1HS7A

Vam3p n-terminal domain solution structure
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
97
structure length
97
Chain Sequence
TNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords SYNTAXIN VAM3
publication title Vam3p structure reveals conserved and divergent properties of syntaxins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 43
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2000-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14523 Syntaxin_2 Syntaxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hs7A00
4TX5A 5M4YA 3C98B 1S94A 1G73A 4JEUB 3LG7A 4JEHB 1FEWA 2DNXA 1FIOA 5LG4A 1HS7A 1EZ3A 2XHEB 1BR0A
chains in the Genus database with same CATH superfamily
1MIVA 5EK4A 1N36T 5AQOB 3VHLA 2ZMAA 3UU3A 3PUVF 3RIFA 2LSIA 2LOPA 2VKDA 2WDQA 3C50A 3UT5E 4TZ4C 3CQCB 1WR0A 3V5UA 3VR9A 2WQYA 2VASA 3O1JA 4TWDA 4QKNA 2CHNA 2WSSV 2XAJB 2Z6EA 1ZKEA 1T8BA 3FZHB 4B6XA 4PFOA 3EUHA 3FBZA 5L3EB 3ZKRA 3AEDA 1QSDA 1NEKA 2VKJA 1S94A 2WDRA 2XAGB 3C64A 1ZP0A 1H7CA 2YKSA 1J5ET 2ZLYA 4E7ZA 3EI0A 5JRCB 4LF8T 3BQKA 1HCIA 3ZEFB 3RIAA 4X1IE 3T1HT 1HG2A 4LFCT 4IE0A 3ZMVB 2B76A 5CGMA 1VCTA 4HWFA 1WLXA 2XQ4A 3N9OA 3VKHA 4AQYT 1E2AA 3ZC1A 4JBWF 4B3TT 2CPTA 4DBQA 4HTEA 4PNIA 4O2AE 2E2AA 4XAXB 5JDQA 5JRCA 4WYVA 2X0LB 3RGLA 5KMGP 3L39A 1HS7A 4CXYA 1IBKT 2CEAA 1IBLT 4PW8A 4IIJE 2NWBA 4Z91A 2JQHA 1KNRA 3CX8B 2IAKA 3AEFA 3AVRA 2WZHA 4ZZCA 2YK0A 3IBPA 2DCFA 5HXHA 4TNVA 4ZOLE 3MZKB 5JDFA 4YSXA 2HHHT 5L3DB 4DR3T 3ZLIA 2L3LA 3K8PC 2WDVA 4MALA 2V1DB 2BKOA 5HEJA 3K1SA 4B3MT 3HKBE 2JQ9A 2LE8A 4QX8B 4HFVA 5FNVE 4DIDB 4AXPA 2V8SV 2G0UA 2W4XA 2ZM8A 4O4IE 2QRXA 4UV9B 3F57A 2E5LT 1MMDA 3I9YA 4IE6A 4HEAA 1SUMB 3AB3B 1KNPA 4GKJT 4PJJA 2X9HA 1D1BA 2X9YA 2M6IA 4F8HA 4BAYB 3Q5EA 3O9XA 2E8IA 3N9LA 1KNZA 2JRKA 2XQYA 3UQ7A 3HL6A 2I0MA 3NWIA 4JI8T 3N2OA 2LHNA 4GKKT 2UXXB 3LK3B 3SOLA 3B13A 3IEEA 5HXSA 1EZ3A 4GYRA 5AQKB 4CI2B 3RLFF 4IL9A 4DUZT 1MIYA 2NW7A 3LK2B 3K3QC 5JQGE 5FXZA 1MMNA 4ZI7E 2DHRA 4GK0E 2W62A 4F6RC 2JMHA 2CE7A 3QNUA 3ZT6A 4UEMA 2CMRA 3JC6D 3KBTA 5LHGB 4WBNE 4B3ST 2D5UA 2Y8DA 4JV5T 5JVDE 3VRBA 4U31A 5AQRB 3I1AA 3ZYMA 2LJLA 4YY3T 3LFMA 1E7PA 5FP3A 4LMJA 3AE4A 4YFSA 3C98B 4HWHA 4JYAT 3ZSSA 4O4JE 5LHHB 2J47A 5IYZE 4HFEA 4JEHB 4KBMB 3VKGA 2MPKA 3ONLC 4O2BE 5DQWA 1B7TA 2JIWA 5HXEA 1JNZA 2X0YA 3OBVE 4EYUA 3RX6A 4K0UA 1XWMA 4DR7T 1QLBA 4TV8E 2WU5A 3FZMB 2KSRA 1ZHCA 2R6GF 5BMVE 1FIOA 4YJ2E 2RP4A 2KWHA 2ZM0A 2BG9E 4H9OC 3U78A 1HX1B 3PUZF 3HA4A 3EDVA 1ZV4X 4BJNA 4L5GA 2H3RA 3CIRA 5HAXA 3PURA 5CFBA 2LSJA 1FMVA 1HNZT 5JDHA 2W67A 3BK9A 3BQIA 1MMAA 1W9RA 4IDNA 5LB7B 2BZBA 4JI1T 1YW0A 2XQ7A 4UVCB 4LFAT 5L4HA 5CJ5A 1YKEB 2H88A 3RPUA 4IL4A 4JI5T 3P4PA 5L2LA 4DNDA 4PK4A 5LJNA 5J2UE 4AQFC 5J2TE 2PBIA 4ILAA 4U2ZA 5DABA 4DO0A 2WU2A 3MKDA 3RQWA 4TV9E 4LF9T 2JJ9A 2V26A 2XQ8A 4CZZB 2BBHA 2XSAA 5LYJE 2BKNA 5FMNA 4DVDA 2CWYA 3WAKA 2LKHA 3PJAJ 4DV7T 5JTGA 5FXWA 1T7SA 2W0GA 3ZT5A 4A56A 2H7VC 2QVAA 3D0TA 1LRZA 2KLQA 4MHCA 5IUXA 3T8OA 5AQTB 1KEYA 4G2AA 2MTQA 3I0QA 2I6HA 1GQEA 3M65A 3V5SA 2UXNB 2UUBT 4XBFB 1MNEA 1D0ZA 5L4EA 4PJMA 4ZI3C 3UQ4A 2FJDA 3EDUA 3JCFA 3LDQB 5LXTE 2WCAA 4EV6A 4ZHQE 1HNWT 2OLTA 4ERRA 2WB5A 2PJQA 4IDPA 3AE6A 3OKQA 3TLSA 3RI5A 3EAMA 2VL0A 4HN9A 1KFYA 3QC9A 2H7OA 3LBXB 5AQVB 4KHPT 3H3AA 2BKPA 2L9QA 1NWMX 5HXCA 1NENA 3AE2A 3N5LA 4CI3B 5LGTB 2Q9QC 3UU6A 3PUYF 2LSKA 1ZEEA 3H3MA 3QK6A 3CVRA 3ZCJA 4X64T 5E0OA 5FL1A 3UFEA 4DMVA 4AISA 3KV9A 2XQ3A 3FXEB 2WBLA 2XJ7A 2XPKA 4J2CA 2V7KA 5FY1A 1WYBA 3FXDB 1MIWA 4UVBB 5CB4E 4AQGA 2D9DA 3N2GE 3PTRB 2NW9A 2BVMA 4I55E 5J1GA 4YXDA 3FZLB 3AVSA 1XNRT 4BA9A 5AQFB 4ZI2C 4EYYR 2YN6A 2L8KA 2WS3A 1SA0E 3CX7B 1HX8A 2V7IA 3J7Yq 3P8CD 2XAFB 3RKGA 3ZN0B 2W63A 4TNWA 2CBJA 3N9NA 3RYCE 4WBOA 2UUCT 1O3XA 4DV3T 4NPPA 3OPCA 4UVAB 2XHEB 5FYMA 3ZMUB 4X5TA 2HN1A 3AEAA 4IDZA 2VQFT 5AQLB 1XDPA 1T98A 2X51A 2KZ7B 1Y64B 1XNQT 4H9SE 3KINB 3ZC0A 4O4LE 3Q9DA 3AA7B 2Q9QB 2D0UA 4EOZB 4JUYA 2BS3A 3EABA 3C51A 4I50E 5HEUA 4ISTA 4DMWA 5BR8T 2IW5B 3AE3A 4N78D 3RRCA 4AKLA 5J0ZA 3P7IA 5H6QB 3PU3A 5HWYA 2WMNA 4HWCA 2VKHA 4PFPA 4Z8XA 3AECA 5F8PA 2DWGA 2LRLA 1J1JA 3ONJA 5JR9C 2X9WA 3S4UA 4U3CA 1R8IA 2NW8A 3UU8A 2Q9QA 2W66A 4XZCA 3Q5WA 3ZYKA 5JDMA 2VVNA 4DV2T 1WCRA 3KVAA 2WWUA 3A7MA 3OYZA 4BJMA 3ABVA 4JI6T 4O8SA 3JADA 2XUEA 