4JEUB

Crystal structure of munc18a and syntaxin1 with native n-terminus complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
242
structure length
225
Chain Sequence
KDRTQELRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 1
publication title Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 90
structure length 225
sequence length 242
ec nomenclature
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jeuB00
5M4YA 1FIOA 2DNXA 2XHEB 1G73A 1FEWA 3C98B 3LG7A 4JEHB 1HS7A 4JEUB 4TX5A 1BR0A 1EZ3A 5LG4A 1S94A
chains in the Genus database with same CATH superfamily
4OX9T 1HR0T 4ZS2A 2VWAA 3RKGA 2P9BA 3ZMVB 5FNVE 1D0ZA 1LVFA 4IDQA 4A5XA 1W0AA 1BR1A 4DO0A 1NENA 2ZM6T 2DLRA 5LGTB 1BR2A 2YK0A 3MK7C 2XTLA 3IF8B 2K48A 2HPLA 2KLQA 5J2TE 4DUYT 1N36T 2N9DA 3F31A 3N9NA 4MHCA 2PBIA 4B3RT 4ILAA 1IBKT 3K3OA 2YU1A 2LOPA 4ZI3C 4UEMA 2DL1A 1HNZT 5JREA 2NW8A 4ZZBA 3B57A 1HFAA 1SUMB 3MA9A 5JQGE 5AQIB 4EAHA 4GYSA 4C91A 4YSXA 3AE2A 3E08A 3J9X1 4YJ2E 3TLWA 4PK6A 3Q5WA 4JI2T 3X1DA 5IWAT 5EK4A 4IIJE 4CI2B 4COFA 3ZMUB 2XQ8A 5DABA 2C5IT 4HFDA 3KVBA 3N2GE 1OWAA 4DBRA 4KHZF 3L3PA 4IE5A 2AXDS 3RF1A 1WFDA 1MMAA 5AQGB 3PUGA 1XZYA 4GOUA 3ANWA 5L3DB 2LSGA 4AKRB 4YSZA 4A56A 1JNZA 5LA6E 1D1CA 3O1HA 1E2AA 4HGAA 4KX6A 3TLTA 5C3JA 3FZHB 5FXXA 4U72A 3ZCJA 2JQQA 2WM9A 4B3MT 4DR2T 1M7KA 3ABVA 1W09A 3QNUA 5LGNB 4YFSA 4X20E 2KNDA 1D1AA 1L0VA 4YJ3E 3AA6B 1XMOT 2V5CA 5HYAA 2V7JA 2BS2A 2CRBA 3HI2A 2W66A 4HFBA 3VU7H 5LG4A 5FP3A 1OEDB 2BBHA 2E9XD 1KEYA 2BS4A 5JDNA 2OLTA 1UX4A 4JI4T 3OPCA 1J5ET 5LB7B 4BA9A 3EDVA 2JQKA 1ZKEA 3AAAB 4IE4A 2LKGA 5CGMA 2Q9QA 3N9LA 2WZHA 2CLYC 3TKLB 5LOVE 4JI0T 3QOFA 5JDLA 4H9QC 2LOSA 1YXRA 5JRCB 3AE5A 2J47A 2ES0A 2IUBA 1NAFA 3BQKA 2V6YB 3KBUA 2V6XA 1SE7A 4K0KT 2IC6A 4AI6A 3AXJB 5HEOA 3C50A 2IHR1 2XASB 3RIFA 4CN1A 1ZP0A 5AQRB 2BBJA 3ZMSB 5LG3A 3P4QA 3HKCE 2VVSA 3AA7B 2WQYA 3N9OA 3PUQA 2EHOC 4ZS3A 4DR3T 1MNEA 4ZEYA 2LRLA 3CX6B 5AQHB 4UVBB 2LLYA 2KZ7B 1W9RA 5LJMA 3UUXB 4YLHA 3ZMZB 2RA1A 4ZI7E 3FXDB 1OEDE 2LSJA 4DV2T 5CFBA 1UURA 2WMOA 3A7MA 3SWHA 5FXZA 3P8CD 3O1IA 4X1KE 2XQYA 5LHHB 5FL1A 3C98B 3CK6A 3AEFA 3UFGA 4KP3C 3OTOT 3VKGA 1J5WA 2Q9QC 2YKSA 4I4TE 4X65T 4QX8B 2XAJB 4QHOA 3FZKB 1D0YA 2X66A 2I59A 4ZHQE 4M1PA 4ZZCA 2XQ3A 1M62A 4YXDA 5HCJA 3GN5A 5J0ZA 2ZMAA 4HEAA 5CB4E 4DR5T 3RRWA 3C4ZA 2XUEA 3LJCA 3UULA 2PTFA 2XSAA 1UK5A 4BJMA 4LFBT 4ERRA 2UXNB 2W00A 4FJOA 1IJ6A 5AQMB 2BG9C 3GN5B 3UUBA 3PUVF 4TNWA 5ABEA 1YW0A 3EUHA 2B1EA 4ZI2D 5LYJE 2DI4A 3OKQA 4LMLA 2WZIA 5F8PA 2QYWA 1SA0E 2FUPA 2IAKA 2XY8B 1U5PA 4JI5T 3NZQA 3UUMA 4GYRA 3NKZA 3UQ7A 5AQJB 1LKXA 5AQVB 1XDOA 3ZN1B 1N33T 3PURA 3QUJA 4HWIB 1HG5A 3PUAA 3JC6D 2E5LT 2V7IA 3D0TA 4QH4A 3T1HT 4OHFA 3CQXC 3FB2A 1YKEB 2C5JA 1ZEEA 3ZT6A 3N2KE 1HX1B 4TV9E 2X9XA 4LMJA 2WWVA 2WDRA 2VB6A 3AAEB 2H7VC 3FZMB 4IDNA 4LF7T 3AB3B 2IDOB 3V5UA 1HNXT 2N2NA 2BKOA 4Z91A 4PAGA 2ZM0A 5C2TA 4K0UA 3P4SA 4NUUA 4NXMT 2LM2A 4EYYR 3EI0A 5F5WA 4DV6T 4O4HE 2FJEA 2BDEA 3O1JA 1AJ3A 3MXZA 4DV1T 3K3QC 4HFHA 3ONXA 3K1SA 3ESLA 1ZOYA 2XQAA 2D0UA 1BR0A 1WR6A 3Q2MA 4AXPA 3NRXA 2C0SA 3RLFF 3PDYA 5DQVA 4L0RA 5L3CB 5LCYA 1FMVA 2BS3A 1IBLT 2MTQA 3T1YT 3AVSA 5LMUT 2ACXA 4PJLA 3N5LA 5LNKA 5J1GA 4IE7A 3IEEA 2UXDT 4UV8B 4YY3T 5LHIB 3KDSE 4DVDA 1I94T 5L3FB 2E8IA 1MNDA 4I50E 5ETWA 3LK42 3SOLA 1WR0A 4U3CA 4JI7T 1V9DA 5FXWA 1O3XA 2CXLA 2UUCT 4AIUA 3H3MA 3EAMA 2BKNA 5LHGB 3AA1B 2MAWA 5AQTB 3UT5E 5AQPB 1S35A 2QGSA 2E9XC 4X66T 2RP4A 3SFEA 5KX5E 2K24A 2UXBT 2XM2A 4ILUA 5GONE 3ONJA 3JCFA 4XAXB 1XMQT 2CCQA 5JR9B 4EOZB 5LXTE 4A97A 1UUSA 2J62A 5AQLB 2CPTA 2WP9A 2LRKA 2X51A 2VKHA 4GKJT 1LRZA 4GK5E 2D0TA 5L4EA 3NWIA 3ZT5A 2XQ5A 2XQ9A 3R84B 1Z0PA 3BK9A 4P0BA 4EYUA 5FKYA 3KFWX 2JRKA 5JDMA 2WSSV 3ETVA 4O8SA 1VOMA 2X0LB 4QXHB 4OK0A 2W4XA 2Y6XA 2HPJA 2CHOA 2H89A 2V1DB 2CBJA 3RH3A 3AEDA 3M65A 1JNRA 3ZLIA 3N9QA 3KV9A 3BQLA 1MMNA 4ILCA 3SRZA 4ZOLE 3LG7A 4ANJA 4P0AA 2J1DG 3CQGB 4KMCA 4FI5A 4U2ZA 1T72A 3JAFA 4PJMA 3RQWA 5LP6E 4TV8E 2LE8A 4EV6A 2WMNA 5H6RB 3CQCB 2CLYB 2KINB 2WCAA 1KK7A 2D9DA 5J2UE 4Q25A 3HA4A 2XSBA 3NZPA 1ZV4X 4JYAT 2DWKA 2XHEB 3ANWB 3ZEFB 3AE9A 2UU9T 3WAKA 4TX5A 3N9MA 2EHOA 4LF6T 2SPCA 2Y48B 3PU8A 4KBMB 4IL4A 4MFRA 2CMRA 3F57A 2WAUA 2ZM8A 4ASKA 2KWHA 2R6GF 2HN1A 2UUAT 3Q5XA 5HWXA 3UU5A 5H6QB 5L2LA 2X67A 4NUVA 