4ZEYA

Crystal structure of a nuclear receptor binding factor 2 mit domain (nrbf2) from homo sapiens at 1.50 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
84
structure length
84
Chain Sequence
GMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Nuclear receptor-binding factor 2
publication title Crystal structure of a nuclear receptor binding factor 2 MIT domain (NRBF2) from Homo sapiens at 1.50 A resolution
rcsb
source organism Homo sapiens
total genus 31
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17169 NRBF2_MIT MIT domain of nuclear receptor-binding factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4zeyA00
4U3CA 2V6YA 1YXRA 2MPKA 2K3WA 2WY2A 4ZEYA 4NIQA 1WCRA 4U2YA 2DL1A 3K1SA 5CGMA 2JQHA 3ZT5A 4U2ZA 4CN6A 2CPTA 5FVKA 2JQ9A 3EABA 3ZSTA 4U7IA 4P1NA 2W2UA 4CN4A 4A5XA 5LB7B 2XZEA 4U33A 3ZT6A 3ZT7A 4U7YA 4WZXA 4IT4A 2WWVA 2LRLA 2A9UA 2RPAA 2JQKA 2V6XA 2LRKA 5FVLA 2CRBA 5CJ5A 3ZSSA 2V6YB 4U31A 1WR0A 1WFDA 4CN1A
chains in the Genus database with same CATH superfamily
5HXCA 1H7CA 4DIDB 1T72A 1US7B 4UF0B 5EK3A 1W0BA 3SS1A 1SA0E 3I1AA 3AE2A 4A5XA 4L9IA 3AAIA 1G8XA 1YD8G 2XM1A 1U5PA 5LG3A 2YDSA 5FVLA 2V26A 4I43B 1ZP0A 4ZI2C 2LSYA 2KT9A 2D0TA 4YTMA 4ZHQE 1LVKA 3JAFA 1IJ6A 5J2TE 2XASB 2N9DA 2FUPA 5AQOB 3UT5E 1YKEB 5HWYA 2YINA 2ZLYA 3UU6A 3ZJ2A 4EIWA 2GK9A 4KMCA 4C91A 2JMKA 2LEHA 2JMHA 3RQUA 2VL0A 4PJLA 3V5SA 3HKBE 4CZZB 2QA7A 2BG9E 3Q5EA 5CJ5A 2KNDA 3UQ4A 4O4IE 4FJOA 1D0XA 3GMIA 1Y01A 4ZI3C 4IHJE 1FMWA 4Z91A 1SE7A 1MIVA 2UXDT 1WR6A 3AA7B 3SWHA 4U72A 1W09A 4AKLA 4ZOLE 4EYUA 2XTLA 5L3BB 3VRAA 2UUCT 2KZ7B 4UV8B 2HN2A 3JADA 3MA9A 3VR9A 1HF8A 5LB7B 1W9RA 3A7MA 5KX5E 4YXDA 5FY0A 4ANJA 4X65T 4GK5E 5M4YA 3KV5A 4LFCT 4HWFA 4MLKA 4V1Av 4TNVA 