4EXTA 4UELA 2AE9A 3HKCE 2V5DA 3NVOA 5HEHA 4CN4A 2QA7A 3P4RA 2BS4A 3C4ZA 2BG9C 3LK42 2LKGA 5LBQB 4KHZF 1IBMT 2W61A 1LVFA 4I43B 2RA1A 1G73A 3NZPA 3ZSTA 5FY7A 1BR0A 4HE8A 3QB5K 2X0HA 2X68A 2LHRA 4E7SA 1UCUA 4ADZA 4YTNA 3P4SA 1W0AA 1W0BA 2IC9A 2VQET 3RF1A 2OV9A 3KV5A 2VKOA 4MBQA 3AA1B 2WP9A 2MYSA 3MACA 2W00A 1L0VA 1FEWA 4H63H 5HEOA 3IHRA 2KWIB 3NRYA 4X1KE 4DBRA 2MOZA 3C4WA 4QXCB 5AQJB 2MBGA 4CI1B 5L3BB 4DR5T 3LJCA 4HWIB 4DUYT 4UF0B 1UUSA 3E08A 2ODUA 2YEVC 2CLYC 2A72A 5ABHA 4A5XA 5JR9B 1UX4A 3I9WA 3KVBA 2CRBA 4CXXA 3QOFA 2V5CA 3UTKA 2BBJA 1DU2A 3AA6B 2JMKA 5LG3A 1YQ4A 5GONE 2XAHB 3HKEE 4UF0A 4OYKA 2CBIA 3PV0F 4YLHA 4IHJE 1OEDC 5AQHB 3AXJB 4GOUA 5ABEA 3CWZB 2BG9B 2VK9A 2K9AA 4LFBT 5FXVA 2X9XA 5EK2A 3UFGA 1N33T 4NUVA 3RHWA 4Z90A 4AKRB 2UUAT 4OYJA 2JQKA 2BDEA 4KX6A 2M6BA 1KF6A 3GN5B 2NTYA 4EZ4A 5KXJA 4DR6T 2E9XC 3N9PA 4HFCA 2KNDA 5LA6E 3PJAA 1W09A 3AXJA 1HFAA 2BG9A 5FY0A 4YTMA 3PUSA 1FJGT 3OJAA 3A8YC 2AXDS 4OHFA 1D1AA 3PUAA 4ZS2A 4QXHB 3N9MA 2CA5A 5HCMA 4IE4A 2WM9A 3RQUA 3KDSE 5FXXA 2W2UA 4TWHA 3PE0A 3ZN1B 3ZYLA 4QWNB 1YKHB 3R6NA 3IA3A 3MXZA 2WZIA 2KT9A 2VVSA 4Q25A 2UU9T 2M67A 4COFA 3QB5A 4V1Av 4ZS3A 4LF7T 1SHZC 4JI4T 2Y6XA 1M62A 1MMGA 3AAEB 5L3GB 4YJ3E 3KV6A 2DL1A 2PG8A 5AQIB 3SFDA 3J9X1 2IHR1 3MJXA 5A1LA 3UU5A 3A5XA 3B57A 3CKDA 3ONXA 4QH1A 4MFRA 3ZMTB 3SS1A 2WMOA 5L47A 4U7YA 4ZI3D 4DV4T 3P50A 5F5WA 3RRWA 3ZT7A 2LSGA 1S35A 1QUUA 2BVLA 3K3NA 2FJEA 2IIUA 4EEDA 3FHNA 4KP3C 4ANJA 5TAOA 4ZZBA 2K48A 4X62T 1U5PA 4DV6T 1HF8A 2RPAA 3OTOT 2VWAA 2YU2A 5IWAT 4LF4T 1XMQT 2XM1A 1BR1A 2E9XB 3L3PA 2Q9QD 1LVKA 1OEDE 2YDRA 3DP7A 2HH7A 5KX5E 3RYFE 2XQ9A 4AKHA 3KBUA 2UXBT 1UGOA 5DJQC 5JDNA 4G63A 2EHOC 4LMLA 4NIQA 2ACXA 2LOSA 2CHOA 2GK9A 2C0SA 5AQSB 5LMNT 4DV5T 2E9XA 3RC3A 2F4VT 3VR8A 2CM0A 2E5VA 4JI3T 4YTPA 4ZI2D 2YDQA 1Z8UA 1XZYA 3ANWB 1D1CA 2J62A 3WAJA 3R84B 3K3OA 1FMWA 2V6XA 2ODVA 2WY2A 2QGSA 4HFBA 3MK7C 2YOEA 1X79A 3LBXA 3HI2A 5M4YA 2MAWA 5FL0A 3B5MA 1OXZA 4X1YE 3ZMSB 3ETUA 1US7B 4OK0A 3EHZA 3NRXA 4U72A 2DWKA 1HNXT 3O1IA 5JDLA 4HKAA 4P1NA 3AE9A 2I59A 1YXRA 3ANWA 4AQFA 3CPZA 5FVLA 4TWFA 3N2KE 3AE8A 4U33A 3X1DA 4TN7B 4X66T 2HN2A 2FBWA 3U3IA 4DR2T 4YHJA 2FUPA 4PJNA 1YD8G 3RH3A 2LEHA 5C3JA 1YQ3A 3CQXC 3RC8A 3KV4A 3RIUC 2LT3A 4MLKA 2ACZA 2DI4A 3FZKB 3ZPOA 4X20E 4CQIA 2K3WA 2XTLA 3W15B 5EK3A 2XQ5A 3Q5DA 3AEBA 5KDMC 4H63V 2EHOB 2CXLA 2WAUA 3AE1A 1KK7A 4JEUB 1UK5A 3NKZA 2FJBA 5CA0E 1XMOT 1MNDA 4JLEA 5AQUB 3CQGB 4ZXLA 4PK5A 5C8YE 1XDOA 4HGAA 4EB6E 2NR4A 5LJMA 3OVUA 2K5BB 4O4HE 3VU7H 2VL8A 3TLWA 3GMIA 4YSYA 4L0RA 2DLRA 3BQLA 4LF5T 2EHOA 5HEGA 3MA9A 4IE5A 4IE7A 4CN1A 4DV1T 4TX5A 5L3CB 2JQQA 3UUNA 2ZM6T 5EZYE 5LP6E 5LNKA 5LBMA 4JI7T 1D0YA 3L8RA 2YDSA 2IC6A 3Q5XA 4EAHA 3H37A 1U4QA 3F31A 3SWHA 3FB2A 1BR2A 2XQ6A 3F2EA 2LRKA 5ABFB 3DJBA 4WNKA 3PUGA 3T1YT 3E0ZA 3Q2MA 1VCSA 2B1EA 4JI0T 4QH4A 2ES0A 4IGUA 4U74A 3AE7A 2CCQA 3L09A 4OX9T 1WRDA 1M7KA 2CWOA 3O1HA 3ZJ1A 5DQVA 1UX5A 5LCYA 5ABFA 2D0TA 4FJOA 2N2NA 1J5WA 4EGWA 4UR9A 3SFEA 2KINB 1AJ3A 1WYCA 1SE7A 3ZCIA 2BS2A 5AFUL 3I0OA 5JDGA 4LF6T 2C5IT 2NOXA 4DV0T 1T72A 4B3RT 4HFIA 2NP9A 4A97A 5JH7E 3RIUA 3PU8A 1N32T 3AAAB 3E22E 4C90A 3O4XE 3IF8B 3RKOA 3RYIE 1LKXA 5AQPB 3TKLB 4YHHT 1HR0T 5JREA 5F3JA 4I0UA 5LGNB 1G8XA 3NZQA 4WZXA 5FKYA 2A2FX 4AKGA 2NTXA 3HKDE 4EIWA 2KXPB 2XSBA 1UURA 3FBLA 4P0BA 1I6ZA 4PAGA 2LM9A 3N9QA 1OWAA 3LSVA 4A98A 3PDYA 4QHOA 4P09A 2CXDA 2X66A 1IZNB 5HYAA 2E9XD 4QH5A 4H9RC 1WR6A 4AKIA 4ZEYA 4IT4A 2XAQB 2DNXA 2IUBA 3FZFB 2YINA 2A3DA 5JR9A 4LMKA 4GIWA 4AIUA 4GK5E 3CMLA 5HCJA 3TLVA 3JAFA 4UIGA 2H89A 3UUBA 2C5JA 4KMCA 2A9UA 3CX6B 1N34T 3DTOA 1CHUA 1ZOYA 4UXNB 4ILUA 2LSYA 2QYWA 4PK6A 4DR1T 5AQMB 5HWXA 4PJLA 5CA1E 3JC6C 1CUNA 2N1GA 1VRBA 3KFWX 2PTFA 2P9BA 2VB6A 5LGUB 4KUMB 4IDQA 3QUJA 3GN5A 4P0AA 2ZM2A 4HWDA 2PFVA 1BR4A 3WI3A 4OFZA 3ZMZB 4U7IA 2J4GA 2SPCA 3RYHE 4HFDA 4ASKA 4FI5A 4HFHA 2CLYB 3AEEA 2K24A 4NXMT 5LMUT 1V9DA 4AI6A 2KMFA 3UU4A 5H6RB 1X9BA 4KI0F 4QXBB 2LLYA 4EEBA 4DR4T 5L3FB 3UUMA 1NAFA 3AAIA 2CXFA 3JAEA 1IJ6A 5C2TA 3TLTA 2OA5A 3C4XA 3UULA 4ILBA 3GWHA 2V7JA 4NUUA 2WWVA 5IHYA 2IMLA 3PUQA 2IDOB 1OEDB 2V7LA 3P4QA 4H9NC 1HG5A 2HPJA 3SRZA 4H9QC 4H9PC 3M3ZB 4L9IA 5LG4A 5ADXL 2X67A 3AEGA 2EHOD 5FVKA 1WFDA 2VURA 5AQGB 2XZEA 3TLUA 3CK6A 1IAPA 2C5KT 1JNRA 3HR0A 4IREA 2V6YB 3PUWF 3NBXX 1VOMA 2D2SA 4JI2T 4K0KT 1D0XA 2V7MA 4I4TE 2XM2A 4TUYE 4WW0A 4CXWA 4UV8B 1E1HB 1OEDA 4X65T 4CN6A 3UUXB 1I94T 2UXDT 1Y01A 2Y48B 4NXNT 3LG7A 3EVYA 4U2YA 3AE5A 2N9DA 3GA8A 3PUXF 2XY8B 5HXRA 5LOVE 2XASB 1Z0PA 2V6YA 2UXCT 3ZJ2A 5LHIB 3G06A 5AQNB 4C91A 2LM2A 4M1PA 5ABGA 4ILCA 4IDOA 4QX7B 4YT0A 2YU1A 4YSZA 2JPFA 2XQAA 3ESLA 4EZHA 3AA0B 2J1DG 3ETVA 3OYXA 2FJAA 3VRAA 1HTJF 5ETWA 5AQQB 4GYSA 1IJ5A 2HPLA 4ISSA 3P4WA