4OFZA 5AQKB 2BVLA 4ZXLA 3FBZA 4L5GA 1YD8G 2EHOB 4QXBB 3CKDA 3HKBE 4U74A 4YTNA 3AA0B 3UTKA 1W0BA 2UXCT 1FEWA 2OA5A 3EABA 4UV9B 2NTYA 3RC3A 2LJLA 3C4WA 4JI8T 1D1BA 2NWBA 4PJJA 1WYCA 2IC9A 2BVMA 2YDSA 2CBIA 3CX7B 2JJ9A 1N34T 3JC6C 3MACA 2Q9QB 4UF0A 4H9SE 3RHWA 3ZT7A 4QH5A 3DP7A 3P50A 3QB5A 3I0QA 1WLXA 3ZSTA 2LEHA 1FMWA 4DR6T 2BG9A 1S94A 1VCTA 4UR9A 3RX6A 5LBMA 4UF0B 4UELA 3V5SA 5IYZE 3U78A 2XPKA 3IHRA 2LSIA 2W63A 3KV4A 4JBWF 1B7TA 2BG9B 4PFPA 4TWHA 4HTEA 3J7Yq 2CA5A 4JUYA 4LF9T 2X9YA 4EEDA 3RIAA 4DR1T 4LF5T 4PJNA 4HE8A 4BJNA 3I9YA 4X5TA 2W2UA 4DR7T 1IAPA 3N2OA 4F6RC 3ZJ1A 4X64T 1HCIA 1FJGT 1BR4A 1KNZA 5LGUB 2NR4A 5JDGA 2NTXA 1D0XA 2XAHB 3M3ZB 4H9NC 3SFDA 2CWYA 2UUBT 4WZXA 2DCFA 4QX7B 4EXTA 3GMIA 4AQFC 3R6NA 3MZKB 4LFAT 3DJBA 3TLVA 2XJ7A 2W67A 1XWMA 5FY0A 5KXJA 4CXWA 2NOXA 5EZYE 4DBQA 3RGLA 2WB5A 3KV6A 4NXNT 4Z90A 1YQ3A 4IDPA 2BG9E 4KUMB 5HAXA 3HL6A 2K3WA 1N32T 3JAEA 3L8RA 3O9XA 4DV5T 4PFOA 5JDQA 1E7PA 5E0OA 3EVYA 3WAJA 4JI6T 5KMGP 2W0GA 5L3EB 2NP9A 4WNKA 1Z8UA 4HFEA 2PG8A 3MKDA 1KNRA 5CJ5A 1VRBA 3NVOA 2XQ7A 4TNVA 2H3RA 2QVAA 2VL0A 4OYKA 2JMHA 3UU3A 5LMNT 4DNDA 4EZ4A 2K5BB 2DNXA 2WDVA 3GWHA 2EHOD 4UIGA 3AECA 2H7OA 3AE6A 4DR4T 4PW8A 1EZ3A 4X1YE 1MMDA 5L3BB 1OXZA 4I0UA 4H9OC 4O2BE 5HXRA 1R8IA 3O4XE 2WS3A 4WW0A 4CXYA 1UGOA 4YT0A 2FJDA 4JV5T 3VR9A 3PE0A 1U4QA 1T7SA 2YDQA 1LVKA 4O4IE 2XAFB 5HXHA 2E9XA 2A3DA 2V7LA 3S4UA 3OYZA 2FBWA 4X62T 4U7IA 2V5DA 1G8XA 4ISSA 5JDFA 2CXFA 3LDQB 4YTMA 2Q9QD 2VVNA 2CHNA 5LJNA 3WI3A 2LHRA 3PUXF 4QXCB 3NBXX 3GA8A 5HXCA 4I43B 1HG2A 2ZLYA 5C8YE 3ZYLA 2M67A 1GQEA 5AQSB 1UCUA 3FXEB 4DUZT 4AQYT 4OYJA 5AQFB 2E9XB 2BZBA 3N9PA 1X79A 3PV0F 3UQ4A 2VKDA 4EIWA 4IHJE 4U33A 3RQUA 3AEEA 3I1AA 3U3IA 3TLUA 2E2AA 3B13A 2A9UA 2RPAA 3AEBA 2NW9A 5JH7E 3ZN0B 4E7SA 4U7YA 3CVRA 1MIVA 4HN9A 3FZFB 2I0MA 2X0HA 3UFEA 4IDZA 3B5MA 2H88A 5DQWA 1MIWA 2VQET 3LFMA 5HEUA 3PUWF 3TLSA 4B3TT 3UU6A 3KVAA 2WY2A 2MOZA 3SS1A 2JQHA 2Y8DA 3G06A 1T98A 3VRAA 3FHNA 4P1NA 3E0ZA 2CEAA 3PJAA 4UXNB 4JEUB 3P4WA 1ZHCA 3KBTA 3T8OA 1QSDA 2X9WA 4PNIA 3H3AA 3OJAA 2VASA 2YOEA 5M4YA 3AAIA 5CA0E 3P4RA 1IBMT 3L09A 5FY1A 2LM9A 2YEVC 4O2AE 2L8KA 1MIYA 1NWMX 2PFVA 1YKHB 2XM1A 1SHZC 4IREA 2QRXA 2JPFA 5FXVA 1UX5A 5BMVE 3OVUA 5BR8T 2PJQA 4EZHA 3PU3A 4XBFB 4JLEA 2LKHA 2DHRA 5IHYA 3NRYA 5AQNB 4EB6E 3E22E 3RIUA 3C51A 5KDMC 3LBXA 2L9QA 1QLBA 1HS7A 3RYFE 5FMNA 3K3NA 4CZZB 3JADA 3LK3B 1US7B 5F3JA 4O4LE 3QK6A 1H7CA 2MPKA 2XAQB 4AQGA 4HWDA 1T8BA 3PUZF 2CWOA 5JR9C 3LBXB 5L47A 1HTJF 3RYHE 4TWFA 1MMGA 2IW5B 3AVRA 4UVAB 2J4GA 5AFUL 3RPUA 2ACZA 4HWCA 3VR8A 3AE7A 4ILBA 2JIWA 3LK2B 4GKKT 4UVCB 1KNPA 2VURA 4LFCT 1OEDA 3Q5DA 4IE6A 3FBLA 4XZCA 1E1HB 3FZLB 4AKIA 3RIUC 4ISTA 4HFCA 1HX8A 3Q9DA 2DWGA 3P7IA 3VHLA 4TZ4C 5ABFA 5AQUB 2A72A 4I55E 4B3ST 5JRCA 3I0OA 4ZI2C 4L9IA 2I6HA 1WRDA 2VKJA 2V6YA 5FYMA 2VQFT 5HEHA 2IIUA 5LBQB 4YTPA 2ZM2A 2E5VA 1CHUA 4IE0A 3AXJA 3W15B 4KI0F 2X68A 4HWHA 4AKHA 2CE7A 4TN7B 3ZJ2A 5ABFB 1HF8A 4CN6A 2XAGB 2WBLA 3ZKRA 2GK9A 2NW7A 4AKLA 2AE9A 5TAOA 5ABHA 3I9WA 1IZNB 4DV3T 4ZI3D 4DV4T 2XQ6A 5ABGA 3PTRB 3UU8A 4AQFA 2V8SV 3Q5EA 4H9RC 4EGWA 4DV7T 2VKOA 4EEBA 4QKNA 1OEDC 4QWNB 5HWYA 2L3LA 4N78D 4HFVA 4G63A 3ETUA 3CMLA 3VKHA 4F8HA 1KFYA 1XDPA 4CN4A 1HNWT 4JI3T 5HEJA 2YDRA 3EHZA 1DU2A 4TUYE 4H63V 3AEGA 4MALA 1YQ4A 2C5KT 4NPPA 4WYVA 4P09A 3MJXA 5CA1E 2G0UA 2KT9A 2V26A 3CIRA 4PK5A 4PK4A 2KXPB 1FIOA 2XZEA 4WBNE 5FVLA 4G2AA 4H9PC 1G73A 2UXXB 5EK2A 3ZPOA 2CM0A 2F4VT 4LF8T 5JTGA 5HEGA 4H63H 3HKDE 1WCRA 4LMKA 1IJ5A 3RKOA 3BQIA 3LSVA 4HKAA 3VRBA 4A98A 5A1LA 5FL0A 3K8PC 3C4XA 2VK9A 4CXXA 2IMLA 2MYSA 3ZYKA 1QUUA 3L39A 2FJAA 3QC9A 3EDUA 4DV0T 2JMKA 5FY7A 2QA7A 4MBQA 3RI5A 4JI1T 3HKEE 4KHPT 2D2SA 2V7KA 2W62A 4TWDA 3OYXA 3QB5K 4E7ZA 5DJQC 4AKGA 3KINB 2W61A 2WU2A 4MLKA 3OBVE 1NEKA 4CI1B 4ADZA 3RYIE 4IDOA 2KWIB 3AE3A 2CXDA 3ZCIA 2WDQA 1X9BA 4GK0E 2JQ9A 2YINA 1I6ZA 5IUXA 3P4PA 3ONLC 3C64A 3RYCE 4YHHT 3UU4A 3H37A 1J1JA 2HH7A 4LF4T 4YSYA 3A8YC 5L3GB 3CX8B 4Z8XA 2HN2A 4X1IE 5FVKA 5HXSA 1Y64B 4HFIA 3CWZB 5HCMA 4B6XA 4AISA 3AE4A 4C90A 5ADXL 2OV9A 4U2YA 1CUNA 5AQOB 4JEHB 1Y01A 4V1Av 4J2CA 2M6IA 3ZYMA 3KV5A 2MBGA 4IL9A 2KMFA 2HHHT 4IGUA 3IA3A 2M6BA 2A2FX 2XQ4A 3ZC0A 3ZSSA 4CI3B 2YN6A 2LT3A 4U31A 2LSKA 2WU5A 3RRCA 1KF6A 3A5XA 3IBPA 4GIWA 3RC8A 1XNRT 5L4HA 3F2EA 3AE8A 2LHNA 4NIQA 3PUYF 4WBOA 5EK3A 2ODUA 5JVDE 2KSRA 3UUNA 4YHJA 3PUSA 4HWFA 5JDHA 2VL8A 2N1GA 2X9HA 4CQIA 5HXEA 2V7MA 3CPZA 4BAYB 2B76A 2D5UA 1VCSA 4O4JE 1XNQT 2LSYA 3DTOA 4DIDB 3PJAJ 5AQQB 3AE1A 2BKPA 2FJBA 2X0YA 2WWUA 4QH1A 3AEAA 2Z6EA 1WYBA 2K9AA 4IT4A 4DMWA 5JR9A 3ZC1A 2YU2A 3ZMTB 4DMVA 2ODVA 3HR0A
