4JEHB

Crystal structure of munc18a and syntaxin1 lacking n-peptide complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
221
structure length
221
Chain Sequence
DRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 1
publication title Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 93
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jehB00
1FEWA 3LG7A 1FIOA 3C98B 5M4YA 4JEHB 2XHEB 1HS7A 1G73A 4JEUB 5LG4A 1S94A 1BR0A 1EZ3A 4TX5A 2DNXA
chains in the Genus database with same CATH superfamily
1OEDC 2LSGA 5AQIB 2Q9QC 4M1PA 5LMNT 4JI4T 1ZP0A 5FKYA 1HFAA 2HN1A 1SE7A 4TNVA 4MLKA 3AE4A 1N36T 2E5VA 1IBLT 1YKHB 2WU5A 3GN5B 4AKIA 3N9MA 5EK4A 5FY7A 2V26A 1N33T 2D2SA 4IE6A 1US7B 5LB7B 1HG2A 1UX4A 5EK3A 2Z6EA 3PUVF 4GK0E 2D0TA 2A3DA 3LBXA 3EAMA 2BS2A 2A9UA 4HFIA 5ABFB 4PAGA 4L5GA 3DJBA 3KINB 2ZM2A 3Q5WA 4DMVA 1HR0T 3KVBA 3F31A 2BVLA 4IT4A 2MBGA 2WM9A 4HWIB 4TNWA 2YKSA 1HNZT 3UU5A 5L4EA 2YDRA 2BKPA 3P7IA 5AFUL 4YY3T 4JI2T 3R84B 3MACA 3F2EA 2JQQA 4OFZA 2WZHA 3U3IA 2LEHA 5ETWA 2R6GF 4NXNT 1WRDA 3UTKA 5A1LA 1HX8A 3AEFA 1WCRA 2J47A 1CUNA 2J62A 5L3CB 3BK9A 1W9RA 2AXDS 4MFRA 4U74A 1OXZA 5AQGB 4H9PC 3ONXA 4DV3T 2LRKA 2LOSA 3P4QA 3QUJA 3VRBA 3M3ZB 3Q5EA 2CBJA 5GONE 5LGTB 4LFAT 5AQKB 2NW9A 1IBMT 1FJGT 4U33A 4COFA 4YTNA 3N9LA 2EHOB 4MHCA 2VKOA 2PJQA 4B3MT 3GA8A 2PFVA 3ABVA 5CB4E 3RRWA 1IAPA 2WP9A 3AVSA 3C4XA 2LJLA 4NUUA 5IWAT 2E9XC 1U5PA 3NVOA 4HWDA 3AAEB 3C4WA 2WU2A 1I6ZA 4DV1T 3RC3A 5ABGA 2WS3A 1J5ET 3FBZA 4TWFA 2V7MA 4DV6T 4YTMA 3NZQA 5HAXA 4YSZA 2NOXA 4AXPA 3ANWB 1MIYA 2ZLYA 3OVUA 5IUXA 5HXEA 4ZHQE 3UU4A 5KXJA 1T98A 2LE8A 5LGUB 1LVFA 4ZS3A 1LVKA 3OKQA 3JAEA 2CLYC 1WLXA 2EHOD 1YQ3A 3PUZF 4O8SA 4AQFC 5C8YE 2IHR1 3AE2A 1B7TA 2VKHA 1BR1A 4LF4T 2QYWA 4DR4T 3ZSSA 3JAFA 2QVAA 2UUCT 3ZCJA 2LSIA 3Q2MA 2LKGA 2KT9A 3QNUA 4YJ3E 3RQUA 2FJAA 3ZYMA 1L0VA 1MIVA 1J5WA 4DUYT 3PUYF 4HFDA 3JADA 1YQ4A 3RRCA 1E2AA 3OYXA 2DI4A 1HNXT 2CEAA 2V7JA 3DP7A 2X9XA 2LLYA 3VKGA 5LBMA 2ZM8A 3MK7C 4LF9T 1SA0E 4QX8B 2WWVA 3CK6A 2H7VC 3N9PA 2VURA 4ANJA 4PK4A 3KBUA 4QXHB 2XQ9A 4EYUA 4IHJE 5JDHA 2BS3A 3I9YA 4CXWA 2FJDA 4TX5A 2H7OA 5LHGB 3B57A 5LMUT 3KVAA 3NRYA 1XMOT 5HEUA 2CMRA 4AIUA 2MYSA 4NXMT 3TLSA 4ASKA 2PBIA 4ZI3C 2YINA 3KV5A 3DTOA 4CI3B 4O2AE 3R6NA 1VCTA 3Q5DA 4LF8T 3ZPOA 4C91A 2LM9A 4BAYB 2BG9B 3OPCA 3ETUA 4IDZA 3TLVA 3QOFA 1D0YA 3ZJ2A 3AAAB 2I59A 3LFMA 2IIUA 4Z8XA 1FIOA 1UUSA 2IUBA 1YD8G 4X66T 2WAUA 3UFEA 3GN5A 3P4PA 2X9YA 2UU9T 1KNZA 4ZS2A 4GOUA 2IMLA 3SFEA 3PUQA 2QGSA 2Y8DA 4ZZBA 2DLRA 2E8IA 3QC9A 2BKOA 3AE5A 4JBWF 2FUPA 2NP9A 2JQ9A 3B5MA 3LDQB 2IC6A 5ABFA 1NENA 4JI5T 2XQ4A 4OK0A 4DIDB 3UT5E 5JDFA 2HPJA 5FVLA 2CWOA 4HFVA 3AXJB 5AQTB 3MXZA 5ADXL 3EVYA 4X1YE 4WW0A 3RIAA 3LJCA 3CWZB 3AE7A 3N9QA 3E08A 5FVKA 1W09A 3KV4A 3AA7B 1OEDB 3BQIA 4DVDA 4L9IA 2ZMAA 3RLFF 2X68A 5AQHB 2ACXA 3AVRA 4HFEA 5JDQA 3N2OA 5FNVE 3AEDA 3F57A 3I9WA 5DQVA 4UF0B 3RF1A 4IIJE 2A72A 4UVAB 5FP3A 3AEGA 2D0UA 3EDVA 3RYHE 2V5CA 2XASB 4HN9A 1HX1B 3JC6C 3CX8B 2DL1A 1KEYA 4A97A 4B6XA 3UU3A 3O1IA 5CFBA 1MMNA 5KDMC 1G73A 5JH7E 4OX9T 1U4QA 2RPAA 2EHOA 2X0HA 3P50A 2BBHA 3EUHA 2IDOB 1FMVA 2VQFT 3N5LA 4DV5T 3AA1B 1KFYA 3VKHA 3G06A 1LKXA 4WBOA 3PURA 2XAFB 3P4SA 3K3QC 3VRAA 2JQHA 3FZLB 5FYMA 5HEJA 3IHRA 5HCJA 2DCFA 4IDNA 5LG4A 4O4JE 3GWHA 5ABHA 4ISSA 2L8KA 1ZOYA 3ANWA 1QLBA 3RX6A 3IF8B 2K9AA 2CBIA 3AAIA 3B13A 3ONJA 2Y48B 3ZEFB 3ZMSB 3ZYKA 5LXTE 3N2GE 2WMNA 4DBRA 1KNPA 2XQ3A 3C64A 4DMWA 1D0XA 2P9BA 4H63H 4CN6A 2WBLA 1HTJF 5JDGA 4UVBB 3IBPA 3EABA 4QX7B 5L3GB 3FBLA 4X20E 1M62A 3FB2A 3NWIA 4U7YA 4YT0A 2KZ7B 2NW8A 2OLTA 4PNIA 4DV4T 2V6YB 2C0SA 5KMGP 2KNDA 2YU2A 1CHUA 3HKEE 2XTLA 3LK42 2A2FX 3PJAJ 1IZNB 4WBNE 1NEKA 5C3JA 5F8PA 2NTYA 4AKRB 1GQEA 3UUBA 1WFDA 2XUEA 1S94A 3UULA 3Q9DA 1FMWA 2E9XD 2NW7A 5FXVA 5AQOB 5HEHA 2H3RA 1LRZA 5HYAA 3KFWX 2FJEA 2OA5A 4KUMB 4HFBA 2DWGA 3SFDA 4X5TA 4CZZB 1E7PA 3NBXX 1OWAA 3PV0F 2XHEB 4EIWA 3AE8A 4AKGA 4EEDA 2JMHA 1I94T 2UUAT 2WQYA 1N34T 4CQIA 1XWMA 2G0UA 2JJ9A 3ZMZB 5JR9A 4PFOA 3AEBA 5JRCA 3AEEA 2SPCA 1DU2A 3K3OA 5AQSB 4AQYT 3RC8A 3PE0A 3UFGA 2K24A 4JI1T 4H9NC 5HXRA 4CN1A 2FBWA 2HHHT 4DV2T 5AQJB 5KX5E 4U2ZA 3MJXA 2VWAA 1MMAA 2X67A 3V5SA 4JI8T 4U7IA 4LFCT 4N78D 1VCSA 3KBTA 5HEGA 3AXJA 4ADZA 4IE7A 2WCAA 5J1GA 4YXDA 4GK5E 4IL9A 3RIUA 