chains in the Genus database with same CATH topology
5L2LA 4CXXA 4DNDA 2IC6A 4PK4A 5LJNA 3Q5XA 4AQFC 5J2UE 5J2TE 4EAHA 3UTKA 1MIVA 2PBIA 3H37A 5DABA 1U4QA 4DO0A 5EK4A 3AA6B 2JMKA 3F31A 3SWHA 3FB2A 1BR2A 3VHLA 3F2EA 3MKDA 2ZMAA 4TV9E 3DJBA 4WNKA 3PUGA 5GONE 2XAHB 2JJ9A 2V26A 4CZZB 3E0ZA 2LSIA 2LOPA 3Q2MA 5LYJE 2B1EA 3HKEE 4UF0A 2VKDA 4OYKA 3C50A 5FMNA 4DVDA 2CWYA 3UT5E 3WAKA 4TZ4C 2ES0A 4IGUA 4YLHA 4IHJE 4U74A 3CQCB 3V5UA 4GOUA 2CCQA 3CWZB 2VK9A 2K9AA 3L09A 5FXWA 2VASA 5FXVA 2X9XA 3O1JA 5EK2A 4QKNA 2W0GA 1WRDA 4NUVA 2WSSV 2XAJB 2Z6EA 4A56A 1ZKEA 2H7VC 4AKRB 4B6XA 4PFOA 3EUHA 3D0TA 2CWOA 3FBZA 3O1HA 5L3EB 3ZJ1A 5DQVA 1QSDA 1LRZA 1UX5A 2KLQA 4MHCA 2VKJA 4OYJA 1S94A 3T8OA 5LCYA 4G2AA 2MTQA 2BDEA 2D0TA 3I0QA 4FJOA 2XAGB 3M65A 2N2NA 3V5SA 3C64A 1H7CA 3GN5B 2NTYA 4EZ4A 2UXNB 2E9XC 2KINB 1AJ3A 1WYCA 2ZLYA 3N9PA 2KNDA 5LA6E 3ZCIA 4E7ZA 5AFUL 4XBFB 3I0OA 5JRCB 1MNEA 5JDGA 3BQKA 1HFAA 1D0ZA 2C5IT 4PJMA 4ZI3C 5FY0A 1HCIA 3ZEFB 2NOXA 3EDUA 3PUSA 3OJAA 5LXTE 2NP9A 4X1IE 4ZHQE 5JH7E 4OHFA 1D1AA 3PUAA 1HG2A 3PU8A 4ERRA 4IE0A 4ZS2A 4QXHB 3ZMVB 2PJQA 3AAAB 3N9MA 2CA5A 3OKQA 3E22E 4IE4A 4C90A 3O4XE 3IF8B 3RKOA 2WM9A 1LKXA 3RYIE 4HN9A 3TKLB 3KDSE 5FXXA 1WLXA 3N9OA 3VKHA 3ZC1A 3QC9A 4DBQA 2H7OA 3LBXB 4HTEA 3PE0A 3H3AA 4PNIA 5JREA 4O2AE 5F3JA 4XAXB 5JDQA 2L9QA 3ZN1B 4QWNB 1NWMX 3ZYLA 1YKHB 5HXCA 5LGNB 1G8XA 3NZQA 3R6NA 5JRCA 2X0LB 3MXZA 3N5LA 4CI3B 5LGTB 2Q9QC 2KT9A 2A2FX 2M67A 5KMGP 4AKGA 2NTXA 2LSKA 3HKDE 1ZEEA 4V1Av 4ZS3A 1HS7A 4EIWA 2KXPB 4CXYA 1SHZC 2CEAA 3FBLA 3QK6A 4PW8A 3CVRA 2Y6XA 3AAEB 1MMGA 3ZCJA 5L3GB 4P0BA 4YJ3E 3KV6A 4IIJE 4PAGA 5E0OA 2LM9A 3N9QA 2NWBA 2PG8A 1OWAA 3UFEA 4DMVA 3J9X1 3MJXA 5A1LA 3A5XA 3PDYA 4QHOA 3CX8B 3KV9A 2IAKA 4P09A 2CXDA 2X66A 3B57A 3FXEB 2WBLA 4J2CA 1IZNB 5HYAA 2V7KA 3AVRA 2E9XD 3CKDA 3ONXA 5FY1A 2YK0A 4MFRA 3IBPA 3ZMTB 2DCFA 4H9RC 1WR6A 3SS1A 5HXHA 1WYBA 4AKIA 3FXDB 1MIWA 4UVBB 2WMOA 4ZOLE 3MZKB 5JDFA 4ZI3D 2XAQB 5CB4E 2DNXA 5L3DB 4AQGA 3PTRB 3N2GE 2NW9A 3ZLIA 2YINA 2L3LA 2A3DA 3K8PC 3RRWA 2BVMA 2LSGA 4I55E 1QUUA 1S35A 4MALA 2BVLA 2V1DB 3K3NA 5J1GA 3HKBE 3FHNA 5JR9A 3AVSA 2LE8A 4QX8B 4KP3C 4BA9A 4ANJA 5TAOA 4ZI2C 2K48A 4GIWA 4HFVA 4EYYR 4GK5E 5FNVE 2L8KA 1SA0E 4AXPA 1U5PA 3CMLA 3CX7B 1HX8A 1HF8A 2G0UA 2V7IA 3J7Yq 3P8CD 2ZM8A 4O4IE 2XAFB 3ZN0B 2W63A 2VWAA 4UV9B 3F57A 2YU2A 4UIGA 1MMDA 3I9YA 2C5JA 4IE6A 4KMCA 1BR1A 4HEAA 2E9XB 3N9NA 3CX6B 3RYCE 3L3PA 3DTOA 2Q9QD 4WBOA 3AB3B 1LVKA 4UXNB 1O3XA 4ILUA 2LSYA 4PK6A 4PJJA 3DP7A 2X9HA 2HH7A 5HWXA 4PJLA 4UVAB 1D1BA 2X9YA 5KX5E 3RYFE 5CA1E 3JC6C 2XHEB 4BAYB 1CUNA 2N1GA 1VRBA 4AKHA 3O9XA 5FYMA 3ZMUB 3KBUA 3KFWX 5DJQC 5JDNA 2E8IA 4G63A 3N9LA 2EHOC 2P9BA 2VB6A 4IDZA 5LGUB 1KNZA 2ACXA 2LOSA 2JRKA 2XQYA 2GK9A 4KUMB 1T98A 3HL6A 2C0SA 3QUJA 2X51A 2KZ7B 1Y64B 4H9SE 3KINB 3N2OA 3ZC0A 3GN5A 2LHNA 4P0AA 2ZM2A 2E9XA 2PFVA 1BR4A 4O4LE 3RC3A 3WI3A 2UXXB 4OFZA 3LK3B 3Q9DA 3ZMZB 2SPCA 3SOLA 3RYHE 3AA7B 3B13A 4ASKA 2Q9QB 2D0UA 4FI5A 4EOZB 2CLYB 3IEEA 5HXSA 4JUYA 1EZ3A 2K24A 3C51A 4I50E 1V9DA 2CM0A 4ISTA 4GYRA 4CI2B 4DMWA 2IW5B 4N78D 4ZI2D 3RRCA 4AI6A 2KMFA 5H6RB 1MIYA 2NW7A 4AKLA 3ANWB 3LK2B 3P7IA 1D1CA 3K3QC 4QXBB 5H6QB 5FXZA 5JQGE 3PU3A 1MMNA 5HWYA 3WAJA 4ZI7E 2WMNA 2DHRA 4GK0E 3R84B 5L3FB 3UUMA 2VKHA 1NAFA 3K3OA 1FMWA 3AAIA 2ODVA 4PFPA 2W62A 4Z8XA 2CXFA 4F6RC 2QGSA 1IJ6A 3MK7C 2JMHA 2OA5A 3C4XA 2CE7A 5F8PA 3UULA 2DWGA 3GWHA 2V7JA 4NUUA 1X79A 3LBXA 5JR9C 3HI2A 5IHYA 2X9WA 3PUQA 3S4UA 5M4YA 2NW8A 4UEMA 2V7LA 2Q9QA 4H9NC 4XZCA 1OXZA 4X1YE 2CMRA 3Q5WA 3ZMSB 3ZYKA 3ETUA 1US7B 4OK0A 1HG5A 5JDMA 3JC6D 2HPJA 3KBTA 3NRXA 4U72A 3SRZA 4WBNE 5LHGB 2DWKA 3O1IA 5JDLA 4H9QC 4H9PC 3KVAA 2WWUA 3OYZA 4HKAA 4BJMA 2D5UA 4L9IA 2I59A 5LG4A 2Y8DA 2X67A 5JVDE 5ADXL 2EHOD 3ANWA 4O8SA 2XUEA 4AQFA 3CPZA 3I1AA 4EXTA 3ZYMA 4UELA 2LJLA 3LFMA 5FP3A 3HKCE 3N2KE 4YFSA 3C98B 1IAPA 2C5KT 2QA7A 4O4JE 