3C98B

Revised structure of the munc18a-syntaxin1 complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
247
structure length
230
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 1
publication title Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide
pubmed doi rcsb
source organism Rattus norvegicus
total genus 91
structure length 230
sequence length 247
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3c98B00
5M4YA 3C98B 2XHEB 1HS7A 1S94A 1FEWA 1G73A 2DNXA 4JEUB 5LG4A 3LG7A 4JEHB 1FIOA 1BR0A 4TX5A 1EZ3A
chains in the Genus database with same CATH superfamily
4B6XA 5JDNA 3R84B 5KMGP 5AQPB 2LSGA 3UFEA 4YTMA 2ZM6T 5AQVB 1E1HB 3Q5EA 3ZPOA 3CX7B 3LJCA 5C8YE 4UV8B 3LG7A 3RC3A 4HWIB 2WU5A 5FXXA 3TLVA 2DL1A 4CQIA 1N34T 1XWMA 4ILBA 2D9DA 3L3PA 2H89A 4PK5A 4WW0A 3PURA 3KV9A 1OXZA 3P8CD 3AEEA 1U4QA 4HWCA 2XAHB 3OVUA 1WYCA 5J2UE 5AQSB 5AQLB 2E9XB 5JRCB 4QKNA 2LLYA 4WBOA 2P9BA 1SHZC 4GK5E 1LVKA 3Q5WA 5HXSA 3RQWA 3PUVF 3ANWB 3HKBE 1W9RA 1MIYA 4X1YE 3SFEA 3RQUA 2HPJA 5J0ZA 5LJNA 4U2YA 2UU9T 4GKJT 1FMVA 3OPCA 3ZYKA 2V7KA 1IJ5A 2IMLA 4CN6A 5GONE 1YXRA 4PJMA 4YJ2E 2KSRA 2N9DA 1V9DA 5HEHA 2ODVA 4TWFA 2XQ9A 4WBNE 3LBXA 3BQLA 2WM9A 4UIGA 2CHOA 3ZMUB 3PDYA 5BMVE 4LMKA 2K48A 2I59A 4JUYA 2WSSV 1IZNB 2D5UA 2IDOB 1S35A 1JNZA 3B57A 4JI3T 5ABFA 4CXYA 5CGMA 3PUYF 2CBIA 3P4PA 2ZLYA 2VURA 3RLFF 3K3NA 1XDPA 3RYHE 4JI4T 1G8XA 2PJQA 4X1KE 5LB7B 3CIRA 3SOLA 5AQGB 3AE1A 1OEDC 3B5MA 3L8RA 4HWFA 1WRDA 1YQ4A 1HFAA 2XQ6A 3B13A 4TX5A 2XQAA 4AIUA 4ISSA 4DR2T 2X9WA 2UXCT 3ZSTA 4AI6A 4PW8A 2BZBA 4AKIA 4YY3T 1J5WA 5HWYA 5L47A 4H9QC 4ISTA 5FYMA 3SS1A 3MK7C 5ETWA 3GWHA 4J2CA 2XQ7A 4EEBA 2JPFA 3PV0F 4I0UA 4DNDA 2XM1A 2ZM0A 2D2SA 1D0YA 2FJBA 2CWOA 3KFWX 4TN7B 3ZMZB 3E22E 3EABA 2JJ9A 4LF9T 3ONJA 3AE3A 3AA6B 2Q9QA 4ZS3A 2V6YA 2I0MA 3VKHA 2WS3A 4ZEYA 3Q2MA 5FXVA 3HKEE 5LYJE 1H7CA 4NXMT 4EV6A 3AE2A 2K5BB 4ZOLE 3UUXB 1W09A 4ERRA 5JQGE 1M62A 4N78D 5FNVE 5LP6E 1LVFA 2JQHA 2KXPB 2CXFA 3KVBA 5JVDE 3IA3A 4O4LE 1FEWA 3N5LA 3ZSSA 3PJAJ 2VWAA 4MLKA 4UF0B 4AKHA 4H9SE 3J7Yq 3FZHB 4ADZA 3JADA 2BBJA 3H3AA 3VR9A 3FBZA 3PUZF 3KBTA 4NUVA 4QXBB 4DR4T 2D0UA 2Q9QD 1HX8A 2MBGA 3FXEB 1OEDB 2W63A 4IT4A 2KWHA 2JMKA 4ZHQE 3N2GE 3UT5E 4G2AA 3NRYA 4H63H 3ZT6A 5CJ5A 3T1YT 1BR1A 4HFBA 2SPCA 2W66A 5H6QB 2DI4A 2PBIA 3CQGB 5HEJA 3RI5A 5M4YA 3K3QC 3MZKB 3DP7A 2FUPA 2WMOA 2JQKA 5F3JA 3EAMA 5LMUT 3KV4A 1MMGA 4QXCB 4JI2T 5IWAT 2X9HA 3L09A 5LMNT 3BK9A 4HFVA 5HCMA 3WAJA 2WMNA 1E2AA 2M6IA 3ETVA 3TLWA 4GK0E 2VKJA 5FMNA 5AQMB 1D0ZA 4LFBT 3N2KE 5L3FB 2LM2A 1AJ3A 4ZI7E 4YTNA 3AXJB 3J9X1 5HYAA 4C91A 3ZC0A 3RRWA 2BG9A 2DLRA 3UUMA 5CA1E 3OYZA 2CE7A 2E9XC 5FKYA 1WLXA 2CWYA 1X9BA 4AQGA 3VKGA 4TWDA 2QVAA 3C4WA 5KX5E 3FZKB 4GYSA 4KI0F 1IAPA 3MJXA 4A97A 1ZKEA 2YOEA 3MACA 2WDQA 3JAEA 3CPZA 1WFDA 4ZS2A 2NW9A 5JR9A 2JQQA 3UULA 4X62T 1LKXA 4ZI3D 2HHHT 3JC6D 5H6RB 3I9WA 2VQFT 2JIWA 3A7MA 1YW0A 3KDSE 5F8PA 2LSYA 4TUYE 3P7IA 3MA9A 3QOFA 5JTGA 3LSVA 2WDVA 5FVKA 2BDEA 2C5IT 4O4IE 3RRCA 4O4HE 4DV3T 2CXLA 1KNRA 2K24A 3RIUC 3RIAA 4HFHA 4WNKA 1ZOYA 4DUZT 2NW7A 3SFDA 2VQET 2CA5A 2LSJA 3QB5A 4JI6T 3RF1A 4H63V 3OKQA 2QGSA 2CM0A 1NAFA 4QXHB 4AQFA 2G0UA 2E2AA 3SRZA 3Q5XA 5JDQA 3N9QA 2XPKA 4ANJA 3KINB 4TWHA 3ZJ2A 4DR7T 2WP9A 4GKKT 5KXJA 2ES0A 4EEDA 1OWAA 4QHOA 3MXZA 4I4TE 2XQ8A 5F5WA 3NKZA 5ABGA 2MTQA 1T72A 3NZPA 2VVNA 1OEDE 3RPUA 2KZ7B 2VL8A 4WYVA 1XDOA 2XQ4A 2W00A 1FIOA 2BVLA 2XTLA 5FY7A 1CUNA 3GN5A 4UVCB 2D0TA 5AQIB 1S94A 4YSZA 4DV5T 1HG2A 4JEUB 2ZM8A 5LGTB 4IDNA 1XMOT 4ILAA 4CXXA 3EDUA 4IDZA 5FVLA 3Q9DA 5CA0E 2X67A 4EAHA 4U2ZA 3UFGA 4TV9E 1IBMT 1MIVA 1D1BA 5LCYA 3AEFA 1Y01A 5HEUA 5LNKA 3I9YA 2V6YB 4BJMA 3RGLA 2WWUA 3RH3A 4EZ4A 3UU8A 5J2TE 2X51A 3LDQB 4IE5A 5BR8T 1W0AA 4IE6A 1VCSA 5AQQB 2XAQB 2C0SA 3ETUA 2E5VA 2YN6A 1BR4A 3RX6A 4YXDA 4NPPA 4WZXA 3HL6A 3AAEB 3ONXA 1VCTA 4QX7B 2X68A 5DQWA 1J1JA 2XZEA 2OLTA 5AQJB 4AQYT 1O3XA 5HAXA 4Z90A 3QB5K 5LHHB 3K3OA 4IHJE 2XHEB 3NVOA 3CX8B 5L3DB 4CI2B 3AE7A 3GA8A 2HN1A 3JCFA 2RA1A 3NRXA 3CQXC 5DJQC 3QK6A 3X1DA 3I0QA 3H3MA 2XQ3A 4LMLA 3N9LA 4OYKA 2B1EA 3TLTA 5AFUL 4HFCA 4QX8B 5E0OA 2N1GA 2OV9A 4JI8T 2KMFA 2LKHA 3N9NA 3PUAA 3PTRB 2LSKA 5JDHA 2W0GA 2X66A 2PTFA 3Q5DA 3N9MA 4LF4T 4X5TA 4YHHT 1U5PA 4GYRA 5JDGA 2B76A 2XAJB 3AVRA 3EI0A 5JRCA 4B3TT 2VL0A 