2D2SA

Crystal structure of the exo84p c-terminal domains
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
229
structure length
217
Chain Sequence
DMSSTAQRLKFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSLMLLNLISLKIEQRREAISSKLSQSILSSNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIVDNPTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNLSPGSIKSSRKQIDGLKAVGLDFVYKLDEFIKKNSDKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords Exocyst complex component EXO84
publication title The structures of exocyst subunit Exo70p and the Exo84p C-terminal domains reveal a common motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 91
structure length 217
sequence length 229
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16528 Exo84_C Exocyst component 84 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA01
1.20.58.1220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA02
2D2SA
chains in the Genus database with same CATH superfamily
3ZN0B 3LFMA 3FHNA 1J1JA 3LSVA 5FL0A 2JIWA 3PURA 5DJQC 1X9BA 1SA0E 2VVSA 1OEDC 3ZSTA 2QYWA 3FZKB 4NIQA 2X0YA 3C4XA 2X66A 3ZEFB 1NAFA 3EDVA 3RI5A 2W67A 2BS4A 1YW0A 4HWDA 3C50A 5AFUL 4DUZT 3LBXA 3OYZA 4YT0A 5F3JA 3M65A 4JI5T 1V9DA 2IHR1 4JYAT 2H7OA 4I43B 2B76A 2FJAA 2E9XA 2WS3A 2M6IA 4XZCA 2UXXB 3AVRA 1XDPA 4X62T 1B7TA 3UULA 2K3WA 2W0GA 2CXLA 3RRWA 5JRCA 3EABA 4TNVA 2L8KA 3QB5K 5J2UE 3N9NA 4EEBA 5L3FB 1MMNA 5FY0A 5CA0E 3U3IA 3I9YA 4ZOLE 5ADXL 2VASA 1HNWT 5FXZA 2KLQA 3FZLB 5LG3A 2LKGA 4OFZA 2XASB 2MTQA 3RIUA 2IAKA 3GN5B 3EDUA 3ONJA 5CB4E 3N2OA 2K48A 2IC6A 3ETVA 3G06A 3AA7B 3KV5A 2X0LB 3IA3A 1WR6A 3N9LA 3A5XA 2LHNA 4ILUA 2LT3A 4TWDA 3M3ZB 3N9PA 2HN2A 5AQJB 2WSSV 2V1DB 4BA9A 3P4WA 4NUVA 4ZI2C 4GKJT 5HEHA 3HKCE 3O1IA 5AQRB 1H7CA 4A97A 5A1LA 2LM2A 4QXCB 4OYKA 1HG2A 5LBMA 3ETUA 2QRXA 1HTJF 4O8SA 4EYYR 2X51A 1WCRA 3PTRB 4XAXB 3ZT5A 1XNRT 3AXJA 1ZV4X 1VCTA 4IDQA 4UR9A 4IIJE 2ZM0A 3P4RA 5ABHA 3P4QA 5FY1A 4QXHB 5JRCB 4DR5T 4UF0A 3UU3A 3ZMVB 1W09A 3V5UA 3CQGB 1E2AA 4GOUA 4YFSA 3VKGA 1UURA 4UVCB 3CK6A 2V7LA 1D1CA 3RQWA 2CBIA 3AE5A 1U5PA 2BG9B 2XQ9A 3Q5WA 2EHOA 3ZJ1A 4MBQA 4U2ZA 3RC8A 3C51A 2MYSA 4DV6T 2KNDA 2JMKA 4DMWA 3KV6A 1HG5A 4HFBA 2LRKA 4UIGA 2E5VA 4UVAB 4LF5T 1IZNB 1XMOT 4PJJA 3JCFA 4U7YA 2BKPA 2EHOD 1US7B 3J7Yq 2CM0A 1CUNA 4HKAA 1D0YA 3HL6A 1WYBA 3ONLC 2IDOB 3CQXC 2DL1A 2ZM8A 4U33A 4TUYE 3UFGA 2ZM6T 1JNRA 3MXZA 3UTKA 3SWHA 3UFEA 3L8RA 1N36T 3KVAA 1D0ZA 3N5LA 3QOFA 4L0RA 2JJ9A 4IT4A 3N2KE 1MMDA 1ZHCA 1NEKA 3ZLIA 3RQUA 5FVLA 2XUEA 4TN7B 4HFEA 1NWMX 5BMVE 2XSBA 4OYJA 2FBWA 4YSYA 3ZJ2A 2DWKA 3F31A 2J62A 2PJQA 5KXJA 5AQOB 4CXYA 4TZ4C 3AXJB 4DV2T 3K1SA 4UELA 2LLYA 3WI3A 2LRLA 4IGUA 5EK3A 5AQPB 3AEEA 3SOLA 2XM1A 2XTLA 5ETWA 2WU5A 5FXXA 2BS3A 4WZXA 3ZSSA 1M7KA 4CN4A 4IL4A 2EHOB 3NZPA 4X66T 3AE6A 2CLYB 3I1AA 3L09A 4JI0T 2E5LT 1D1BA 2V5DA 2LSKA 4ZHQE 3AA0B 3FBZA 3V5SA 3UT5E 3CX8B 3OYXA 3CX6B 4JV5T 2VWAA 2LM9A 4AKGA 3WAJA 2QVAA 3LG7A 1YQ4A 2M67A 3B13A 3VR8A 1IBMT 2LSJA 4AKHA 5LJMA 3KINB 2WZIA 2V5CA 4I0UA 2NTXA 2XPKA 2CMRA 3ZMTB 3GMIA 2N9DA 2LJLA 4DR7T 3ZT6A 1U4QA 4PK4A 5KX5E 4L9IA 2L3LA 5TAOA 3AEDA 1YD8G 1HR0T 2V26A 4CXXA 4IREA 3KVBA 4YTPA 2UUCT 3ZPOA 2XAQB 3H37A 2CEAA 2ZMAA 3ANWA 3J9X1 4F6RC 3OKQA 2LKHA 4YJ2E 1KF6A 2V7IA 2LOPA 5FKYA 4B3RT 3D0TA 4DMVA 4PW8A 2YU1A 4P1NA 1Y01A 2DCFA 2XQYA 2VVNA 4AIUA 4X1IE 4H9RC 1JNZA 5L2LA 4PK6A 2BKNA 1HNZT 1MIWA 1MNDA 3ZC1A 3NZQA 4NXMT 1MMAA 2QA7A 2XAJB 3I0OA 4HFCA 2FJBA 1W9RA 2WMNA 3Q5EA 3P7IA 5ABFA 1M62A 5AQTB 3O4XE 3ZT7A 3EUHA 3ESLA 3ZMSB 5LA6E 4CI2B 3U78A 1HCIA 5HXCA 3RYFE 4LMJA 4DV5T 2Q9QA 2X9HA 3JADA 1WR0A 2AE9A 3PUGA 1LVFA 2KINB 2Y8DA 3LDQB 2EHOC 4U7IA 2CLYC 2Q9QD 3FZMB 3CX7B 4KBMB 3AEAA 1SUMB 2OV9A 4YHJA 3AEFA 5LB7B 2WDRA 3IHRA 4EXTA 3HKBE 4AKLA 4OK0A 1OXZA 2K9AA 4E7SA 2C5IT 5EK4A 5HEGA 4H63V 2UXCT 3Q5DA 4WYVA 1HX8A 5HXEA 4WNKA 1T7SA 2VKDA 5HAXA 5L3EB 3K3NA 4UVBB 1XWMA 3HKEE 2X0HA 3OJAA 1T8BA 2W61A 2BVMA 3SS1A 4ZS2A 4IHJE 2X9WA 1D1AA 3IBPA 3BQIA 4DV7T 3GA8A 3NKZA 4EZ4A 5JQGE 3RIAA 4PFOA 2E8IA 2XJ7A 2VURA 3RYHE 2UUAT 4TV9E 4B3TT 2DLRA 5L4HA 4LMKA 1LVKA 4XBFB 2E9XD 3PE0A 1LRZA 2L9QA 2JPFA 3F2EA 2Q9QB 4Z91A 4ZI7E 2JQ9A 2NW9A 3NRXA 3KV9A 2WBLA 4ZZBA 3P50A 3DP7A 5HXRA 4AQFC 2KT9A 3LJCA 5DQVA 2Y48B 3N9QA 2XQ7A 5LJNA 2UXBT 4H9PC 4A56A 5HWXA 2D0TA 