4TN7B 5LHHB 3U3IA 4YHJA 5IYZE 4PJNA 1YD8G 3HR0A 3C4ZA 3RH3A 4JEHB 3LK42 5LBQB 3NBXX 2LEHA 4KBMB 1VOMA 2D2SA 3VKGA 4O2BE 1D0XA 2W61A 1LVFA 3CQXC 5DQWA 2V7MA 4I4TE 3RC8A 1B7TA 4I43B 3KV4A 4TUYE 2RA1A 4WW0A 5HXEA 4CXWA 4UV8B 1E1HB 3OBVE 2LT3A 4MLKA 1G73A 2DI4A 3NZPA 4EYUA 3ZPOA 4X20E 3UUXB 3RX6A 5FY7A 1BR0A 4CQIA 4HE8A 4K0UA 2XTLA 2Y48B 2X68A 3W15B 2LHRA 4E7SA 1UCUA 4ADZA 3LG7A 5EK3A 3EVYA 5KDMC 4H63V 2EHOB 2N9DA 2CXLA 2WAUA 4TV8E 3GA8A 1ZHCA 1KK7A 5HXRA 2IC9A 4JEUB 5BMVE 1FIOA 4YJ2E 2RP4A 2KWHA 5LOVE 2XASB 3KV5A 2VKOA 2ZM0A 1Z0PA 4MBQA 5CA0E 4H9OC 3AA1B 3U78A 3ZJ2A 5LHIB 1MNDA 4JLEA 4C91A 2MYSA 3MACA 3HA4A 3EDVA 1ZV4X 2W00A 3CQGB 4M1PA 4BJNA 1FEWA 4L5GA 2H3RA 5HAXA 4PK5A 4QX7B 4H63H 5C8YE 3IHRA 3PURA 2KWIB 4HGAA 2LSJA 2YU1A 4EB6E 5LJMA 3NRYA 4O4HE 2K5BB 1FMVA 3VU7H 4X1KE 4DBRA 2VL8A 3GMIA 2JPFA 2MOZA 3C4WA 3ESLA 4QXCB 4EZHA 3AA0B 2J1DG 5JDHA 2MBGA 3ETVA 3BQIA 3BK9A 4CI1B 4L0RA 2DLRA 3BQLA 5L3BB 3LJCA 3OYXA 2EHOA 3MA9A 4IE5A 4IE7A 4UF0B 1MMAA 4TX5A 3E08A 5L3CB 2JQQA 2ODUA 2BZBA 1YW0A 3UUNA 1HTJF 2YEVC 5EZYE 5ETWA 2CLYC 2A72A 5LP6E 5LNKA 4GYSA 4UVCB 5LBMA 1D0YA 1YKEB 3RPUA 5JR9B 1UX4A 1IJ5A 2HPLA 3I9WA 3KVBA 4ISSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX5 A;  5M4Y A;  3C98 B;  1S94 A;  1G73 A;  4JEU B;  3LG7 A;  4JEH B;  1FEW A;  2DNX A;  1FIO A;  5LG4 A;  1HS7 A;  1EZ3 A;  2XHE B;  1BR0 A; 
#chains in the Genus database with same CATH topology
 1MIV A;  5EK4 A;  1N36 T;  5AQO B;  3VHL A;  2ZMA A;  3UU3 A;  3PUV F;  3RIF A;  2LSI A;  2LOP A;  2VKD A;  2WDQ A;  3C50 A;  3UT5 E;  4TZ4 C;  3CQC B;  1WR0 A;  3V5U A;  3VR9 A;  2WQY A;  2VAS A;  3O1J A;  4TWD A;  4QKN A;  2CHN A;  2WSS V;  2XAJ B;  2Z6E A;  1ZKE A;  1T8B A;  3FZH B;  4B6X A;  4PFO A;  3EUH A;  3FBZ A;  5L3E B;  3ZKR A;  3AED A;  1QSD A;  1NEK A;  2VKJ A;  1S94 A;  2WDR A;  2XAG B;  3C64 A;  1ZP0 A;  1H7C A;  2YKS A;  1J5E T;  2ZLY A;  4E7Z A;  3EI0 A;  5JRC B;  4LF8 T;  3BQK A;  1HCI A;  3ZEF B;  3RIA A;  4X1I E;  3T1H T;  1HG2 A;  4LFC T;  4IE0 A;  3ZMV B;  2B76 A;  5CGM A;  1VCT A;  4HWF A;  1WLX A;  2XQ4 A;  3N9O A;  3VKH A;  4AQY T;  1E2A A;  3ZC1 A;  4JBW F;  4B3T T;  2CPT A;  4DBQ A;  4HTE A;  4PNI A;  4O2A E;  2E2A A;  4XAX B;  5JDQ A;  5JRC A;  4WYV A;  2X0L B;  3RGL A;  5KMG P;  3L39 A;  1HS7 A;  4CXY A;  1IBK T;  2CEA A;  1IBL T;  4PW8 A;  4IIJ E;  2NWB A;  4Z91 A;  2JQH A;  1KNR A;  3CX8 B;  2IAK A;  3AEF A;  3AVR A;  2WZH A;  4ZZC A;  2YK0 A;  3IBP A;  2DCF A;  5HXH A;  4TNV A;  4ZOL E;  3MZK B;  5JDF A;  4YSX A;  2HHH T;  5L3D B;  4DR3 T;  3ZLI A;  2L3L A;  3K8P C;  2WDV A;  4MAL A;  2V1D B;  2BKO A;  5HEJ A;  3K1S A;  4B3M T;  3HKB E;  2JQ9 A;  2LE8 A;  4QX8 B;  4HFV A;  5FNV E;  4DID B;  4AXP A;  2V8S V;  2G0U A;  2W4X A;  2ZM8 A;  4O4I E;  2QRX A;  4UV9 B;  3F57 A;  2E5L T;  1MMD A;  3I9Y A;  4IE6 A;  4HEA A;  1SUM B;  3AB3 B;  1KNP A;  4GKJ T;  4PJJ A;  2X9H A;  1D1B A;  2X9Y A;  2M6I A;  4F8H A;  4BAY B;  3Q5E A;  3O9X A;  2E8I A;  3N9L A;  1KNZ A;  2JRK A;  2XQY A;  3UQ7 A;  3HL6 A;  2I0M A;  3NWI A;  4JI8 T;  3N2O A;  2LHN A;  4GKK T;  2UXX B;  3LK3 B;  3SOL A;  3B13 A;  3IEE A;  5HXS A;  1EZ3 A;  4GYR A;  5AQK B;  4CI2 B;  3RLF F;  4IL9 A;  4DUZ T;  1MIY A;  2NW7 A;  3LK2 B;  3K3Q C;  5JQG E;  5FXZ A;  1MMN A;  4ZI7 E;  2DHR A;  4GK0 E;  2W62 A;  4F6R C;  2JMH A;  2CE7 A;  3QNU A;  3ZT6 A;  4UEM A;  2CMR A;  3JC6 D;  3KBT A;  5LHG B;  4WBN E;  4B3S T;  2D5U A;  2Y8D A;  4JV5 T;  5JVD E;  3VRB A;  4U31 A;  5AQR B;  3I1A A;  3ZYM A;  2LJL A;  4YY3 T;  3LFM A;  1E7P A;  5FP3 A;  4LMJ A;  3AE4 A;  4YFS A;  3C98 B;  4HWH A;  4JYA T;  3ZSS A;  4O4J E;  5LHH B;  2J47 A;  5IYZ E;  4HFE A;  4JEH B;  4KBM B;  3VKG A;  2MPK A;  3ONL C;  4O2B E;  5DQW A;  1B7T A;  2JIW A;  5HXE A;  1JNZ A;  2X0Y A;  3OBV E;  4EYU A;  3RX6 A;  4K0U A;  1XWM A;  4DR7 T;  1QLB A;  4TV8 E;  2WU5 A;  3FZM B;  2KSR A;  1ZHC A;  2R6G F;  5BMV E;  1FIO A;  4YJ2 E;  2RP4 A;  2KWH A;  2ZM0 A;  2BG9 E;  4H9O C;  3U78 A;  1HX1 B;  3PUZ F;  3HA4 A;  3EDV A;  1ZV4 X;  4BJN A;  4L5G A;  2H3R A;  3CIR A;  5HAX A;  3PUR A;  5CFB A;  2LSJ A;  1FMV A;  1HNZ T;  5JDH A;  2W67 A;  3BK9 A;  3BQI A;  1MMA A;  1W9R A;  4IDN A;  5LB7 B;  2BZB A;  4JI1 T;  1YW0 