4F6RC 2CBJA 3SFEA 2WP9A 2Y6XA 4JI1T 3N9PA 3ZMZB 4EYYR 3LBXA 2LT3A 2RA1A 4UVBB 2V6YB 4PK4A 5HEUA 5L3GB 2VURA 1IZNB 4B3TT 4X66T 2WY2A 4PK6A 2UUAT 3TLTA 4X62T 3FZLB 2JRKA 3ZT5A 4DNDA 4O4HE 4ILAA 3HKCE 5LHGB 1S94A 4IE7A 1ZKEA 4YHJA 4LF5T 2JPFA 3H3AA 2XSAA 2NOXA 4WW0A 3T8OA 4PNIA 4DUYT 3N2KE 2A2FX 3S4UA 4JBWF 4C90A 3AVRA 4WBNE 1NEKA 5HWXA 5LMUT 4UIGA 3MJXA 3AE9A 4YJ3E 5AQKB 4EV6A 3JCFA 4N78D 1I94T 4JI8T 2EHOC 4HFVA 2F4VT 2W00A 4AISA 2XJ7A 5JQGE 4HWHA 2KWHA 3M3ZB 3EVYA 4U33A 2CE7A 4UR9A 3PUYF 2A3DA 4YSYA 4ZS2A 4DV2T 4PJNA 2LKHA 1JNRA 2I0MA 4DBRA 3KBUA 1XMOT 3AEAA 4PK5A 4A98A 4COFA 3H37A 4G2AA 5FY7A 2CA5A 3N9QA 2IHR1 2W66A 3X1DA 3ZSSA 2N2NA 3BQIA 5AQLB 2XQ4A 2HPLA 4JI6T 2BVLA 1Z8UA 1J1JA 3K3NA 2CM0A 2WQYA 2D9DA 2BS2A 4JI2T 4DV6T 4LF4T 3E0ZA 2EHOB 4ZEYA 1UX4A 1J5WA 5FVKA 2LSIA 4NUUA 4MALA 3NZQA 4DR6T 2VQFT 2WDQA 3Q5WA 4HFHA 3L3PA 4DV0T 4AXPA 1HR0T 2XQYA 4KI0F 3T1YT 3BK9A 4HE8A 5LP6E 3PDYA 2LSGA 4DBQA 4ZXLA 3RC3A 3PUVF 4DV1T 4FI5A 1OEDA 2H7VC 2JQQA 3PUWF 3PUXF 3EDVA 2BG9B 2NW8A 3PE0A 1MIWA 2WCAA 4YFSA 3G06A 4QXBB 4LF7T 2CLYC 4HTEA 5FL1A 3RYCE 2NP9A 2H89A 5IYZE 2NW7A 3LSVA 4DMWA 3RF1A 4YSXA 2XSBA 4HFEA 2IC9A 3P8CD 3UULA 4BAYB 3RRCA 4EEBA 3CQXC 3ZSTA 4OX9T 2WZHA 3HI2A 2CXLA 3N9MA 4MFRA 3QOFA 4CN1A 3RHWA 3I9YA 3RIFA 2PFVA 1XDPA 3SOLA 3TLSA 2BZBA 4O2AE 2CLYB 4ILUA 2E9XB 4OHFA 2CRBA 4ZI2D 1UCUA 1Z0PA 3ZYMA 4DR2T 2M6BA 3AA1B 3ZMTB 2B1EA 3CQGB 2CWYA 4KHZF 4DR1T 3C51A 1L0VA 5HCJA 3AA6B 1XWMA 5JDGA 4HFCA 3VRBA 4DVDA 3FZKB 2H3RA 2DWGA 3RIUC 4AKIA 5AFUL 3RC8A 3GN5B 3MK7C 2MBGA 4H9NC 1FEWA 2VL8A 3C4XA 3AE8A 3VKGA 4X64T 3D0TA 4PAGA 5IHYA 1HS7A 4GYSA 2NR4A 3DTOA 2K48A 2LOPA 4DMVA 3HKEE 2Y8DA 5FY1A 2VQET 2E5LT 2E8IA 3QB5K 2CCQA 5JRCB 3N5LA 4HKAA 1QSDA 2Q9QD 4HWCA 2LM9A 4AKHA 1QLBA 