2HH7A 1J5ET 3FXDB 5CJ5A 5HYAA 3FZFB 4PJLA 2KSRA 5LMNT 2YDSA 5J0ZA 5JREA 2JRKA 1N34T 5AQVB 4IL9A 2XQAA 3UU8A 4GYRA 1ZOYA 3PJAJ 3L3PA 4GK5E 4ZXLA 4I4TE 3LK3B 4EEDA 3N9MA 4M1PA 5LHGB 2UXNB 5AQNB 3H3AA 4IDOA 4KUMB 2UXDT 3LBXB 5L4EA 1S94A 2NTYA 2E9XB 4CN1A 3ZCJA 2JQKA 2WCAA 1FMWA 2XQ8A 4DR4T 5HEJA 5LCYA 3ZKRA 3EVYA 1UGOA 4MHCA 2KXPB 4IDNA 4YSZA 3Q5XA 3TKLB 2IUBA 4ASKA 2P9BA 1YKEB 3PUVF 1UUSA 2F4VT 4N78D 1E7PA 2CE7A 3UQ4A 2XAFB 1VRBA 3UU4A 3AEBA 1IBKT 4AKRB 4TWFA 3GWHA 2KZ7B 2IC9A 3FZHB 1G73A 3AECA 5AQMB 3A8YC 3AEGA 1WFDA 2X9YA 4PJNA 2V6YA 3RF1A 3NBXX 4LFCT 1ZKEA 4DR6T 5LGTB 2V7JA 2B1EA 4TNWA 5FP3A 4HN9A 5C3JA 2MPKA 1IAPA 1UX4A 4LMLA 5AQSB 2NOXA 4LF4T 5F5WA 1BR4A 2J4GA 2OLTA 3DTOA 3UUNA 1VCSA 2LOSA 1FJGT 4GIWA 5LXTE 1OEDA 4UEMA 4CI1B 2KWHA 2Q9QC 1W0AA 5IYZE 4A5XA 1J5WA 3AB3B 2VL0A 4DR3T 5IUXA 4ZEYA 2ACXA 2XQ4A 4EB6E 3RPUA 3KDSE 3AAIA 5LGUB 2CHNA 4O4IE 4QHOA 1MNEA 4DV4T 1N33T 2DI4A 3P4PA 1E1HB 3QC9A 3AE9A 4AISA 3O1HA 2ZM2A 3TLWA 5IWAT 2A3DA 3ABVA 2XM2A 1DU2A 2IIUA 2W63A 4CQIA 4EV6A 2QGSA 3L39A 4V1Av 4QX8B 4UF0B 2D5UA 3JC6D 1I6ZA 4HFHA 4MLKA 4U3CA 4HE8A 5LG4A 3EHZA 4ERRA 4I55E 5L3DB 3AE4A 1FIOA 4H9QC 4AXPA 5L3CB 4HWCA 2E2AA 3UU5A 4HWHA 3C64A 4HEAA 1KEYA 4ZS3A 3PUXF 2JQHA 5FY7A 5JDGA 4O4LE 3RH3A 5LHIB 4HWIB 4LFAT 1T98A 2V6YB 4IE4A 5CGMA 5LHHB 2CPTA 4KI0F 2E9XC 4DIDB 4EZHA 5GONE 3RRCA 5AQFB 5LYJE 2X67A 5JR9A 4AQGA 3MJXA 4PK5A 3CWZB 4UXNB 4HFDA 2VK9A 3MA9A 4ISSA 5AQIB 5M4YA 4O2AE 1GQEA 3FB2A 5DQWA 4ADZA 1W0BA 2WDQA 5JTGA 2ACZA 2WWUA 3PUAA 1UCUA 1L0VA 4ISTA 4LF6T 5FMNA 2ES0A 2CA5A 4HGAA 2M6BA 2NP9A 4CI3B 1IJ6A 2IMLA 2A2FX 5IHYA 2C0SA 2LSGA 4QWNB 3RGLA 4J2CA 2I59A 3RIUC 1UK5A 2X9XA 3OTOT 3R84B 2CXFA 3QUJA 5E0OA 4ILAA 3Q9DA 2YN6A 4JI3T 4BJMA 3RLFF 1XZYA 2MOZA 4DVDA 3A7MA 5L47A 2XAHB 4JI2T 5BR8T 2WZHA 3JAEA 4KHZF 3WAKA 1BR2A 4IDPA 1G8XA 2HPJA 4OHFA 3ZYKA 3DJBA 4IE5A 2RA1A 4K0UA 2DWGA 2D0UA 5HEOA 2YDRA 4X65T 3AAAB 4YTMA 1XDOA 3Q2MA 1N32T 5H6RB 5JR9B 3VKHA 3E0ZA 4CZZB 3BK9A 3NWIA 4JUYA 4CXWA 3OBVE 3ZN1B 1BR0A 1HX1B 3K3QC 1SHZC 1IJ5A 1XMQT 1OEDE 2JQQA 2WQYA 5L3GB 2A9UA 2KWIB 3SFEA 2I0MA 2PG8A 3K8PC 3RYIE 1Z0PA 5JDNA 2G0UA 2VB6A 2N1GA 4H63H 5JVDE 3T1YT 2H88A 2W66A 3KBUA 2BVLA 3N9OA 4EGWA 4JBWF 2DNXA 4P0AA 4UV9B 3UUBA 3FBLA 2WU2A 4MALA 2PTFA 2A72A 3AA6B 3ANWB 3PUYF 2XSAA 4ZZCA 3T1HT 5EK2A 4AKIA 2V8SV 4P09A 5LP6E 3RIFA 4TV8E 2WDVA 4H9NC 4PJMA 4P0BA 3CIRA 2D9DA 1Z8UA 1KNPA 3KV4A 2VKJA 1OWAA 4KHPT 2W4XA 4DBRA 4BJNA 3ZC0A 2CWYA 3NRYA 3KFWX 4BAYB 1QUUA 4PFPA 3C98B 3PU8A 2CRBA 5JDMA 2FUPA 2W2UA 3HA4A 1WRDA 2WWVA 3JC6C 1O3XA 5ABFB 2AXDS 3AAEB 2NW7A 4DR2T 1FMVA 5FYMA 2CXDA 2C5KT 3FXEB 2Y6XA 5HXSA 3BQKA 4A98A 4HTEA 3C4WA 2UU9T 4WBOA 2LSYA 4QX7B 2CBJA 3IEEA 2YEVC 5HCJA 4NXNT 4DR1T 2BZBA 5AQHB 2CWOA 3AA1B 2NW8A 3VRBA 2CHOA 2H3RA 3QK6A 1D0XA 4QH1A 3ZMZB 2BG9A 4X1KE 3W15B 3AE2A 4ANJA 2WY2A 3I9WA 5H6QB 4G2AA 3OPCA 1HNXT 5DABA 5JR9C 3I0QA 4KX6A 4DUYT 3AE3A 2YK0A 3EI0A 3RKOA 3HKDE 2WM9A 3R6NA 3N2GE 4EIWA 2W62A 3UUMA 5FNVE 2Z6EA 4U31A 4EAHA 3RC3A 4C91A 4JLEA 5LBQB 3RHWA 1KK7A 1CHUA 1BR1A 3PUSA 4X5TA 2MAWA 2HN1A 3RKGA 4ZI3D 4WW0A 4IDZA 2OA5A 2ODVA 5CFBA 4EOZB 5FXWA 2YKSA 2R6GF 4DV0T 2LSIA 2VKHA 4HFVA 5ABEA 2GK9A 5HCMA 4IE7A 1HS7A 3E22E 4JI1T 4LF8T 3SRZA 3QNUA 3C4ZA 3F57A 4QH4A 1NENA 4GK0E 2XQ5A 2HPLA 4FJOA 1HF8A 4JI8T 3LK42 1MIVA 4B6XA 4LFBT 2C5JA 4O2BE 3VHLA 2K24A 4QKNA 5LOVE 5AQUB 1I94T 5KDMC 2N2NA 3PU3A 5HWYA 4DV1T 3MACA 1WYCA 4MFRA 1T72A 3B5MA 2LHRA 2X68A 4AI6A 3KBTA 1SE7A 4NPPA 3SFDA 5EZYE 5CA1E 3CMLA 3NVOA 5C2TA 2XAGB 5JDLA 4KMCA 2WB5A 4PNIA 4WBNE 4ILBA 3AE1A 5AQQB 3ONXA 4OX9T 4YTNA 3HI2A 4QXBB 1R8IA 2W00A 3MZKB 4U74A 4FI5A 3UQ7A 3AVSA 1AJ3A 1YXRA 1YQ3A 3P8CD 3HR0A 5FXVA 3CPZA 3H3MA 2BBHA 2V7MA 1S35A 2KMFA 3RYCE 4YLHA 1KNRA 4U2YA 5C8YE 2ODUA 1VOMA 3O9XA 3TLUA 4H9OC 3PUQA 2VKOA 2XQ6A 4QH5A 2PBIA 4IE6A 2RPAA 3PDYA 5AQKB 3LK2B 4TWHA 3VRAA 2FJEA 2YDQA 5AQGB 3EAMA 4COFA 3ZMUB 4F8HA 4O4HE 3CVRA 4U72A 3PUWF 4DNDA 1QSDA 3IF8B 4JI4T 3BQLA 3UU6A 2UUBT 2V7KA 2LE8A 3PV0F 4Z90A 1IBLT 4JI7T 4AQFA 4K0KT 1ZP0A 2YOEA 2VL8A 4NUUA 4X64T 1WLXA 3PJAA 4GYSA 2BG9E 3TLVA 4UV8B 2XY8B 2J47A 4KP3C 4JI6T 4CN6A 1QLBA 3CKDA 4YJ3E 2BKOA 1Y64B 2SPCA 5ABGA 4YXDA 1OEDB 4YHHT 4I50E 2JMHA 2FJDA 3OVUA 3TLTA 1UX5A 5FVKA 5FL1A 2WP9A 1MIYA 5LMUT 2BBJA 1X79A 3AE8A 4IE0A 5J2TE 5J1GA 