5FXWA 4HFEA 3OJAA 4M1PA 5C2TA 2UXXB 3FB2A 4YT0A 4U74A 2DWKA 3F57A 1HG5A 3O1JA 2WZIA 2FBWA 3O1HA 1WYBA 5EK3A 1WCRA 2W62A 5AQKB 2W4XA 1UGOA 2WCAA 4PNIA 4KX6A 4HWHA 2V7JA 3G06A 3KV5A 5HXRA 3UUNA 4CZZB 3N9PA 5LBMA 1Z0PA 1EZ3A 3TLSA 3C4XA 4AXPA 1SE7A 1QUUA 1FJGT 2YEVC 3NZQA 4K0KT 4ILCA 1FMWA 1HR0T 2OA5A 2NW8A 3UQ7A 3WAKA 5FL0A 2BS2A 5HWXA 2J1DG 2WQYA 4X1IE 3U78A 3EDVA 4TV8E 2KINB 5AQHB 4JI0T 2UXBT 2I6HA 5A1LA 3OBVE 4JI1T 2ACXA 2IAKA 2A72A 4UXNB 3O4XE 3GMIA 5L3BB 4QH5A 2XQ5A 2J4GA 3FZLB 2RPAA 4L9IA 4ZI2D 2A9UA 1D1AA 2KWIB 4ZXLA 2K3WA 2BKPA 2ZMAA 4V1Av 3LFMA 4PAGA 1IBKT 5LHIB 4YLHA 3SWHA 2CBJA 5LA6E 4PJNA 2A2FX 2JMHA 5AQNB 3ZYLA 3TLUA 2YDSA 3ZLIA 2MAWA 4KHPT 3ZCJA 3E08A 5TAOA 4IE4A 3U3IA 5AQFB 1GQEA 1N33T 3AVSA 4YJ3E 4IREA 1NENA 3BQIA 3AA7B 5AQOB 3NBXX 3UQ4A 4EXTA 3M65A 5DQVA 2E8IA 5IHYA 1IJ6A 4BA9A 4P1NA 1I94T 2BVMA 3OYXA 4EB6E 4QH4A 2HPLA 4NXNT 4U7IA 2X9YA 2WDRA 5LG3A 4AKLA 2EHOA 3F31A 2WBLA 5LGNB 1VOMA 5HEOA 3P4QA 2YDRA 4P0AA 4PFOA 2UXNB 3AEGA 4CI3B 4TNWA 1KFYA 1DU2A 5IYZE 4F8HA 2JRKA 1X79A 3CMLA 2LSIA 1E7PA 1HS7A 3P4SA 5LG4A 3F2EA 3M3ZB 1R8IA 3PUWF 3ZMSB 4EGWA 4DBQA 2DNXA 4H9RC 4B3RT 4XZCA 1UCUA 3DJBA 3AE8A 5HXEA 4B3ST 3AE4A 2C5KT 4JBWF 2V8SV 4UF0A 4U7YA 2V1DB 2BS3A 3H37A 4CN4A 2H7VC 4H9NC 4Z91A 4DMVA 4OK0A 4IDPA 4DBRA 2FJAA 3UU6A 4DV0T 4IL4A 3UU3A 2AE9A 5FL1A 3ZCIA 3AB3B 3I1AA 3QC9A 3V5UA 3AA0B 2DHRA 4FJOA 4HWDA 4LF5T 5AQRB 2EHOD 3PE0A 2Q9QC 2IC9A 1HNZT 4H9PC 1XNQT 1MMDA 1WR0A 3BQKA 4O2BE 1OEDA 4DV2T 4TNVA 4Q25A 4LFCT 5HXHA 4UEMA 4JEHB 4TZ4C 3T1HT 4DV1T 4U33A 2LM9A 5AQUB 4P09A 2WAUA 3LBXB 5DABA 4MALA 2NTYA 4HKAA 1YKEB 2GK9A 4H9OC 3CQCB 2BBHA 3C4ZA 3CKDA 5L3EB 3VU7H 2NWBA 3A8YC 3PUGA 2CCQA 3UTKA 3ZJ1A 2IIUA 4EOZB 5LHGB 2VB6A 3P50A 1ZHCA 2CLYC 2A3DA 3HI2A 4X65T 2CRBA 5ABFB 3WI3A 3ZC1A 2LHNA 2V5DA 5JDMA 2QA7A 3TKLB 5CFBA 3O9XA 4LFAT 1BR0A 3RYCE 2L3LA 2K9AA 3ABVA 3QUJA 4O8SA 2CEAA 5JH7E 3E0ZA 3RKGA 2YDQA 3CK6A 2CMRA 1HNXT 3AAIA 2XQYA 4EZHA 2YU2A 3O1IA 3VRAA 4KBMB 4XBFB 1B7TA 5L3CB 3RYIE 4DR3T 3ZYMA 1HCIA 4HEAA 5FP3A 2H3RA 2W61A 4Z8XA 5C3JA 1MMNA 3AXJA 2LOSA 5J1GA 4UELA 2N2NA 4BJNA 4E7ZA 2X9XA 1G73A 4LF8T 3ESLA 4UVAB 3CX6B 2LOPA 3FXDB 4GOUA 4IDOA 4LF7T 2F4VT 2DCFA 5LXTE 2M6BA 4DMWA 2PG8A 1ZP0A 2W2UA 5IUXA 2V6XA 4OX9T 2WZHA 3LK42 2BKNA 4O2AE 5EK4A 3A5XA 2Q9QB 2W67A 2ZM2A 4FI5A 5L3GB 1W0BA 2XJ7A 4HFIA 3EUHA 2UUAT 4YSXA 4ZZBA 4UVBB 4ZI3C 2LKGA 1M7KA 3JC6C 2EHOC 1MNEA 4X64T 4PK4A 2YK0A 2XUEA 5HEGA 1D0XA 3NWIA 4JV5T 3HA4A 3ZKRA 3KBUA 2J47A 4I43B 4COFA 2BG9C 4KP3C 4F6RC 4A98A 2CPTA 2FJDA 3RIFA 2Y8DA 3RYFE 1Z8UA 1LRZA 3W15B 3R6NA 1WR6A 2NP9A 3EHZA 3CWZB 2Y6XA 3ZN0B 4DR6T 1T98A 2XASB 4DUYT 2CLYB 1XMQT 4C90A 1N32T 5L4HA 2MYSA 2Y48B 2X0HA 1D1CA 4LF6T 4CN1A 2NOXA 2ODUA 4HGAA 3JAFA 4ZZCA 5LJMA 4OHFA 4P0BA 5ADXL 2WB5A 3AE9A 5JR9C 2IUBA 4DO0A 4YFSA 2WY2A 2WU2A 2BS4A 2QRXA 4DR5T 2R6GF 3ZT7A 3RC8A 2DWGA 3PUXF 1NWMX 2VASA 2XAGB 3QNUA 4BAYB 4UV9B 2HN2A 4A5XA 2LEHA 4X66T 4AKRB 4PK6A 2LT3A 4DV6T 2E9XA 1KNPA 4QWNB 4QH1A 2LHRA 3AECA 4UR9A 3K1SA 1XNRT 4YSYA 3ZEFB 5FXZA 5EZYE 4IE0A 3ONLC 2LRKA 2V26A 3IEEA 4K0UA 4AQFC 1ZEEA 2L9QA 1CHUA 1US7B 4DV4T 4MFRA 2C5JA 3ANWA 4CI1B 5ABEA 3V5SA 5L2LA 4KMCA 5JREA 3K8PC 4PJJA 1UURA 2VK9A 2XM2A 2RP4A 2EHOB 4HN9A 4IIJE 4U3CA 4PJLA 2KT9A 2X0YA 1HNWT 2VKDA 4L0RA 1JNRA 1UX4A 1VRBA 2BG9B 3RIUA 2E9XD 2WWVA 1KNZA 3IHRA 2XSAA 1XZYA 2YKSA 2QYWA 4AISA 4X20E 4B3MT 1HTJF 3AEAA 1KEYA 1SUMB 3VR8A 3RKOA 3DTOA 2M67A 2FJEA 5JDFA 5FY1A 3UUBA 1SA0E 3AAAB 3RHWA 5JR9B 3ZMVB 5LBQB 3S4UA 3VHLA 2LE8A 1Y64B 1ZV4X 5CB4E 3AA1B 1QSDA 4PFPA 1KF6A 2IHR1 2LRLA 4HE8A 2LJLA 2VKOA 3C50A 3P4RA 3HR0A 4EYUA 3LK3B 4JLEA 2KLQA 4I50E 2UXDT 3FZFB 4JYAT 3PU8A 3FBLA 4XAXB 4L5GA 4NUUA 2H88A 2ACZA 4U72A 2HH7A 3KVAA 4GIWA 1MMAA 1T7SA 4IE7A 3KV6A 2VVSA 4YHJA 3N2OA 5LOVE 2NR4A 5AQTB 4EIWA 2BKOA 5JDLA 1KK7A 2L8KA 2YINA 3PU3A 4I55E 3L39A 3FZMB 2IW5B 1QLBA 3AEBA 2V5CA 2H7OA 3MKDA 1IBLT 1MIWA 4YTPA 1HX1B 3GN5B 5KDMC 4U31A 3ZT5A 3PJAA 3C98B 1N36T 1I6ZA 1L0VA 2J62A 4HTEA 4A56A 4ASKA 1MNDA 4IL9A 4NIQA 2YU1A 3HKDE 5EK2A 4G63A 4HFDA 5ABHA 3IF8B 5LGUB 3VRBA 2MOZA 3P4WA 2PFVA 3AE5A 3EVYA 1UX5A 5FY0A 4OYJA 1YD8G 2Z6EA 4IGUA 4DR1T 4DIDB 3UU5A 4JI5T 4DVDA 3I0OA 2CHNA 4LMJA 3D0TA 3HKCE 4ZI2C 2NTXA 2E5LT 4KHZF 5L4EA 4ILUA 2V7LA 2UUBT 3PUQA 1BR2A 3CVRA 2AXDS 2MPKA 1HF8A 2VKHA 3AE6A 2IC6A 5HXCA 4MBQA 3FHNA 1J5ET 1UK5A 4JI7T 3T8OA 2CXDA 2XY8B 2XAFB 3AEDA 4EYYR 3IBPA 4IDQA 1NEKA 2XSBA 4AKGA 4OFZA 3LK2B 3OTOT 3PUSA 2UUCT 2V7IA 3ZN1B 2V7MA 3C51A 1T8BA 4E7SA 4O4JE 2BG9E 4MHCA 2KNDA 3C64A 5HCJA 1UUSA 3UU4A 4CXWA 1YKHB 4KUMB 4DV7T 1YQ3A 2X0LB 3ZMTB 2JQ9A 3N9OA