chains in the Genus database with same CATH topology
3AB3B 4UVCB 4HTEA 3J7Yq 2CA5A 4ZS2A 3V5UA 4IE6A 2N2NA 4JUYA 3FBLA 4XZCA 2VWAA 2X9YA 4PAGA 2P9BA 1E1HB 2ZM0A 4AKIA 3ZMVB 5FNVE 4PJNA 4K0UA 4HE8A 4ISTA 4NUUA 4BJNA 1D0ZA 1LVFA 3I9YA 4EYYR 1IAPA 1BR1A 3N2OA 4DO0A 1HX8A 3Q9DA 2DWGA 4O4HE 3P7IA 4F6RC 3VHLA 3ZJ1A 2DLRA 4TZ4C 5LGTB 1BR2A 2BDEA 1HCIA 2YK0A 3MK7C 3O1JA 1BR4A 2XTLA 1KNZA 1AJ3A 3IF8B 2A72A 2K48A 4I55E 2HPLA 5LGUB 2KLQA 3MXZA 5J2TE 5JDGA 5JRCA 3I0OA 2N9DA 2NTXA 3F31A 3K3QC 4L9IA 4ZI2C 1D0XA 3ONXA 3N9NA 1WRDA 4MHCA 2XAHB 2VKJA 3ESLA 2PBIA 2CWYA 5FYMA 3K3OA 2YU1A 5LBQB 2ZM2A 2LOPA 4ZI3C 4UEMA 2DCFA 2D0UA 1BR0A 5JREA 4IE0A 4QX7B 4EXTA 3GMIA 2NW8A 3W15B 4AQFC 1WR6A 3B57A 1HFAA 2X68A 3R6NA 4AKHA 3Q2MA 3MZKB 4AXPA 2CE7A 3MA9A 3NRXA 2C0SA 5JQGE 4TN7B 3DJBA 3ZJ2A 4EAHA 3PDYA 4GYSA 1HF8A 4L0RA 5DQVA 2XAGB 4C91A 5L3CB 2WBLA 5LCYA 3J9X1 1FMVA 3E08A 2GK9A 2NW7A 4AKLA 5FY0A 2MTQA 4YJ2E 3AVSA 2ACXA 4PK6A 4CXWA 5TAOA 3Q5WA 3I9WA 1IZNB 2NOXA 5EK4A 4PJLA 5EZYE 4DBQA 4IIJE 3N5LA 4CI2B 4ZI3D 5LNKA 5J1GA 4IE7A 3ZMUB 3KV6A 3IEEA 5DABA 2C5IT 3PTRB 4UV8B 4KUMB 4AQFA 5LHIB 3KDSE 3KVBA 4DVDA 5HAXA 3HL6A 3N2GE 4H9RC 1OWAA 2VKOA 4DBRA 5L3FB 4QKNA 3L3PA 2E8IA 1MNDA 4IE5A 4QWNB 3O9XA 5HWYA 4PFOA 5JDQA 2L3LA 4N78D 5E0OA 3EVYA 3WAJA 1MMAA 4HFVA 4I50E 5KMGP 3PUGA 5ETWA 4G63A 3LK42 3ETUA 3SOLA 4GOUA 3CMLA 2W0GA 3ANWA 5L3DB 5L3EB 2NP9A 3VKHA 4WNKA 2LSGA 4AKRB 2PG8A 1V9DA 3MKDA 4A56A 5LA6E 5FXWA 1O3XA 1VRBA 2CXLA 1D1CA 3O1HA 4HGAA 4TUYE 4H63V 5FXXA 2H3RA 4U72A 5LHGB 3ZCJA 2JQQA 2WM9A 3AA1B 4MALA 4OYKA 2C5KT 2JMHA 3UT5E 4DNDA 4EZ4A 2K5BB 2DNXA 3GWHA 1S35A 2QGSA 2E9XC 4YFSA 5LGNB 2RP4A 2EHOD 4P09A 2KNDA 3MJXA 4X20E 4UIGA 5CA1E 5KX5E 2K24A 2H7OA 1D1AA 2G0UA 2KT9A 4ILUA 1EZ3A 4PW8A 5GONE 4X1YE 1MMDA 5L3BB 1OXZA 2V26A 4YJ3E 4PK5A 3AA6B 4PK4A 2KXPB 4XAXB 4H9OC 5HYAA 4O2BE 1FIOA 5HXRA 2CCQA 2V7JA 4WBNE 3O4XE 5JR9B 4G2AA 4WW0A 4H9PC 4CXYA 3HI2A 1G73A 4EOZB 5LXTE 3VU7H 2UXXB 5LG4A 5FP3A 5EK2A 2X51A 2VKHA 3ZPOA 1LRZA 4GK5E 2D0TA 2E9XD 3PE0A 2CM0A 1U4QA 5JDNA 1LVKA 4O4IE 2XAFB 1UX4A 5HXHA 2E9XA 2A3DA 2V7LA 3R84B 1Z0PA 3OYZA 3S4UA 3BK9A 4P0BA 1G8XA 3EDVA 4BA9A 4ISSA 5JDFA 2CXFA 4EYUA 3KFWX 4H63H 2JRKA 2Q9QD 3HKDE 1ZKEA 5JDMA 2WSSV 5LJNA 3WI3A 3AAAB 2LHRA 1IJ5A 4IE4A 3ETVA 3RKOA 4O8SA 3BQIA 2Q9QA 4QXCB 3N9LA 1VOMA 3NBXX 2X0LB 2CLYC 4HKAA 4QXHB 4OK0A 5LOVE 3TKLB 3GA8A 5HXCA 5A1LA 5JDLA 2Y6XA 4I43B 4H9QC 1HG2A 2ZLYA 2HPJA 2LOSA 3C4XA 3K8PC 2V1DB 4DMVA 5C8YE 3ZYLA 2M67A 2VK9A 4CXXA 5JRCB 2MYSA 1UCUA 3RH3A 2ES0A 1NAFA 3BQKA 3FXEB 4OYJA 3KBUA 2E9XB 3ZYKA 1QUUA 2BZBA 3N9PA 3M65A 1X79A 2IC6A 3QC9A 4AI6A 3ZLIA 3N9QA 3EDUA 3C50A 2JMKA 2XASB 5FY7A 2QA7A 2VKDA 3KV9A 4IHJE 3BQLA 4EIWA 1MMNA 4MBQA 3I1AA 3U3IA 3HKEE 3ZMSB 3SRZA 2D2SA 2V7KA 2W62A 3HKCE 4ZOLE 3B13A 3LG7A 3AA7B 3N9OA 4ANJA 4P0AA 2J1DG 3OYXA 2NW9A 4E7ZA 5JH7E 3CQGB 4KMCA 4FI5A 3PUQA 2EHOC 5DJQC 3ZN0B 4E7SA 3KINB 4ZS3A 4AKGA 2W61A 1MNEA 4MLKA 3OBVE 3CVRA 1MIVA 3CX6B 4HN9A 4CI1B 4UVBB 4PJMA 5LP6E 4ADZA 4TV8E 3RYIE 2KZ7B 2LE8A 2WMNA 5H6RB 5LJMA 3UFEA 3UUXB 4IDZA 4YLHA 3ZMZB 2KWIB 2RA1A 4ZI7E 2CXDA 5DQWA 1MIWA 3ZCIA 3FXDB 3CQCB 3LFMA 2CLYB 2KINB 2LSJA 1KK7A 4GK0E 2WMOA 2YINA 5J2UE 3SWHA 3HA4A 5FXZA 3NZPA 3P8CD 1ZV4X 3KVAA 3O1IA 4X1KE 2MOZA 2DWKA 3SS1A 2XQYA 2XHEB 2Y8DA 3ANWB 3ZEFB 3C98B 5LHHB 3WAKA 4TX5A 3N9MA 2EHOA 2SPCA 2Y48B 1T98A 3PU8A 4KBMB 4KP3C 3VKGA 3C64A 3RYCE 3FHNA 2Q9QC 3E0ZA 4MFRA 2CEAA 4UXNB 4I4TE 2CMRA 3H37A 3F57A 4JEUB 4QX8B 2XAJB 4QHOA 1ZHCA 2HH7A 3KBTA 2WAUA 3T8OA 1QSDA 2X9WA 2ZM8A 1D0YA 2X66A 4PNIA 3H3AA 2KWHA 4ASKA 3OJAA 2VASA 3Q5XA 5M4YA 5HWXA 5L3GB 3AAIA 3CX8B 2I59A 5CA0E 5H6QB 4Z8XA 4ZHQE 5L2LA 4M1PA 3L09A 2X67A 4NUVA 4X1IE 4OFZA 2BVLA 3FBZA 5FY1A 5HXSA 2LM9A 2YEVC 4L5GA 1Y64B 2EHOB 1YD8G 2L8KA 4O2AE 4QXBB 3CWZB 3CKDA 1MIYA 1NWMX 2PFVA 3GN5A 1YKHB 4B6XA 1SHZC 3HKBE 4U74A 4C90A 3AA0B 3UTKA 5ADXL 1CUNA 2JPFA 1FEWA 2ZMAA 4HEAA 5FXVA 1UX5A 4JEHB 5BMVE 2OA5A 