2HHHT 4HWFA 4LF7T 2XHEB 3MK7C 3X1DA 2PFVA 1HFAA 4DV3T 4JEHB 2BG9C 5L3BB 2WMOA 3TLSA 2RP4A 4LF9T 3ZYMA 2H7VC 2I6HA 2BS2A 5KMGP 4B3ST 5F8PA 1ZEEA 4EYUA 2NR4A 3K3OA 4ZI2D 3CQCB 4ILCA 3AE7A 2MBGA 1LKXA 3MKDA 3O1JA 2XQ3A 3VU7H 5LGNB 5LNKA 2IW5B 2BDEA 4Q25A 4ZI3C 1FEWA 5AQLB 4L5GA 1YKHB 2H89A 4HFIA 5JH7E 2K5BB 3E08A 4DO0A 2VQET 4GKKT 4DBQA 2YINA 3P4SA 3PUZF 3UUXB 1MMGA 4G63A 4Z8XA 3RX6A 1KFYA 4E7ZA 2CCQA 2D2SA 5HXHA 5JDFA 4AQYT 3ZCIA 4H9SE 2DHRA 2ZLYA 5JDQA 4B3MT 2YU2A 4JEUB 3B57A 1KNZA 4YSXA 3VR9A 2J1DG 5JDHA 4C90A 4TX5A 3ZYLA 2XZEA 4O4JE 2VQFT 3S4UA 4YY3T 4X20E 3QB5A 2WAUA 1EZ3A 5HEUA 3T8OA 1XNQT 2LEHA 3JAFA 4PAGA 2V6XA 2NWBA 3GN5A 4X1YE
chains in the Genus database with same CATH topology
5TAOA 3ZN0B 3LFMA 3N2GE 3R6NA 4EIWA 2W62A 3FHNA 3UUMA 2ACXA 3PURA 1YD8G 5FNVE 4EB6E 3RPUA 5DJQC 1SA0E 3KDSE 2Z6EA 4EAHA 2V26A 3RC3A 4CXXA 4C91A 3AAIA 5LGUB 3KVBA 4JLEA 3ZPOA 5LBQB 4O4IE 1KK7A 2XAQB 1BR1A 3H37A 2CEAA 3C4XA 2X66A 3PUSA 4QHOA 1MNEA 2ZMAA 3ZEFB 3ANWA 3J9X1 4F6RC 1NAFA 3OKQA 4ZI3D 4YJ2E 2DI4A 3EDVA 3QC9A 1E1HB 4WW0A 3O1HA 2ZM2A 1YW0A 2V7IA 4IDZA 2LOPA 2A3DA 2OA5A 3C50A 2ODVA 4EOZB 5FXWA 2W63A 4CQIA 5AFUL 2QGSA 4V1Av 3D0TA 2LSIA 4DMVA 2VKHA 4QX8B 4HFVA 4PW8A 4UF0B 2YU1A 2GK9A 2D5UA 2DCFA 3JC6D 3LBXA 3OYZA 2XQYA 4IE7A 4MLKA 1HS7A 5F3JA 3E22E 3M65A 4HE8A 5LG4A 1V9DA 4X1IE 4ERRA 4I55E 5L3DB 1FIOA 4H9RC 2H7OA 4I43B 4H9QC 3SRZA 4AXPA 5L3CB 5L2LA 3C4ZA 3F57A 2E9XA 4PK6A 4GK0E 2HPLA 4XZCA 4FJOA 1HF8A 1MIWA 1MNDA 2UXXB 3AVRA 3ZC1A 3NZQA 3C64A 4HEAA 3LK42 1B7TA 1MIVA 4B6XA 3UULA 2C5JA 4O2BE 3VHLA 1MMAA 2K24A 4ZS3A 4QKNA 5LOVE 5FY7A 2QA7A 2W0GA 2XAJB 3I0OA 2CXLA 3RRWA 5JDGA 2N2NA 4O4LE 3RH3A 5KDMC 2WMNA 5LHIB 5JRCA 1T98A 3P7IA 3PU3A 5HWYA 4IE4A 3O4XE 2L8KA 3MACA 1WYCA 5J2UE 5LHHB 4MFRA 3EUHA 3N9NA 2E9XC 3ESLA 3ZMSB 4EZHA 5GONE 2LHRA 2X68A 3RRCA 4AI6A 5LA6E 4CI2B 3KBTA 3U78A 5LYJE 2X67A 5JR9A 1HCIA 5HXCA 4AQGA 5L3FB 3RYFE 3MJXA 1MMNA 4PK5A 3CWZB 4UXNB 5FY0A 5EZYE 5CA1E 2VK9A 2Q9QA 5CA0E 3U3IA 2X9HA 3I9YA 4ZOLE 5ADXL 3CMLA 3MA9A 2VASA 4ISSA 5M4YA 4O2AE 2XAGB 5JDLA 5FXZA 3FB2A 2KLQA 4KMCA 5DQWA 3PUGA 1LVFA 4ADZA 2KINB 4OFZA 2XASB 2Y8DA 2WWUA 4PNIA 4WBNE 2EHOC 2MTQA 3PUAA 2IAKA 1UCUA 3ONXA 2CLYC 2Q9QD 3GN5B 4ISTA 3EDUA 5FMNA 5CB4E 2ES0A 3HI2A 2CA5A 3CX7B 4QXBB 2W00A 3MZKB 3N2OA 4U74A 4FI5A 4HGAA 4KBMB 2K48A 2IC6A 2NP9A 3AVSA 4YHJA 4CI3B 1AJ3A 3ETVA 1IJ6A 3AA7B 3P8CD 3HR0A 5FXVA 3KV5A 3IHRA 3CPZA 2A2FX 4EXTA 2X0LB 5IHYA 1WR6A 2C0SA 2V7MA 3HKBE 3N9LA 4AKLA 3A5XA 2LSGA 4QWNB 1S35A 4J2CA 2KMFA 4OK0A 4YLHA 2I59A 3RYCE 1OXZA 2K9AA 2LHNA 4ILUA 2LT3A 4E7SA 2C5IT 5EK4A 2X9XA 3N9PA 5C8YE 2ODUA 1VOMA 4H63V 3O9XA 3R84B 2CXFA 4H9OC 3PUQA 2WSSV 2VKOA 3QUJA 2V1DB 5E0OA 4BA9A 1HX8A 5HXEA 3Q9DA 2PBIA 4NUVA 4ZI2C 4IE6A 4WNKA 3PDYA 3HKCE 2VKDA 3O1IA 3LK2B 4BJMA 1H7CA 5A1LA 5HAXA 4QXCB 2MOZA 4OYKA 5L3EB 3ZMUB 4DVDA 3K3NA 4UVBB 1HG2A 3HKEE 4O4HE 3CVRA 4U72A 2XAHB 3OJAA 5LBMA 3ETUA 1HTJF 4O8SA 3WAKA 4EYYR 2X51A 4DNDA 2W61A 1BR2A 3PTRB 4XAXB 1QSDA 2BVMA 1ZV4X 1G8XA 2HPJA 3IF8B 4OHFA 3SS1A 3ZYKA 3BQLA 3DJBA 4IE5A 4ZS2A 4IHJE 2X9WA 2RA1A 2V7KA 4IIJE 2ZM0A 4K0UA 1D1AA 3IBPA 2DWGA 2D0UA 3BQIA 5FY1A 2LE8A 4QXHB 3AAAB 5JRCB 3GA8A 4EZ4A 4UF0A 5JQGE 3ZMVB 4PFOA 2E8IA 3RYHE 3V5UA 3CQGB 4AQFA 4GOUA 4YFSA 3VKGA 3Q2MA 4TV9E 2VL8A 2DLRA 4NUUA 1LVKA 4XBFB 1WLXA 5H6RB 2E9XD 3PE0A 4UVCB 5JR9B 4GYSA 1LRZA 2V7LA 3VKHA 1D1CA 2L9QA 2JPFA 3E0ZA 4UV8B 3F2EA 4CZZB 1U5PA 3BK9A 2Q9QB 3Q5WA 2EHOA 3ZJ1A 4JUYA 4CXWA 4KP3C 4ZI7E 2NW9A 4MBQA 3NRXA 3RC8A 3KV9A 2WBLA 3C51A 2MYSA 3CKDA 4YJ3E 3OBVE 3ZN1B 1BR0A 3DP7A 3K3QC 5HXRA 1SHZC 2KNDA 4AQFC 2JMKA 1Y64B 4DMWA 3KV6A 2SPCA 1IJ5A 1HG5A 4UIGA 2KT9A 4UVAB 3LJCA 1IZNB 5DQVA 2Y48B 4PJJA 4I50E 2JMHA 3N9QA 2JQQA 1UX5A 5LJNA 2EHOD 4H9PC 1US7B 4A56A 5L3GB 3J7Yq 5HWXA 2D0TA 2HH7A 2CM0A 1CUNA 1MIYA 4HKAA 3FXDB 5HYAA 2KWIB 1D0YA 3HL6A 4PJLA 3RYIE 2PG8A 1WYBA 3K8PC 5JREA 1X79A 2JRKA 1Z0PA 4IE0A 5JDNA 3CQXC 2G0UA 2VB6A 4L9IA 2N1GA 2ZM8A 4H63H 5J1GA 5JVDE 5J2TE 4TUYE 2XHEB 3KBUA 3MK7C 2BVLA 3N9OA 4GYRA 3MXZA 3L3PA 3UTKA 3SWHA 2PFVA 1HFAA 2DNXA 4P0AA 4JEHB 4UV9B 3UFEA 3FBLA 5L3BB 4GK5E 2WMOA 4MALA 3KVAA 2A72A 1D0ZA 3AA6B 2RP4A 3ANWB 3N5LA 3ZYMA 2H7VC 4L0RA 5KMGP 4I4TE 5F8PA 3LK3B 2JJ9A 1ZEEA 5EK2A 4EYUA 3N2KE 4AKIA 3K3OA 4ZI2D 1MMDA 1ZHCA 3CQCB 3ZLIA 2MBGA 