chains in the Genus database with same CATH topology
1FMWA 4B6XA 1WR6A 2NP9A 1D0ZA 3R84B 5JDNA 3CWZB 2Y6XA 3N2KE 3ZN0B 2OA5A 5L3FB 1T98A 2XASB 5KMGP 2NW8A 2CLYB 1AJ3A 2LSGA 3WAKA 4C90A 3UFEA 4ZI7E 2MYSA 2Y48B 1D1CA 5HWXA 2J1DG 4X1IE 1E1HB 3ZPOA 3CX7B 3LJCA 3U78A 4UV8B 3LG7A 3EDVA 3RC3A 5C8YE 3J9X1 4TV8E 2NOXA 2ODUA 4HGAA 2KINB 5HYAA 5FXXA 4C91A 4CQIA 3ZC0A 5A1LA 3RRWA 5LJMA 4OHFA 4P0BA 5ADXL 2DLRA 3UUMA 3OBVE 5CA1E 3L3PA 3OYZA 4PK5A 4WW0A 3PURA 5JR9C 2CE7A 2ACXA 2E9XC 2IAKA 3KV9A 1OXZA 2A72A 1WLXA 4UXNB 3O4XE 4DO0A 3P8CD 3GMIA 4YFSA 5L3BB 2CWYA 4AQGA 3VKGA 3RC8A 2DWGA 1U4QA 3C4WA 2XAHB 1WYCA 1NWMX 5KX5E 4L9IA 4ZI2D 4GYSA 1D1AA 2VASA 2KWIB 1IAPA 2XAGB 2ZMAA 5J2UE 4V1Av 3MJXA 2E9XB 3LFMA 4PAGA 4BAYB 1ZKEA 5LHIB 3MACA 4UV9B 4YLHA 5JRCB 4QKNA 2LEHA 4AKRB 4PK6A 3CPZA 3SWHA 2LT3A 4WBOA 5LA6E 2P9BA 1SHZC 4ZS2A 2NW9A 5JR9A 2JQQA 3UULA 2E9XA 4PJNA 4GK5E 1LKXA 2A2FX 2JMHA 1LVKA 4ZI3D 3Q5WA 3ZYLA 5HXSA 4QWNB 2LHRA 3JC6D 5H6RB 3I9WA 3ZEFB 1YW0A 3KDSE 5FXZA 5F8PA 2LSYA 3ZLIA 5EZYE 4TUYE 4IE0A 3P7IA 3MA9A 3ANWB 3ZCJA 3E08A 5TAOA 2BDEA 2V26A 4IE4A 3IEEA 3HKBE 3U3IA 2C5IT 4O4IE 3RRCA 4K0UA 1MIYA 4AQFC 4O4HE 1ZEEA 4X1YE 3AVSA 2L9QA 4YJ3E 2CXLA 1US7B 2HPJA 3BQIA 2K24A 3AA7B 5LJNA 4MFRA 2C5JA 3ANWA 4CI1B 3NBXX 3V5SA 4EXTA 3M65A 1FMVA 5DQVA 2E8IA 5IHYA 5L2LA 3ZYKA 4KMCA 2V7KA 4WNKA 1IJ5A 5JREA 3K8PC 1IJ6A 2NW7A 4PJJA 4BA9A 5GONE 4PJMA 4YJ2E 2VK9A 2BVMA 3OYXA 2CA5A 2RP4A 2EHOB 2LSJA 4HN9A 4EB6E 4IIJE 2N9DA 1V9DA 2ODVA 4PJLA 2HPLA 2X9YA 4WBNE 3LBXA 4H63V 2KT9A 3OKQA 3BQLA 2WM9A 4UIGA 4AKLA 2QGSA 2CM0A 3ZMUB 3PDYA 5BMVE 1NAFA 4QXHB 2VKDA 4L0RA 4AQFA 2EHOA 2G0UA 3F31A 2WBLA 5LGNB 1VOMA 3SRZA 3Q5XA 5JDQA 2K48A 2I59A 4JUYA 1UX4A 1VRBA 2WSSV 4PFOA 4P0AA 2UXNB 4CI3B 3N9QA 2E9XD 1KNZA 3IHRA 1IZNB 5IYZE 2D5UA 2JRKA 1S35A 1X79A 4ANJA 3CMLA 2LSIA 3B57A 3KINB 1HS7A 5LG4A 3F2EA 4X20E 1HTJF 3ZJ2A 3ZMSB 4DBQA 2ES0A 4CXYA 2DNXA 1OWAA 4H9RC 4QHOA 3MXZA 3RKOA 4I4TE 4XZCA 3DTOA 1UCUA 2M67A 3DJBA 2ZLYA 2MTQA 3K3NA 5JDFA 5HXEA 3RYHE 1G8XA 2PJQA 3NZPA 4X1KE 2C5KT 5FY1A 3SOLA 1SA0E 3RPUA 2KZ7B 2VL8A 3AAAB 4UF0A 2V1DB 2W00A 1FIOA 2BVLA 5JR9B 3H37A 2H7VC 2XTLA 3ZMVB 4H9NC 1WRDA 5LBQB 4DMVA 1HFAA 3B13A 5FY7A 1CUNA 3S4UA 4TX5A 3GN5A 4UVCB 2D0TA 3VHLA 2LE8A 4ISSA 1Y64B 4OK0A 1ZV4X 1S94A 5CB4E 2X9WA 3AA1B 1QSDA 4DBRA 4PFPA 1HG2A 4JEUB 2ZM8A 5LGTB 3ZCIA 3AB3B 3I1AA 4AI6A 3QC9A 4HE8A 3AA0B 3V5UA 2LJLA 2VKOA 3C50A 2DHRA 4FJOA 4PW8A 2BZBA 4AKIA 4CXXA 3HR0A 4EYUA 2EHOD 3EDUA 4IDZA 3PE0A 5HWYA 3LK3B 2Q9QC 4JLEA 4H9QC 2KLQA 3Q9DA 4ISTA 2IC9A 5FYMA 5CA0E 2X67A 3SS1A 3MK7C 4EAHA 4I50E 4H9PC 5ETWA 1MMDA 3GWHA 3PU8A 4J2CA 3FBLA 3BQKA 4O2BE 4TV9E 4XAXB 4L5GA 1MIVA 2JPFA 1D1BA 4DNDA 5LCYA 2ZM0A 4NUUA 5HXHA 4UEMA 2D2SA 1D0YA 4JEHB 4TZ4C 2CWOA 2LM9A 5LNKA 3KFWX 3I9YA 4P09A 4TN7B 4U72A 4BJMA 2WAUA 3ZMZB 3E22E 2WWUA 3RH3A 2HH7A 4EZ4A 3LBXB 5DABA 4MALA 2JJ9A 2NTYA 3KVAA 4HKAA 5J2TE 1YKEB 2GK9A 4GIWA 2X51A 3CQCB 4H9OC 4IE5A 3AA6B 1MMAA 2Q9QA 4ZS3A 3C4ZA 3VKHA 3CKDA 3Q2MA 5FXVA 3HKEE 5LYJE 4IE6A 5L3EB 3VU7H 2NWBA 2XAQB 4IE7A 1H7CA 2C0SA 3PUGA 3KV6A 3ETUA 2CCQA 3UTKA 3ZJ1A 2K5BB 4ZOLE 1BR4A 3UUXB 4EOZB 4YHJA 5LHGB 3N2OA 5LOVE 2VB6A 1ZHCA 2CLYC 2A3DA 3RX6A 3HI2A 4ERRA 3HL6A 4EIWA 5JQGE 3AAEB 3ONXA 4N78D 5FNVE 3WI3A 3ZC1A 2LHNA 5LP6E 1LVFA 4QX7B 5JDMA 2X68A 2QA7A 3TKLB 2KXPB 2CXFA 3O9XA 1BR0A 5DQWA 3RYCE 2L3LA 5JDLA 3KVBA 2K9AA 5JVDE 1KK7A 2L8KA 3QUJA 2YINA 1O3XA 5HAXA 4O8SA 2CEAA 3PU3A 4I55E 4O4LE 5JH7E 3E0ZA 2IW5B 5LHHB 1FEWA 3K3OA 2CMRA 3N5LA 3AAIA 2VWAA 2XQYA 4MLKA 4EZHA 4IHJE 4UF0B 4AKHA 2YU2A 3O1IA 4H9SE 2XHEB 3J7Yq 4KBMB 4XBFB 1B7TA 3CX8B 5L3DB 3RYIE 5L3CB 4CI2B 2H7OA 3MKDA 4ADZA 1MIWA 3ZYMA 3GA8A 3GN5B 5KDMC 1HCIA 4HEAA 2RA1A 3NRXA 3C98B 5FP3A 3H3AA 2H3RA 2W61A 3CQXC 4Z8XA 5DJQC 3QK6A 3FBZA 3I0QA 1MMNA 3KBTA 2LOSA 5J1GA 4HTEA 4UELA 4A56A 4NUVA 4QXBB 4ASKA 2D0UA 2N2NA 4BJNA 4E7ZA 1MNDA 2Q9QD 2X9XA 3N9LA 1G73A 2YU1A 3HKDE 4OYKA 2B1EA 1HX8A 5EK2A 