2PJQA 5CB4E 3RRWA 3C4ZA 4V1Av 4EZHA 4J2CA 2XUEA 3PU3A 4XBFB 3ZYMA 4JLEA 3LJCA 3KV5A 4UV9B 2NTYA 2DHRA 3UULA 3RC3A 2MBGA 2LJLA 3C4WA 5IHYA 1D1BA 2KMFA 2NWBA 3E22E 3NRYA 4EB6E 4IGUA 4BJMA 4PJJA 2A2FX 3C51A 4ERRA 2UXNB 2W00A 1WYCA 2IC9A 4FJOA 3ZC0A 1IJ6A 5KDMC 3LBXA 2L9QA 4CI3B 2BVMA 2LT3A 3GN5B 1HS7A 3RYFE 5FMNA 2LSKA 3CX7B 2JJ9A 3K3NA 1YW0A 3RRCA 3JC6C 3MACA 3EUHA 2B1EA 2Q9QB 3A5XA 4UF0A 4CZZB 4ZI2D 5LYJE 3IBPA 2DI4A 4H9SE 3LK3B 3OKQA 4GIWA 3RC8A 3F2EA 3DP7A 5F8PA 1US7B 2LHNA 3I0QA 5F3JA 4O4LE 1SA0E 1WLXA 3QK6A 1H7CA 2IAKA 4WBOA 1U5PA 2XAQB 3NZQA 5EK3A 2ODUA 5JVDE 3UUMA 4AQGA 4GYRA 3UUNA 4YHJA 1LKXA 2CWOA 2LEHA 5JR9C 3LBXB 3PUSA 1FMWA 5JDHA 1HTJF 3RYHE 3ZN1B 3PURA 3QUJA 1MMGA 2VL8A 1HG5A 2N1GA 2X9HA 1S94A 2IW5B 4CQIA 5HXEA 3PUAA 3JC6D 2V7MA 3AVRA 4UVAB 3CPZA 3RX6A 2V7IA 5LBMA 4UF0B 5AFUL 3RPUA 4BAYB 4UELA 2D5UA 3D0TA 3V5SA 5IYZE 4OHFA 3U78A 4O4JE 2LSYA 3DTOA 3CQXC 3FB2A 3IHRA 1YKEB 2C5JA 3LK2B 1ZEEA 2WWUA 2LSIA 2W63A 3KV4A 1B7TA 3N2KE 4TV9E 2Z6EA 2X9XA 1WYBA 2K9AA 2VB6A 4DMWA 3AAEB 5JR9A 3ZC1A 2YU2A 2H7VC 3ZMTB 4H9NC 2ODVA 4PFPA 3HR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M4Y A;  1FIO A;  2DNX A;  2XHE B;  1G73 A;  1FEW A;  3C98 B;  3LG7 A;  4JEH B;  1HS7 A;  4JEU B;  4TX5 A;  1BR0 A;  1EZ3 A;  5LG4 A;  1S94 A; 
#chains in the Genus database with same CATH topology
 4OX9 T;  1HR0 T;  4ZS2 A;  2VWA A;  3RKG A;  2P9B A;  3ZMV B;  5FNV E;  1D0Z A;  1LVF A;  4IDQ A;  4A5X A;  1W0A A;  1BR1 A;  4DO0 A;  1NEN A;  2ZM6 T;  2DLR A;  5LGT B;  1BR2 A;  2YK0 A;  3MK7 C;  2XTL A;  3IF8 B;  2K48 A;  2HPL A;  2KLQ A;  5J2T E;  4DUY T;  1N36 T;  2N9D A;  3F31 A;  3N9N A;  4MHC A;  2PBI A;  4B3R T;  4ILA A;  1IBK T;  3K3O A;  2YU1 A;  2LOP A;  4ZI3 C;  4UEM A;  2DL1 A;  1HNZ T;  5JRE A;  2NW8 A;  4ZZB A;  3B57 A;  1HFA A;  1SUM B;  3MA9 A;  5JQG E;  5AQI B;  4EAH A;  4GYS A;  4C91 A;  4YSX A;  3AE2 A;  3E08 A;  3J9X 1;  4YJ2 E;  3TLW A;  4PK6 A;  3Q5W A;  4JI2 T;  3X1D A;  5IWA T;  5EK4 A;  4IIJ E;  4CI2 B;  4COF A;  3ZMU B;  2XQ8 A;  5DAB A;  2C5I T;  4HFD A;  3KVB A;  3N2G E;  1OWA A;  4DBR A;  4KHZ F;  3L3P A;  4IE5 A;  2AXD S;  3RF1 A;  1WFD A;  1MMA A;  5AQG B;  3PUG A;  1XZY A;  4GOU A;  3ANW A;  5L3D B;  2LSG A;  4AKR B;  4YSZ A;  4A56 A;  1JNZ A;  5LA6 E;  1D1C A;  3O1H A;  1E2A A;  4HGA A;  4KX6 A;  3TLT A;  5C3J A;  3FZH B;  5FXX A;  4U72 A;  3ZCJ A;  2JQQ A;  2WM9 A;  4B3M T;  4DR2 T;  1M7K A;  3ABV A;  1W09 A;  3QNU A;  5LGN B;  4YFS A;  4X20 E;  2KND A;  1D1A A;  1L0V A;  4YJ3 E;  3AA6 B;  1XMO T;  2V5C A;  5HYA A;  2V7J A;  2BS2 A;  2CRB A;  3HI2 A;  2W66 A;  4HFB A;  3VU7 H;  5LG4 A;  5FP3 A;  1OED B;  2BBH A;  2E9X D;  1KEY A;  2BS4 A;  5JDN A;  2OLT A;  1UX4 A;  4JI4 T;  3OPC A;  1J5E T;  5LB7 B;  4BA9 A;  3EDV A;  2JQK A;  1ZKE A;  3AAA B;  4IE4 A;  2LKG A;  5CGM A;  2Q9Q A;  3N9L A;  2WZH A;  2CLY C;  3TKL B;  5LOV E;  4JI0 T;  3QOF A;  5JDL A;  4H9Q C;  2LOS A;  1YXR A;  5JRC B;  3AE5 A;  2J47 A;  2ES0 A;  2IUB A;  1NAF A;  3BQK A;  2V6Y B;  3KBU A;  2V6X A;  1SE7 A;  4K0K T;  2IC6 A;  4AI6 A;  3AXJ B;  5HEO A;  3C50 A;  2IHR 1;  2XAS B;  3RIF A;  4CN1 A;  1ZP0 A;  5AQR B;  2BBJ A;  3ZMS B;  5LG3 A;  3P4Q A;  3HKC E;  2VVS A;  3AA7 B;  2WQY A;  3N9O A;  3PUQ A;  2EHO C;  4ZS3 A;  4DR3 T;  1MNE A;  4ZEY A;  2LRL A;  3CX6 B;  5AQH B;  4UVB B;  2LLY A;  2KZ7 B;  1W9R A;  5LJM A;  3UUX B;  4YLH A;  3ZMZ B;  2RA1 A;  4ZI7 E;  3FXD B;  1OED E;  2LSJ A;  4DV2 T;  5CFB A;  1UUR A;  2WMO A;  3A7M A;  3SWH A;  5FXZ A;  3P8C D;  3O1I A;  4X1K E;  2XQY A;  5LHH B;  5FL1 A;  3C98 B;  3CK6 A;  3AEF A;  3UFG A;  4KP3 C;  3OTO T;  3VKG A;  1J5W A;  2Q9Q C;  2YKS A;  4I4T E;  4X65 T;  4QX8 B;  2XAJ B;  4QHO A;  3FZK B;  1D0Y A;  2X66 A;  2I59 A;  4ZHQ E;  4M1P A;  4ZZC A;  2XQ3 A;  1M62 A;  4YXD A;  5HCJ A;  3GN5 A;  5J0Z A;  2ZMA A;  4HEA A;  5CB4 E;  4DR5 T;  3RRW A;  3C4Z A;  2XUE A;  3LJC A;  3UUL A;  2PTF A;  2XSA A;  1UK5 A;  4BJM A;  4LFB T;  4ERR A;  2UXN B;  2W00 A;  4FJO A;  1IJ6 A;  5AQM B;  2BG9 C;  3GN5 B;  3UUB A;  3PUV F;  4TNW A;  5ABE A;  1YW0 A;  3EUH A;  2B1E A;  4ZI2 D;  5LYJ E;  2DI4 A;  3OKQ A;  4LML A;  2WZI A;  5F8P A;  2QYW A;  1SA0 E;  2FUP A;  2IAK A;  2XY8 