4P09A 5LP6E 4TV8E 3N9MA 1LKXA 2XUEA 4M1PA 5LHGB 2UXNB 4H9NC 3MKDA 4TN7B 4PJMA 3H3AA 3O1JA 1NWMX 4P0BA 4KUMB 3VU7H 5BMVE 5LGNB 3LBXB 3KV4A 4OYJA 2VKJA 5LNKA 3ZJ2A 1OWAA 2DWKA 3F31A 1S94A 4DBRA 2PJQA 4BJNA 2IW5B 4CXYA 2BDEA 4TZ4C 3ZC0A 4ZI3C 2L3LA 2NTYA 4UELA 1FEWA 2CWYA 3NRYA 3KFWX 2E9XB 4L5GA 4BAYB 1QUUA 4PFPA 3ZCJA 3C98B 1FMWA 1YKHB 3PU8A 3WI3A 4IGUA 5LCYA 5JH7E 5EK3A 3EVYA 5JDMA 2K5BB 4MHCA 2KXPB 3HA4A 1WRDA 3Q5XA 3SOLA 3E08A 3JC6C 1O3XA 2XTLA 5ETWA 4DO0A 3TKLB 5FXXA 3AAEB 4ASKA 2P9BA 1YKEB 2NW7A 1FMVA 5FYMA 4DBQA 2CXDA 2YINA 3UUXB 1MMGA 4N78D 2C5KT 4G63A 2CE7A 3FXEB 4Z8XA 2EHOB 2Y6XA 3NZPA 3RX6A 5HXSA 2CLYB 3BQKA 2XAFB 1VRBA 4HTEA 3C4WA 4WBOA 4E7ZA 2CCQA 2D2SA 2LSYA 3I1AA 3L09A 5HXHA 1D1BA 4QX7B 4AKRB 5JDFA 3IEEA 3ZCIA 2LSKA 2YEVC 4H9SE 4ZHQE 2DHRA 2ZLYA 3GWHA 2KZ7B 2IC9A 3AA0B 1G73A 3FBZA 3V5SA 2BZBA 5JDQA 3UT5E 2YU2A 4JEUB 2X9YA 4PJNA 2CWOA 3AA1B 3CX8B 3B57A 3OYXA 2NW8A 2H3RA 3CX6B 3NBXX 3QK6A 1ZKEA 2VWAA 1KNZA 1D0XA 5LGTB 2LM9A 2V7JA 3ZMZB 2B1EA 2J1DG 4AKGA 5JDHA 3WAJA 5FP3A 4C90A 4TX5A 4X1KE 4HN9A 3LG7A 3ZYLA 1IAPA 1UX4A 4O4JE 3W15B 3S4UA 4ANJA 2NOXA 2M67A 1BR4A 3B13A 3DTOA 3I9WA 5H6QB 4G2AA 3UUNA 2LOSA 4GIWA 2LSJA 4AKHA 5LXTE 5LJMA 3KINB 4X20E 2NTXA 2CMRA 3ZMTB 3GMIA 2N9DA 1EZ3A 2WAUA 4UEMA 5DABA 3T8OA 5JR9C 2LJLA 3I0QA 4CI1B 2KWHA 2LEHA 2Q9QC 2YK0A 1U4QA 5IYZE 4PAGA 4PK4A 5KX5E 2NWBA 3GN5A 3RKOA 3HKDE 3AB3B 4X1YE 2WM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2S A; 
#chains in the Genus database with same CATH topology
 3ZN0 B;  3LFM A;  3FHN A;  1J1J A;  3LSV A;  5FL0 A;  2JIW A;  3PUR A;  5DJQ C;  1X9B A;  1SA0 E;  2VVS A;  1OED C;  3ZST A;  2QYW A;  3FZK B;  4NIQ A;  2X0Y A;  3C4X A;  2X66 A;  3ZEF B;  1NAF A;  3EDV A;  3RI5 A;  2W67 A;  2BS4 A;  1YW0 A;  4HWD A;  3C50 A;  5AFU L;  4DUZ T;  3LBX A;  3OYZ A;  4YT0 A;  5F3J A;  3M65 A;  4JI5 T;  1V9D A;  2IHR 1;  4JYA T;  2H7O A;  4I43 B;  2B76 A;  2FJA A;  2E9X A;  2WS3 A;  2M6I A;  4XZC A;  2UXX B;  3AVR A;  1XDP A;  4X62 T;  1B7T A;  3UUL A;  2K3W A;  2W0G A;  2CXL A;  3RRW A;  5JRC A;  3EAB A;  4TNV A;  2L8K A;  3QB5 K;  5J2U E;  3N9N A;  4EEB A;  5L3F B;  1MMN A;  5FY0 A;  5CA0 E;  3U3I A;  3I9Y A;  4ZOL E;  5ADX L;  2VAS A;  1HNW T;  5FXZ A;  2KLQ A;  3FZL B;  5LG3 A;  2LKG A;  4OFZ A;  2XAS B;  2MTQ A;  3RIU A;  2IAK A;  3GN5 B;  3EDU A;  3ONJ A;  5CB4 E;  3N2O A;  2K48 A;  2IC6 A;  3ETV A;  3G06 A;  3AA7 B;  3KV5 A;  2X0L B;  3IA3 A;  1WR6 A;  3N9L A;  3A5X A;  2LHN A;  4ILU A;  2LT3 A;  4TWD A;  3M3Z B;  3N9P A;  2HN2 A;  5AQJ B;  2WSS V;  2V1D B;  4BA9 A;  3P4W A;  4NUV A;  4ZI2 C;  4GKJ T;  5HEH A;  3HKC E;  3O1I A;  5AQR B;  1H7C A;  4A97 A;  5A1L A;  2LM2 A;  4QXC B;  4OYK A;  1HG2 A;  5LBM A;  3ETU A;  2QRX A;  1HTJ F;  4O8S A;  4EYY R;  2X51 A;  1WCR A;  3PTR B;  4XAX B;  3ZT5 A;  1XNR T;  3AXJ A;  1ZV4 X;  1VCT A;  4IDQ A;  4UR9 A;  4IIJ E;  2ZM0 A;  3P4R A;  5ABH A;  3P4Q A;  5FY1 A;  4QXH B;  5JRC B;  4DR5 T;  4UF0 A;  3UU3 A;  3ZMV B;  1W09 A;  3V5U A;  3CQG B;  1E2A A;  4GOU A;  4YFS A;  3VKG A;  1UUR A;  4UVC B;  3CK6 A;  2V7L A;  1D1C A;  3RQW A;  2CBI A;  3AE5 A;  1U5P A;  2BG9 B;  2XQ9 A;  3Q5W A;  2EHO A;  3ZJ1 A;  4MBQ A;  4U2Z A;  3RC8 A;  3C51 A;  2MYS A;  4DV6 T;  2KND A;  2JMK A;  4DMW A;  3KV6 A;  1HG5 A;  4HFB A;  2LRK A;  4UIG A;  2E5V A;  4UVA B;  4LF5 T;  1IZN B;  1XMO T;  4PJJ A;  3JCF A;  4U7Y A;  2BKP A;  2EHO D;  1US7 B;  3J7Y q;  2CM0 A;  1CUN A;  4HKA A;  1D0Y A;  3HL6 A;  1WYB A;  3ONL C;  2IDO B;  3CQX C;  2DL1 A;  2ZM8 A;  4U33 A;  4TUY E;  3UFG A;  2ZM6 T;  1JNR A;  3MXZ A;  3UTK A;  3SWH A;  3UFE A;  3L8R A;  1N36 T;  3KVA A;  1D0Z A;  3N5L A;  3QOF A;  4L0R A;  2JJ9 A;  4IT4 A;  3N2K E;  1MMD A;  1ZHC A;  1NEK A;  3ZLI A;  3RQU A;  5FVL A;  2XUE A;  4TN7 B;  4HFE A;  1NWM X;  5BMV E;  2XSB A;  4OYJ A;  2FBW A;  4YSY A;  3ZJ2 A;  2DWK A;  3F31 A;  2J62 A;  2PJQ A;  5KXJ A;  5AQO B;  4CXY A;  4TZ4 C;  3AXJ B;  4DV2 T;  3K1S A;  4UEL A;  2LLY A;  3WI3 A;  2LRL A;  4IGU A;  5EK3 A;  5AQP B;  3AEE A;  3SOL A;  2XM1 A;  2XTL A;  5ETW A;  2WU5 A;  5FXX A;  2BS3 A;  4WZX A;  3ZSS A;  1M7K A;  4CN4 A;  4IL4 A;  2EHO B;  3NZP A;  4X66 T;  3AE6 A;  2CLY B;  3I1A A;  3L09 A;  4JI0 T;  2E5L T;  1D1B A;  2V5D A;  2LSK