4G63A 2MBGA 3ESLA 3FXEB 3IF8B 5AFUL 5LGUB 4UVAB 2MOZA 3CX6B 2PFVA 3EVYA 4QX8B 1UX5A 2N1GA 5E0OA 5FY0A 2W63A 2LOPA 3FXDB 4OYJA 1YD8G 2KWHA 2Z6EA 4GOUA 2JMKA 4IGUA 4ZHQE 2KMFA 4DVDA 2DCFA 3N2GE 3I0OA 5LXTE 4DMWA 3N9NA 3UT5E 3PUAA 2PG8A 3PTRB 4G2AA 3D0TA 3HKCE 2LSKA 3NRYA 4H63H 2NTXA 4ZI2C 2W0GA 5JDHA 2X66A 1BR1A 3N9MA 4ILUA 2V7LA 2SPCA 5H6QB 1U5PA 2DI4A 3LK42 4GYRA 5JDGA 2PBIA 3PUQA 1BR2A 2XAJB 3CVRA 3AVRA 4O2AE 5JRCA 3CQGB 5M4YA 5FXWA 3K3QC 5EK4A 1HF8A 2VKHA 2Q9QB 2IC6A 2ZM2A 3A5XA 3MZKB 3OJAA 4FI5A 5HXCA 5L3GB 3DP7A 4M1PA 3EUHA 4MBQA 2UXXB 3FB2A 2WMOA 4U74A 2DWKA 3F57A 3FHNA 5F3JA 1HG5A 3O1JA 4UVBB 4ZI3C 3O1HA 2CXDA 3T8OA 2XAFB 1WYBA 5EK3A 4EYYR 3KV4A 3JC6C 2EHOC 1MNEA 3IBPA 1MMGA 4PK4A 2W62A 4OFZA 4QXCB 4AKGA 3LK2B 2YK0A 2XUEA 4PNIA 1D0XA 3PUSA 2V7JA 2X9HA 3L09A 3KV5A 2V7IA 3HA4A 5HXRA 3UUNA 3BK9A 3ZN1B 3N9PA 2V7MA 3KBUA 4HFVA 3C51A 4CZZB 4E7SA 4O4JE 5LBMA 3WAJA 1Z0PA 1EZ3A 2WMNA 3C4XA 4I43B 4MHCA 2KNDA 3C64A 4AXPA 4KP3C 4F6RC 1QUUA 3ETVA 4CXWA 4GK0E 2VKJA 1YKHB 4KUMB 2Y8DA 3RYFE 2X0LB 1LRZA 3W15B 5FMNA 3ZMTB 2YEVC 3N9OA 3NZQA 3R6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4Y A;  3C98 B;  2XHE B;  1HS7 A;  1S94 A;  1FEW A;  1G73 A;  2DNX A;  4JEU B;  5LG4 A;  3LG7 A;  4JEH B;  1FIO A;  1BR0 A;  4TX5 A;  1EZ3 A; 
#chains in the Genus database with same CATH topology
 4B6X A;  5JDN A;  3R84 B;  5KMG P;  5AQP B;  2LSG A;  3UFE A;  4YTM A;  2ZM6 T;  5AQV B;  1E1H B;  3Q5E A;  3ZPO A;  3CX7 B;  3LJC A;  5C8Y E;  4UV8 B;  3LG7 A;  3RC3 A;  4HWI B;  2WU5 A;  5FXX A;  3TLV A;  2DL1 A;  4CQI A;  1N34 T;  1XWM A;  4ILB A;  2D9D A;  3L3P A;  2H89 A;  4PK5 A;  4WW0 A;  3PUR A;  3KV9 A;  1OXZ A;  3P8C D;  3AEE A;  1U4Q A;  4HWC A;  2XAH B;  3OVU A;  1WYC A;  5J2U E;  5AQS B;  5AQL B;  2E9X B;  5JRC B;  4QKN A;  2LLY A;  4WBO A;  2P9B A;  1SHZ C;  4GK5 E;  1LVK A;  3Q5W A;  5HXS A;  3RQW A;  3PUV F;  3ANW B;  3HKB E;  1W9R A;  1MIY A;  4X1Y E;  3SFE A;  3RQU A;  2HPJ A;  5J0Z A;  5LJN A;  4U2Y A;  2UU9 T;  4GKJ T;  1FMV A;  3OPC A;  3ZYK A;  2V7K A;  1IJ5 A;  2IML A;  4CN6 A;  5GON E;  1YXR A;  4PJM A;  4YJ2 E;  2KSR A;  2N9D A;  1V9D A;  5HEH A;  2ODV A;  4TWF A;  2XQ9 A;  4WBN E;  3LBX A;  3BQL A;  2WM9 A;  4UIG A;  2CHO A;  3ZMU B;  3PDY A;  5BMV E;  4LMK A;  2K48 A;  2I59 A;  4JUY A;  2WSS V;  1IZN B;  2D5U A;  2IDO B;  1S35 A;  1JNZ A;  3B57 A;  4JI3 T;  5ABF A;  4CXY A;  5CGM A;  3PUY F;  2CBI A;  3P4P A;  2ZLY A;  2VUR A;  3RLF F;  3K3N A;  1XDP A;  3RYH E;  4JI4 T;  1G8X A;  2PJQ A;  4X1K E;  5LB7 B;  3CIR A;  3SOL A;  5AQG B;  3AE1 A;  1OED C;  3B5M A;  3L8R A;  4HWF A;  1WRD A;  1YQ4 A;  1HFA A;  2XQ6 A;  3B13 A;  4TX5 A;  2XQA A;  4AIU A;  4ISS A;  4DR2 T;  2X9W A;  2UXC T;  3ZST A;  4AI6 A;  4PW8 A;  2BZB A;  4AKI A;  4YY3 T;  1J5W A;  5HWY A;  5L47 A;  4H9Q C;  4IST A;  5FYM A;  3SS1 A;  3MK7 C;  5ETW A;  3GWH A;  4J2C A;  2XQ7 A;  4EEB A;  2JPF A;  3PV0 F;  4I0U A;  4DND A;  2XM1 A;  2ZM0 A;  2D2S A;  1D0Y A;  2FJB A;  2CWO A;  3KFW X;  4TN7 B;  3ZMZ B;  3E22 E;  3EAB A;  2JJ9 A;  4LF9 T;  3ONJ A;  3AE3 A;  3AA6 B;  2Q9Q A;  4ZS3 A;  2V6Y A;  2I0M A;  3VKH A;  2WS3 A;  4ZEY A;  3Q2M A;  5FXV A;  3HKE E;  5LYJ E;  1H7C A;  4NXM T;  4EV6 A;  3AE2 A;  2K5B B;  4ZOL E;  3UUX B;  1W09 A;  4ERR A;  5JQG E;  1M62 A;  4N78 D;  5FNV E;  5LP6 E;  1LVF A;  2JQH A;  2KXP B;  2CXF A;  3KVB A;  5JVD E;  3IA3 A;  4O4L E;  1FEW A;  3N5L A;  3ZSS A;  3PJA J;  2VWA A;  4MLK A;  4UF0 B;  4AKH A;  4H9S E;  3J7Y q;  3FZH B;  4ADZ A;  3JAD A;  2BBJ A;  3H3A A;  3VR9 A;  3FBZ A;  3PUZ F;  3KBT A;  4NUV A;  4QXB B;  4DR4 T;  2D0U A;  2Q9Q D;  1HX8 A;  2MBG A;  3FXE B;  1OED B;  2W63 A;  4IT4 A;  2KWH A;  2JMK A;  4ZHQ E;  3N2G E;  3UT5 E;  4G2A A;  3NRY A;  4H63 H;  3ZT6 A;  5CJ5 A;  3T1Y T;  1BR1 A;  4HFB A;  2SPC A;  2W66 A;  5H6Q B;  2DI4 A;  2PBI A;  3CQG B;  5HEJ A;  3RI5 A;  5M4Y A;  3K3Q C;  3MZK B;  3DP7 A;  2FUP A;  2WMO A;  2JQK A;  5F3J A;  3EAM A;  5LMU T;  3KV4 A;  1MMG A;  4QXC B;  4JI2 T;  5IWA T;  2X9H A;  3L09 A;  5LMN T;  3BK9 A;  4HFV A;  5HCM A;  3WAJ A;  2WMN A;  1E2A A;  2M6I A;  3ETV A;  3TLW A;  4GK0 E;  2VKJ A;  5FMN A;  5AQM B;  1D0Z A;  4LFB T;  3N2K E;  5L3F B;  2LM2 