B;  1U5P A;  4JI5 T;  3NZQ A;  3UUM A;  4GYR A;  3NKZ A;  3UQ7 A;  5AQJ B;  1LKX A;  5AQV B;  1XDO A;  3ZN1 B;  1N33 T;  3PUR A;  3QUJ A;  4HWI B;  1HG5 A;  3PUA A;  3JC6 D;  2E5L T;  2V7I A;  3D0T A;  4QH4 A;  3T1H T;  4OHF A;  3CQX C;  3FB2 A;  1YKE B;  2C5J A;  1ZEE A;  3ZT6 A;  3N2K E;  1HX1 B;  4TV9 E;  2X9X A;  4LMJ A;  2WWV A;  2WDR A;  2VB6 A;  3AAE B;  2H7V C;  3FZM B;  4IDN A;  4LF7 T;  3AB3 B;  2IDO B;  3V5U A;  1HNX T;  2N2N A;  2BKO A;  4Z91 A;  4PAG A;  2ZM0 A;  5C2T A;  4K0U A;  3P4S A;  4NUU A;  4NXM T;  2LM2 A;  4EYY R;  3EI0 A;  5F5W A;  4DV6 T;  4O4H E;  2FJE A;  2BDE A;  3O1J A;  1AJ3 A;  3MXZ A;  4DV1 T;  3K3Q C;  4HFH A;  3ONX A;  3K1S A;  3ESL A;  1ZOY A;  2XQA A;  2D0U A;  1BR0 A;  1WR6 A;  3Q2M A;  4AXP A;  3NRX A;  2C0S A;  3RLF F;  3PDY A;  5DQV A;  4L0R A;  5L3C B;  5LCY A;  1FMV A;  2BS3 A;  1IBL T;  2MTQ A;  3T1Y T;  3AVS A;  5LMU T;  2ACX A;  4PJL A;  3N5L A;  5LNK A;  5J1G A;  4IE7 A;  3IEE A;  2UXD T;  4UV8 B;  4YY3 T;  5LHI B;  3KDS E;  4DVD A;  1I94 T;  5L3F B;  2E8I A;  1MND A;  4I50 E;  5ETW A;  3LK4 2;  3SOL A;  1WR0 A;  4U3C A;  4JI7 T;  1V9D A;  5FXW A;  1O3X A;  2CXL A;  2UUC T;  4AIU A;  3H3M A;  3EAM A;  2BKN A;  5LHG B;  3AA1 B;  2MAW A;  5AQT B;  3UT5 E;  5AQP B;  1S35 A;  2QGS A;  2E9X C;  4X66 T;  2RP4 A;  3SFE A;  5KX5 E;  2K24 A;  2UXB T;  2XM2 A;  4ILU A;  5GON E;  3ONJ A;  3JCF A;  4XAX B;  1XMQ T;  2CCQ A;  5JR9 B;  4EOZ B;  5LXT E;  4A97 A;  1UUS A;  2J62 A;  5AQL B;  2CPT A;  2WP9 A;  2LRK A;  2X51 A;  2VKH A;  4GKJ T;  1LRZ A;  4GK5 E;  2D0T A;  5L4E A;  3NWI A;  3ZT5 A;  2XQ5 A;  2XQ9 A;  3R84 B;  1Z0P A;  3BK9 A;  4P0B A;  4EYU A;  5FKY A;  3KFW X;  2JRK A;  5JDM A;  2WSS V;  3ETV A;  4O8S A;  1VOM A;  2X0L B;  4QXH B;  4OK0 A;  2W4X A;  2Y6X A;  2HPJ A;  2CHO A;  2H89 A;  2V1D B;  2CBJ A;  3RH3 A;  3AED A;  3M65 A;  1JNR A;  3ZLI A;  3N9Q A;  3KV9 A;  3BQL A;  1MMN A;  4ILC A;  3SRZ A;  4ZOL E;  3LG7 A;  4ANJ A;  4P0A A;  2J1D G;  3CQG B;  4KMC A;  4FI5 A;  4U2Z A;  1T72 A;  3JAF A;  4PJM A;  3RQW A;  5LP6 E;  4TV8 E;  2LE8 A;  4EV6 A;  2WMN A;  5H6R B;  3CQC B;  2CLY B;  2KIN B;  2WCA A;  1KK7 A;  2D9D A;  5J2U E;  4Q25 A;  3HA4 A;  2XSB A;  3NZP A;  1ZV4 X;  4JYA T;  2DWK A;  2XHE B;  3ANW B;  3ZEF B;  3AE9 A;  2UU9 T;  3WAK A;  4TX5 A;  3N9M A;  2EHO A;  4LF6 T;  2SPC A;  2Y48 B;  3PU8 A;  4KBM B;  4IL4 A;  4MFR A;  2CMR A;  3F57 A;  2WAU A;  2ZM8 A;  4ASK A;  2KWH A;  2R6G F;  2HN1 A;  2UUA T;  3Q5X A;  5HWX A;  3UU5 A;  5H6Q B;  5L2L A;  2X67 A;  4NUV A;  4OFZ A;  5AQK B;  2BVL A;  4ZXL A;  3FBZ A;  4L5G A;  1YD8 G;  2EHO B;  4QXB B;  3CKD A;  3HKB E;  4U74 A;  4YTN A;  3AA0 B;  3UTK A;  1W0B A;  2UXC T;  1FEW A;  2OA5 A;  3EAB A;  4UV9 B;  2NTY A;  3RC3 A;  2LJL A;  3C4W A;  4JI8 T;  1D1B A;  2NWB A;  4PJJ A;  1WYC A;  2IC9 A;  2BVM A;  2YDS A;  2CBI A;  3CX7 B;  2JJ9 A;  1N34 T;  3JC6 C;  3MAC A;  2Q9Q B;  4UF0 A;  4H9S E;  3RHW A;  3ZT7 A;  4QH5 A;  3DP7 A;  3P50 A;  3QB5 A;  3I0Q A;  1WLX A;  3ZST A;  2LEH A;  1FMW A;  4DR6 T;  2BG9 A;  1S94 A;  1VCT A;  4UR9 A;  3RX6 A;  5LBM A;  4UF0 B;  4UEL A;  3V5S A;  5IYZ E;  3U78 A;  2XPK A;  3IHR A;  2LSI A;  2W63 A;  3KV4 A;  4JBW F;  1B7T A;  2BG9 B;  4PFP A;  4TWH A;  4HTE A;  3J7Y q;  2CA5 A;  4JUY A;  4LF9 T;  2X9Y A;  4EED A;  3RIA A;  4DR1 T;  4LF5 T;  4PJN A;  4HE8 A;  4BJN A;  3I9Y A;  4X5T A;  2W2U A;  4DR7 T;  1IAP A;  3N2O A;  4F6R C;  3ZJ1 A;  4X64 T;  1HCI A;  1FJG T;  1BR4 A;  1KNZ A;  5LGU B;  2NR4 A;  5JDG A;  2NTX A;  1D0X A;  2XAH B;  3M3Z B;  4H9N C;  3SFD A;  2CWY A;  2UUB T;  4WZX A;  2DCF A;  4QX7 B;  4EXT A;  3GMI A;  4AQF C;  3R6N A;  3MZK B;  4LFA T;  3DJB A;  3TLV A;  2XJ7 A;  2W67 A;  1XWM A;  5FY0 A;  5KXJ A;  4CXW A;  2NOX A;  5EZY E;  4DBQ A;  3RGL A;  2WB5 A;  3KV6 A;  4NXN T;  4Z90 A;  1YQ3 A;  4IDP A;  2BG9 E;  4KUM B;  5HAX A;  3HL6 A;  2K3W A;  1N32 T;  3JAE A;  3L8R A;  3O9X A;  4DV5 T;  4PFO A;  5JDQ A;  1E7P A;  5E0O A;  3EVY A;  3WAJ A;  4JI6 T;  5KMG P;  2W0G A;  5L3E B;  2NP9 A;  4WNK A;  1Z8U A;  4HFE A;  2PG8 A;  3MKD A;  1KNR A;  5CJ5 A;  1VRB A;  3NVO A;  2XQ7 A;  4TNV A;  2H3R A;  2QVA A;  2VL0 A;  4OYK A;  2JMH A;  3UU3 A;  5LMN