A;  2XQ7 A;  4UVC B;  4LFA T;  5L4H A;  5CJ5 A;  1YKE B;  2H88 A;  3RPU A;  4IL4 A;  4JI5 T;  3P4P A;  5L2L A;  4DND A;  4PK4 A;  5LJN A;  5J2U E;  4AQF C;  5J2T E;  2PBI A;  4ILA A;  4U2Z A;  5DAB A;  4DO0 A;  2WU2 A;  3MKD A;  3RQW A;  4TV9 E;  4LF9 T;  2JJ9 A;  2V26 A;  2XQ8 A;  4CZZ B;  2BBH A;  2XSA A;  5LYJ E;  2BKN A;  5FMN A;  4DVD A;  2CWY A;  3WAK A;  2LKH A;  3PJA J;  4DV7 T;  5JTG A;  5FXW A;  1T7S A;  2W0G A;  3ZT5 A;  4A56 A;  2H7V C;  2QVA A;  3D0T A;  1LRZ A;  2KLQ A;  4MHC A;  5IUX A;  3T8O A;  5AQT B;  1KEY A;  4G2A A;  2MTQ A;  3I0Q A;  2I6H A;  1GQE A;  3M65 A;  3V5S A;  2UXN B;  2UUB T;  4XBF B;  1MNE A;  1D0Z A;  5L4E A;  4PJM A;  4ZI3 C;  3UQ4 A;  2FJD A;  3EDU A;  3JCF A;  3LDQ B;  5LXT E;  2WCA A;  4EV6 A;  4ZHQ E;  1HNW T;  2OLT A;  4ERR A;  2WB5 A;  2PJQ A;  4IDP A;  3AE6 A;  3OKQ A;  3TLS A;  3RI5 A;  3EAM A;  2VL0 A;  4HN9 A;  1KFY A;  3QC9 A;  2H7O A;  3LBX B;  5AQV B;  4KHP T;  3H3A A;  2BKP A;  2L9Q A;  1NWM X;  5HXC A;  1NEN A;  3AE2 A;  3N5L A;  4CI3 B;  5LGT B;  2Q9Q C;  3UU6 A;  3PUY F;  2LSK A;  1ZEE A;  3H3M A;  3QK6 A;  3CVR A;  3ZCJ A;  4X64 T;  5E0O A;  5FL1 A;  3UFE A;  4DMV A;  4AIS A;  3KV9 A;  2XQ3 A;  3FXE B;  2WBL A;  2XJ7 A;  2XPK A;  4J2C A;  2V7K A;  5FY1 A;  1WYB A;  3FXD B;  1MIW A;  4UVB B;  5CB4 E;  4AQG A;  2D9D A;  3N2G E;  3PTR B;  2NW9 A;  2BVM A;  4I55 E;  5J1G A;  4YXD A;  3FZL B;  3AVS A;  1XNR T;  4BA9 A;  5AQF B;  4ZI2 C;  4EYY R;  2YN6 A;  2L8K A;  2WS3 A;  1SA0 E;  3CX7 B;  1HX8 A;  2V7I A;  3J7Y q;  3P8C D;  2XAF B;  3RKG A;  3ZN0 B;  2W63 A;  4TNW A;  2CBJ A;  3N9N A;  3RYC E;  4WBO A;  2UUC T;  1O3X A;  4DV3 T;  4NPP A;  3OPC A;  4UVA B;  2XHE B;  5FYM A;  3ZMU B;  4X5T A;  2HN1 A;  3AEA A;  4IDZ A;  2VQF T;  5AQL B;  1XDP A;  1T98 A;  2X51 A;  2KZ7 B;  1Y64 B;  1XNQ T;  4H9S E;  3KIN B;  3ZC0 A;  4O4L E;  3Q9D A;  3AA7 B;  2Q9Q B;  2D0U A;  4EOZ B;  4JUY A;  2BS3 A;  3EAB A;  3C51 A;  4I50 E;  5HEU A;  4IST A;  4DMW A;  5BR8 T;  2IW5 B;  3AE3 A;  4N78 D;  3RRC A;  4AKL A;  5J0Z A;  3P7I A;  5H6Q B;  3PU3 A;  5HWY A;  2WMN A;  4HWC A;  2VKH A;  4PFP A;  4Z8X A;  3AEC A;  5F8P A;  2DWG A;  2LRL A;  1J1J A;  3ONJ A;  5JR9 C;  2X9W A;  3S4U A;  4U3C A;  1R8I A;  2NW8 A;  3UU8 A;  2Q9Q A;  2W66 A;  4XZC A;  3Q5W A;  3ZYK A;  5JDM A;  2VVN A;  4DV2 T;  1WCR A;  3KVA A;  2WWU A;  3A7M A;  3OYZ A;  4BJM A;  3ABV A;  4JI6 T;  4O8S A;  3JAD A;  2XUE A;  4EXT A;  4UEL A;  2AE9 A;  3HKC E;  2V5D A;  3NVO A;  5HEH A;  4CN4 A;  2QA7 A;  3P4R A;  2BS4 A;  3C4Z A;  2BG9 C;  3LK4 2;  2LKG A;  5LBQ B;  4KHZ F;  1IBM T;  2W61 A;  1LVF A;  4I43 B;  2RA1 A;  1G73 A;  3NZP A;  3ZST A;  5FY7 A;  1BR0 A;  4HE8 A;  3QB5 K;  2X0H A;  2X68 A;  2LHR A;  4E7S A;  1UCU A;  4ADZ A;  4YTN A;  3P4S A;  1W0A A;  1W0B A;  2IC9 A;  2VQE T;  3RF1 A;  2OV9 A;  3KV5 A;  2VKO A;  4MBQ A;  3AA1 B;  2WP9 A;  2MYS A;  3MAC A;  2W00 A;  1L0V A;  1FEW A;  4H63 H;  5HEO A;  3IHR A;  2KWI B;  3NRY A;  4X1K E;  4DBR A;  2MOZ A;  3C4W A;  4QXC B;  5AQJ B;  2MBG A;  4CI1 B;  5L3B B;  4DR5 T;  3LJC A;  4HWI B;  4DUY T;  4UF0 B;  1UUS A;  3E08 A;  2ODU A;  2YEV C;  2CLY C;  2A72 A;  5ABH A;  4A5X A;  5JR9 B;  1UX4 A;  3I9W A;  3KVB A;  2CRB A;  4CXX A;  3QOF A;  2V5C A;  3UTK A;  2BBJ A;  1DU2 A;  3AA6 B;  2JMK A;  5LG3 A;  1YQ4 A;  5GON E;  2XAH B;  3HKE E;  4UF0 A;  4OYK A;  2CBI A;  3PV0 F;  4YLH A;  4IHJ E;  1OED C;  5AQH B;  3AXJ B;  4GOU A;  5ABE A;  3CWZ B;  2BG9 B;  2VK9 A;  2K9A A;  4LFB T;  5FXV A;  2X9X A;  5EK2 A;  3UFG A;  1N33 T;  4NUV A;  3RHW A;  4Z90 A;  4AKR B;  2UUA T;  4OYJ A;  2JQK A;  2BDE A;  4KX6 A;  2M6B A;  1KF6 A;  3GN5 B;  2NTY A;  4EZ4 A;  5KXJ A;  4DR6 T;  2E9X C;  3N9P A;  4HFC A;  2KND A;  5LA6 E;  3PJA A;  1W09 A;  3AXJ A;  1HFA A;  2BG9 A;  5FY0 A;  4YTM A;  3PUS A;  1FJG T;  3OJA A;  3A8Y C;  2AXD S;  4OHF A;  1D1A A;  3PUA A;  4ZS2 A;  4QXH B;  3N9M A;  2CA5 A;  5HCM A;  4IE4 A;  2WM9 A;  3RQU A;  3KDS E;  5FXX A;  2W2U A;  4TWH A;  3PE0 A;  3ZN1 B;  3ZYL A;  4QWN B;  1YKH B;  3R6N A;  3IA3 A;  3MXZ A;  2WZI A;  2KT9 A;  2VVS A;  4Q25 A;  2UU9 T;  2M67 A;  4COF A;  3QB5 A;  4V1A v;  4ZS3 A;  4LF7 T;  1SHZ C;  4JI4 T;  2Y6X A;  1M62 A;  1MMG A;  3AAE