A;  1AJ3 A;  4ZI7 E;  4YTN A;  3AXJ B;  3J9X 1;  5HYA A;  4C91 A;  3ZC0 A;  3RRW A;  2BG9 A;  2DLR A;  3UUM A;  5CA1 E;  3OYZ A;  2CE7 A;  2E9X C;  5FKY A;  1WLX A;  2CWY A;  1X9B A;  4AQG A;  3VKG A;  4TWD A;  2QVA A;  3C4W A;  5KX5 E;  3FZK B;  4GYS A;  4KI0 F;  1IAP A;  3MJX A;  4A97 A;  1ZKE A;  2YOE A;  3MAC A;  2WDQ A;  3JAE A;  3CPZ A;  1WFD A;  4ZS2 A;  2NW9 A;  5JR9 A;  2JQQ A;  3UUL A;  4X62 T;  1LKX A;  4ZI3 D;  2HHH T;  3JC6 D;  5H6R B;  3I9W A;  2VQF T;  2JIW A;  3A7M A;  1YW0 A;  3KDS E;  5F8P A;  2LSY A;  4TUY E;  3P7I A;  3MA9 A;  3QOF A;  5JTG A;  3LSV A;  2WDV A;  5FVK A;  2BDE A;  2C5I T;  4O4I E;  3RRC A;  4O4H E;  4DV3 T;  2CXL A;  1KNR A;  2K24 A;  3RIU C;  3RIA A;  4HFH A;  4WNK A;  1ZOY A;  4DUZ T;  2NW7 A;  3SFD A;  2VQE T;  2CA5 A;  2LSJ A;  3QB5 A;  4JI6 T;  3RF1 A;  4H63 V;  3OKQ A;  2QGS A;  2CM0 A;  1NAF A;  4QXH B;  4AQF A;  2G0U A;  2E2A A;  3SRZ A;  3Q5X A;  5JDQ A;  3N9Q A;  2XPK A;  4ANJ A;  3KIN B;  4TWH A;  3ZJ2 A;  4DR7 T;  2WP9 A;  4GKK T;  5KXJ A;  2ES0 A;  4EED A;  1OWA A;  4QHO A;  3MXZ A;  4I4T E;  2XQ8 A;  5F5W A;  3NKZ A;  5ABG A;  2MTQ A;  1T72 A;  3NZP A;  2VVN A;  1OED E;  3RPU A;  2KZ7 B;  2VL8 A;  4WYV A;  1XDO A;  2XQ4 A;  2W00 A;  1FIO A;  2BVL A;  2XTL A;  5FY7 A;  1CUN A;  3GN5 A;  4UVC B;  2D0T A;  5AQI B;  1S94 A;  4YSZ A;  4DV5 T;  1HG2 A;  4JEU B;  2ZM8 A;  5LGT B;  4IDN A;  1XMO T;  4ILA A;  4CXX A;  3EDU A;  4IDZ A;  5FVL A;  3Q9D A;  5CA0 E;  2X67 A;  4EAH A;  4U2Z A;  3UFG A;  4TV9 E;  1IBM T;  1MIV A;  1D1B A;  5LCY A;  3AEF A;  1Y01 A;  5HEU A;  5LNK A;  3I9Y A;  2V6Y B;  4BJM A;  3RGL A;  2WWU A;  3RH3 A;  4EZ4 A;  3UU8 A;  5J2T E;  2X51 A;  3LDQ B;  4IE5 A;  5BR8 T;  1W0A A;  4IE6 A;  1VCS A;  5AQQ B;  2XAQ B;  2C0S A;  3ETU A;  2E5V A;  2YN6 A;  1BR4 A;  3RX6 A;  4YXD A;  4NPP A;  4WZX A;  3HL6 A;  3AAE B;  3ONX A;  1VCT A;  4QX7 B;  2X68 A;  5DQW A;  1J1J A;  2XZE A;  2OLT A;  5AQJ B;  4AQY T;  1O3X A;  5HAX A;  4Z90 A;  3QB5 K;  5LHH B;  3K3O A;  4IHJ E;  2XHE B;  3NVO A;  3CX8 B;  5L3D B;  4CI2 B;  3AE7 A;  3GA8 A;  2HN1 A;  3JCF A;  2RA1 A;  3NRX A;  3CQX C;  5DJQ C;  3QK6 A;  3X1D A;  3I0Q A;  3H3M A;  2XQ3 A;  4LML A;  3N9L A;  4OYK A;  2B1E A;  3TLT A;  5AFU L;  4HFC A;  4QX8 B;  5E0O A;  2N1G A;  2OV9 A;  4JI8 T;  2KMF A;  2LKH A;  3N9N A;  3PUA A;  3PTR B;  2LSK A;  5JDH A;  2W0G A;  2X66 A;  2PTF A;  3Q5D A;  3N9M A;  4LF4 T;  4X5T A;  4YHH T;  1U5P A;  4GYR A;  5JDG A;  2B76 A;  2XAJ B;  3AVR A;  3EI0 A;  5JRC A;  4B3T T;  2VL0 A;  5FXW A;  4HFE A;  3OJA A;  4M1P A;  5C2T A;  2UXX B;  3FB2 A;  4YT0 A;  4U74 A;  2DWK A;  3F57 A;  1HG5 A;  3O1J A;  2WZI A;  2FBW A;  3O1H A;  1WYB A;  5EK3 A;  1WCR A;  2W62 A;  5AQK B;  2W4X A;  1UGO A;  2WCA A;  4PNI A;  4KX6 A;  4HWH A;  2V7J A;  3G06 A;  3KV5 A;  5HXR A;  3UUN A;  4CZZ B;  3N9P A;  5LBM A;  1Z0P A;  1EZ3 A;  3TLS A;  3C4X A;  4AXP A;  1SE7 A;  1QUU A;  1FJG T;  2YEV C;  3NZQ A;  4K0K T;  4ILC A;  1FMW A;  1HR0 T;  2OA5 A;  2NW8 A;  3UQ7 A;  3WAK A;  5FL0 A;  2BS2 A;  5HWX A;  2J1D G;  2WQY A;  4X1I E;  3U78 A;  3EDV A;  4TV8 E;  2KIN B;  5AQH B;  4JI0 T;  2UXB T;  2I6H A;  5A1L A;  3OBV E;  4JI1 T;  2ACX A;  2IAK A;  2A72 A;  4UXN B;  3O4X E;  3GMI A;  5L3B B;  4QH5 A;  2XQ5 A;  2J4G A;  3FZL B;  2RPA A;  4L9I A;  4ZI2 D;  2A9U A;  1D1A A;  2KWI B;  4ZXL A;  2K3W A;  2BKP A;  2ZMA A;  4V1A v;  3LFM A;  4PAG A;  1IBK T;  5LHI B;  4YLH A;  3SWH A;  2CBJ A;  5LA6 E;  4PJN A;  2A2F X;  2JMH A;  5AQN B;  3ZYL A;  3TLU A;  2YDS A;  3ZLI A;  2MAW A;  4KHP T;  3ZCJ A;  3E08 A;  5TAO A;  4IE4 A;  3U3I A;  5AQF B;  1GQE A;  1N33 T;  3AVS A;  4YJ3 E;  4IRE A;  1NEN A;  3BQI A;  3AA7 B;  5AQO B;  3NBX X;  3UQ4 A;  4EXT A;  3M65 A;  5DQV A;  2E8I A;  5IHY A;  1IJ6 A;  4BA9 A;  4P1N A;  1I94 T;  2BVM A;  3OYX A;  4EB6 E;  4QH4 A;  2HPL A;  4NXN T;  4U7I A;  2X9Y A;  2WDR A;  5LG3 A;  4AKL A;  2EHO A;  3F31 A;  2WBL A;  5LGN B;  1VOM A;  5HEO A;  3P4Q A;  2YDR A;  4P0A A;  4PFO A;  2UXN B;  3AEG A;  4CI3 B;  4TNW A;  1KFY A;  1DU2 A;  5IYZ E;  4F8H A;  2JRK A;  1X79 A;  3CML A;  2LSI A;  1E7P A;  1HS7 A;  3P4S A;  5LG4 A;  3F2E A;  3M3Z B;  1R8I A;  3PUW F;  3ZMS B;  4EGW