1D1AA 5H6RB 4IDOA 4F6RC 5LGNB 3HL6A 4WNKA 2WWUA 3PUAA 2WMOA 3CKDA 3KV9A 4OYJA 1X79A 3PUSA 2VL0A 1ZHCA 1WR0A 4I55E 4AISA 2LM2A 3AE1A 3O1JA 5LCYA 1YKEB 4MALA 1XDPA 2BDEA 5L2LA 3WI3A 4UF0A 2ZM0A 2RP4A 3UUMA 5AQVB 3LBXB 4G63A 3UU6A 4GIWA 2EHOC 4LF6T 2B1EA 2PG8A 3ZKRA 4UXNB 4DV0T 2KMFA 3KDSE 4YHHT 2W4XA 1XDOA 2UXXB 3IEEA 2N2NA 5ABEA 2LSJA 2V7IA 4CN4A 3P4RA 4UIGA 4KHPT 2W0GA 4UV8B 2ZM6T 5AQNB 4I50E 4JEHB 3C51A 2E5LT 2NWBA 4DR6T 2HN2A 3ZT6A 2NTXA 3ZMVB 4ISTA 4PJNA 4GKJT 3T1HT 3ZC0A 2LSKA 4QXBB 4TV9E 4P0BA 4OYKA 4LMJA 1BR2A 1Y64B 4EXTA 4PJJA 3TLTA 3V5UA 2LRLA 4EB6E 5FXXA 4JLEA 2VVSA 4UELA 5IHYA 4L0RA 4YSXA 2XQAA 3LK3B 2ES0A 3EDUA 5FY0A 1KNRA 3AE3A 4DV7T 3UUXB 1SUMB 2XAHB 2JMKA 2CWYA 2V6XA 3OTOT 2F4VT 2UXBT 2HH7A 2YOEA 3ZT5A 5M4YA 2IW5B 3PU8A 1UURA 3RKOA 3ZSTA 3O4XE 2YEVC 3ZN0B 1UK5A 2DWKA 4OHFA 3RPUA 4AKLA 4DR2T 4KBMB 4IGUA 3ZT7A 4Z90A 4LF5T 2W61A 5L3FB 2BG9E 2X66A 4I0UA 3ZLIA 4H9OC 3VHLA 2CCQA 3UQ7A 4PK6A 2W67A 4ZI7E 4EV6A 3N2KE 5LJMA 3EI0A 3CMLA 1VRBA 4ILAA 1D0ZA 1YXRA 4H9QC 1YW0A 1WR6A 2LSYA 4UVCB 1IBKT 4E7ZA 4ZI2D 4DBQA 5F5WA 2UXDT 2V6YA 1ZKEA 4P0AA 2Q9QB 2C5IT 3BQLA 1MNDA 5CA0E 2WSSV 4GKKT 1XZYA 1D1BA 5J2TE 3OYZA 2X0LB 4O4LE 3L3PA 3SRZA 2XQ7A 3HA4A 3VR8A 4LFBT 3PTRB 4B3ST 2DHRA 2AE9A 1N32T 5DJQC 1WYBA 1MMGA 3FXDB 3ZCIA 4QH5A 4ZEYA 4G2AA 2VQET 4X1IE 2X9HA 1W0BA 2XM1A 4BJMA 4I4TE 1OEDE 2CE7A 1IJ5A 3GMIA 5IYZE 5HEOA 2V7LA 3FZKB 4H63V 2FJBA 5LG3A 2X51A 4IL4A 5AQRB 3VR9A 2C5KT 4C90A 5L47A 5JR9C 2CPTA 2Q9QD 3AECA 3FZFB 1MIWA 2W00A 4WYVA 1HG5A 3A7MA 5JDMA 3AEAA 4X65T 4E7SA 4IDPA 2LHRA 5FMNA 4LF7T 4EGWA 3QB5K 4FI5A 4LMKA 4U2YA 3VU7H 3PU3A 2C5JA 4PFPA 3RKGA 2VL8A 4HFHA 2XQ5A 3H3AA 4DR5T 3FXEB 3RIUC 2VB6A 4HGAA 4NUVA 4A98A 2IC9A 4GYRA 2XPKA 3O1HA 2WY2A 3J9X1 2K3WA 2M6IA 4HWFA 1UCUA 3CQGB 3T1YT 1X9BA 3ETVA 3S4UA 5HXCA 3SS1A 3C50A 3AA0B 4X62T 4K0KT 2PTFA 4JI3T 4F8HA 2K5BB 3MA9A 5LA6E 5AQMB 4XZCA 3O9XA 2IAKA 1Z0PA 2E9XB 1UGOA 2W66A 4HEAA 3RYCE 3RIFA 5LBQB 2CA5A 1O3XA 4AKHA 2XQ6A 4UEMA 2BBJA 1HS7A 4IE0A 2WDQA 2MOZA 4X1KE 1T72A 1NAFA 2XAJB 3C98B 3SOLA 2WDVA 5LHIB 3N9NA 3CX6B 3SWHA 4WZXA 5L3EB 4HFCA 4HTEA 2ODVA 3PUWF 3K8PC 2CXFA 4EOZB 5LYJE 4B3TT 5HXSA 1JNRA 5FXWA 3H37A 2CHNA 3AA6B 3D0TA 4P09A 2MTQA 2XAGB 4YHJA 5JREA 4IDQA 1D1CA 2CLYB 2KWHA 3PJAA 4KMCA 5HWXA 2MPKA 4JEUB 4QWNB 3U78A 3ZN1B 4QKNA 4PK5A 5H6QB 5LNKA 4U31A 1Z8UA 2BG9A 3AE9A 2XAQB 3WAJA 3Q5XA 2XM2A 2DNXA 2I6HA 4YTPA 5C2TA 4AI6A 2ODUA 2WB5A 1W0AA 4JV5T 3UQ4A 5CGMA 2X0YA 2XQYA 2CXDA 5FL0A 1M7KA 1MMDA 4U3CA 4U72A 5E0OA 3I0QA 2XJ7A 1G8XA 2J4GA 2N9DA 2UUBT 1WYCA 2JIWA 4IE4A 3QB5A 3P4WA 4J2CA 4JUYA 5LHHB 4TV8E 1KF6A 1JNZA 3HKBE 4LMLA 4EZHA 3J7Yq 4GYSA 1T7SA 2RA1A 2LKHA 4QXCB 2QRXA 5LOVE 2XSBA 2W63A 4CXYA 4YSYA 3RI5A 3LG7A 5JTGA 5LJNA 3LK2B 3TLUA 2D5UA 5L4HA 1OEDA 2D9DA 2XSAA 2Q9QA 2CM0A 2H89A 2MAWA 2VVNA 2WDRA 1R8IA 4EYYR 2BS4A 3AE6A 5AQPB 5LP6E 2YK0A 4HWCA 3CIRA 3L8RA 3RGLA 4JYAT 2YU1A 2K48A 3N9OA 4XAXB 2LT3A 4O4HE 4TWHA 2JRKA 4I43B 4QHOA 4TUYE 3HKDE 4QH1A 3TKLB 4FJOA 2YDSA 4KHZF 4IE5A 3FZHB 4DNDA 3RYFE 5EK2A 1ZV4X 2B76A 3HR0A 5TAOA 2W62A 4UV9B 4ZI3D 4NPPA 4A56A 3CVRA 5AQQB 2V5DA 2BKNA 1VOMA 4ILBA 1XMQT 2W2UA 3CQXC 5JQGE 3ESLA 3ZMTB 5CA1E 5FL1A 4PW8A 5HXHA 4DR3T 4EAHA 2UXCT 3UUNA 2Y6XA 5L3DB 3RYIE 4DR7T 4XBFB 3BQKA 3CX7B 1EZ3A 5FY1A 3A8YC 4JI0T 1NWMX 3X1DA 1HCIA 2N1GA 1J1JA 4CI1B 1UX5A 3FZMB 3EHZA 2M67A 4JI6T 5HCMA 3W15B 4DR1T 3I0OA 4PJLA 2VKJA 2H88A 4TZ4C 2J1DG 3ZMUB 5BR8T 2L3LA 4EZ4A 5BMVE 2HPLA 2KINB 5DABA 4ILCA 4V1Av 4KX6A 4BJNA 5HWYA 2CHOA 4HKAA 3CQCB 2JQKA 2VKDA 3NZPA 4HE8A 3NKZA 3HKCE 3ZYLA 1T8BA 4KI0F 3RH3A 2KLQA 3OBVE 3AB3B 3PUGA 1KK7A 3IA3A 4Q25A 4CXXA 5JVDE 2JPFA 3MKDA 4X64T 5FXZA 4EEBA 4JI7T 3I1AA 1IJ6A 3P8CD 4KP3C 2LOPA 3OJAA 5JR9B 3CPZA 1MNEA 4DUZT 4ZXLA 5JRCB 2E9XA 4TN7B 2V8SV 1HF8A 3H3MA 2CRBA 3WAKA 2BVMA 2KXPB 3C4ZA 2CXLA 4TWDA 2GK9A 2YDQA 5L3BB 4P1NA 5JDNA 3JCFA 2X9WA 1HNWT 1V9DA 5F3JA 4ILUA 1E1HB 4BA9A 3JC6D 2KWIB 4H9RC 1AJ3A 4H9SE 5EZYE 5AQFB 5AQUB 1H7CA 2V7KA 4YJ2E 1BR0A 3PDYA 3K1SA 4Z91A 1XNRT 2XY8B 2BG9C 1SHZC 3K3NA 4QH4A 2ACZA 4AQFA 4UR9A 4YFSA 2LHNA 4ZI2C 2M6BA 3PUXF 2VASA 2OV9A 3LSVA 5DQWA 4A5XA 2XQ8A 2E2AA 2NR4A 3A5XA 3RQWA 1QUUA 2QA7A 3FHNA 1BR4A 4AQGA 4YLHA 1ZEEA 4CI2B 1QSDA 2UXNB 4K0UA 5AQLB 3MZKB 3ONLC 3HI2A 4PJMA 3L39A 2WZIA 1S35A 2VK9A 4ERRA 4NIQA 5J0ZA 3UU8A 4ZZCA 1Y01A 3T8OA 4IREA 4B3RT 3KV6A 3RHWA 4MBQA 5CJ5A 4HWHA 3E22E 3ZJ1A 2BZBA 3TLWA 2KSRA 4O4IE 4DO0A 4O2BE 3NRXA 3QK6A 2V1DB 1FEWA 2YN6A 3E0ZA 3ZC1A 2XZEA 1XNQT 4ZOLE 3M65A 2I0MA 5J2UE 2L9QA 3L09A 5JDLA