2YK0A 1X9BA 2MYSA 3I0QA 5LGNB 4ZZCA 3ZCIA 1LKXA 2PJQA 1T98A 4TWHA 3TKLB 3ZC1A 3ZPOA 2LLYA 2IIUA 4IE4A 4XAXB 3WAJA 3UUMA 3PU3A 4Q25A 3CX6B 3RRWA 2WAUA 3PUZF 2W63A 2AE9A 5CGMA 1SHZC 4UF0A 5J2UE 2XQ3A 5AQSB 4GK0E 5EZYE 3RKGA 4JI0T 3CKDA 1HTJF 2XQ7A 4HFDA 2L9QA 2ACZA 4JYAT 1T7SA 3Q5DA 5BR8T 3R6NA 4X1YE 5HAXA 4CI3B 3PUQA 2FJAA 3OKQA 5LCYA 5F8PA 4AI6A 4LMLA 1AJ3A 3IF8B 4OYKA 2J1DG 4U31A 4QHOA 3A8YC 2LSKA 2JIWA 3T1HT 3UU5A 4JEUB 3OJAA 3FB2A 4GYRA 4B3MT 5ADXL 2X51A 4DV5T 5LBMA 3VR8A 2ZM0A 5CA0E 3UUBA 1IJ5A 1WYCA 2ZMAA 4CXXA 4JI4T 5FYMA 2C5KT 3F31A 3TLWA 4P1NA 1NAFA 2KXPB 3OBVE 4YT0A 4UXNB 1MMAA 2YKSA 3AE1A 3B13A 4LMJA 3RX6A 1WCRA 3KFWX 2MAWA 2FJEA 5AQQB 2UXBT 5C3JA 5HXSA 1D1CA 1W0AA 3F2EA 2XZEA 5EK2A 2OV9A 2WWVA 2VKOA 3MZKB 1B7TA 4DR3T 3H3MA 2ACXA 2IC6A 3KBTA 3EHZA 5LHIB 2LJLA 2BKPA 3I0OA 1KFYA 3K3OA 1WYBA 4U7YA 4A97A 1BR2A 5HEHA 5HEOA 3SRZA 2V1DB 2HN1A 2V6YA 2W67A 4DR7T 4I50E 4YHHT 5AQTB 3AE4A 2E2AA 4CQIA 5AQJB 4EXTA 2Q9QA 5AQGB 2XQAA 3FHNA 1N36T 2WMOA 1YW0A 2LSJA 2D5UA 3FZFB 2R6GF 2I6HA 3DP7A 2V5DA 3KDSE 5FXXA 2LHRA 1O3XA 4HWIB 1VCSA 5FXVA 1M7KA 1YQ3A 3OPCA 2V7IA 1IBMT 4GKKT 2BBHA 2CHOA 2PTFA 3K3QC 4DV3T 5CFBA 3P4QA 4UVCB 2L3LA 5LXTE 5L3DB 3UU4A 5JDLA 2YN6A 4NXNT 3O9XA 5F5WA 2FBWA 5HXRA 4I55E 3PV0F 3I9WA 2PBIA 4ZI7E 2E9XD 2WZIA 2V7MA 2UUBT 2C5IT 3LK42 3CQCB 4IREA 3MACA 4H9SE 4IDOA 3CMLA 5FXWA 4F8HA 5HXHA 2X0HA 5AQPB 4JLEA 5IWAT 3IA3A 2V6XA 3QC9A 4DR5T 5AQMB 3M65A 2YEVC 4AQFC 2IAKA 3WAKA 4IL9A 2H88A 2VVSA 3C50A 2OA5A 5LGUB 4BJNA 5H6QB 4TWFA 3QNUA 1NENA 4O2BE 3PJAA 2BKNA 3C4ZA 5LNKA 3AXJB 5JDNA 5JVDE 5TAOA 1S35A 5EK4A 2B76A 3AEBA 4Z8XA 4QX7B 2X68A 5AQNB 4DR4T 2CXFA 2ZM6T 4KBMB 5LMNT 5ABFB 3J9X1 3RYIE 1SUMB 2XAGB 4EAHA 4TNWA 3UUNA 4H9OC 2IW5B 2WM9A 3C64A 3Q9DA 