A;  4DBQ A;  2DNX A;  4H9R C;  4B3R T;  4XZC A;  1UCU A;  3DJB A;  3AE8 A;  5HXE A;  4B3S T;  3AE4 A;  2C5K T;  4JBW F;  2V8S V;  4UF0 A;  4U7Y A;  2V1D B;  2BS3 A;  3H37 A;  4CN4 A;  2H7V C;  4H9N C;  4Z91 A;  4DMV A;  4OK0 A;  4IDP A;  4DBR A;  2FJA A;  3UU6 A;  4DV0 T;  4IL4 A;  3UU3 A;  2AE9 A;  5FL1 A;  3ZCI A;  3AB3 B;  3I1A A;  3QC9 A;  3V5U A;  3AA0 B;  2DHR A;  4FJO A;  4HWD A;  4LF5 T;  5AQR B;  2EHO D;  3PE0 A;  2Q9Q C;  2IC9 A;  1HNZ T;  4H9P C;  1XNQ T;  1MMD A;  1WR0 A;  3BQK A;  4O2B E;  1OED A;  4DV2 T;  4TNV A;  4Q25 A;  4LFC T;  5HXH A;  4UEM A;  4JEH B;  4TZ4 C;  3T1H T;  4DV1 T;  4U33 A;  2LM9 A;  5AQU B;  4P09 A;  2WAU A;  3LBX B;  5DAB A;  4MAL A;  2NTY A;  4HKA A;  1YKE B;  2GK9 A;  4H9O C;  3CQC B;  2BBH A;  3C4Z A;  3CKD A;  5L3E B;  3VU7 H;  2NWB A;  3A8Y C;  3PUG A;  2CCQ A;  3UTK A;  3ZJ1 A;  2IIU A;  4EOZ B;  5LHG B;  2VB6 A;  3P50 A;  1ZHC A;  2CLY C;  2A3D A;  3HI2 A;  4X65 T;  2CRB A;  5ABF B;  3WI3 A;  3ZC1 A;  2LHN A;  2V5D A;  5JDM A;  2QA7 A;  3TKL B;  5CFB A;  3O9X A;  4LFA T;  1BR0 A;  3RYC E;  2L3L A;  2K9A A;  3ABV A;  3QUJ A;  4O8S A;  2CEA A;  5JH7 E;  3E0Z A;  3RKG A;  2YDQ A;  3CK6 A;  2CMR A;  1HNX T;  3AAI A;  2XQY A;  4EZH A;  2YU2 A;  3O1I A;  3VRA A;  4KBM B;  4XBF B;  1B7T A;  5L3C B;  3RYI E;  4DR3 T;  3ZYM A;  1HCI A;  4HEA A;  5FP3 A;  2H3R A;  2W61 A;  4Z8X A;  5C3J A;  1MMN A;  3AXJ A;  2LOS A;  5J1G A;  4UEL A;  2N2N A;  4BJN A;  4E7Z A;  2X9X A;  1G73 A;  4LF8 T;  3ESL A;  4UVA B;  3CX6 B;  2LOP A;  3FXD B;  4GOU A;  4IDO A;  4LF7 T;  2F4V T;  2DCF A;  5LXT E;  2M6B A;  4DMW A;  2PG8 A;  1ZP0 A;  2W2U A;  5IUX A;  2V6X A;  4OX9 T;  2WZH A;  3LK4 2;  2BKN A;  4O2A E;  5EK4 A;  3A5X A;  2Q9Q B;  2W67 A;  2ZM2 A;  4FI5 A;  5L3G B;  1W0B A;  2XJ7 A;  4HFI A;  3EUH A;  2UUA T;  4YSX A;  4ZZB A;  4UVB B;  4ZI3 C;  2LKG A;  1M7K A;  3JC6 C;  2EHO C;  1MNE A;  4X64 T;  4PK4 A;  2YK0 A;  2XUE A;  5HEG A;  1D0X A;  3NWI A;  4JV5 T;  3HA4 A;  3ZKR A;  3KBU A;  2J47 A;  4I43 B;  4COF A;  2BG9 C;  4KP3 C;  4F6R C;  4A98 A;  2CPT A;  2FJD A;  3RIF A;  2Y8D A;  3RYF E;  1Z8U A;  1LRZ A;  3W15 B;  3R6N A;  1WR6 A;  2NP9 A;  3EHZ A;  3CWZ B;  2Y6X A;  3ZN0 B;  4DR6 T;  1T98 A;  2XAS B;  4DUY T;  2CLY B;  1XMQ T;  4C90 A;  1N32 T;  5L4H A;  2MYS A;  2Y48 B;  2X0H A;  1D1C A;  4LF6 T;  4CN1 A;  2NOX A;  2ODU A;  4HGA A;  3JAF A;  4ZZC A;  5LJM A;  4OHF A;  4P0B A;  5ADX L;  2WB5 A;  3AE9 A;  5JR9 C;  2IUB A;  4DO0 A;  4YFS A;  2WY2 A;  2WU2 A;  2BS4 A;  2QRX A;  4DR5 T;  2R6G F;  3ZT7 A;  3RC8 A;  2DWG A;  3PUX F;  1NWM X;  2VAS A;  2XAG B;  3QNU A;  4BAY B;  4UV9 B;  2HN2 A;  4A5X A;  2LEH A;  4X66 T;  4AKR B;  4PK6 A;  2LT3 A;  4DV6 T;  2E9X A;  1KNP A;  4QWN B;  4QH1 A;  2LHR A;  3AEC A;  4UR9 A;  3K1S A;  1XNR T;  4YSY A;  3ZEF B;  5FXZ A;  5EZY E;  4IE0 A;  3ONL C;  2LRK A;  2V26 A;  3IEE A;  4K0U A;  4AQF C;  1ZEE A;  2L9Q A;  1CHU A;  1US7 B;  4DV4 T;  4MFR A;  2C5J A;  3ANW A;  4CI1 B;  5ABE A;  3V5S A;  5L2L A;  4KMC A;  5JRE A;  3K8P C;  4PJJ A;  1UUR A;  2VK9 A;  2XM2 A;  2RP4 A;  2EHO B;  4HN9 A;  4IIJ E;  4U3C A;  4PJL A;  2KT9 A;  2X0Y A;  1HNW T;  2VKD A;  4L0R A;  1JNR A;  1UX4 A;  1VRB A;  2BG9 B;  3RIU A;  2E9X D;  2WWV A;  1KNZ A;  3IHR A;  2XSA A;  1XZY A;  2YKS A;  2QYW A;  4AIS A;  4X20 E;  4B3M T;  1HTJ F;  3AEA A;  1KEY A;  1SUM B;  3VR8 A;  3RKO A;  3DTO A;  2M67 A;  2FJE A;  5JDF A;  5FY1 A;  3UUB A;  1SA0 E;  3AAA B;  3RHW A;  5JR9 B;  3ZMV B;  5LBQ B;  3S4U A;  3VHL A;  2LE8 A;  1Y64 B;  1ZV4 X;  5CB4 E;  3AA1 B;  1QSD A;  4PFP A;  1KF6 A;  2IHR 1;  2LRL A;  4HE8 A;  2LJL A;  2VKO A;  3C50 A;  3P4R A;  3HR0 A;  4EYU A;  3LK3 B;  4JLE A;  2KLQ A;  4I50 E;  2UXD T;  3FZF B;  4JYA T;  3PU8 A;  3FBL A;  4XAX B;  4L5G A;  4NUU A;  2H88 A;  2ACZ A;  4U72 A;  2HH7 A;  3KVA A;  4GIW A;  1MMA A;  1T7S A;  4IE7 A;  3KV6 A;  2VVS A;  4YHJ A;  3N2O A;  5LOV E;  2NR4 A;  5AQT B;  4EIW A;  2BKO A;  5JDL A;  1KK7 A;  2L8K A;  2YIN A;  3PU3 A;  4I55 E;  3L39 A;  3FZM B;  2IW5 B;  1QLB A;  3AEB A;  2V5C A;  2H7O A;  3MKD A;  1IBL T;  1MIW A;  4YTP A;  1HX1 B;  3GN5 B;  5KDM C;  4U31 A;  3ZT5 A;  3PJA A;  3C98 B;  1N36 T;  1I6Z A;  1L0V