A;  4ZHQ E;  3AA0 B;  3FBZ A;  3V5S A;  3UT5 E;  3CX8 B;  3OYX A;  3CX6 B;  4JV5 T;  2VWA A;  2LM9 A;  4AKG A;  3WAJ A;  2QVA A;  3LG7 A;  1YQ4 A;  2M67 A;  3B13 A;  3VR8 A;  1IBM T;  2LSJ A;  4AKH A;  5LJM A;  3KIN B;  2WZI A;  2V5C A;  4I0U A;  2NTX A;  2XPK A;  2CMR A;  3ZMT B;  3GMI A;  2N9D A;  2LJL A;  4DR7 T;  3ZT6 A;  1U4Q A;  4PK4 A;  5KX5 E;  4L9I A;  2L3L A;  5TAO A;  3AED A;  1YD8 G;  1HR0 T;  2V26 A;  4CXX A;  4IRE A;  3KVB A;  4YTP A;  2UUC T;  3ZPO A;  2XAQ B;  3H37 A;  2CEA A;  2ZMA A;  3ANW A;  3J9X 1;  4F6R C;  3OKQ A;  2LKH A;  4YJ2 E;  1KF6 A;  2V7I A;  2LOP A;  5FKY A;  4B3R T;  3D0T A;  4DMV A;  4PW8 A;  2YU1 A;  4P1N A;  1Y01 A;  2DCF A;  2XQY A;  2VVN A;  4AIU A;  4X1I E;  4H9R C;  1JNZ A;  5L2L A;  4PK6 A;  2BKN A;  1HNZ T;  1MIW A;  1MND A;  3ZC1 A;  3NZQ A;  4NXM T;  1MMA A;  2QA7 A;  2XAJ B;  3I0O A;  4HFC A;  2FJB A;  1W9R A;  2WMN A;  3Q5E A;  3P7I A;  5ABF A;  1M62 A;  5AQT B;  3O4X E;  3ZT7 A;  3EUH A;  3ESL A;  3ZMS B;  5LA6 E;  4CI2 B;  3U78 A;  1HCI A;  5HXC A;  3RYF E;  4LMJ A;  4DV5 T;  2Q9Q A;  2X9H A;  3JAD A;  1WR0 A;  2AE9 A;  3PUG A;  1LVF A;  2KIN B;  2Y8D A;  3LDQ B;  2EHO C;  4U7I A;  2CLY C;  2Q9Q D;  3FZM B;  3CX7 B;  4KBM B;  3AEA A;  1SUM B;  2OV9 A;  4YHJ A;  3AEF A;  5LB7 B;  2WDR A;  3IHR A;  4EXT A;  3HKB E;  4AKL A;  4OK0 A;  1OXZ A;  2K9A A;  4E7S A;  2C5I T;  5EK4 A;  5HEG A;  4H63 V;  2UXC T;  3Q5D A;  4WYV A;  1HX8 A;  5HXE A;  4WNK A;  1T7S A;  2VKD A;  5HAX A;  5L3E B;  3K3N A;  4UVB B;  1XWM A;  3HKE E;  2X0H A;  3OJA A;  1T8B A;  2W61 A;  2BVM A;  3SS1 A;  4ZS2 A;  4IHJ E;  2X9W A;  1D1A A;  3IBP A;  3BQI A;  4DV7 T;  3GA8 A;  3NKZ A;  4EZ4 A;  5JQG E;  3RIA A;  4PFO A;  2E8I A;  2XJ7 A;  2VUR A;  3RYH E;  2UUA T;  4TV9 E;  4B3T T;  2DLR A;  5L4H A;  4LMK A;  1LVK A;  4XBF B;  2E9X D;  3PE0 A;  1LRZ A;  2L9Q A;  2JPF A;  3F2E A;  2Q9Q B;  4Z91 A;  4ZI7 E;  2JQ9 A;  2NW9 A;  3NRX A;  3KV9 A;  2WBL A;  4ZZB A;  3P50 A;  3DP7 A;  5HXR A;  4AQF C;  2KT9 A;  3LJC A;  5DQV A;  2Y48 B;  3N9Q A;  2XQ7 A;  5LJN A;  2UXB T;  4H9P C;  4A56 A;  5HWX A;  2D0T A;  2HH7 A;  1J5E T;  3FXD B;  5CJ5 A;  5HYA A;  3FZF B;  4PJL A;  2KSR A;  5LMN T;  2YDS A;  5J0Z A;  5JRE A;  2JRK A;  1N34 T;  5AQV B;  4IL9 A;  2XQA A;  3UU8 A;  4GYR A;  1ZOY A;  3PJA J;  3L3P A;  4GK5 E;  4ZXL A;  4I4T E;  3LK3 B;  4EED A;  3N9M A;  4M1P A;  5LHG B;  2UXN B;  5AQN B;  3H3A A;  4IDO A;  4KUM B;  2UXD T;  3LBX B;  5L4E A;  1S94 A;  2NTY A;  2E9X B;  4CN1 A;  3ZCJ A;  2JQK A;  2WCA A;  1FMW A;  2XQ8 A;  4DR4 T;  5HEJ A;  5LCY A;  3ZKR A;  3EVY A;  1UGO A;  4MHC A;  2KXP B;  4IDN A;  4YSZ A;  3Q5X A;  3TKL B;  2IUB A;  4ASK A;  2P9B A;  1YKE B;  3PUV F;  1UUS A;  2F4V T;  4N78 D;  1E7P A;  2CE7 A;  3UQ4 A;  2XAF B;  1VRB A;  3UU4 A;  3AEB A;  1IBK T;  4AKR B;  4TWF A;  3GWH A;  2KZ7 B;  2IC9 A;  3FZH B;  1G73 A;  3AEC A;  5AQM B;  3A8Y C;  3AEG A;  1WFD A;  2X9Y A;  4PJN A;  2V6Y A;  3RF1 A;  3NBX X;  4LFC T;  1ZKE A;  4DR6 T;  5LGT B;  2V7J A;  2B1E A;  4TNW A;  5FP3 A;  4HN9 A;  5C3J A;  2MPK A;  1IAP A;  1UX4 A;  4LML A;  5AQS B;  2NOX A;  4LF4 T;  5F5W A;  1BR4 A;  2J4G A;  2OLT A;  3DTO A;  3UUN A;  1VCS A;  2LOS A;  1FJG T;  4GIW A;  5LXT E;  1OED A;  4UEM A;  4CI1 B;  2KWH A;  2Q9Q C;  1W0A A;  5IYZ E;  4A5X A;  1J5W A;  3AB3 B;  2VL0 A;  4DR3 T;  5IUX A;  4ZEY A;  2ACX A;  2XQ4 A;  4EB6 E;  3RPU A;  3KDS E;  3AAI A;  5LGU B;  2CHN A;  4O4I E;  4QHO A;  1MNE A;  4DV4 T;  1N33 T;  2DI4 A;  3P4P A;  1E1H B;  3QC9 A;  3AE9 A;  4AIS A;  3O1H A;  2ZM2 A;  3TLW A;  5IWA T;  2A3D A;  3ABV A;  2XM2 A;  1DU2 A;  2IIU A;  2W63 A;  4CQI A;  4EV6 A;  2QGS A;  3L39 A;  4V1A v;  4QX8 B;  4UF0 B;  2D5U A;  3JC6 D;  1I6Z A;  4HFH A;  4MLK A;  4U3C A;  4HE8 A;  5LG4 A;  3EHZ A;  4ERR A;  4I55 E;  5L3D B;  3AE4 A;  1FIO A;  4H9Q C;  4AXP A;  5L3C B;  4HWC A;  2E2A A;  3UU5 A;  4HWH A;  3C64 A;  4HEA A;  1KEY A;  4ZS3 A;  3PUX F;  2JQH A;  5FY7 A;  5JDG A;  4O4L E;  3RH3 A;  5LHI B;  4HWI B;  4LFA T;  1T98 A;  2V6Y B;  4IE4 A;  5CGM A;  5LHH B;  2CPT A;  4KI0 F;  2E9X C;  4DID B;  4EZH A;  5GON E;  3RRC A;  5AQF B;  5LYJ E;  2X67 A;  5JR9 A;  4AQG A;  3MJX A;  4PK5 A;  3CWZ B;  4UXN B;  4HFD A;  2VK9 A;  