chains in the Genus database with same CATH topology
4OK0A 4AI6A 2LSGA 3UT5E 2ODUA 4GIWA 2EHOC 2Q9QC 5JDFA 4M1PA 2HPJA 2B1EA 2PG8A 1HFAA 4UXNB 2CWOA 2KMFA 4HFVA 3KDSE 3MXZA 5ADXL 4MLKA 3EVYA 4X1YE 4WW0A 2UXXB 3IEEA 2N2NA 1YKHB 2XQYA 3CWZB 2LSJA 3LJCA 3N9QA 2V7IA 3E08A 2CXDA 3GN5B 3KV4A 3AA7B 4AKIA 3BQIA 3N9MA 1MMDA 5EK4A 4UIGA 5FY7A 2W0GA 4UV8B 4U72A 2V26A 5E0OA 3I0QA 4DVDA 2D2SA 4I50E 2ZMAA 4IE6A 4JEHB 4L9IA 3C51A 1US7B 1G8XA 1HG2A 2X68A 2ACXA 2N9DA 1UX4A 3AVRA 5EK3A 5JDQA 2NWBA 1WYCA 2Z6EA 4IE4A 4J2CA 3N2OA 4JUYA 5LHHB 4GK0E 4TV8E 5FNVE 3F57A 2NTXA 3I9WA 3ZMVB 3HKBE 5DQVA 4UF0B 2D0TA 4ISTA 4PJNA 4EZHA 2A3DA 4IIJE 3LBXA 3ZC0A 2A72A 2LSKA 4UVAB 3J7Yq 4QXBB 5FP3A 4GYSA 4TV9E 2D0UA 3EDVA 4P0BA 2RA1A 4OYKA 3RYHE 4QXCB 2XASB 5LOVE 1BR2A 1Y64B 2W63A 4HN9A 4CXYA 4PAGA 4PJJA 4EXTA 3JC6C 3CX8B 3V5UA 4L5GA 4B6XA 3DJBA 4EB6E 3LG7A 4JLEA 3O1IA 5FXXA 3KINB 4UELA 2ZM2A 5LJNA 3LK2B 3Q5WA 5IHYA 1MMNA 3KVBA 3F31A 2BVLA 4L0RA 4DMVA 3LK3B 2ES0A 3EDUA 5FY0A 2MBGA 2WM9A 5KDMC 1G73A 3UUXB 2XAHB 2JMKA 5JH7E 2CWYA 2D5UA 1U4QA 2HH7A 2EHOA 5M4YA 2IW5B 2Q9QA 2CM0A 3EUHA 3PU8A 3RKOA 3P7IA 1FMVA 4EYYR 3O4XE 3N5LA 5AFUL 2YEVC 3ZN0B 3R84B 5LP6E 3AA1B 2DWKA 3MACA 4OHFA 3RPUA 2YK0A 3F2EA 4AKLA 4KBMB 3VKHA 4IGUA 1LKXA 2JQQA 2YU1A 4OFZA 2K48A 3N9OA 4WBOA 3PURA 2W61A 5L3FB 4XAXB 3U3IA 2LEHA 2LT3A 2XAFB 3K3QC 5ETWA 2X66A 4O4HE 3ZLIA 4H9OC 5FYMA 2JRKA 4I43B 4QHOA 3VHLA 1WRDA 2CCQA 4PK6A 4TUYE 3IHRA 3HKDE 2DCFA 3UTKA 4ZI7E 5A1LA 1HX8A 3N2KE 5LG4A 5LJMA 4O4JE 3TKLB 4FJOA 3CMLA 1VRBA 1CUNA 3GWHA 1D0ZA 4IE5A 5L3CB 4DNDA 3RYFE 3BK9A 4H9QC 1YW0A 4ISSA 2L8KA 4MFRA 1WR6A 4U74A 5EK2A 1OXZA 2LSYA 4H9PC 1ZV4X 3ONXA 5TAOA 3ANWA 3HR0A 2W62A 4UVCB 3RX6A 4UV9B 3IF8B 4ZI3D 2LOSA 2K9AA 3QUJA 4E7ZA 4ZI2D 4DBQA 5GONE 5LGTB 4A56A 3CVRA 2NW9A 1VOMA 3AAIA 3N9LA 2EHOB 1ZKEA 3B13A 4MHCA 4P0AA 3CQXC 2VKOA 2Q9QB 2PJQA 2C5IT 5JQGE 3GA8A 3BQLA 2PFVA 5CB4E 1MNDA 3RRWA 2Y48B 3ESLA 1IAPA 5CA0E 3ZMTB 5CA1E 4PW8A 2WSSV 5HXHA 4EAHA 3AVSA 3C4XA 3UUNA 1D1BA 3ZEFB 2LJLA 3ZMSB 5J2TE 4NUUA 3OYZA 3ZYKA 5LXTE 2E9XC 3N2GE 2Y6XA 5L3DB 2WMNA 2X0LB 1U5PA 3L3PA 4O4LE 3RYIE 3SRZA 4XBFB 4DBRA 3HA4A 3BQKA 3CX7B 1EZ3A 3PTRB 3AAEB 3C4WA 2DHRA 5FY1A 1NWMX 5DJQC 1HCIA 2N1GA 4CI1B 1WYBA 3C64A 4DMWA 1D0XA 1UX5A 2P9BA 1MMGA 3FXDB 4H63H 2M67A 3ZCIA 2WBLA 3RC3A 3W15B 1HTJF 3I0OA 4G2AA 3FBZA 4PJLA 2VKJA 4X1IE 2X9HA 2V7MA 5JDGA 4TZ4C 2J1DG 4UVBB 3IBPA 3ZMUB 3NZQA 5HAXA 4BJMA 2L3LA 4EZ4A 5BMVE 2HPLA 2NOXA 4I4TE 4QX7B 4AXPA 2KINB 2CE7A 1IJ5A 5DABA 3ANWB 4V1Av 3GMIA 5L3GB 1MIYA 5IYZE 4BJNA 3FBLA 4X20E 2V7LA 2ZLYA 5HWYA 3FB2A 4HKAA 4ZHQE 5HXEA 4H63V 1T98A 2KZ7B 2NW8A 3CQCB 2LE8A 4PNIA 2X51A 2VKDA 5LGUB 2C0SA 5KMGP 2KNDA 2YU2A 3NZPA 1LVFA 4ZS3A 1LVKA 3OKQA 4HE8A 3HKCE 3HKEE 3ZYLA 2XTLA 2C5KT 4C90A 2CLYC 3RH3A 5JR9C 3LK42 1WLXA 2A2FX 2EHOD 2KLQA 3OBVE 2Q9QD 3AB3B 1IZNB 3PUGA 4WBNE 1KK7A 1MIWA 2W00A 4CXXA 1HG5A 2JPFA 3MKDA 4O8SA 5JVDE 5JDMA 5FXZA 5F8PA 4AQFC 5C8YE 3I1AA 1B7TA 1IJ6A 2VKHA 1BR1A 4E7SA 3P8CD 2LHRA 4KP3C 2NTYA 5FMNA 2LOPA 3OJAA 5JR9B 3CPZA 1MNEA 5JRCB 2E9XA 3ZCJA 4FI5A 4AKRB 2LSIA 3Q2MA 2KT9A 4YJ3E 3VU7H 4TN7B 1HF8A 3PU3A 3ZYMA 2C5JA 1MIVA 3WAKA 2BVMA 2KXPB 2XUEA 1S94A 2VL8A 4PFPA 3UULA 3Q9DA 1FMWA 2E9XD 2NW7A 5FXVA 3RRCA 3C4ZA 3OYXA 3H3AA 2H3RA 2CXLA 2DI4A 3FXEB 2CEAA 2VB6A 4HGAA 4NUVA 2V7JA 3DP7A 2GK9A 1LRZA 2X9XA 5HYAA 3KFWX 3VKGA 5L3BB 2OA5A 4KUMB 2IC9A 4GYRA 2DWGA 5LBMA 2ZM8A 3MK7C 3O1HA 3J9X1 4CZZB 5JDNA 3NBXX 1SA0E 2X9WA 4QX8B 1V9DA 5F3JA 4ILUA 1E1HB 2H7VC 1OWAA 4BA9A 3JC6D 2KWIB 4H9RC 1AJ3A 1UCUA 3N9PA 4H9SE 2XHEB 3CQGB 4ANJA 5EZYE 4PK4A 3KBUA 4QXHB 4EIWA 4EYUA 4AKGA 1H7CA 2V7KA 2JMHA 4IHJE 5JDHA 3ETVA 3I9YA 4CXWA 4YJ2E 4TX5A 3S4UA 1BR0A 5HXCA 3SS1A 2H7OA 4CQIA 2G0UA 5LHGB 3C50A 3AA0B 3PDYA 3B57A 2JJ9A 3ZMZB 5JR9A 4PFOA 5JRCA 3KVAA 3NRYA 2K5BB 2SPCA 2CMRA 3K3OA 3MA9A 4XZCA 5LA6E 3O9XA 2IAKA 1SHZC 1Z0PA 3K3NA 3RC8A 2E9XB 3PE0A 2MYSA 4ASKA 2PBIA 4AQFA 2K24A 4ZI3C 4H9NC 4HEAA 2YINA 3KV5A 5LBQB 5HXRA 3DTOA 