A;  2J62 A;  4HTE A;  4A56 A;  4ASK A;  1MND A;  4IL9 A;  4NIQ A;  2YU1 A;  3HKD E;  5EK2 A;  4G63 A;  4HFD A;  5ABH A;  3IF8 B;  5LGU B;  3VRB A;  2MOZ A;  3P4W A;  2PFV A;  3AE5 A;  3EVY A;  1UX5 A;  5FY0 A;  4OYJ A;  1YD8 G;  2Z6E A;  4IGU A;  4DR1 T;  4DID B;  3UU5 A;  4JI5 T;  4DVD A;  3I0O A;  2CHN A;  4LMJ A;  3D0T A;  3HKC E;  4ZI2 C;  2NTX A;  2E5L T;  4KHZ F;  5L4E A;  4ILU A;  2V7L A;  2UUB T;  3PUQ A;  1BR2 A;  3CVR A;  2AXD S;  2MPK A;  1HF8 A;  2VKH A;  3AE6 A;  2IC6 A;  5HXC A;  4MBQ A;  3FHN A;  1J5E T;  1UK5 A;  4JI7 T;  3T8O A;  2CXD A;  2XY8 B;  2XAF B;  3AED A;  4EYY R;  3IBP A;  4IDQ A;  1NEK A;  2XSB A;  4AKG A;  4OFZ A;  3LK2 B;  3OTO T;  3PUS A;  2UUC T;  2V7I A;  3ZN1 B;  2V7M A;  3C51 A;  1T8B A;  4E7S A;  4O4J E;  2BG9 E;  4MHC A;  2KND A;  3C64 A;  5HCJ A;  1UUS A;  3UU4 A;  4CXW A;  1YKH B;  4KUM B;  4DV7 T;  1YQ3 A;  2X0L B;  3ZMT B;  2JQ9 A;  3N9O A; 
#chains in the Genus database with same CATH homology
 1FMW A;  4B6X A;  1WR6 A;  2NP9 A;  1D0Z A;  3R84 B;  5JDN A;  3CWZ B;  2Y6X A;  3N2K E;  3ZN0 B;  2OA5 A;  5L3F B;  1T98 A;  2XAS B;  5KMG P;  2NW8 A;  2CLY B;  1AJ3 A;  2LSG A;  3WAK A;  4C90 A;  3UFE A;  4ZI7 E;  2MYS A;  2Y48 B;  1D1C A;  5HWX A;  2J1D G;  4X1I E;  1E1H B;  3ZPO A;  3CX7 B;  3LJC A;  3U78 A;  4UV8 B;  3LG7 A;  3EDV A;  3RC3 A;  5C8Y E;  3J9X 1;  4TV8 E;  2NOX A;  2ODU A;  4HGA A;  2KIN B;  5HYA A;  5FXX A;  4C91 A;  4CQI A;  3ZC0 A;  5A1L A;  3RRW A;  5LJM A;  4OHF A;  4P0B A;  5ADX L;  2DLR A;  3UUM A;  3OBV E;  5CA1 E;  3L3P A;  3OYZ A;  4PK5 A;  4WW0 A;  3PUR A;  5JR9 C;  2CE7 A;  2ACX A;  2E9X C;  2IAK A;  3KV9 A;  1OXZ A;  2A72 A;  1WLX A;  4UXN B;  3O4X E;  4DO0 A;  3P8C D;  3GMI A;  4YFS A;  5L3B B;  2CWY A;  4AQG A;  3VKG A;  3RC8 A;  2DWG A;  1U4Q A;  3C4W A;  2XAH B;  1WYC A;  1NWM X;  5KX5 E;  4L9I A;  4ZI2 D;  4GYS A;  1D1A A;  2VAS A;  2KWI B;  1IAP A;  2XAG B;  2ZMA A;  5J2U E;  4V1A v;  3MJX A;  2E9X B;  3LFM A;  4PAG A;  4BAY B;  1ZKE A;  5LHI B;  3MAC A;  4UV9 B;  4YLH A;  5JRC B;  4QKN A;  2LEH A;  4AKR B;  4PK6 A;  3CPZ A;  3SWH A;  2LT3 A;  4WBO A;  5LA6 E;  2P9B A;  1SHZ C;  4ZS2 A;  2NW9 A;  5JR9 A;  2JQQ A;  3UUL A;  2E9X A;  4PJN A;  4GK5 E;  1LKX A;  2A2F X;  2JMH A;  1LVK A;  4ZI3 D;  3Q5W A;  3ZYL A;  5HXS A;  4QWN B;  2LHR A;  3JC6 D;  5H6R B;  3I9W A;  3ZEF B;  1YW0 A;  3KDS E;  5FXZ A;  5F8P A;  2LSY A;  3ZLI A;  5EZY E;  4TUY E;  4IE0 A;  3P7I A;  3MA9 A;  3ANW B;  3ZCJ A;  3E08 A;  5TAO A;  2BDE A;  2V26 A;  4IE4 A;  3IEE A;  3HKB E;  3U3I A;  2C5I T;  4O4I E;  3RRC A;  4K0U A;  1MIY A;  4AQF C;  4O4H E;  1ZEE A;  4X1Y E;  3AVS A;  2L9Q A;  4YJ3 E;  2CXL A;  1US7 B;  2HPJ A;  3BQI A;  2K24 A;  3AA7 B;  5LJN A;  4MFR A;  2C5J A;  3ANW A;  4CI1 B;  3NBX X;  3V5S A;  4EXT A;  3M65 A;  1FMV A;  5DQV A;  2E8I A;  5IHY A;  5L2L A;  3ZYK A;  4KMC A;  2V7K A;  4WNK A;  1IJ5 A;  5JRE A;  3K8P C;  1IJ6 A;  2NW7 A;  4PJJ A;  4BA9 A;  5GON E;  4PJM A;  4YJ2 E;  2VK9 A;  2BVM A;  3OYX A;  2CA5 A;  2RP4 A;  2EHO B;  2LSJ A;  4HN9 A;  4EB6 E;  4IIJ E;  2N9D A;  1V9D A;  2ODV A;  4PJL A;  2HPL A;  2X9Y A;  4WBN E;  3LBX A;  4H63 V;  2KT9 A;  3OKQ A;  3BQL A;  2WM9 A;  4UIG A;  4AKL A;  2QGS A;  2CM0 A;  3ZMU B;  3PDY A;  5BMV E;  1NAF A;  4QXH B;  2VKD A;  4L0R A;  4AQF A;  2EHO A;  2G0U A;  3F31 A;  2WBL A;  5LGN B;  1VOM A;  3SRZ A;  3Q5X A;  5JDQ A;  2K48 A;  2I59 A;  4JUY A;  1UX4 A;  1VRB A;  2WSS V;  4PFO A;  4P0A A;  2UXN B;  4CI3 B;  3N9Q A;  2E9X D;  1KNZ A;  3IHR A;  1IZN B;  5IYZ E;  2D5U A;  2JRK A;  1S35 A;  1X79 A;  4ANJ A;  3CML A;  2LSI A;  3B57 A;  3KIN B;  1HS7 A;  5LG4 A;  3F2E A;  4X20 E;  1HTJ F;  3ZJ2 A;  3ZMS B;  4DBQ A;  2ES0 A;  4CXY A;  2DNX A;  1OWA A;  4H9R C;  4QHO A;  3MXZ A;  3RKO A;  4I4T E;  4XZC A;  3DTO A;  1UCU A;  2M67 A;  3DJB A;  2ZLY A;  2MTQ A;  3K3N A;  5JDF A;  5HXE A;  3RYH E;  1G8X A;  2PJQ A;  3NZP A;  4X1K E;  2C5K T;  5FY1 A;  3SOL A;  1SA0 E;  3RPU A;  2KZ7 B;  2VL8 A;  3AAA B;  4UF0 A;  2V1D B;  2W00 A;  1FIO A;  2BVL A;  5JR9 B;  3H37 A;  2H7V C;  2XTL A;  3ZMV B;  4H9N C;  1WRD A;  5LBQ B;  4DMV A;  1HFA A;  3B13 A;  5FY7 A;  1CUN A;  3S4U A;  4TX5 A;  3GN5 A;  4UVC