3MA9 A;  4ISS A;  5AQI B;  5M4Y A;  4O2A E;  1GQE A;  3FB2 A;  5DQW A;  4ADZ A;  1W0B A;  2WDQ A;  5JTG A;  2ACZ A;  2WWU A;  3PUA A;  1UCU A;  1L0V A;  4IST A;  4LF6 T;  5FMN A;  2ES0 A;  2CA5 A;  4HGA A;  2M6B A;  2NP9 A;  4CI3 B;  1IJ6 A;  2IML A;  2A2F X;  5IHY A;  2C0S A;  2LSG A;  4QWN B;  3RGL A;  4J2C A;  2I59 A;  3RIU C;  1UK5 A;  2X9X A;  3OTO T;  3R84 B;  2CXF A;  3QUJ A;  5E0O A;  4ILA A;  3Q9D A;  2YN6 A;  4JI3 T;  4BJM A;  3RLF F;  1XZY A;  2MOZ A;  4DVD A;  3A7M A;  5L47 A;  2XAH B;  4JI2 T;  5BR8 T;  2WZH A;  3JAE A;  4KHZ F;  3WAK A;  1BR2 A;  4IDP A;  1G8X A;  2HPJ A;  4OHF A;  3ZYK A;  3DJB A;  4IE5 A;  2RA1 A;  4K0U A;  2DWG A;  2D0U A;  5HEO A;  2YDR A;  4X65 T;  3AAA B;  4YTM A;  1XDO A;  3Q2M A;  1N32 T;  5H6R B;  5JR9 B;  3VKH A;  3E0Z A;  4CZZ B;  3BK9 A;  3NWI A;  4JUY A;  4CXW A;  3OBV E;  3ZN1 B;  1BR0 A;  1HX1 B;  3K3Q C;  1SHZ C;  1IJ5 A;  1XMQ T;  1OED E;  2JQQ A;  2WQY A;  5L3G B;  2A9U A;  2KWI B;  3SFE A;  2I0M A;  2PG8 A;  3K8P C;  3RYI E;  1Z0P A;  5JDN A;  2G0U A;  2VB6 A;  2N1G A;  4H63 H;  5JVD E;  3T1Y T;  2H88 A;  2W66 A;  3KBU A;  2BVL A;  3N9O A;  4EGW A;  4JBW F;  2DNX A;  4P0A A;  4UV9 B;  3UUB A;  3FBL A;  2WU2 A;  4MAL A;  2PTF A;  2A72 A;  3AA6 B;  3ANW B;  3PUY F;  2XSA A;  4ZZC A;  3T1H T;  5EK2 A;  4AKI A;  2V8S V;  4P09 A;  5LP6 E;  3RIF A;  4TV8 E;  2WDV A;  4H9N C;  4PJM A;  4P0B A;  3CIR A;  2D9D A;  1Z8U A;  1KNP A;  3KV4 A;  2VKJ A;  1OWA A;  4KHP T;  2W4X A;  4DBR A;  4BJN A;  3ZC0 A;  2CWY A;  3NRY A;  3KFW X;  4BAY B;  1QUU A;  4PFP A;  3C98 B;  3PU8 A;  2CRB A;  5JDM A;  2FUP A;  2W2U A;  3HA4 A;  1WRD A;  2WWV A;  3JC6 C;  1O3X A;  5ABF B;  2AXD S;  3AAE B;  2NW7 A;  4DR2 T;  1FMV A;  5FYM A;  2CXD A;  2C5K T;  3FXE B;  2Y6X A;  5HXS A;  3BQK A;  4A98 A;  4HTE A;  3C4W A;  2UU9 T;  4WBO A;  2LSY A;  4QX7 B;  2CBJ A;  3IEE A;  2YEV C;  5HCJ A;  4NXN T;  4DR1 T;  2BZB A;  5AQH B;  2CWO A;  3AA1 B;  2NW8 A;  3VRB A;  2CHO A;  2H3R A;  3QK6 A;  1D0X A;  4QH1 A;  3ZMZ B;  2BG9 A;  4X1K E;  3W15 B;  3AE2 A;  4ANJ A;  2WY2 A;  3I9W A;  5H6Q B;  4G2A A;  3OPC A;  1HNX T;  5DAB A;  5JR9 C;  3I0Q A;  4KX6 A;  4DUY T;  3AE3 A;  2YK0 A;  3EI0 A;  3RKO A;  3HKD E;  2WM9 A;  3R6N A;  3N2G E;  4EIW A;  2W62 A;  3UUM A;  5FNV E;  2Z6E A;  4U31 A;  4EAH A;  3RC3 A;  4C91 A;  4JLE A;  5LBQ B;  3RHW A;  1KK7 A;  1CHU A;  1BR1 A;  3PUS A;  4X5T A;  2MAW A;  2HN1 A;  3RKG A;  4ZI3 D;  4WW0 A;  4IDZ A;  2OA5 A;  2ODV A;  5CFB A;  4EOZ B;  5FXW A;  2YKS A;  2R6G F;  4DV0 T;  2LSI A;  2VKH A;  4HFV A;  5ABE A;  2GK9 A;  5HCM A;  4IE7 A;  1HS7 A;  3E22 E;  4JI1 T;  4LF8 T;  3SRZ A;  3QNU A;  3C4Z A;  3F57 A;  4QH4 A;  1NEN A;  4GK0 E;  2XQ5 A;  2HPL A;  4FJO A;  1HF8 A;  4JI8 T;  3LK4 2;  1MIV A;  4B6X A;  4LFB T;  2C5J A;  4O2B E;  3VHL A;  2K24 A;  4QKN A;  5LOV E;  5AQU B;  1I94 T;  5KDM C;  2N2N A;  3PU3 A;  5HWY A;  4DV1 T;  3MAC A;  1WYC A;  4MFR A;  1T72 A;  3B5M A;  2LHR A;  2X68 A;  4AI6 A;  3KBT A;  1SE7 A;  4NPP A;  3SFD A;  5EZY E;  5CA1 E;  3CML A;  3NVO A;  5C2T A;  2XAG B;  5JDL A;  4KMC A;  2WB5 A;  4PNI A;  4WBN E;  4ILB A;  3AE1 A;  5AQQ B;  3ONX A;  4OX9 T;  4YTN A;  3HI2 A;  4QXB B;  1R8I A;  2W00 A;  3MZK B;  4U74 A;  4FI5 A;  3UQ7 A;  3AVS A;  1AJ3 A;  1YXR A;  1YQ3 A;  3P8C D;  3HR0 A;  5FXV A;  3CPZ A;  3H3M A;  2BBH A;  2V7M A;  1S35 A;  2KMF A;  3RYC E;  4YLH A;  1KNR A;  4U2Y A;  5C8Y E;  2ODU A;  1VOM A;  3O9X A;  3TLU A;  4H9O C;  3PUQ A;  2VKO A;  2XQ6 A;  4QH5 A;  2PBI A;  4IE6 A;  2RPA A;  3PDY A;  5AQK B;  3LK2 B;  4TWH A;  3VRA A;  2FJE A;  2YDQ A;  5AQG B;  3EAM A;  4COF A;  3ZMU B;  4F8H A;  4O4H E;  3CVR A;  4U72 A;  3PUW F;  4DND A;  1QSD A;  3IF8 B;  4JI4 T;  3BQL A;  3UU6 A;  2UUB T;  2V7K A;  2LE8 A;  3PV0 F;  4Z90 A;  1IBL T;  4JI7 T;  4AQF A;  4K0K T;  1ZP0 A;  2YOE A;  2VL8 A;  4NUU A;  4X64 T;  1WLX A;  3PJA A;  4GYS A;  2BG9 E;  3TLV A;  4UV8 B;  2XY8 B;  2J47 A;  4KP3 C;  4JI6 T;  4CN6 A;  1QLB A;  3CKD A;  4YJ3 E;  2BKO A;  1Y64 B;  2SPC A;  5ABG A;  4YXD A;  1OED B;  4YHH T;  4I50 E;  2JMH A;  2FJD A;  3OVU A;  3TLT A;  1UX5 A;  5FVK A;  5FL1 A;  2WP9 A;  1MIY A;  5LMU T;  2BBJ A;  1X79 A;  3AE8 A;  4IE0 A;  5J2T E;  5J1G A;  2HHH