4YFSA 3RYCE 2LHNA 4ZI2C 2CA5A 1O3XA 4CI3B 4O2AE 3R6NA 4AKHA 2VASA 4UEMA 1HS7A 4IE0A 3ZPOA 4C91A 5KX5E 2LM9A 5DQWA 2MOZA 3MJXA 4X1KE 2VWAA 4BAYB 1NAFA 3ETUA 1MMAA 2XAJB 2X67A 4IDZA 3A5XA 3C98B 3SOLA 3V5SA 1QUUA 2QA7A 5LHIB 1D0YA 3FHNA 1BR4A 3ZJ2A 4AQGA 4YLHA 3AAAB 3N9NA 2I59A 4N78D 3KBTA 1ZEEA 3CX6B 3SWHA 1QSDA 4CI2B 4ADZA 2UXNB 4IE7A 3LFMA 4HTEA 4GK5E 4K0UA 4Z8XA 1FIOA 5J1GA 5L3EB 1D1AA 2ODVA 5H6RB 3MZKB 3HI2A 4PJMA 1YD8G 3K8PC 2CXFA 2WAUA 3UFEA 3GN5A 4F6RC 2X9YA 5LGNB 4EOZB 3HL6A 5LYJE 1S35A 5HXSA 4WNKA 2WWUA 3PUAA 2VK9A 4ZS2A 1KNZA 4ERRA 2WMOA 3CKDA 3KV9A 4OYJA 1X79A 5FXWA 3H37A 4GOUA 3PUSA 3T8OA 1ZHCA 3AA6B 3D0TA 4P09A 4I55E 2MTQA 3PUQA 2XAGB 3KV6A 4YHJA 5JREA 3O1JA 5LCYA 1D1CA 2CLYB 2QGSA 4MBQA 2KWHA 2Y8DA 1YKEB 4KMCA 3E22E 4MALA 2BDEA 5HWXA 3ZJ1A 2BZBA 2DLRA 4JEUB 4QWNB 4O4IE 4DO0A 5L2LA 2E8IA 3QC9A 3WI3A 4O2BE 4UF0A 3NRXA 3QK6A 3U78A 2ZM0A 3ZN1B 2V1DB 2RP4A 1FEWA 3UUMA 3E0ZA 2NP9A 4QKNA 3ZC1A 4PK5A 5H6QB 5LNKA 4ZOLE 3M65A 2IC6A 5J2UE 3LBXB 2L9QA 2XAQB 3L09A 3WAJA 4G63A 3Q5XA 5JDLA 2DNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEW A;  3LG7 A;  1FIO A;  3C98 B;  5M4Y A;  4JEH B;  2XHE B;  1HS7 A;  1G73 A;  4JEU B;  5LG4 A;  1S94 A;  1BR0 A;  1EZ3 A;  4TX5 A;  2DNX A; 
#chains in the Genus database with same CATH topology
 1OED C;  2LSG A;  5AQI B;  2Q9Q C;  4M1P A;  5LMN T;  4JI4 T;  1ZP0 A;  5FKY A;  1HFA A;  2HN1 A;  1SE7 A;  4TNV A;  4MLK A;  3AE4 A;  1N36 T;  2E5V A;  1IBL T;  1YKH B;  2WU5 A;  3GN5 B;  4AKI A;  3N9M A;  5EK4 A;  5FY7 A;  2V26 A;  1N33 T;  2D2S A;  4IE6 A;  1US7 B;  5LB7 B;  1HG2 A;  1UX4 A;  5EK3 A;  2Z6E A;  3PUV F;  4GK0 E;  2D0T A;  2A3D A;  3LBX A;  3EAM A;  2BS2 A;  2A9U A;  4HFI A;  5ABF B;  4PAG A;  4L5G A;  3DJB A;  3KIN B;  2ZM2 A;  3Q5W A;  4DMV A;  1HR0 T;  3KVB A;  3F31 A;  2BVL A;  4IT4 A;  2MBG A;  2WM9 A;  4HWI B;  4TNW A;  2YKS A;  1HNZ T;  3UU5 A;  5L4E A;  2YDR A;  2BKP A;  3P7I A;  5AFU L;  4YY3 T;  4JI2 T;  3R84 B;  3MAC A;  3F2E A;  2JQQ A;  4OFZ A;  2WZH A;  3U3I A;  2LEH A;  5ETW A;  2R6G F;  4NXN T;  1WRD A;  3UTK A;  5A1L A;  1HX8 A;  3AEF A;  1WCR A;  2J47 A;  1CUN A;  2J62 A;  5L3C B;  3BK9 A;  1W9R A;  2AXD S;  4MFR A;  4U74 A;  1OXZ A;  5AQG B;  4H9P C;  3ONX A;  4DV3 T;  2LRK A;  2LOS A;  3P4Q A;  3QUJ A;  3VRB A;  3M3Z B;  3Q5E A;  2CBJ A;  5GON E;  5LGT B;  4LFA T;  5AQK B;  2NW9 A;  1IBM T;  1FJG T;  4U33 A;  4COF A;  4YTN A;  3N9L A;  2EHO B;  4MHC A;  2VKO A;  2PJQ A;  4B3M T;  3GA8 A;  2PFV A;  3ABV A;  5CB4 E;  3RRW A;  1IAP A;  2WP9 A;  3AVS A;  3C4X A;  2LJL A;  4NUU A;  5IWA T;  2E9X C;  1U5P A;  3NVO A;  4HWD A;  3AAE B;  3C4W A;  2WU2 A;  1I6Z A;  4DV1 T;  3RC3 A;  5ABG A;  2WS3 A;  1J5E T;  3FBZ A;  4TWF A;  2V7M A;  4DV6 T;  4YTM A;  3NZQ A;  5HAX A;  4YSZ A;  2NOX A;  4AXP A;  3ANW B;  1MIY A;  2ZLY A;  3OVU A;  5IUX A;  5HXE A;  4ZHQ E;  3UU4 A;  5KXJ A;  1T98 A;  2LE8 A;  5LGU B;  1LVF A;  4ZS3 A;  1LVK A;  3OKQ A;  3JAE A;  2CLY C;  1WLX A;  2EHO D;  1YQ3 A;  3PUZ F;  4O8S A;  4AQF C;  5C8Y E;  2IHR 1;  3AE2 A;  1B7T A;  2VKH A;  1BR1 A;  4LF4 T;  2QYW A;  4DR4 T;  3ZSS A;  3JAF A;  2QVA A;  2UUC T;  3ZCJ A;  2LSI A;  3Q2M A;  2LKG A;  2KT9 A;  3QNU A;  4YJ3 E;  3RQU A;  2FJA A;  3ZYM A;  1L0V A;  1MIV A;  1J5W A;  4DUY T;  3PUY F;  4HFD A;  3JAD A;  1YQ4 A;  3RRC A;  1E2A A;  3OYX A;  2DI4 A;  1HNX T;  2CEA A;  2V7J A;  3DP7 A;  2X9X A;  2LLY A;  3VKG A;  5LBM A;  2ZM8 A;  3MK7 C;  4LF9 T;  1SA0 E;  4QX8 B;  2WWV A;  3CK6 A;  2H7V C;  3N9P A;  2VUR A;  4ANJ A;  4PK4 A;  3KBU A;  4QXH B;  2XQ9 A;  4EYU A;  4IHJ E;  5JDH A;  2BS3 A;  3I9Y A;  4CXW A;  2FJD A;  4TX5 A;  2H7O A;  5LHG B;  3B57 A;  5LMU T;  3KVA A;  3NRY A;  1XMO T;  5HEU A;  2CMR A;  4AIU A;  2MYS A;  4NXM T;  3TLS A;  4ASK A;  2PBI A;  4ZI3 C;  2YIN A;  3KV5 A;  3DTO A;  4CI3 B;  4O2A E;  3R6N A;  1VCT A;  3Q5D A;  4LF8 T;  3ZPO A;  4C91 A;  2LM9 A;  4BAY B;  2BG9 B;  3OPC A;  3ETU A;  4IDZ A;  3TLV A;  3QOF A;  1D0Y A;  3ZJ2 A;  3AAA B;  2I59 A;  3LFM A;  2IIU A;  4Z8X A;  1FIO A;  1UUS A;  2IUB A;  1YD8 G;  4X66 T;  2WAU A;  3UFE A;  3GN5 A;  3P4P A;  2X9Y A;  2UU9 T;  1KNZ A;  4ZS2 A;  4GOU A;  2IML A;  3SFE A;  3PUQ A;  2QGS