B;  2D0T A;  3VHL A;  2LE8 A;  4ISS A;  1Y64 B;  4OK0 A;  1ZV4 X;  1S94 A;  5CB4 E;  2X9W A;  3AA1 B;  1QSD A;  4DBR A;  4PFP A;  1HG2 A;  4JEU B;  2ZM8 A;  5LGT B;  3ZCI A;  3AB3 B;  3I1A A;  4AI6 A;  3QC9 A;  4HE8 A;  3AA0 B;  3V5U A;  2LJL A;  2VKO A;  3C50 A;  2DHR A;  4FJO A;  4PW8 A;  2BZB A;  4AKI A;  4CXX A;  3HR0 A;  4EYU A;  2EHO D;  3EDU A;  4IDZ A;  3PE0 A;  5HWY A;  3LK3 B;  2Q9Q C;  4JLE A;  4H9Q C;  2KLQ A;  3Q9D A;  4IST A;  2IC9 A;  5FYM A;  5CA0 E;  2X67 A;  3SS1 A;  3MK7 C;  4EAH A;  4I50 E;  4H9P C;  5ETW A;  1MMD A;  3GWH A;  3PU8 A;  4J2C A;  3FBL A;  3BQK A;  4O2B E;  4TV9 E;  4XAX B;  4L5G A;  1MIV A;  2JPF A;  1D1B A;  4DND A;  5LCY A;  2ZM0 A;  4NUU A;  5HXH A;  4UEM A;  2D2S A;  1D0Y A;  4JEH B;  4TZ4 C;  2CWO A;  2LM9 A;  5LNK A;  3KFW X;  3I9Y A;  4P09 A;  4TN7 B;  4U72 A;  4BJM A;  2WAU A;  3ZMZ B;  3E22 E;  2WWU A;  3RH3 A;  2HH7 A;  4EZ4 A;  3LBX B;  5DAB A;  4MAL A;  2JJ9 A;  2NTY A;  3KVA A;  4HKA A;  5J2T E;  1YKE B;  2GK9 A;  4GIW A;  2X51 A;  3CQC B;  4H9O C;  4IE5 A;  3AA6 B;  1MMA A;  2Q9Q A;  4ZS3 A;  3C4Z A;  3VKH A;  3CKD A;  3Q2M A;  5FXV A;  3HKE E;  5LYJ E;  4IE6 A;  5L3E B;  3VU7 H;  2NWB A;  2XAQ B;  4IE7 A;  1H7C A;  2C0S A;  3PUG A;  3KV6 A;  3ETU A;  2CCQ A;  3UTK A;  3ZJ1 A;  2K5B B;  4ZOL E;  1BR4 A;  3UUX B;  4EOZ B;  4YHJ A;  5LHG B;  3N2O A;  5LOV E;  2VB6 A;  1ZHC A;  2CLY C;  2A3D A;  3RX6 A;  3HI2 A;  4ERR A;  3HL6 A;  4EIW A;  5JQG E;  3AAE B;  3ONX A;  4N78 D;  5FNV E;  3WI3 A;  3ZC1 A;  2LHN A;  5LP6 E;  1LVF A;  4QX7 B;  5JDM A;  2X68 A;  2QA7 A;  3TKL B;  2KXP B;  2CXF A;  3O9X A;  1BR0 A;  5DQW A;  3RYC E;  2L3L A;  5JDL A;  3KVB A;  2K9A A;  5JVD E;  1KK7 A;  2L8K A;  3QUJ A;  2YIN A;  1O3X A;  5HAX A;  4O8S A;  2CEA A;  3PU3 A;  4I55 E;  4O4L E;  5JH7 E;  3E0Z A;  2IW5 B;  5LHH B;  1FEW A;  3K3O A;  2CMR A;  3N5L A;  3AAI A;  2VWA A;  2XQY A;  4MLK A;  4EZH A;  4IHJ E;  4UF0 B;  4AKH A;  2YU2 A;  3O1I A;  4H9S E;  2XHE B;  3J7Y q;  4KBM B;  4XBF B;  1B7T A;  3CX8 B;  5L3D B;  3RYI E;  5L3C B;  4CI2 B;  2H7O A;  3MKD A;  4ADZ A;  1MIW A;  3ZYM A;  3GA8 A;  3GN5 B;  5KDM C;  1HCI A;  4HEA A;  2RA1 A;  3NRX A;  3C98 B;  5FP3 A;  3H3A A;  2H3R A;  2W61 A;  3CQX C;  4Z8X A;  5DJQ C;  3QK6 A;  3FBZ A;  3I0Q A;  1MMN A;  3KBT A;  2LOS A;  5J1G A;  4HTE A;  4UEL A;  4A56 A;  4NUV A;  4QXB B;  4ASK A;  2D0U A;  2N2N A;  4BJN A;  4E7Z A;  1MND A;  2Q9Q D;  2X9X A;  3N9L A;  1G73 A;  2YU1 A;  3HKD E;  4OYK A;  2B1E A;  1HX8 A;  5EK2 A;  4G63 A;  2MBG A;  3ESL A;  3FXE B;  3IF8 B;  5AFU L;  5LGU B;  4UVA B;  2MOZ A;  3CX6 B;  2PFV A;  3EVY A;  4QX8 B;  1UX5 A;  2N1G A;  5E0O A;  5FY0 A;  2W63 A;  2LOP A;  3FXD B;  4OYJ A;  1YD8 G;  2KWH A;  2Z6E A;  4GOU A;  2JMK A;  4IGU A;  4ZHQ E;  2KMF A;  4DVD A;  2DCF A;  3N2G E;  3I0O A;  5LXT E;  4DMW A;  3N9N A;  3UT5 E;  3PUA A;  2PG8 A;  3PTR B;  4G2A A;  3D0T A;  3HKC E;  2LSK A;  3NRY A;  4H63 H;  2NTX A;  4ZI2 C;  2W0G A;  5JDH A;  2X66 A;  1BR1 A;  3N9M A;  4ILU A;  2V7L A;  2SPC A;  5H6Q B;  1U5P A;  2DI4 A;  3LK4 2;  4GYR A;  5JDG A;  2PBI A;  3PUQ A;  1BR2 A;  2XAJ B;  3CVR A;  3AVR A;  4O2A E;  5JRC A;  3CQG B;  5M4Y A;  5FXW A;  3K3Q C;  5EK4 A;  1HF8 A;  2VKH A;  2Q9Q B;  2IC6 A;  2ZM2 A;  3A5X A;  3MZK B;  3OJA A;  4FI5 A;  5HXC A;  5L3G B;  3DP7 A;  4M1P A;  3EUH A;  4MBQ A;  2UXX B;  3FB2 A;  2WMO A;  4U74 A;  2DWK A;  3F57 A;  3FHN A;  5F3J A;  1HG5 A;  3O1J A;  4UVB B;  4ZI3 C;  3O1H A;  2CXD A;  3T8O A;  2XAF B;  1WYB A;  5EK3 A;  4EYY R;  3KV4 A;  3JC6 C;  2EHO C;  1MNE A;  3IBP A;  1MMG A;  4PK4 A;  2W62 A;  4OFZ A;  4QXC B;  4AKG A;  3LK2 B;  2YK0 A;  2XUE A;  4PNI A;  1D0X A;  3PUS A;  2V7J A;  2X9H A;  3L09 A;  3KV5 A;  2V7I A;  3HA4 A;  5HXR A;  3UUN A;  3BK9 A;  3ZN1 B;  3N9P A;  2V7M A;  3KBU A;  4HFV A;  3C51 A;  4CZZ B;  4E7S A;  4O4J E;  5LBM A;  3WAJ A;  1Z0P A;  1EZ3 A;  2WMN A;  3C4X A;  4I43 B;  4MHC A;  2KND A;  3C64 A;  4AXP A;  4KP3 C;  4F6R C;  1QUU A;  3ETV A;  4CXW A;  4GK0 E;  2VKJ A;  1YKH B;  4KUM B;  2Y8D A;  3RYF E;  2X0L B;  1LRZ A;  3W15 B;  5FMN A;  3ZMT B;  2YEV C;  3N9O A;  3NZQ A;  3R6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...