1HX1B 1MNEA 1WRDA 4IT4A 4JEHB 3ONJA 2ZM2A 2J4GA 4MBQA 2NWBA 3PUAA 3U78A 4DV4T 4LF9T 2BG9A 4YJ2E 4LF8T 2MTQA 4WZXA 3P4PA 2X9HA 4EGWA 1XMQT 1M62A 3AECA 2BS4A 4CXYA 3ANWB 2K3WA 2YOEA 3E22E 1OWAA 4U2ZA 4ERRA 5JDHA 4K0UA 1N32T 1N34T 2WBLA 3KVAA 3L39A 4CN4A 1HFAA 5C2TA 3ZN1B 3N9OA 4JUYA 4OFZA 2VK9A 1IAPA 2VKDA 3AEDA 3AA0B 1X79A 3N2OA 4L0RA 1BR1A 4U2YA 5HEGA 1XNQT 1Y64B 5L4EA 4CI1B 3UTKA 5FL0A 3VU7H 5JH7E 2J62A 2FJBA 3ZYKA 1GQEA 3PUSA 2YDQA 3AEEA 2JJ9A 4U3CA 4TX5A 2UXXB 4B3RT 2X9WA 4HEAA 3KV4A 2CWOA 4EZ4A 1KNRA 3HKDE 5JR9C 4UVAB 4TV8E 4ILBA 2KLQA 2X0LB 1MMGA 3UU3A 3O1IA 3ZC0A 2E9XA 3CVRA 4IE5A 2MPKA 5LA6E 1EZ3A 3AVSA 3LDQB 4KHPT 4XZCA 2NTXA 4U7IA 2LOSA 3IBPA 1QUUA 2H7OA 2WS3A 2VWAA 1D1AA 2W61A 2P9BA 3ESLA 2CHNA 3RH3A 3AEGA 4EZHA 4IDPA 1BR4A 2BS3A 3R84B 4QXCB 4OYJA 2DL1A 4DO0A 4JI7T 4B3ST 2WU5A 3GN5A 4NPPA 4JI3T 4EB6E 1T8BA 2DNXA 2SPCA 3OYXA 5J1GA 4ZZBA 4AIUA 4ZI3D 5JR9B 4X20E 4KUMB 2XAHB 1ZOYA 3O4XE 2KINB 4H9PC 2WDRA 5AQFB 1NWMX 4K0KT 4CI2B 2QGSA 4ASKA 1MMDA 4YLHA 3TLVA 5ABGA 3OYZA 4UV9B 3RPUA 3LK3B 2CMRA 3F57A 2MOZA 4E7ZA 3PURA 4I0UA 5E0OA 5JTGA 3RIUA 2D0UA 4IE0A 3ZJ1A 4J2CA 3O1HA 3E08A 3FZMB 1UURA 3RYFE 1KK7A 1UK5A 4QH5A 2LM2A 2M67A 4I4TE 1MNDA 4X1IE 4IE6A 1D0YA 3NVOA 3ZMVB 3UQ7A 3ONLC 3HA4A 1LRZA 5ETWA 5BMVE 3C4WA 1VRBA 2JQ9A 2HPJA 4MHCA 3CWZB 3DJBA 2C0SA 4ZS3A 2XQ5A 4P09A 3ZT7A 1IBLT 5CB4E 1YXRA 3FXDB 3CX8B 2G0UA 1FMVA 3JC6C 4YTNA 3PU8A 2VVNA 2XQ8A 1J5ET 2XM2A 3NZPA 4TUYE 3P7IA 5JREA 3AE6A 1WR0A 2L8KA 1E1HB 2LE8A 2IUBA 2EHOD 2XQ6A 1V9DA 2IMLA 3B57A 4LFAT 4PJMA 1HX8A 1OEDE 4YSZA 3ZCJA 2N1GA 3AB3B 2LRLA 3NBXX 2VKJA 4TWDA 4ISSA 3P4WA 4HFIA 1KF6A 2ODUA 4EOZB 2X66A 3ZEFB 2V5CA 4H9RC 3CIRA 1MMNA 2DWKA 2Q9QC 5L47A 2JQKA 1IBKT 4UEMA 2XAQB 3FZHB 5DQVA 5L3FB 2ES0A 