B;  5L3G B;  4YJ3 E;  3KV6 A;  2DL1 A;  2PG8 A;  5AQI B;  3SFD A;  3J9X 1;  2IHR 1;  3MJX A;  5A1L A;  3UU5 A;  3A5X A;  3B57 A;  3CKD A;  3ONX A;  4QH1 A;  4MFR A;  3ZMT B;  3SS1 A;  2WMO A;  5L47 A;  4U7Y A;  4ZI3 D;  4DV4 T;  3P50 A;  5F5W A;  3RRW A;  3ZT7 A;  2LSG A;  1S35 A;  1QUU A;  2BVL A;  3K3N A;  2FJE A;  2IIU A;  4EED A;  3FHN A;  4KP3 C;  4ANJ A;  5TAO A;  4ZZB A;  2K48 A;  4X62 T;  1U5P A;  4DV6 T;  1HF8 A;  2RPA A;  3OTO T;  2VWA A;  2YU2 A;  5IWA T;  4LF4 T;  1XMQ T;  2XM1 A;  1BR1 A;  2E9X B;  3L3P A;  2Q9Q D;  1LVK A;  1OED E;  2YDR A;  3DP7 A;  2HH7 A;  5KX5 E;  3RYF E;  2XQ9 A;  4AKH A;  3KBU A;  2UXB T;  1UGO A;  5DJQ C;  5JDN A;  4G63 A;  2EHO C;  4LML A;  4NIQ A;  2ACX A;  2LOS A;  2CHO A;  2GK9 A;  2C0S A;  5AQS B;  5LMN T;  4DV5 T;  2E9X A;  3RC3 A;  2F4V T;  3VR8 A;  2CM0 A;  2E5V A;  4JI3 T;  4YTP A;  4ZI2 D;  2YDQ A;  1Z8U A;  1XZY A;  3ANW B;  1D1C A;  2J62 A;  3WAJ A;  3R84 B;  3K3O A;  1FMW A;  2V6X A;  2ODV A;  2WY2 A;  2QGS A;  4HFB A;  3MK7 C;  2YOE A;  1X79 A;  3LBX A;  3HI2 A;  5M4Y A;  2MAW A;  5FL0 A;  3B5M A;  1OXZ A;  4X1Y E;  3ZMS B;  3ETU A;  1US7 B;  4OK0 A;  3EHZ A;  3NRX A;  4U72 A;  2DWK A;  1HNX T;  3O1I A;  5JDL A;  4HKA A;  4P1N A;  3AE9 A;  2I59 A;  1YXR A;  3ANW A;  4AQF A;  3CPZ A;  5FVL A;  4TWF A;  3N2K E;  3AE8 A;  4U33 A;  3X1D A;  4TN7 B;  4X66 T;  2HN2 A;  2FBW A;  3U3I A;  4DR2 T;  4YHJ A;  2FUP A;  4PJN A;  1YD8 G;  3RH3 A;  2LEH A;  5C3J A;  1YQ3 A;  3CQX C;  3RC8 A;  3KV4 A;  3RIU C;  2LT3 A;  4MLK A;  2ACZ A;  2DI4 A;  3FZK B;  3ZPO A;  4X20 E;  4CQI A;  2K3W A;  2XTL A;  3W15 B;  5EK3 A;  2XQ5 A;  3Q5D A;  3AEB A;  5KDM C;  4H63 V;  2EHO B;  2CXL A;  2WAU A;  3AE1 A;  1KK7 A;  4JEU B;  1UK5 A;  3NKZ A;  2FJB A;  5CA0 E;  1XMO T;  1MND A;  4JLE A;  5AQU B;  3CQG B;  4ZXL A;  4PK5 A;  5C8Y E;  1XDO A;  4HGA A;  4EB6 E;  2NR4 A;  5LJM A;  3OVU A;  2K5B B;  4O4H E;  3VU7 H;  2VL8 A;  3TLW A;  3GMI A;  4YSY A;  4L0R A;  2DLR A;  3BQL A;  4LF5 T;  2EHO A;  5HEG A;  3MA9 A;  4IE5 A;  4IE7 A;  4CN1 A;  4DV1 T;  4TX5 A;  5L3C B;  2JQQ A;  3UUN A;  2ZM6 T;  5EZY E;  5LP6 E;  5LNK A;  5LBM A;  4JI7 T;  1D0Y A;  3L8R A;  2YDS A;  2IC6 A;  3Q5X A;  4EAH A;  3H37 A;  1U4Q A;  3F31 A;  3SWH A;  3FB2 A;  1BR2 A;  2XQ6 A;  3F2E A;  2LRK A;  5ABF B;  3DJB A;  4WNK A;  3PUG A;  3T1Y T;  3E0Z A;  3Q2M A;  1VCS A;  2B1E A;  4JI0 T;  4QH4 A;  2ES0 A;  4IGU A;  4U74 A;  3AE7 A;  2CCQ A;  3L09 A;  4OX9 T;  1WRD A;  1M7K A;  2CWO A;  3O1H A;  3ZJ1 A;  5DQV A;  1UX5 A;  5LCY A;  5ABF A;  2D0T A;  4FJO A;  2N2N A;  1J5W A;  4EGW A;  4UR9 A;  3SFE A;  2KIN B;  1AJ3 A;  1WYC A;  1SE7 A;  3ZCI A;  2BS2 A;  5AFU L;  3I0O A;  5JDG A;  4LF6 T;  2C5I T;  2NOX A;  4DV0 T;  1T72 A;  4B3R T;  4HFI A;  2NP9 A;  4A97 A;  5JH7 E;  3RIU A;  3PU8 A;  1N32 T;  3AAA B;  3E22 E;  4C90 A;  3O4X E;  3IF8 B;  3RKO A;  3RYI E;  1LKX A;  5AQP B;  3TKL B;  4YHH T;  1HR0 T;  5JRE A;  5F3J A;  4I0U A;  5LGN B;  1G8X A;  3NZQ A;  4WZX A;  5FKY A;  2A2F X;  4AKG A;  2NTX A;  3HKD E;  4EIW A;  2KXP B;  2XSB A;  1UUR A;  3FBL A;  4P0B A;  1I6Z A;  4PAG A;  2LM9 A;  3N9Q A;  1OWA A;  3LSV A;  4A98 A;  3PDY A;  4QHO A;  4P09 A;  2CXD A;  2X66 A;  1IZN B;  5HYA A;  2E9X D;  4QH5 A;  4H9R C;  1WR6 A;  4AKI A;  4ZEY A;  4IT4 A;  2XAQ B;  2DNX A;  2IUB A;  3FZF B;  2YIN A;  2A3D A;  5JR9 A;  4LMK A;  4GIW A;  4AIU A;  4GK5 E;  3CML A;  5HCJ A;  3TLV A;  3JAF A;  4UIG A;  2H89 A;  3UUB A;  2C5J A;  4KMC A;  2A9U A;  3CX6 B;  1N34 T;  3DTO A;  1CHU A;  1ZOY A;  4UXN B;  4ILU A;  2LSY A;  2QYW A;  4PK6 A;  4DR1 T;  5AQM B;  5HWX A;  4PJL A;  5CA1 E;  3JC6 C;  1CUN A;  2N1G A;  1VRB A;  3KFW X;  2PTF A;  2P9B A;  2VB6 A;  5LGU B;  4KUM B;  4IDQ A;  3QUJ A;  3GN5 A;  4P0A A;  2ZM2 A;  4HWD A;  2PFV A;  1BR4 A;  3WI3 A;  4OFZ A;  3ZMZ B;  4U7I A;  2J4G A;  2SPC A;  3RYH E;  4HFD A;  4ASK A;  4FI5 A;  4HFH A;  2CLY B;  3AEE A;  2K24 A;  4NXM T;  5LMU T;  1V9D A;  4AI6 A;  2KMF A;  3UU4 A;  5H6R B;  1X9B A;  4KI0 F;  4QXB B;  2LLY A;  4EEB A;  4DR4 T;  5L3F B;  3UUM A;  1NAF A;  3AAI A;  2CXF A;  3JAE A;  1IJ6 A;  5C2T A;  3TLT A;  2OA5 A;  3C4X A;  3UUL A;  4ILB A;  3GWH A;  2V7J A;  4NUU A;  2WWV A;  