A;  2Y8D A;  4ZZB A;  2DLR A;  2E8I A;  3QC9 A;  2BKO A;  3AE5 A;  4JBW F;  2FUP A;  2NP9 A;  2JQ9 A;  3B5M A;  3LDQ B;  2IC6 A;  5ABF A;  1NEN A;  4JI5 T;  2XQ4 A;  4OK0 A;  4DID B;  3UT5 E;  5JDF A;  2HPJ A;  5FVL A;  2CWO A;  4HFV A;  3AXJ B;  5AQT B;  3MXZ A;  5ADX L;  3EVY A;  4X1Y E;  4WW0 A;  3RIA A;  3LJC A;  3CWZ B;  3AE7 A;  3N9Q A;  3E08 A;  5FVK A;  1W09 A;  3KV4 A;  3AA7 B;  1OED B;  3BQI A;  4DVD A;  4L9I A;  2ZMA A;  3RLF F;  2X68 A;  5AQH B;  2ACX A;  3AVR A;  4HFE A;  5JDQ A;  3N2O A;  5FNV E;  3AED A;  3F57 A;  3I9W A;  5DQV A;  4UF0 B;  3RF1 A;  4IIJ E;  2A72 A;  4UVA B;  5FP3 A;  3AEG A;  2D0U A;  3EDV A;  3RYH E;  2V5C A;  2XAS B;  4HN9 A;  1HX1 B;  3JC6 C;  3CX8 B;  2DL1 A;  1KEY A;  4A97 A;  4B6X A;  3UU3 A;  3O1I A;  5CFB A;  1MMN A;  5KDM C;  1G73 A;  5JH7 E;  4OX9 T;  1U4Q A;  2RPA A;  2EHO A;  2X0H A;  3P50 A;  2BBH A;  3EUH A;  2IDO B;  1FMV A;  2VQF T;  3N5L A;  4DV5 T;  3AA1 B;  1KFY A;  3VKH A;  3G06 A;  1LKX A;  4WBO A;  3PUR A;  2XAF B;  3P4S A;  3K3Q C;  3VRA A;  2JQH A;  3FZL B;  5FYM A;  5HEJ A;  3IHR A;  5HCJ A;  2DCF A;  4IDN A;  5LG4 A;  4O4J E;  3GWH A;  5ABH A;  4ISS A;  2L8K A;  1ZOY A;  3ANW A;  1QLB A;  3RX6 A;  3IF8 B;  2K9A A;  2CBI A;  3AAI A;  3B13 A;  3ONJ A;  2Y48 B;  3ZEF B;  3ZMS B;  3ZYK A;  5LXT E;  3N2G E;  2WMN A;  4DBR A;  1KNP A;  2XQ3 A;  3C64 A;  4DMW A;  1D0X A;  2P9B A;  4H63 H;  4CN6 A;  2WBL A;  1HTJ F;  5JDG A;  4UVB B;  3IBP A;  3EAB A;  4QX7 B;  5L3G B;  3FBL A;  4X20 E;  1M62 A;  3FB2 A;  3NWI A;  4U7Y A;  4YT0 A;  2KZ7 B;  2NW8 A;  2OLT A;  4PNI A;  4DV4 T;  2V6Y B;  2C0S A;  5KMG P;  2KND A;  2YU2 A;  1CHU A;  3HKE E;  2XTL A;  3LK4 2;  2A2F X;  3PJA J;  1IZN B;  4WBN E;  1NEK A;  5C3J A;  5F8P A;  2NTY A;  4AKR B;  1GQE A;  3UUB A;  1WFD A;  2XUE A;  1S94 A;  3UUL A;  3Q9D A;  1FMW A;  2E9X D;  2NW7 A;  5FXV A;  5AQO B;  5HEH A;  2H3R A;  1LRZ A;  5HYA A;  3KFW X;  2FJE A;  2OA5 A;  4KUM B;  4HFB A;  2DWG A;  3SFD A;  4X5T A;  4CZZ B;  1E7P A;  3NBX X;  1OWA A;  3PV0 F;  2XHE B;  4EIW A;  3AE8 A;  4AKG A;  4EED A;  2JMH A;  1I94 T;  2UUA T;  2WQY A;  1N34 T;  4CQI A;  1XWM A;  2G0U A;  2JJ9 A;  3ZMZ B;  5JR9 A;  4PFO A;  3AEB A;  5JRC A;  3AEE A;  2SPC A;  1DU2 A;  3K3O A;  5AQS B;  4AQY T;  3RC8 A;  3PE0 A;  3UFG A;  2K24 A;  4JI1 T;  4H9N C;  5HXR A;  4CN1 A;  2FBW A;  2HHH T;  4DV2 T;  5AQJ B;  5KX5 E;  4U2Z A;  3MJX A;  2VWA A;  1MMA A;  2X67 A;  3V5S A;  4JI8 T;  4U7I A;  4LFC T;  4N78 D;  1VCS A;  3KBT A;  5HEG A;  3AXJ A;  4ADZ A;  4IE7 A;  2WCA A;  5J1G A;  4YXD A;  4GK5 E;  4IL9 A;  3RIU A;  1D1A A;  5H6R B;  4IDO A;  4F6R C;  5LGN B;  3HL6 A;  4WNK A;  2WWU A;  3PUA A;  2WMO A;  3CKD A;  3KV9 A;  4OYJ A;  1X79 A;  3PUS A;  2VL0 A;  1ZHC A;  1WR0 A;  4I55 E;  4AIS A;  2LM2 A;  3AE1 A;  3O1J A;  5LCY A;  1YKE B;  4MAL A;  1XDP A;  2BDE A;  5L2L A;  3WI3 A;  4UF0 A;  2ZM0 A;  2RP4 A;  3UUM A;  5AQV B;  3LBX B;  4G63 A;  3UU6 A;  4GIW A;  2EHO C;  4LF6 T;  2B1E A;  2PG8 A;  3ZKR A;  4UXN B;  4DV0 T;  2KMF A;  3KDS E;  4YHH T;  2W4X A;  1XDO A;  2UXX B;  3IEE A;  2N2N A;  5ABE A;  2LSJ A;  2V7I A;  4CN4 A;  3P4R A;  4UIG A;  4KHP T;  2W0G A;  4UV8 B;  2ZM6 T;  5AQN B;  4I50 E;  4JEH B;  3C51 A;  2E5L T;  2NWB A;  4DR6 T;  2HN2 A;  3ZT6 A;  2NTX A;  3ZMV B;  4IST A;  4PJN A;  4GKJ T;  3T1H T;  3ZC0 A;  2LSK A;  4QXB B;  4TV9 E;  4P0B A;  4OYK A;  4LMJ A;  1BR2 A;  1Y64 B;  4EXT A;  4PJJ A;  3TLT A;  3V5U A;  2LRL A;  4EB6 E;  5FXX A;  4JLE A;  2VVS A;  4UEL A;  5IHY A;  4L0R A;  4YSX A;  2XQA A;  3LK3 B;  2ES0 A;  3EDU A;  5FY0 A;  1KNR A;  3AE3 A;  4DV7 T;  3UUX B;  1SUM B;  2XAH B;  2JMK A;  2CWY A;  2V6X A;  3OTO T;  2F4V T;  2UXB T;  2HH7 A;  2YOE A;  3ZT5 A;  5M4Y A;  2IW5 B;  3PU8 A;  1UUR A;  3RKO A;  3ZST A;  3O4X E;  2YEV C;  3ZN0 B;  1UK5 A;  2DWK A;  4OHF A;  3RPU A;  4AKL A;  4DR2 T;  4KBM B;  4IGU A;  3ZT7 A;  4Z90 A;  4LF5 T;  2W61 A;  5L3F B;  2BG9 E;  2X66 A;  4I0U A;  3ZLI A;  4H9O C;  3VHL A;  2CCQ A;  3UQ7 A;  4PK6 A;  2W67 A;  4ZI7 E;  4EV6 A;  3N2K E;  5LJM A;  3EI0 A;  3CML A;  1VRB A;  4ILA A;  1D0Z A;  1YXR A;  4H9Q C;  1YW0 A;  1WR6 A;  2LSY A;  4UVC B;  1IBK T;  4E7Z A;  4ZI2 