T;  4HWF A;  4LF7 T;  2XHE B;  3MK7 C;  3X1D A;  2PFV A;  1HFA A;  4DV3 T;  4JEH B;  2BG9 C;  5L3B B;  2WMO A;  3TLS A;  2RP4 A;  4LF9 T;  3ZYM A;  2H7V C;  2I6H A;  2BS2 A;  5KMG P;  4B3S T;  5F8P A;  1ZEE A;  4EYU A;  2NR4 A;  3K3O A;  4ZI2 D;  3CQC B;  4ILC A;  3AE7 A;  2MBG A;  1LKX A;  3MKD A;  3O1J A;  2XQ3 A;  3VU7 H;  5LGN B;  5LNK A;  2IW5 B;  2BDE A;  4Q25 A;  4ZI3 C;  1FEW A;  5AQL B;  4L5G A;  1YKH B;  2H89 A;  4HFI A;  5JH7 E;  2K5B B;  3E08 A;  4DO0 A;  2VQE T;  4GKK T;  4DBQ A;  2YIN A;  3P4S A;  3PUZ F;  3UUX B;  1MMG A;  4G63 A;  4Z8X A;  3RX6 A;  1KFY A;  4E7Z A;  2CCQ A;  2D2S A;  5HXH A;  5JDF A;  4AQY T;  3ZCI A;  4H9S E;  2DHR A;  2ZLY A;  5JDQ A;  4B3M T;  2YU2 A;  4JEU B;  3B57 A;  1KNZ A;  4YSX A;  3VR9 A;  2J1D G;  5JDH A;  4C90 A;  4TX5 A;  3ZYL A;  2XZE A;  4O4J E;  2VQF T;  3S4U A;  4YY3 T;  4X20 E;  3QB5 A;  2WAU A;  1EZ3 A;  5HEU A;  3T8O A;  1XNQ T;  2LEH A;  3JAF A;  4PAG A;  2V6X A;  2NWB A;  3GN5 A;  4X1Y E; 
#chains in the Genus database with same CATH homology
 5TAO A;  3ZN0 B;  3LFM A;  3N2G E;  3R6N A;  4EIW A;  2W62 A;  3FHN A;  3UUM A;  2ACX A;  3PUR A;  1YD8 G;  5FNV E;  4EB6 E;  3RPU A;  5DJQ C;  1SA0 E;  3KDS E;  2Z6E A;  4EAH A;  2V26 A;  3RC3 A;  4CXX A;  4C91 A;  3AAI A;  5LGU B;  3KVB A;  4JLE A;  3ZPO A;  5LBQ B;  4O4I E;  1KK7 A;  2XAQ B;  1BR1 A;  3H37 A;  2CEA A;  3C4X A;  2X66 A;  3PUS A;  4QHO A;  1MNE A;  2ZMA A;  3ZEF B;  3ANW A;  3J9X 1;  4F6R C;  1NAF A;  3OKQ A;  4ZI3 D;  4YJ2 E;  2DI4 A;  3EDV A;  3QC9 A;  1E1H B;  4WW0 A;  3O1H A;  2ZM2 A;  1YW0 A;  2V7I A;  4IDZ A;  2LOP A;  2A3D A;  2OA5 A;  3C50 A;  2ODV A;  4EOZ B;  5FXW A;  2W63 A;  4CQI A;  5AFU L;  2QGS A;  4V1A v;  3D0T A;  2LSI A;  4DMV A;  2VKH A;  4QX8 B;  4HFV A;  4PW8 A;  4UF0 B;  2YU1 A;  2GK9 A;  2D5U A;  2DCF A;  3JC6 D;  3LBX A;  3OYZ A;  2XQY A;  4IE7 A;  4MLK A;  1HS7 A;  5F3J A;  3E22 E;  3M65 A;  4HE8 A;  5LG4 A;  1V9D A;  4X1I E;  4ERR A;  4I55 E;  5L3D B;  1FIO A;  4H9R C;  2H7O A;  4I43 B;  4H9Q C;  3SRZ A;  4AXP A;  5L3C B;  5L2L A;  3C4Z A;  3F57 A;  2E9X A;  4PK6 A;  4GK0 E;  2HPL A;  4XZC A;  4FJO A;  1HF8 A;  1MIW A;  1MND A;  2UXX B;  3AVR A;  3ZC1 A;  3NZQ A;  3C64 A;  4HEA A;  3LK4 2;  1B7T A;  1MIV A;  4B6X A;  3UUL A;  2C5J A;  4O2B E;  3VHL A;  1MMA A;  2K24 A;  4ZS3 A;  4QKN A;  5LOV E;  5FY7 A;  2QA7 A;  2W0G A;  2XAJ B;  3I0O A;  2CXL A;  3RRW A;  5JDG A;  2N2N A;  4O4L E;  3RH3 A;  5KDM C;  2WMN A;  5LHI B;  5JRC A;  1T98 A;  3P7I A;  3PU3 A;  5HWY A;  4IE4 A;  3O4X E;  2L8K A;  3MAC A;  1WYC A;  5J2U E;  5LHH B;  4MFR A;  3EUH A;  3N9N A;  2E9X C;  3ESL A;  3ZMS B;  4EZH A;  5GON E;  2LHR A;  2X68 A;  3RRC A;  4AI6 A;  5LA6 E;  4CI2 B;  3KBT A;  3U78 A;  5LYJ E;  2X67 A;  5JR9 A;  1HCI A;  5HXC A;  4AQG A;  5L3F B;  3RYF E;  3MJX A;  1MMN A;  4PK5 A;  3CWZ B;  4UXN B;  5FY0 A;  5EZY E;  5CA1 E;  2VK9 A;  2Q9Q A;  5CA0 E;  3U3I A;  2X9H A;  3I9Y A;  4ZOL E;  5ADX L;  3CML A;  3MA9 A;  2VAS A;  4ISS A;  5M4Y A;  4O2A E;  2XAG B;  5JDL A;  5FXZ A;  3FB2 A;  2KLQ A;  4KMC A;  5DQW A;  3PUG A;  1LVF A;  4ADZ A;  2KIN B;  4OFZ A;  2XAS B;  2Y8D A;  2WWU A;  4PNI A;  4WBN E;  2EHO C;  2MTQ A;  3PUA A;  2IAK A;  1UCU A;  3ONX A;  2CLY C;  2Q9Q D;  3GN5 B;  4IST A;  3EDU A;  5FMN A;  5CB4 E;  2ES0 A;  3HI2 A;  2CA5 A;  3CX7 B;  4QXB B;  2W00 A;  3MZK B;  3N2O A;  4U74 A;  4FI5 A;  4HGA A;  4KBM B;  2K48 A;  2IC6 A;  2NP9 A;  3AVS A;  4YHJ A;  4CI3 B;  1AJ3 A;  3ETV A;  1IJ6 A;  3AA7 B;  3P8C D;  3HR0 A;  5FXV A;  3KV5 A;  3IHR A;  3CPZ A;  2A2F X;  4EXT A;  2X0L B;  5IHY A;  1WR6 A;  2C0S A;  2V7M A;  3HKB E;  3N9L A;  4AKL A;  3A5X A;  2LSG A;  4QWN B;  1S35 A;  4J2C A;  2KMF A;  4OK0 A;  4YLH A;  2I59 A;  3RYC E;  1OXZ A;  2K9A A;  2LHN A;  4ILU A;  2LT3 A;  4E7S A;  2C5I T;  5EK4 A;  2X9X A;  3N9P A;  5C8Y E;  2ODU A;  1VOM A;  4H63 V;  3O9X A;  3R84 B;  2CXF A;  4H9O C;  3PUQ A;  2WSS V;  2VKO A;  3QUJ A;  2V1D B;  5E0O A;  4BA9 A;  1HX8 A;  5HXE A;  3Q9D A;  2PBI A;  4NUV A;  4ZI2 C;  4IE6 A;  4WNK A;  3PDY A;  3HKC E;  2VKD A;  3O1I A;  3LK2 B;  4BJM A;  1H7C A;  5A1L A;  5HAX A;  4QXC B;  2MOZ A;  4OYK A;  5L3E B;  3ZMU B;  4DVD A;  3K3N A;  4UVB B;  1HG2 A;  3HKE E;  