T;  4DND A;  4EZ4 A;  2K5B B;  2DNX A;  2WDV A;  3GWH A;  2EHO D;  4UIG A;  3AEC A;  2H7O A;  3AE6 A;  4DR4 T;  4PW8 A;  1EZ3 A;  4X1Y E;  1MMD A;  5L3B B;  1OXZ A;  4I0U A;  4H9O C;  4O2B E;  5HXR A;  1R8I A;  3O4X E;  2WS3 A;  4WW0 A;  4CXY A;  1UGO A;  4YT0 A;  2FJD A;  4JV5 T;  3VR9 A;  3PE0 A;  1U4Q A;  1T7S A;  2YDQ A;  1LVK A;  4O4I E;  2XAF B;  5HXH A;  2E9X A;  2A3D A;  2V7L A;  3S4U A;  3OYZ A;  2FBW A;  4X62 T;  4U7I A;  2V5D A;  1G8X A;  4ISS A;  5JDF A;  2CXF A;  3LDQ B;  4YTM A;  2Q9Q D;  2VVN A;  2CHN A;  5LJN A;  3WI3 A;  2LHR A;  3PUX F;  4QXC B;  3NBX X;  3GA8 A;  5HXC A;  4I43 B;  1HG2 A;  2ZLY A;  5C8Y E;  3ZYL A;  2M67 A;  1GQE A;  5AQS B;  1UCU A;  3FXE B;  4DUZ T;  4AQY T;  4OYJ A;  5AQF B;  2E9X B;  2BZB A;  3N9P A;  1X79 A;  3PV0 F;  3UQ4 A;  2VKD A;  4EIW A;  4IHJ E;  4U33 A;  3RQU A;  3AEE A;  3I1A A;  3U3I A;  3TLU A;  2E2A A;  3B13 A;  2A9U A;  2RPA A;  3AEB A;  2NW9 A;  5JH7 E;  3ZN0 B;  4E7S A;  4U7Y A;  3CVR A;  1MIV A;  4HN9 A;  3FZF B;  2I0M A;  2X0H A;  3UFE A;  4IDZ A;  3B5M A;  2H88 A;  5DQW A;  1MIW A;  2VQE T;  3LFM A;  5HEU A;  3PUW F;  3TLS A;  4B3T T;  3UU6 A;  3KVA A;  2WY2 A;  2MOZ A;  3SS1 A;  2JQH A;  2Y8D A;  3G06 A;  1T98 A;  3VRA A;  3FHN A;  4P1N A;  3E0Z A;  2CEA A;  3PJA A;  4UXN B;  4JEU B;  3P4W A;  1ZHC A;  3KBT A;  3T8O A;  1QSD A;  2X9W A;  4PNI A;  3H3A A;  3OJA A;  2VAS A;  2YOE A;  5M4Y A;  3AAI A;  5CA0 E;  3P4R A;  1IBM T;  3L09 A;  5FY1 A;  2LM9 A;  2YEV C;  4O2A E;  2L8K A;  1MIY A;  1NWM X;  2PFV A;  1YKH B;  2XM1 A;  1SHZ C;  4IRE A;  2QRX A;  2JPF A;  5FXV A;  1UX5 A;  5BMV E;  3OVU A;  5BR8 T;  2PJQ A;  4EZH A;  3PU3 A;  4XBF B;  4JLE A;  2LKH A;  2DHR A;  5IHY A;  3NRY A;  5AQN B;  4EB6 E;  3E22 E;  3RIU A;  3C51 A;  5KDM C;  3LBX A;  2L9Q A;  1QLB A;  1HS7 A;  3RYF E;  5FMN A;  3K3N A;  4CZZ B;  3JAD A;  3LK3 B;  1US7 B;  5F3J A;  4O4L E;  3QK6 A;  1H7C A;  2MPK A;  2XAQ B;  4AQG A;  4HWD A;  1T8B A;  3PUZ F;  2CWO A;  5JR9 C;  3LBX B;  5L47 A;  1HTJ F;  3RYH E;  4TWF A;  1MMG A;  2IW5 B;  3AVR A;  4UVA B;  2J4G A;  5AFU L;  3RPU A;  2ACZ A;  4HWC A;  3VR8 A;  3AE7 A;  4ILB A;  2JIW A;  3LK2 B;  4GKK T;  4UVC B;  1KNP A;  2VUR A;  4LFC T;  1OED A;  3Q5D A;  4IE6 A;  3FBL A;  4XZC A;  1E1H B;  3FZL B;  4AKI A;  3RIU C;  4IST A;  4HFC A;  1HX8 A;  3Q9D A;  2DWG A;  3P7I A;  3VHL A;  4TZ4 C;  5ABF A;  5AQU B;  2A72 A;  4I55 E;  4B3S T;  5JRC A;  3I0O A;  4ZI2 C;  4L9I A;  2I6H A;  1WRD A;  2VKJ A;  2V6Y A;  5FYM A;  2VQF T;  5HEH A;  2IIU A;  5LBQ B;  4YTP A;  2ZM2 A;  2E5V A;  1CHU A;  4IE0 A;  3AXJ A;  3W15 B;  4KI0 F;  2X68 A;  4HWH A;  4AKH A;  2CE7 A;  4TN7 B;  3ZJ2 A;  5ABF B;  1HF8 A;  4CN6 A;  2XAG B;  2WBL A;  3ZKR A;  2GK9 A;  2NW7 A;  4AKL A;  2AE9 A;  5TAO A;  5ABH A;  3I9W A;  1IZN B;  4DV3 T;  4ZI3 D;  4DV4 T;  2XQ6 A;  5ABG A;  3PTR B;  3UU8 A;  4AQF A;  2V8S V;  3Q5E A;  4H9R C;  4EGW A;  4DV7 T;  2VKO A;  4EEB A;  4QKN A;  1OED C;  4QWN B;  5HWY A;  2L3L A;  4N78 D;  4HFV A;  4G63 A;  3ETU A;  3CML A;  3VKH A;  4F8H A;  1KFY A;  1XDP A;  4CN4 A;  1HNW T;  4JI3 T;  5HEJ A;  2YDR A;  3EHZ A;  1DU2 A;  4TUY E;  4H63 V;  3AEG A;  4MAL A;  1YQ4 A;  2C5K T;  4NPP A;  4WYV A;  4P09 A;  3MJX A;  5CA1 E;  2G0U A;  2KT9 A;  2V26 A;  3CIR A;  4PK5 A;  4PK4 A;  2KXP B;  1FIO A;  2XZE A;  4WBN E;  5FVL A;  4G2A A;  4H9P C;  1G73 A;  2UXX B;  5EK2 A;  3ZPO A;  2CM0 A;  2F4V T;  4LF8 T;  5JTG A;  5HEG A;  4H63 H;  3HKD E;  1WCR A;  4LMK A;  1IJ5 A;  3RKO A;  3BQI A;  3LSV A;  4HKA A;  3VRB A;  4A98 A;  5A1L A;  5FL0 A;  3K8P C;  3C4X A;  2VK9 A;  4CXX A;  2IML A;  2MYS A;  3ZYK A;  1QUU A;  3L39 A;  2FJA A;  3QC9 A;  3EDU A;  4DV0 T;  2JMK A;  5FY7 A;  2QA7 A;  4MBQ A;  3RI5 A;  4JI1 T;  3HKE E;  4KHP T;  2D2S A;  2V7K A;  2W62 A;  4TWD A;  3OYX A;  3QB5 K;  4E7Z A;  5DJQ C;  4AKG A;  3KIN B;  2W61 A;  2WU2 A;  4MLK A;  3OBV E;  1NEK A;  4CI1 B;  4ADZ A;  3RYI E;  4IDO A;  2KWI B;  3AE3 A;  2CXD A;  3ZCI A;  2WDQ A;  1X9B A;  4GK0 E;  2JQ9 A;  2YIN A;  1I6Z A;  5IUX A;  3P4P A;  3ONL C;  3C64 A;  3RYC E;  4YHH T;  3UU4 A;  3H37 A;  1J1J A;  2HH7 A;  4LF4 T;  4YSY A;  3A8Y C;  5L3G B;  3CX8 B;  4Z8X A;  2HN2 A;  4X1I