5IHY A;  2IML A;  3PUQ A;  2IDO B;  1OED B;  2V7L A;  3P4Q A;  4H9N C;  1HG5 A;  2HPJ A;  3SRZ A;  4H9Q C;  4H9P C;  3M3Z B;  4L9I A;  5LG4 A;  5ADX L;  2X67 A;  3AEG A;  2EHO D;  5FVK A;  1WFD A;  2VUR A;  5AQG B;  2XZE A;  3TLU A;  3CK6 A;  1IAP A;  2C5K T;  1JNR A;  3HR0 A;  4IRE A;  2V6Y B;  3PUW F;  3NBX X;  1VOM A;  2D2S A;  4JI2 T;  4K0K T;  1D0X A;  2V7M A;  4I4T E;  2XM2 A;  4TUY E;  4WW0 A;  4CXW A;  4UV8 B;  1E1H B;  1OED A;  4X65 T;  4CN6 A;  3UUX B;  1I94 T;  2UXD T;  1Y01 A;  2Y48 B;  4NXN T;  3LG7 A;  3EVY A;  4U2Y A;  3AE5 A;  2N9D A;  3GA8 A;  3PUX F;  2XY8 B;  5HXR A;  5LOV E;  2XAS B;  1Z0P A;  2V6Y A;  2UXC T;  3ZJ2 A;  5LHI B;  3G06 A;  5AQN B;  4C91 A;  2LM2 A;  4M1P A;  5ABG A;  4ILC A;  4IDO A;  4QX7 B;  4YT0 A;  2YU1 A;  4YSZ A;  2JPF A;  2XQA A;  3ESL A;  4EZH A;  3AA0 B;  2J1D G;  3ETV A;  3OYX A;  2FJA A;  3VRA A;  1HTJ F;  5ETW A;  5AQQ B;  4GYS A;  1IJ5 A;  2HPL A;  4ISS A;  3P4W A; 
#chains in the Genus database with same CATH homology
 5L2L A;  4CXX A;  4DND A;  2IC6 A;  4PK4 A;  5LJN A;  3Q5X A;  4AQF C;  5J2U E;  5J2T E;  4EAH A;  3UTK A;  1MIV A;  2PBI A;  3H37 A;  5DAB A;  1U4Q A;  4DO0 A;  5EK4 A;  3AA6 B;  2JMK A;  3F31 A;  3SWH A;  3FB2 A;  1BR2 A;  3VHL A;  3F2E A;  3MKD A;  2ZMA A;  4TV9 E;  3DJB A;  4WNK A;  3PUG A;  5GON E;  2XAH B;  2JJ9 A;  2V26 A;  4CZZ B;  3E0Z A;  2LSI A;  2LOP A;  3Q2M A;  5LYJ E;  2B1E A;  3HKE E;  4UF0 A;  2VKD A;  4OYK A;  3C50 A;  5FMN A;  4DVD A;  2CWY A;  3UT5 E;  3WAK A;  4TZ4 C;  2ES0 A;  4IGU A;  4YLH A;  4IHJ E;  4U74 A;  3CQC B;  3V5U A;  4GOU A;  2CCQ A;  3CWZ B;  2VK9 A;  2K9A A;  3L09 A;  5FXW A;  2VAS A;  5FXV A;  2X9X A;  3O1J A;  5EK2 A;  4QKN A;  2W0G A;  1WRD A;  4NUV A;  2WSS V;  2XAJ B;  2Z6E A;  4A56 A;  1ZKE A;  2H7V C;  4AKR B;  4B6X A;  4PFO A;  3EUH A;  3D0T A;  2CWO A;  3FBZ A;  3O1H A;  5L3E B;  3ZJ1 A;  5DQV A;  1QSD A;  1LRZ A;  1UX5 A;  2KLQ A;  4MHC A;  2VKJ A;  4OYJ A;  1S94 A;  3T8O A;  5LCY A;  4G2A A;  2MTQ A;  2BDE A;  2D0T A;  3I0Q A;  4FJO A;  2XAG B;  3M65 A;  2N2N A;  3V5S A;  3C64 A;  1H7C A;  3GN5 B;  2NTY A;  4EZ4 A;  2UXN B;  2E9X C;  2KIN B;  1AJ3 A;  1WYC A;  2ZLY A;  3N9P A;  2KND A;  5LA6 E;  3ZCI A;  4E7Z A;  5AFU L;  4XBF B;  3I0O A;  5JRC B;  1MNE A;  5JDG A;  3BQK A;  1HFA A;  1D0Z A;  2C5I T;  4PJM A;  4ZI3 C;  5FY0 A;  1HCI A;  3ZEF B;  2NOX A;  3EDU A;  3PUS A;  3OJA A;  5LXT E;  2NP9 A;  4X1I E;  4ZHQ E;  5JH7 E;  4OHF A;  1D1A A;  3PUA A;  1HG2 A;  3PU8 A;  4ERR A;  4IE0 A;  4ZS2 A;  4QXH B;  3ZMV B;  2PJQ A;  3AAA B;  3N9M A;  2CA5 A;  3OKQ A;  3E22 E;  4IE4 A;  4C90 A;  3O4X E;  3IF8 B;  3RKO A;  2WM9 A;  1LKX A;  3RYI E;  4HN9 A;  3TKL B;  3KDS E;  5FXX A;  1WLX A;  3N9O A;  3VKH A;  3ZC1 A;  3QC9 A;  4DBQ A;  2H7O A;  3LBX B;  4HTE A;  3PE0 A;  3H3A A;  4PNI A;  5JRE A;  4O2A E;  5F3J A;  4XAX B;  5JDQ A;  2L9Q A;  3ZN1 B;  4QWN B;  1NWM X;  3ZYL A;  1YKH B;  5HXC A;  5LGN B;  1G8X A;  3NZQ A;  3R6N A;  5JRC A;  2X0L B;  3MXZ A;  3N5L A;  4CI3 B;  5LGT B;  2Q9Q C;  2KT9 A;  2A2F X;  2M67 A;  5KMG P;  4AKG A;  2NTX A;  2LSK A;  3HKD E;  1ZEE A;  4V1A v;  4ZS3 A;  1HS7 A;  4EIW A;  2KXP B;  4CXY A;  1SHZ C;  2CEA A;  3FBL A;  3QK6 A;  4PW8 A;  3CVR A;  2Y6X A;  3AAE B;  1MMG A;  3ZCJ A;  5L3G B;  4P0B A;  4YJ3 E;  3KV6 A;  4IIJ E;  4PAG A;  5E0O A;  2LM9 A;  3N9Q A;  2NWB A;  2PG8 A;  1OWA A;  3UFE A;  4DMV A;  3J9X 1;  3MJX A;  5A1L A;  3A5X A;  3PDY A;  4QHO A;  3CX8 B;  3KV9 A;  2IAK A;  4P09 A;  2CXD A;  2X66 A;  3B57 A;  3FXE B;  2WBL A;  4J2C A;  1IZN B;  5HYA A;  2V7K A;  3AVR A;  2E9X D;  3CKD A;  3ONX A;  5FY1 A;  2YK0 A;  4MFR A;  3IBP A;  3ZMT B;  2DCF A;  4H9R C;  1WR6 A;  3SS1 A;  5HXH A;  1WYB A;  4AKI A;  3FXD B;  1MIW A;  4UVB B;  2WMO A;  4ZOL E;  3MZK B;  5JDF A;  4ZI3 D;  2XAQ B;  5CB4 E;  2DNX A;  5L3D B;  4AQG A;  3PTR B;  3N2G E;  2NW9 A;  3ZLI A;  2YIN A;  2L3L A;  2A3D A;  3K8P C;  3RRW A;  2BVM A;  2LSG A;  4I55 E;  1QUU A;  1S35 A;  4MAL A;  2BVL A;  2V1D B;  3K3N A;  5J1G A;  3HKB E;  3FHN A;  5JR9 A;  3AVS A;  2LE8 A;  4QX8 B;  4KP3 C;  4BA9 A;  4ANJ A;  5TAO A;  4ZI2 C;  2K48 A;  4GIW A;  4HFV A;  4EYY R;  4GK5 E;  5FNV E;  2L8K A;  1SA0 E;  4AXP A;  