D;  4DBQ A;  5F5W A;  2UXD T;  2V6Y A;  1ZKE A;  4P0A A;  2Q9Q B;  2C5I T;  3BQL A;  1MND A;  5CA0 E;  2WSS V;  4GKK T;  1XZY A;  1D1B A;  5J2T E;  3OYZ A;  2X0L B;  4O4L E;  3L3P A;  3SRZ A;  2XQ7 A;  3HA4 A;  3VR8 A;  4LFB T;  3PTR B;  4B3S T;  2DHR A;  2AE9 A;  1N32 T;  5DJQ C;  1WYB A;  1MMG A;  3FXD B;  3ZCI A;  4QH5 A;  4ZEY A;  4G2A A;  2VQE T;  4X1I E;  2X9H A;  1W0B A;  2XM1 A;  4BJM A;  4I4T E;  1OED E;  2CE7 A;  1IJ5 A;  3GMI A;  5IYZ E;  5HEO A;  2V7L A;  3FZK B;  4H63 V;  2FJB A;  5LG3 A;  2X51 A;  4IL4 A;  5AQR B;  3VR9 A;  2C5K T;  4C90 A;  5L47 A;  5JR9 C;  2CPT A;  2Q9Q D;  3AEC A;  3FZF B;  1MIW A;  2W00 A;  4WYV A;  1HG5 A;  3A7M A;  5JDM A;  3AEA A;  4X65 T;  4E7S A;  4IDP A;  2LHR A;  5FMN A;  4LF7 T;  4EGW A;  3QB5 K;  4FI5 A;  4LMK A;  4U2Y A;  3VU7 H;  3PU3 A;  2C5J A;  4PFP A;  3RKG A;  2VL8 A;  4HFH A;  2XQ5 A;  3H3A A;  4DR5 T;  3FXE B;  3RIU C;  2VB6 A;  4HGA A;  4NUV A;  4A98 A;  2IC9 A;  4GYR A;  2XPK A;  3O1H A;  2WY2 A;  3J9X 1;  2K3W A;  2M6I A;  4HWF A;  1UCU A;  3CQG B;  3T1Y T;  1X9B A;  3ETV A;  3S4U A;  5HXC A;  3SS1 A;  3C50 A;  3AA0 B;  4X62 T;  4K0K T;  2PTF A;  4JI3 T;  4F8H A;  2K5B B;  3MA9 A;  5LA6 E;  5AQM B;  4XZC A;  3O9X A;  2IAK A;  1Z0P A;  2E9X B;  1UGO A;  2W66 A;  4HEA A;  3RYC E;  3RIF A;  5LBQ B;  2CA5 A;  1O3X A;  4AKH A;  2XQ6 A;  4UEM A;  2BBJ A;  1HS7 A;  4IE0 A;  2WDQ A;  2MOZ A;  4X1K E;  1T72 A;  1NAF A;  2XAJ B;  3C98 B;  3SOL A;  2WDV A;  5LHI B;  3N9N A;  3CX6 B;  3SWH A;  4WZX A;  5L3E B;  4HFC A;  4HTE A;  2ODV A;  3PUW F;  3K8P C;  2CXF A;  4EOZ B;  5LYJ E;  4B3T T;  5HXS A;  1JNR A;  5FXW A;  3H37 A;  2CHN A;  3AA6 B;  3D0T A;  4P09 A;  2MTQ A;  2XAG B;  4YHJ A;  5JRE A;  4IDQ A;  1D1C A;  2CLY B;  2KWH A;  3PJA A;  4KMC A;  5HWX A;  2MPK A;  4JEU B;  4QWN B;  3U78 A;  3ZN1 B;  4QKN A;  4PK5 A;  5H6Q B;  5LNK A;  4U31 A;  1Z8U A;  2BG9 A;  3AE9 A;  2XAQ B;  3WAJ A;  3Q5X A;  2XM2 A;  2DNX A;  2I6H A;  4YTP A;  5C2T A;  4AI6 A;  2ODU A;  2WB5 A;  1W0A A;  4JV5 T;  3UQ4 A;  5CGM A;  2X0Y A;  2XQY A;  2CXD A;  5FL0 A;  1M7K A;  1MMD A;  4U3C A;  4U72 A;  5E0O A;  3I0Q A;  2XJ7 A;  1G8X A;  2J4G A;  2N9D A;  2UUB T;  1WYC A;  2JIW A;  4IE4 A;  3QB5 A;  3P4W A;  4J2C A;  4JUY A;  5LHH B;  4TV8 E;  1KF6 A;  1JNZ A;  3HKB E;  4LML A;  4EZH A;  3J7Y q;  4GYS A;  1T7S A;  2RA1 A;  2LKH A;  4QXC B;  2QRX A;  5LOV E;  2XSB A;  2W63 A;  4CXY A;  4YSY A;  3RI5 A;  3LG7 A;  5JTG A;  5LJN A;  3LK2 B;  3TLU A;  2D5U A;  5L4H A;  1OED A;  2D9D A;  2XSA A;  2Q9Q A;  2CM0 A;  2H89 A;  2MAW A;  2VVN A;  2WDR A;  1R8I A;  4EYY R;  2BS4 A;  3AE6 A;  5AQP B;  5LP6 E;  2YK0 A;  4HWC A;  3CIR A;  3L8R A;  3RGL A;  4JYA T;  2YU1 A;  2K48 A;  3N9O A;  4XAX B;  2LT3 A;  4O4H E;  4TWH A;  2JRK A;  4I43 B;  4QHO A;  4TUY E;  3HKD E;  4QH1 A;  3TKL B;  4FJO A;  2YDS A;  4KHZ F;  4IE5 A;  3FZH B;  4DND A;  3RYF E;  5EK2 A;  1ZV4 X;  2B76 A;  3HR0 A;  5TAO A;  2W62 A;  4UV9 B;  4ZI3 D;  4NPP A;  4A56 A;  3CVR A;  5AQQ B;  2V5D A;  2BKN A;  1VOM A;  4ILB A;  1XMQ T;  2W2U A;  3CQX C;  5JQG E;  3ESL A;  3ZMT B;  5CA1 E;  5FL1 A;  4PW8 A;  5HXH A;  4DR3 T;  4EAH A;  2UXC T;  3UUN A;  2Y6X A;  5L3D B;  3RYI E;  4DR7 T;  4XBF B;  3BQK A;  3CX7 B;  1EZ3 A;  5FY1 A;  3A8Y C;  4JI0 T;  1NWM X;  3X1D A;  1HCI A;  2N1G A;  1J1J A;  4CI1 B;  1UX5 A;  3FZM B;  3EHZ A;  2M67 A;  4JI6 T;  5HCM A;  3W15 B;  4DR1 T;  3I0O A;  4PJL A;  2VKJ A;  2H88 A;  4TZ4 C;  2J1D G;  3ZMU B;  5BR8 T;  2L3L A;  4EZ4 A;  5BMV E;  2HPL A;  2KIN B;  5DAB A;  4ILC A;  4V1A v;  4KX6 A;  4BJN A;  5HWY A;  2CHO A;  4HKA A;  3CQC B;  2JQK A;  2VKD A;  3NZP A;  4HE8 A;  3NKZ A;  3HKC E;  3ZYL A;  1T8B A;  4KI0 F;  3RH3 A;  2KLQ A;  3OBV E;  3AB3 B;  3PUG A;  1KK7 A;  3IA3 A;  4Q25 A;  4CXX A;  5JVD E;  2JPF A;  3MKD A;  4X64 T;  5FXZ A;  4EEB A;  4JI7 T;  3I1A A;  1IJ6 A;  3P8C D;  4KP3 C;  2LOP A;  3OJA A;  5JR9 B;  3CPZ A;  1MNE A;  4DUZ T;  4ZXL A;  5JRC B;  2E9X A;  4TN7 B;  2V8S V;  1HF8 A;  3H3M A;  2CRB A;  3WAK A;  2BVM A;  2KXP B;  3C4Z A;  2CXL A;  4TWD A;  2GK9 A;  2YDQ A;  5L3B B;  4P1N A;  5JDN A;  3JCF A;  2X9W A;  1HNW T;  1V9D A;  5F3J A;  4ILU A;  1E1H B;  4BA9 