4O4H E;  3CVR A;  4U72 A;  2XAH B;  3OJA A;  5LBM A;  3ETU A;  1HTJ F;  4O8S A;  3WAK A;  4EYY R;  2X51 A;  4DND A;  2W61 A;  1BR2 A;  3PTR B;  4XAX B;  1QSD A;  2BVM A;  1ZV4 X;  1G8X A;  2HPJ A;  3IF8 B;  4OHF A;  3SS1 A;  3ZYK A;  3BQL A;  3DJB A;  4IE5 A;  4ZS2 A;  4IHJ E;  2X9W A;  2RA1 A;  2V7K A;  4IIJ E;  2ZM0 A;  4K0U A;  1D1A A;  3IBP A;  2DWG A;  2D0U A;  3BQI A;  5FY1 A;  2LE8 A;  4QXH B;  3AAA B;  5JRC B;  3GA8 A;  4EZ4 A;  4UF0 A;  5JQG E;  3ZMV B;  4PFO A;  2E8I A;  3RYH E;  3V5U A;  3CQG B;  4AQF A;  4GOU A;  4YFS A;  3VKG A;  3Q2M A;  4TV9 E;  2VL8 A;  2DLR A;  4NUU A;  1LVK A;  4XBF B;  1WLX A;  5H6R B;  2E9X D;  3PE0 A;  4UVC B;  5JR9 B;  4GYS A;  1LRZ A;  2V7L A;  3VKH A;  1D1C A;  2L9Q A;  2JPF A;  3E0Z A;  4UV8 B;  3F2E A;  4CZZ B;  1U5P A;  3BK9 A;  2Q9Q B;  3Q5W A;  2EHO A;  3ZJ1 A;  4JUY A;  4CXW A;  4KP3 C;  4ZI7 E;  2NW9 A;  4MBQ A;  3NRX A;  3RC8 A;  3KV9 A;  2WBL A;  3C51 A;  2MYS A;  3CKD A;  4YJ3 E;  3OBV E;  3ZN1 B;  1BR0 A;  3DP7 A;  3K3Q C;  5HXR A;  1SHZ C;  2KND A;  4AQF C;  2JMK A;  1Y64 B;  4DMW A;  3KV6 A;  2SPC A;  1IJ5 A;  1HG5 A;  4UIG A;  2KT9 A;  4UVA B;  3LJC A;  1IZN B;  5DQV A;  2Y48 B;  4PJJ A;  4I50 E;  2JMH A;  3N9Q A;  2JQQ A;  1UX5 A;  5LJN A;  2EHO D;  4H9P C;  1US7 B;  4A56 A;  5L3G B;  3J7Y q;  5HWX A;  2D0T A;  2HH7 A;  2CM0 A;  1CUN A;  1MIY A;  4HKA A;  3FXD B;  5HYA A;  2KWI B;  1D0Y A;  3HL6 A;  4PJL A;  3RYI E;  2PG8 A;  1WYB A;  3K8P C;  5JRE A;  1X79 A;  2JRK A;  1Z0P A;  4IE0 A;  5JDN A;  3CQX C;  2G0U A;  2VB6 A;  4L9I A;  2N1G A;  2ZM8 A;  4H63 H;  5J1G A;  5JVD E;  5J2T E;  4TUY E;  2XHE B;  3KBU A;  3MK7 C;  2BVL A;  3N9O A;  4GYR A;  3MXZ A;  3L3P A;  3UTK A;  3SWH A;  2PFV A;  1HFA A;  2DNX A;  4P0A A;  4JEH B;  4UV9 B;  3UFE A;  3FBL A;  5L3B B;  4GK5 E;  2WMO A;  4MAL A;  3KVA A;  2A72 A;  1D0Z A;  3AA6 B;  2RP4 A;  3ANW B;  3N5L A;  3ZYM A;  2H7V C;  4L0R A;  5KMG P;  4I4T E;  5F8P A;  3LK3 B;  2JJ9 A;  1ZEE A;  5EK2 A;  4EYU A;  3N2K E;  4AKI A;  3K3O A;  4ZI2 D;  1MMD A;  1ZHC A;  3CQC B;  3ZLI A;  2MBG A;  4P09 A;  5LP6 E;  4TV8 E;  3N9M A;  1LKX A;  2XUE A;  4M1P A;  5LHG B;  2UXN B;  4H9N C;  3MKD A;  4TN7 B;  4PJM A;  3H3A A;  3O1J A;  1NWM X;  4P0B A;  4KUM B;  3VU7 H;  5BMV E;  5LGN B;  3LBX B;  3KV4 A;  4OYJ A;  2VKJ A;  5LNK A;  3ZJ2 A;  1OWA A;  2DWK A;  3F31 A;  1S94 A;  4DBR A;  2PJQ A;  4BJN A;  2IW5 B;  4CXY A;  2BDE A;  4TZ4 C;  3ZC0 A;  4ZI3 C;  2L3L A;  2NTY A;  4UEL A;  1FEW A;  2CWY A;  3NRY A;  3KFW X;  2E9X B;  4L5G A;  4BAY B;  1QUU A;  4PFP A;  3ZCJ A;  3C98 B;  1FMW A;  1YKH B;  3PU8 A;  3WI3 A;  4IGU A;  5LCY A;  5JH7 E;  5EK3 A;  3EVY A;  5JDM A;  2K5B B;  4MHC A;  2KXP B;  3HA4 A;  1WRD A;  3Q5X A;  3SOL A;  3E08 A;  3JC6 C;  1O3X A;  2XTL A;  5ETW A;  4DO0 A;  3TKL B;  5FXX A;  3AAE B;  4ASK A;  2P9B A;  1YKE B;  2NW7 A;  1FMV A;  5FYM A;  4DBQ A;  2CXD A;  2YIN A;  3UUX B;  1MMG A;  4N78 D;  2C5K T;  4G63 A;  2CE7 A;  3FXE B;  4Z8X A;  2EHO B;  2Y6X A;  3NZP A;  3RX6 A;  5HXS A;  2CLY B;  3BQK A;  2XAF B;  1VRB A;  4HTE A;  3C4W A;  4WBO A;  4E7Z A;  2CCQ A;  2D2S A;  2LSY A;  3I1A A;  3L09 A;  5HXH A;  1D1B A;  4QX7 B;  4AKR B;  5JDF A;  3IEE A;  3ZCI A;  2LSK A;  2YEV C;  4H9S E;  4ZHQ E;  2DHR A;  2ZLY A;  3GWH A;  2KZ7 B;  2IC9 A;  3AA0 B;  1G73 A;  3FBZ A;  3V5S A;  2BZB A;  5JDQ A;  3UT5 E;  2YU2 A;  4JEU B;  2X9Y A;  4PJN A;  2CWO A;  3AA1 B;  3CX8 B;  3B57 A;  3OYX A;  2NW8 A;  2H3R A;  3CX6 B;  3NBX X;  3QK6 A;  1ZKE A;  2VWA A;  1KNZ A;  1D0X A;  5LGT B;  2LM9 A;  2V7J A;  3ZMZ B;  2B1E A;  2J1D G;  4AKG A;  5JDH A;  3WAJ A;  5FP3 A;  4C90 A;  4TX5 A;  4X1K E;  4HN9 A;  3LG7 A;  3ZYL A;  1IAP A;  1UX4 A;  4O4J E;  3W15 B;  3S4U A;  4ANJ A;  2NOX A;  2M67 A;  1BR4 A;  3B13 A;  3DTO A;  3I9W A;  5H6Q B;  4G2A A;  3UUN A;  2LOS A;  4GIW A;  2LSJ A;  4AKH A;  5LXT E;  5LJM A;  3KIN B;  4X20 E;  2NTX A;  2CMR A;  3ZMT B;  3GMI A;  2N9D A;  1EZ3 A;  2WAU A;  4UEM A;  5DAB A;  3T8O A;  5JR9 C;  2LJL A;  3I0Q A;  4CI1 B;  2KWH A;  2LEH A;  2Q9Q C;  2YK0 A;  1U4Q A;  5IYZ E;  4PAG A;  4PK4 A;  5KX5 E;  2NWB A;  3GN5 A;  3RKO A;  3HKD E;  3AB3 B;  4X1Y E;  2WM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...