1U5P A;  3CML A;  3CX7 B;  1HX8 A;  1HF8 A;  2G0U A;  2V7I A;  3J7Y q;  3P8C D;  2ZM8 A;  4O4I E;  2XAF B;  3ZN0 B;  2W63 A;  2VWA A;  4UV9 B;  3F57 A;  2YU2 A;  4UIG A;  1MMD A;  3I9Y A;  2C5J A;  4IE6 A;  4KMC A;  1BR1 A;  4HEA A;  2E9X B;  3N9N A;  3CX6 B;  3RYC E;  3L3P A;  3DTO A;  2Q9Q D;  4WBO A;  3AB3 B;  1LVK A;  4UXN B;  1O3X A;  4ILU A;  2LSY A;  4PK6 A;  4PJJ A;  3DP7 A;  2X9H A;  2HH7 A;  5HWX A;  4PJL A;  4UVA B;  1D1B A;  2X9Y A;  5KX5 E;  3RYF E;  5CA1 E;  3JC6 C;  2XHE B;  4BAY B;  1CUN A;  2N1G A;  1VRB A;  4AKH A;  3O9X A;  5FYM A;  3ZMU B;  3KBU A;  3KFW X;  5DJQ C;  5JDN A;  2E8I A;  4G63 A;  3N9L A;  2EHO C;  2P9B A;  2VB6 A;  4IDZ A;  5LGU B;  1KNZ A;  2ACX A;  2LOS A;  2JRK A;  2XQY A;  2GK9 A;  4KUM B;  1T98 A;  3HL6 A;  2C0S A;  3QUJ A;  2X51 A;  2KZ7 B;  1Y64 B;  4H9S E;  3KIN B;  3N2O A;  3ZC0 A;  3GN5 A;  2LHN A;  4P0A A;  2ZM2 A;  2E9X A;  2PFV A;  1BR4 A;  4O4L E;  3RC3 A;  3WI3 A;  2UXX B;  4OFZ A;  3LK3 B;  3Q9D A;  3ZMZ B;  2SPC A;  3SOL A;  3RYH E;  3AA7 B;  3B13 A;  4ASK A;  2Q9Q B;  2D0U A;  4FI5 A;  4EOZ B;  2CLY B;  3IEE A;  5HXS A;  4JUY A;  1EZ3 A;  2K24 A;  3C51 A;  4I50 E;  1V9D A;  2CM0 A;  4IST A;  4GYR A;  4CI2 B;  4DMW A;  2IW5 B;  4N78 D;  4ZI2 D;  3RRC A;  4AI6 A;  2KMF A;  5H6R B;  1MIY A;  2NW7 A;  4AKL A;  3ANW B;  3LK2 B;  3P7I A;  1D1C A;  3K3Q C;  4QXB B;  5H6Q B;  5FXZ A;  5JQG E;  3PU3 A;  1MMN A;  5HWY A;  3WAJ A;  4ZI7 E;  2WMN A;  2DHR A;  4GK0 E;  3R84 B;  5L3F B;  3UUM A;  2VKH A;  1NAF A;  3K3O A;  1FMW A;  3AAI A;  2ODV A;  4PFP A;  2W62 A;  4Z8X A;  2CXF A;  4F6R C;  2QGS A;  1IJ6 A;  3MK7 C;  2JMH A;  2OA5 A;  3C4X A;  2CE7 A;  5F8P A;  3UUL A;  2DWG A;  3GWH A;  2V7J A;  4NUU A;  1X79 A;  3LBX A;  5JR9 C;  3HI2 A;  5IHY A;  2X9W A;  3PUQ A;  3S4U A;  5M4Y A;  2NW8 A;  4UEM A;  2V7L A;  2Q9Q A;  4H9N C;  4XZC A;  1OXZ A;  4X1Y E;  2CMR A;  3Q5W A;  3ZMS B;  3ZYK A;  3ETU A;  1US7 B;  4OK0 A;  1HG5 A;  5JDM A;  3JC6 D;  2HPJ A;  3KBT A;  3NRX A;  4U72 A;  3SRZ A;  4WBN E;  5LHG B;  2DWK A;  3O1I A;  5JDL A;  4H9Q C;  4H9P C;  3KVA A;  2WWU A;  3OYZ A;  4HKA A;  4BJM A;  2D5U A;  4L9I A;  2I59 A;  5LG4 A;  2Y8D A;  2X67 A;  5JVD E;  5ADX L;  2EHO D;  3ANW A;  4O8S A;  2XUE A;  4AQF A;  3CPZ A;  3I1A A;  4EXT A;  3ZYM A;  4UEL A;  2LJL A;  3LFM A;  5FP3 A;  3HKC E;  3N2K E;  4YFS A;  3C98 B;  1IAP A;  2C5K T;  2QA7 A;  4O4J E;  4TN7 B;  5LHH B;  3U3I A;  4YHJ A;  5IYZ E;  4PJN A;  1YD8 G;  3HR0 A;  3C4Z A;  3RH3 A;  4JEH B;  3LK4 2;  5LBQ B;  3NBX X;  2LEH A;  4KBM B;  1VOM A;  2D2S A;  3VKG A;  4O2B E;  1D0X A;  2W61 A;  1LVF A;  3CQX C;  5DQW A;  2V7M A;  4I4T E;  3RC8 A;  1B7T A;  4I43 B;  3KV4 A;  4TUY E;  2RA1 A;  4WW0 A;  5HXE A;  4CXW A;  4UV8 B;  1E1H B;  3OBV E;  2LT3 A;  4MLK A;  1G73 A;  2DI4 A;  3NZP A;  4EYU A;  3ZPO A;  4X20 E;  3UUX B;  3RX6 A;  5FY7 A;  1BR0 A;  4CQI A;  4HE8 A;  4K0U A;  2XTL A;  2Y48 B;  2X68 A;  3W15 B;  2LHR A;  4E7S A;  1UCU A;  4ADZ A;  3LG7 A;  5EK3 A;  3EVY A;  5KDM C;  4H63 V;  2EHO B;  2N9D A;  2CXL A;  2WAU A;  4TV8 E;  3GA8 A;  1ZHC A;  1KK7 A;  5HXR A;  2IC9 A;  4JEU B;  5BMV E;  1FIO A;  4YJ2 E;  2RP4 A;  2KWH A;  5LOV E;  2XAS B;  3KV5 A;  2VKO A;  2ZM0 A;  1Z0P A;  4MBQ A;  5CA0 E;  4H9O C;  3AA1 B;  3U78 A;  3ZJ2 A;  5LHI B;  1MND A;  4JLE A;  4C91 A;  2MYS A;  3MAC A;  3HA4 A;  3EDV A;  1ZV4 X;  2W00 A;  3CQG B;  4M1P A;  4BJN A;  1FEW A;  4L5G A;  2H3R A;  5HAX A;  4PK5 A;  4QX7 B;  4H63 H;  5C8Y E;  3IHR A;  3PUR A;  2KWI B;  4HGA A;  2LSJ A;  2YU1 A;  4EB6 E;  5LJM A;  3NRY A;  4O4H E;  2K5B B;  1FMV A;  3VU7 H;  4X1K E;  4DBR A;  2VL8 A;  3GMI A;  2JPF A;  2MOZ A;  3C4W A;  3ESL A;  4QXC B;  4EZH A;  3AA0 B;  2J1D G;  5JDH A;  2MBG A;  3ETV A;  3BQI A;  3BK9 A;  4CI1 B;  4L0R A;  2DLR A;  3BQL A;  5L3B B;  3LJC A;  3OYX A;  2EHO A;  3MA9 A;  4IE5 A;  4IE7 A;  4UF0 B;  1MMA A;  4TX5 A;  3E08 A;  5L3C B;  2JQQ A;  2ODU A;  2BZB A;  1YW0 A;  3UUN A;  1HTJ F;  2YEV C;  5EZY E;  5ETW A;  2CLY C;  2A72 A;  5LP6 E;  5LNK A;  4GYS A;  4UVC B;  5LBM A;  1D0Y A;  1YKE B;  3RPU A;  5JR9 B;  1UX4 A;  1IJ5 A;  2HPL A;  3I9W A;  3KVB A;  4ISS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...