A;  3JC6 D;  2KWI B;  4H9R C;  1AJ3 A;  4H9S E;  5EZY E;  5AQF B;  5AQU B;  1H7C A;  2V7K A;  4YJ2 E;  1BR0 A;  3PDY A;  3K1S A;  4Z91 A;  1XNR T;  2XY8 B;  2BG9 C;  1SHZ C;  3K3N A;  4QH4 A;  2ACZ A;  4AQF A;  4UR9 A;  4YFS A;  2LHN A;  4ZI2 C;  2M6B A;  3PUX F;  2VAS A;  2OV9 A;  3LSV A;  5DQW A;  4A5X A;  2XQ8 A;  2E2A A;  2NR4 A;  3A5X A;  3RQW A;  1QUU A;  2QA7 A;  3FHN A;  1BR4 A;  4AQG A;  4YLH A;  1ZEE A;  4CI2 B;  1QSD A;  2UXN B;  4K0U A;  5AQL B;  3MZK B;  3ONL C;  3HI2 A;  4PJM A;  3L39 A;  2WZI A;  1S35 A;  2VK9 A;  4ERR A;  4NIQ A;  5J0Z A;  3UU8 A;  4ZZC A;  1Y01 A;  3T8O A;  4IRE A;  4B3R T;  3KV6 A;  3RHW A;  4MBQ A;  5CJ5 A;  4HWH A;  3E22 E;  3ZJ1 A;  2BZB A;  3TLW A;  2KSR A;  4O4I E;  4DO0 A;  4O2B E;  3NRX A;  3QK6 A;  2V1D B;  1FEW A;  2YN6 A;  3E0Z A;  3ZC1 A;  2XZE A;  1XNQ T;  4ZOL E;  3M65 A;  2I0M A;  5J2U E;  2L9Q A;  3L09 A;  5JDL A; 
#chains in the Genus database with same CATH homology
 4OK0 A;  4AI6 A;  2LSG A;  3UT5 E;  2ODU A;  4GIW A;  2EHO C;  2Q9Q C;  5JDF A;  4M1P A;  2HPJ A;  2B1E A;  2PG8 A;  1HFA A;  4UXN B;  2CWO A;  2KMF A;  4HFV A;  3KDS E;  3MXZ A;  5ADX L;  4MLK A;  3EVY A;  4X1Y E;  4WW0 A;  2UXX B;  3IEE A;  2N2N A;  1YKH B;  2XQY A;  3CWZ B;  2LSJ A;  3LJC A;  3N9Q A;  2V7I A;  3E08 A;  2CXD A;  3GN5 B;  3KV4 A;  3AA7 B;  4AKI A;  3BQI A;  3N9M A;  1MMD A;  5EK4 A;  4UIG A;  5FY7 A;  2W0G A;  4UV8 B;  4U72 A;  2V26 A;  5E0O A;  3I0Q A;  4DVD A;  2D2S A;  4I50 E;  2ZMA A;  4IE6 A;  4JEH B;  4L9I A;  3C51 A;  1US7 B;  1G8X A;  1HG2 A;  2X68 A;  2ACX A;  2N9D A;  1UX4 A;  3AVR A;  5EK3 A;  5JDQ A;  2NWB A;  1WYC A;  2Z6E A;  4IE4 A;  4J2C A;  3N2O A;  4JUY A;  5LHH B;  4GK0 E;  4TV8 E;  5FNV E;  3F57 A;  2NTX A;  3I9W A;  3ZMV B;  3HKB E;  5DQV A;  4UF0 B;  2D0T A;  4IST A;  4PJN A;  4EZH A;  2A3D A;  4IIJ E;  3LBX A;  3ZC0 A;  2A72 A;  2LSK A;  4UVA B;  3J7Y q;  4QXB B;  5FP3 A;  4GYS A;  4TV9 E;  2D0U A;  3EDV A;  4P0B A;  2RA1 A;  4OYK A;  3RYH E;  4QXC B;  2XAS B;  5LOV E;  1BR2 A;  1Y64 B;  2W63 A;  4HN9 A;  4CXY A;  4PAG A;  4PJJ A;  4EXT A;  3JC6 C;  3CX8 B;  3V5U A;  4L5G A;  4B6X A;  3DJB A;  4EB6 E;  3LG7 A;  4JLE A;  3O1I A;  5FXX A;  3KIN B;  4UEL A;  2ZM2 A;  5LJN A;  3LK2 B;  3Q5W A;  5IHY A;  1MMN A;  3KVB A;  3F31 A;  2BVL A;  4L0R A;  4DMV A;  3LK3 B;  2ES0 A;  3EDU A;  5FY0 A;  2MBG A;  2WM9 A;  5KDM C;  1G73 A;  3UUX B;  2XAH B;  2JMK A;  5JH7 E;  2CWY A;  2D5U A;  1U4Q A;  2HH7 A;  2EHO A;  5M4Y A;  2IW5 B;  2Q9Q A;  2CM0 A;  3EUH A;  3PU8 A;  3RKO A;  3P7I A;  1FMV A;  4EYY R;  3O4X E;  3N5L A;  5AFU L;  2YEV C;  3ZN0 B;  3R84 B;  5LP6 E;  3AA1 B;  2DWK A;  3MAC A;  4OHF A;  3RPU A;  2YK0 A;  3F2E A;  4AKL A;  4KBM B;  3VKH A;  4IGU A;  1LKX A;  2JQQ A;  2YU1 A;  4OFZ A;  2K48 A;  3N9O A;  4WBO A;  3PUR A;  2W61 A;  5L3F B;  4XAX B;  3U3I A;  2LEH A;  2LT3 A;  2XAF B;  3K3Q C;  5ETW A;  2X66 A;  4O4H E;  3ZLI A;  4H9O C;  5FYM A;  2JRK A;  4I43 B;  4QHO A;  3VHL A;  1WRD A;  2CCQ A;  4PK6 A;  4TUY E;  3IHR A;  3HKD E;  2DCF A;  3UTK A;  4ZI7 E;  5A1L A;  1HX8 A;  3N2K E;  5LG4 A;  5LJM A;  4O4J E;  3TKL B;  4FJO A;  3CML A;  1VRB A;  1CUN A;  3GWH A;  1D0Z A;  4IE5 A;  5L3C B;  4DND A;  3RYF E;  3BK9 A;  4H9Q C;  1YW0 A;  4ISS A;  2L8K A;  4MFR A;  1WR6 A;  4U74 A;  5EK2 A;  1OXZ A;  2LSY A;  4H9P C;  1ZV4 X;  3ONX A;  5TAO A;  3ANW A;  3HR0 A;  2W62 A;  4UVC B;  3RX6 A;  4UV9 B;  3IF8 B;  4ZI3 D;  2LOS A;  2K9A A;  3QUJ A;  4E7Z A;  4ZI2 D;  4DBQ A;  5GON E;  5LGT B;  4A56 A;  3CVR A;  2NW9 A;  1VOM A;  3AAI A;  3N9L A;  2EHO B;  1ZKE A;  3B13 A;  4MHC A;  4P0A A;  3CQX C;  2VKO A;  2Q9Q B;  2PJQ A;  2C5I T;  5JQG E;  3GA8 A;  3BQL A;  2PFV A;  5CB4 E;  1MND A;  3RRW A;  2Y48 B;  3ESL A;  1IAP A;  5CA0 E;  3ZMT B;  5CA1 E;  4PW8 A;  2WSS V;  5HXH A;  4EAH A;  3AVS A;  3C4X A;  3UUN A;  1D1B A;  3ZEF B;  2LJL A;  3ZMS B;  5J2T E;  4NUU A;  3OYZ A;  3ZYK A;  5LXT E;  2E9X C;  3N2G E;  2Y6X A;  5L3D B;  2WMN A;  2X0L B;  1U5P A;  3L3P A;  4O4L E;  3RYI E;  3SRZ A;  4XBF B;  4DBR A;  3HA4 A;  3BQK A;  3CX7 B;  1EZ3 A;  3PTR B;  3AAE B;  3C4W A;  2DHR A;  5FY1 A;  1NWM X;  5DJQ C;  1HCI A;  2N1G A;  4CI1 B;  1WYB