E;  5FVK A;  5HXS A;  1Y64 B;  4HFI A;  3CWZ B;  5HCM A;  4B6X A;  4AIS A;  3AE4 A;  4C90 A;  5ADX L;  2OV9 A;  4U2Y A;  1CUN A;  5AQO B;  4JEH B;  1Y01 A;  4V1A v;  4J2C A;  2M6I A;  3ZYM A;  3KV5 A;  2MBG A;  4IL9 A;  2KMF A;  2HHH T;  4IGU A;  3IA3 A;  2M6B A;  2A2F X;  2XQ4 A;  3ZC0 A;  3ZSS A;  4CI3 B;  2YN6 A;  2LT3 A;  4U31 A;  2LSK A;  2WU5 A;  3RRC A;  1KF6 A;  3A5X A;  3IBP A;  4GIW A;  3RC8 A;  1XNR T;  5L4H A;  3F2E A;  3AE8 A;  2LHN A;  4NIQ A;  3PUY F;  4WBO A;  5EK3 A;  2ODU A;  5JVD E;  2KSR A;  3UUN A;  4YHJ A;  3PUS A;  4HWF A;  5JDH A;  2VL8 A;  2N1G A;  2X9H A;  4CQI A;  5HXE A;  2V7M A;  3CPZ A;  4BAY B;  2B76 A;  2D5U A;  1VCS A;  4O4J E;  1XNQ T;  2LSY A;  3DTO A;  4DID B;  3PJA J;  5AQQ B;  3AE1 A;  2BKP A;  2FJB A;  2X0Y A;  2WWU A;  4QH1 A;  3AEA A;  2Z6E A;  1WYB A;  2K9A A;  4IT4 A;  4DMW A;  5JR9 A;  3ZC1 A;  2YU2 A;  3ZMT B;  4DMV A;  2ODV A;  3HR0 A; 
#chains in the Genus database with same CATH homology
 3AB3 B;  4UVC B;  4HTE A;  3J7Y q;  2CA5 A;  4ZS2 A;  3V5U A;  4IE6 A;  2N2N A;  4JUY A;  3FBL A;  4XZC A;  2VWA A;  2X9Y A;  4PAG A;  2P9B A;  1E1H B;  2ZM0 A;  4AKI A;  3ZMV B;  5FNV E;  4PJN A;  4K0U A;  4HE8 A;  4IST A;  4NUU A;  4BJN A;  1D0Z A;  1LVF A;  3I9Y A;  4EYY R;  1IAP A;  1BR1 A;  3N2O A;  4DO0 A;  1HX8 A;  3Q9D A;  2DWG A;  4O4H E;  3P7I A;  4F6R C;  3VHL A;  3ZJ1 A;  2DLR A;  4TZ4 C;  5LGT B;  1BR2 A;  2BDE A;  1HCI A;  2YK0 A;  3MK7 C;  3O1J A;  1BR4 A;  2XTL A;  1KNZ A;  1AJ3 A;  3IF8 B;  2A72 A;  2K48 A;  4I55 E;  2HPL A;  5LGU B;  2KLQ A;  3MXZ A;  5J2T E;  5JDG A;  5JRC A;  3I0O A;  2N9D A;  2NTX A;  3F31 A;  3K3Q C;  4L9I A;  4ZI2 C;  1D0X A;  3ONX A;  3N9N A;  1WRD A;  4MHC A;  2XAH B;  2VKJ A;  3ESL A;  2PBI A;  2CWY A;  5FYM A;  3K3O A;  2YU1 A;  5LBQ B;  2ZM2 A;  2LOP A;  4ZI3 C;  4UEM A;  2DCF A;  2D0U A;  1BR0 A;  5JRE A;  4IE0 A;  4QX7 B;  4EXT A;  3GMI A;  2NW8 A;  3W15 B;  4AQF C;  1WR6 A;  3B57 A;  1HFA A;  2X68 A;  3R6N A;  4AKH A;  3Q2M A;  3MZK B;  4AXP A;  2CE7 A;  3MA9 A;  3NRX A;  2C0S A;  5JQG E;  4TN7 B;  3DJB A;  3ZJ2 A;  4EAH A;  3PDY A;  4GYS A;  1HF8 A;  4L0R A;  5DQV A;  2XAG B;  4C91 A;  5L3C B;  2WBL A;  5LCY A;  3J9X 1;  1FMV A;  3E08 A;  2GK9 A;  2NW7 A;  4AKL A;  5FY0 A;  2MTQ A;  4YJ2 E;  3AVS A;  2ACX A;  4PK6 A;  4CXW A;  5TAO A;  3Q5W A;  3I9W A;  1IZN B;  2NOX A;  5EK4 A;  4PJL A;  5EZY E;  4DBQ A;  4IIJ E;  3N5L A;  4CI2 B;  4ZI3 D;  5LNK A;  5J1G A;  4IE7 A;  3ZMU B;  3KV6 A;  3IEE A;  5DAB A;  2C5I T;  3PTR B;  4UV8 B;  4KUM B;  4AQF A;  5LHI B;  3KDS E;  3KVB A;  4DVD A;  5HAX A;  3HL6 A;  3N2G E;  4H9R C;  1OWA A;  2VKO A;  4DBR A;  5L3F B;  4QKN A;  3L3P A;  2E8I A;  1MND A;  4IE5 A;  4QWN B;  3O9X A;  5HWY A;  4PFO A;  5JDQ A;  2L3L A;  4N78 D;  5E0O A;  3EVY A;  3WAJ A;  1MMA A;  4HFV A;  4I50 E;  5KMG P;  3PUG A;  5ETW A;  4G63 A;  3LK4 2;  3ETU A;  3SOL A;  4GOU A;  3CML A;  2W0G A;  3ANW A;  5L3D B;  5L3E B;  2NP9 A;  3VKH A;  4WNK A;  2LSG A;  4AKR B;  2PG8 A;  1V9D A;  3MKD A;  4A56 A;  5LA6 E;  5FXW A;  1O3X A;  1VRB A;  2CXL A;  1D1C A;  3O1H A;  4HGA A;  4TUY E;  4H63 V;  5FXX A;  2H3R A;  4U72 A;  5LHG B;  3ZCJ A;  2JQQ A;  2WM9 A;  3AA1 B;  4MAL A;  4OYK A;  2C5K T;  2JMH A;  3UT5 E;  4DND A;  4EZ4 A;  2K5B B;  2DNX A;  3GWH A;  1S35 A;  2QGS A;  2E9X C;  4YFS A;  5LGN B;  2RP4 A;  2EHO D;  4P09 A;  2KND A;  3MJX A;  4X20 E;  4UIG A;  5CA1 E;  5KX5 E;  2K24 A;  2H7O A;  1D1A A;  2G0U A;  2KT9 A;  4ILU A;  1EZ3 A;  4PW8 A;  5GON E;  4X1Y E;  1MMD A;  5L3B B;  1OXZ A;  2V26 A;  4YJ3 E;  4PK5 A;  3AA6 B;  4PK4 A;  2KXP B;  4XAX B;  4H9O C;  5HYA A;  4O2B E;  1FIO A;  5HXR A;  2CCQ A;  2V7J A;  4WBN E;  3O4X E;  5JR9 B;  4G2A A;  4WW0 A;  4H9P C;  4CXY A;  3HI2 A;  1G73 A;  4EOZ B;  5LXT E;  3VU7 H;  2UXX B;  5LG4 A;  5FP3 A;  5EK2 A;  2X51 A;  2VKH A;  3ZPO A;  1LRZ A;  4GK5 E;  2D0T A;  2E9X D;  3PE0 A;  2CM0 A;  1U4Q A;  5JDN A;  1LVK A;  4O4I E;  2XAF B;  1UX4 A;  5HXH A;  2E9X A;  2A3D A;  2V7L A;  3R84 B;  1Z0P A;  3OYZ A;  3S4U A;  3BK9 A;  4P0B A;  1G8X A;  3EDV A;  4BA9 A;  4ISS A;  5JDF A;  2CXF A;  4EYU A;  3KFW X;  4H63 H;  2JRK A;  2Q9Q D;  3HKD E;  1ZKE A;  5JDM A;  2WSS