A;  5KXJ A;  2N2N A;  3UQ7 A;  3CWZ B;  1CUN A;  3AXJ B;  2HPL A;  3ONX A;  1AJ3 A;  4IE6 A;  4HFD A;  5FYM A;  1G8X A;  5L3E B;  2WY2 A;  1LVF A;  3NKZ A;  2LKH A;  4FJO A;  4DR3 T;  4LFC T;  5F5W A;  5DQV A;  5LA6 E;  4JLE A;  4UF0 B;  4ILC A;  4H9N C;  4IST A;  5BMV E;  4X64 T;  3M3Z B;  3RKG A;  2G0U A;  3K8P C;  2L8K A;  2DWK A;  4X65 T;  4AQG A;  2D0U A;  2V5C A;  4P0A A;  3O1I A;  3SWH A;  3PJA A;  2BVL A;  2JQK A;  1KFY A;  2E9X B;  1UUR A;  4EB6 E;  1MIW A;  3R6N A;  1U5P A;  4HFH A;  3T1H T;  4JI0 T;  4U33 A;  4CN6 A;  4UVC B;  5ETW A;  1VOM A;  2LSK A;  2EHO D;  5JR9 A;  3NRY A;  4IDO A;  3AA7 B;  4IL9 A;  3RI5 A;  3C98 B;  3SOL A;  2JIW A;  1WR0 A;  2NOX A;  4QH4 A;  2VVS A;  4QHO A;  2PFV A;  3CML A;  4E7S A;  4CN4 A;  1CHU A;  3LBX B;  4UV9 B;  4P09 A;  2WU5 A;  2ODU A;  4DR2 T;  4NPP A;  3OKQ A;  1WCR A;  4K0K T;  2W2U A;  2V7K A;  4X1K E;  4IE7 A;  5JDM A;  2JPF A;  4X66 T;  2ZLY A; 
#chains in the Genus database with same CATH homology
 4ZEY A;  4CN1 A;  2K3W A;  2LRK A;  4P1N A;  4A5X A;  2CRB A;  5LB7 B;  4IT4 A;  4U33 A;  5CGM A;  4U2Z A;  3ZSS A;  3ZT7 A;  4U31 A;  5FVK A;  4CN6 A;  2V6X A;  2LRL A;  2V6Y A;  2JQH A;  2V6Y B;  2JQ9 A;  1WCR A;  4WZX A;  3K1S A;  2JQK A;  5CJ5 A;  1WFD A;  4U3C A;  3ZT6 A;  3EAB A;  2W2U A;  2A9U A;  1YXR A;  2WWV A;  3ZST A;  2WY2 A;  4U2Y A;  1WR0 A;  4NIQ A;  5FVL A;  2DL1 A;  2XZE A;  4U7Y A;  2MPK A;  4U7I A;  3ZT5 A;  4CN4 A;  2CPT A;  2RPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...