A;  3C64 A;  4DMW A;  1D0X A;  1UX5 A;  2P9B A;  1MMG A;  3FXD B;  4H63 H;  2M67 A;  3ZCI A;  2WBL A;  3RC3 A;  3W15 B;  1HTJ F;  3I0O A;  4G2A A;  3FBZ A;  4PJL A;  2VKJ A;  4X1I E;  2X9H A;  2V7M A;  5JDG A;  4TZ4 C;  2J1D G;  4UVB B;  3IBP A;  3ZMU B;  3NZQ A;  5HAX A;  4BJM A;  2L3L A;  4EZ4 A;  5BMV E;  2HPL A;  2NOX A;  4I4T E;  4QX7 B;  4AXP A;  2KIN B;  2CE7 A;  1IJ5 A;  5DAB A;  3ANW B;  4V1A v;  3GMI A;  5L3G B;  1MIY A;  5IYZ E;  4BJN A;  3FBL A;  4X20 E;  2V7L A;  2ZLY A;  5HWY A;  3FB2 A;  4HKA A;  4ZHQ E;  5HXE A;  4H63 V;  1T98 A;  2KZ7 B;  2NW8 A;  3CQC B;  2LE8 A;  4PNI A;  2X51 A;  2VKD A;  5LGU B;  2C0S A;  5KMG P;  2KND A;  2YU2 A;  3NZP A;  1LVF A;  4ZS3 A;  1LVK A;  3OKQ A;  4HE8 A;  3HKC E;  3HKE E;  3ZYL A;  2XTL A;  2C5K T;  4C90 A;  2CLY C;  3RH3 A;  5JR9 C;  3LK4 2;  1WLX A;  2A2F X;  2EHO D;  2KLQ A;  3OBV E;  2Q9Q D;  3AB3 B;  1IZN B;  3PUG A;  4WBN E;  1KK7 A;  1MIW A;  2W00 A;  4CXX A;  1HG5 A;  2JPF A;  3MKD A;  4O8S A;  5JVD E;  5JDM A;  5FXZ A;  5F8P A;  4AQF C;  5C8Y E;  3I1A A;  1B7T A;  1IJ6 A;  2VKH A;  1BR1 A;  4E7S A;  3P8C D;  2LHR A;  4KP3 C;  2NTY A;  5FMN A;  2LOP A;  3OJA A;  5JR9 B;  3CPZ A;  1MNE A;  5JRC B;  2E9X A;  3ZCJ A;  4FI5 A;  4AKR B;  2LSI A;  3Q2M A;  2KT9 A;  4YJ3 E;  3VU7 H;  4TN7 B;  1HF8 A;  3PU3 A;  3ZYM A;  2C5J A;  1MIV A;  3WAK A;  2BVM A;  2KXP B;  2XUE A;  1S94 A;  2VL8 A;  4PFP A;  3UUL A;  3Q9D A;  1FMW A;  2E9X D;  2NW7 A;  5FXV A;  3RRC A;  3C4Z A;  3OYX A;  3H3A A;  2H3R A;  2CXL A;  2DI4 A;  3FXE B;  2CEA A;  2VB6 A;  4HGA A;  4NUV A;  2V7J A;  3DP7 A;  2GK9 A;  1LRZ A;  2X9X A;  5HYA A;  3KFW X;  3VKG A;  5L3B B;  2OA5 A;  4KUM B;  2IC9 A;  4GYR A;  2DWG A;  5LBM A;  2ZM8 A;  3MK7 C;  3O1H A;  3J9X 1;  4CZZ B;  5JDN A;  3NBX X;  1SA0 E;  2X9W A;  4QX8 B;  1V9D A;  5F3J A;  4ILU A;  1E1H B;  2H7V C;  1OWA A;  4BA9 A;  3JC6 D;  2KWI B;  4H9R C;  1AJ3 A;  1UCU A;  3N9P A;  4H9S E;  2XHE B;  3CQG B;  4ANJ A;  5EZY E;  4PK4 A;  3KBU A;  4QXH B;  4EIW A;  4EYU A;  4AKG A;  1H7C A;  2V7K A;  2JMH A;  4IHJ E;  5JDH A;  3ETV A;  3I9Y A;  4CXW A;  4YJ2 E;  4TX5 A;  3S4U A;  1BR0 A;  5HXC A;  3SS1 A;  2H7O A;  4CQI A;  2G0U A;  5LHG B;  3C50 A;  3AA0 B;  3PDY A;  3B57 A;  2JJ9 A;  3ZMZ B;  5JR9 A;  4PFO A;  5JRC A;  3KVA A;  3NRY A;  2K5B B;  2SPC A;  2CMR A;  3K3O A;  3MA9 A;  4XZC A;  5LA6 E;  3O9X A;  2IAK A;  1SHZ C;  1Z0P A;  3K3N A;  3RC8 A;  2E9X B;  3PE0 A;  2MYS A;  4ASK A;  2PBI A;  4AQF A;  2K24 A;  4ZI3 C;  4H9N C;  4HEA A;  2YIN A;  3KV5 A;  5LBQ B;  5HXR A;  3DTO A;  4YFS A;  3RYC E;  2LHN A;  4ZI2 C;  2CA5 A;  1O3X A;  4CI3 B;  4O2A E;  3R6N A;  4AKH A;  2VAS A;  4UEM A;  1HS7 A;  4IE0 A;  3ZPO A;  4C91 A;  5KX5 E;  2LM9 A;  5DQW A;  2MOZ A;  3MJX A;  4X1K E;  2VWA A;  4BAY B;  1NAF A;  3ETU A;  1MMA A;  2XAJ B;  2X67 A;  4IDZ A;  3A5X A;  3C98 B;  3SOL A;  3V5S A;  1QUU A;  2QA7 A;  5LHI B;  1D0Y A;  3FHN A;  1BR4 A;  3ZJ2 A;  4AQG A;  4YLH A;  3AAA B;  3N9N A;  2I59 A;  4N78 D;  3KBT A;  1ZEE A;  3CX6 B;  3SWH A;  1QSD A;  4CI2 B;  4ADZ A;  2UXN B;  4IE7 A;  3LFM A;  4HTE A;  4GK5 E;  4K0U A;  4Z8X A;  1FIO A;  5J1G A;  5L3E B;  1D1A A;  2ODV A;  5H6R B;  3MZK B;  3HI2 A;  4PJM A;  1YD8 G;  3K8P C;  2CXF A;  2WAU A;  3UFE A;  3GN5 A;  4F6R C;  2X9Y A;  5LGN B;  4EOZ B;  3HL6 A;  5LYJ E;  1S35 A;  5HXS A;  4WNK A;  2WWU A;  3PUA A;  2VK9 A;  4ZS2 A;  1KNZ A;  4ERR A;  2WMO A;  3CKD A;  3KV9 A;  4OYJ A;  1X79 A;  5FXW A;  3H37 A;  4GOU A;  3PUS A;  3T8O A;  1ZHC A;  3AA6 B;  3D0T A;  4P09 A;  4I55 E;  2MTQ A;  3PUQ A;  2XAG B;  3KV6 A;  4YHJ A;  5JRE A;  3O1J A;  5LCY A;  1D1C A;  2CLY B;  2QGS A;  4MBQ A;  2KWH A;  2Y8D A;  1YKE B;  4KMC A;  3E22 E;  4MAL A;  2BDE A;  5HWX A;  3ZJ1 A;  2BZB A;  2DLR A;  4JEU B;  4QWN B;  4O4I E;  4DO0 A;  5L2L A;  2E8I A;  3QC9 A;  3WI3 A;  4O2B E;  4UF0 A;  3NRX A;  3QK6 A;  3U78 A;  2ZM0 A;  3ZN1 B;  2V1D B;  2RP4 A;  1FEW A;  3UUM A;  3E0Z A;  2NP9 A;  4QKN A;  3ZC1 A;  4PK5 A;  5H6Q B;  5LNK A;  4ZOL E;  3M65 A;  2IC6 A;  5J2U E;  3LBX B;  2L9Q A;  2XAQ B;  3L09 A;  3WAJ A;  4G63 A;  3Q5X A;  5JDL A;  2DNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...