V;  5LJN A;  3WI3 A;  3AAA B;  2LHR A;  1IJ5 A;  4IE4 A;  3ETV A;  3RKO A;  4O8S A;  3BQI A;  2Q9Q A;  4QXC B;  3N9L A;  1VOM A;  3NBX X;  2X0L B;  2CLY C;  4HKA A;  4QXH B;  4OK0 A;  5LOV E;  3TKL B;  3GA8 A;  5HXC A;  5A1L A;  5JDL A;  2Y6X A;  4I43 B;  4H9Q C;  1HG2 A;  2ZLY A;  2HPJ A;  2LOS A;  3C4X A;  3K8P C;  2V1D B;  4DMV A;  5C8Y E;  3ZYL A;  2M67 A;  2VK9 A;  4CXX A;  5JRC B;  2MYS A;  1UCU A;  3RH3 A;  2ES0 A;  1NAF A;  3BQK A;  3FXE B;  4OYJ A;  3KBU A;  2E9X B;  3ZYK A;  1QUU A;  2BZB A;  3N9P A;  3M65 A;  1X79 A;  2IC6 A;  3QC9 A;  4AI6 A;  3ZLI A;  3N9Q A;  3EDU A;  3C50 A;  2JMK A;  2XAS B;  5FY7 A;  2QA7 A;  2VKD A;  3KV9 A;  4IHJ E;  3BQL A;  4EIW A;  1MMN A;  4MBQ A;  3I1A A;  3U3I A;  3HKE E;  3ZMS B;  3SRZ A;  2D2S A;  2V7K A;  2W62 A;  3HKC E;  4ZOL E;  3B13 A;  3LG7 A;  3AA7 B;  3N9O A;  4ANJ A;  4P0A A;  2J1D G;  3OYX A;  2NW9 A;  4E7Z A;  5JH7 E;  3CQG B;  4KMC A;  4FI5 A;  3PUQ A;  2EHO C;  5DJQ C;  3ZN0 B;  4E7S A;  3KIN B;  4ZS3 A;  4AKG A;  2W61 A;  1MNE A;  4MLK A;  3OBV E;  3CVR A;  1MIV A;  3CX6 B;  4HN9 A;  4CI1 B;  4UVB B;  4PJM A;  5LP6 E;  4ADZ A;  4TV8 E;  3RYI E;  2KZ7 B;  2LE8 A;  2WMN A;  5H6R B;  5LJM A;  3UFE A;  3UUX B;  4IDZ A;  4YLH A;  3ZMZ B;  2KWI B;  2RA1 A;  4ZI7 E;  2CXD A;  5DQW A;  1MIW A;  3ZCI A;  3FXD B;  3CQC B;  3LFM A;  2CLY B;  2KIN B;  2LSJ A;  1KK7 A;  4GK0 E;  2WMO A;  2YIN A;  5J2U E;  3SWH A;  3HA4 A;  5FXZ A;  3NZP A;  3P8C D;  1ZV4 X;  3KVA A;  3O1I A;  4X1K E;  2MOZ A;  2DWK A;  3SS1 A;  2XQY A;  2XHE B;  2Y8D A;  3ANW B;  3ZEF B;  3C98 B;  5LHH B;  3WAK A;  4TX5 A;  3N9M A;  2EHO A;  2SPC A;  2Y48 B;  1T98 A;  3PU8 A;  4KBM B;  4KP3 C;  3VKG A;  3C64 A;  3RYC E;  3FHN A;  2Q9Q C;  3E0Z A;  4MFR A;  2CEA A;  4UXN B;  4I4T E;  2CMR A;  3H37 A;  3F57 A;  4JEU B;  4QX8 B;  2XAJ B;  4QHO A;  1ZHC A;  2HH7 A;  3KBT A;  2WAU A;  3T8O A;  1QSD A;  2X9W A;  2ZM8 A;  1D0Y A;  2X66 A;  4PNI A;  3H3A A;  2KWH A;  4ASK A;  3OJA A;  2VAS A;  3Q5X A;  5M4Y A;  5HWX A;  5L3G B;  3AAI A;  3CX8 B;  2I59 A;  5CA0 E;  5H6Q B;  4Z8X A;  4ZHQ E;  5L2L A;  4M1P A;  3L09 A;  2X67 A;  4NUV A;  4X1I E;  4OFZ A;  2BVL A;  3FBZ A;  5FY1 A;  5HXS A;  2LM9 A;  2YEV C;  4L5G A;  1Y64 B;  2EHO B;  1YD8 G;  2L8K A;  4O2A E;  4QXB B;  3CWZ B;  3CKD A;  1MIY A;  1NWM X;  2PFV A;  3GN5 A;  1YKH B;  4B6X A;  1SHZ C;  3HKB E;  4U74 A;  4C90 A;  3AA0 B;  3UTK A;  5ADX L;  1CUN A;  2JPF A;  1FEW A;  2ZMA A;  4HEA A;  5FXV A;  1UX5 A;  4JEH B;  5BMV E;  2OA5 A;  2PJQ A;  5CB4 E;  3RRW A;  3C4Z A;  4V1A v;  4EZH A;  4J2C A;  2XUE A;  3PU3 A;  4XBF B;  3ZYM A;  4JLE A;  3LJC A;  3KV5 A;  4UV9 B;  2NTY A;  2DHR A;  3UUL A;  3RC3 A;  2MBG A;  2LJL A;  3C4W A;  5IHY A;  1D1B A;  2KMF A;  2NWB A;  3E22 E;  3NRY A;  4EB6 E;  4IGU A;  4BJM A;  4PJJ A;  2A2F X;  3C51 A;  4ERR A;  2UXN B;  2W00 A;  1WYC A;  2IC9 A;  4FJO A;  3ZC0 A;  1IJ6 A;  5KDM C;  3LBX A;  2L9Q A;  4CI3 B;  2BVM A;  2LT3 A;  3GN5 B;  1HS7 A;  3RYF E;  5FMN A;  2LSK A;  3CX7 B;  2JJ9 A;  3K3N A;  1YW0 A;  3RRC A;  3JC6 C;  3MAC A;  3EUH A;  2B1E A;  2Q9Q B;  3A5X A;  4UF0 A;  4CZZ B;  4ZI2 D;  5LYJ E;  3IBP A;  2DI4 A;  4H9S E;  3LK3 B;  3OKQ A;  4GIW A;  3RC8 A;  3F2E A;  3DP7 A;  5F8P A;  1US7 B;  2LHN A;  3I0Q A;  5F3J A;  4O4L E;  1SA0 E;  1WLX A;  3QK6 A;  1H7C A;  2IAK A;  4WBO A;  1U5P A;  2XAQ B;  3NZQ A;  5EK3 A;  2ODU A;  5JVD E;  3UUM A;  4AQG A;  4GYR A;  3UUN A;  4YHJ A;  1LKX A;  2CWO A;  2LEH A;  5JR9 C;  3LBX B;  3PUS A;  1FMW A;  5JDH A;  1HTJ F;  3RYH E;  3ZN1 B;  3PUR A;  3QUJ A;  1MMG A;  2VL8 A;  1HG5 A;  2N1G A;  2X9H A;  1S94 A;  2IW5 B;  4CQI A;  5HXE A;  3PUA A;  3JC6 D;  2V7M A;  3AVR A;  4UVA B;  3CPZ A;  3RX6 A;  2V7I A;  5LBM A;  4UF0 B;  5AFU L;  3RPU A;  4BAY B;  4UEL A;  2D5U A;  3D0T A;  3V5S A;  5IYZ E;  4OHF A;  3U78 A;  4O4J E;  2LSY A;  3DTO A;  3CQX C;  3FB2 A;  3IHR A;  1YKE B;  2C5J A;  3LK2 B;  1ZEE A;  2WWU A;  2LSI A;  2W63 A;  3KV4 A;  1B7T A;  3N2K E;  4TV9 E;  2Z6E A;  2X9X A;  1WYB A;  2K9A A;  2VB6 A;  4DMW A;  3AAE B;  5JR9 A;  3ZC1 A;  2YU2 A;  2H7V C;  3ZMT B;  4H9N C;  2ODV A;  4PFP A;  3HR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...