2DCFA 5F3JA 2CPTA 2WSSV 2Z6EA 3SFDA 2KSRA 4IGUA 3PUGA 2NW9A 5HXEA 2UXCT 2XAFB 5KMGP 3OVUA 2JQHA 4PJJA 3ZN0B 4DV7T 4O8SA 2NTYA 3TLUA 4QXHB 3AAEB 5H6RB 3FBZA 3LBXB 4LF6T 2DI4A 2YU1A 4EEDA 2YU2A 3NWIA 4B6XA 5JDFA 1HNXT 1BR0A 5IUXA 2KWIB 2K9AA 5L3CB 2WU2A 3RI5A 3EDUA 3IHRA 1WFDA 2RP4A 1I6ZA 2HH7A 2BBJA 4P0AA 4O4JE 3FBLA 4YY3T 4AKGA 5GONE 3PJAJ 2Q9QB 4WYVA 1MIYA 5ABHA 2AXDS 2WWUA 5HCMA 4IIJE 3FXEB 2YDRA 3B5MA 1HNZT 3KINB 4HFBA 4ISTA 2Y48B 5LJMA 4LFBT 2UU9T 1XNRT 4U74A 3K8PC 3LG7A 2V7KA 3AEFA 4M1PA 1ZV4X 4GIWA 2I59A 3ZYLA 3LJCA 1G73A 5JDMA 4H63H 1UUSA 3K1SA 3ZMSB 3EABA 5DQWA 2XAJB 3NRXA 5AQHB 2RPAA 3BQKA 3QB5A 2J47A 1FIOA 3BQLA 1ZHCA 2BDEA 3ZMUB 4PW8A 2K24A 2V7LA 1D1BA 3LFMA 4GOUA 5KXJA 3AE5A 2W62A 3P4RA 4X5TA 4H9QC 5C8YE 4QH1A 2ODVA 1CUNA 5HYAA 1OEDC 4DUZT 5FP3A 5FNVE 1UX5A 1KNZA 2VB6A 2CXDA 4TN7B 2EHOA 2LHNA 4IDZA 4AQYT 2BG9C 1DU2A 3AXJA 1N33T 2E5VA 3QUJA 1U4QA 3AE3A 3RGLA 2D2SA 4YTPA 1FJGT 3RQWA 4TZ4C 4HN9A 5LYJE 5ABFA 1VCTA 3ZKRA 3AE7A 4ADZA 5LBQB 3OTOT 1OXZA 5LG4A 2ZM8A 2X0YA 1VOMA 2W4XA 2W2UA 2UXNB 3EAMA 2XY8B 3CPZA 3VKHA 2HHHT 3RLFF 1WLXA 1KEYA 5FXZA 3KV9A 3KVBA 2KMFA 2DHRA 2XQ9A 4KP3C 5LHHB 4AQFA 5L3EB 1KNPA 3A5XA 4JV5T 3O1JA 2C5JA 2XHEB 3N9NA 3GWHA 1OEDB 1R8IA 5LGTB 4JI5T 3ANWA 3ETUA 4IL4A 1HNWT 3LK2B 4A56A 3U3IA 5FKYA 5HEJA 3VHLA 4HGAA 2E9XC 3ABVA 3HL6A 4KX6A 2QYWA 2QRXA 4QKNA 5CA1E 3IEEA 2WMNA 3Q5XA 4QWNB 3UFGA 3EUHA 5AQRB 3ZLIA 4XBFB 2VASA 2CEAA 2V8SV 3ONXA 4BA9A 4HWDA 3V5UA 3CX7B 4WNKA 3KV6A 4LMKA 4IDQA 5J0ZA 1D0ZA 2WB5A 4PFPA 5ABEA 4H63V 4GKJT 3EI0A 5L2LA 1YKHB 3L8RA 2V7JA 4G63A 5LOVE 2OLTA 2A9UA 4X1KE 3RKOA 5LJNA 1XZYA 3PTRB 3NRYA 1HG5A 4E7SA 4NIQA 3J7Yq 2DLRA 1HCIA 1ZEEA 3ETVA 2LKGA 3HR0A 2A72A 2X9YA 2QVAA 3MXZA 4P0BA 2XUEA 5AQIB 2X67A 2X9XA 1E7PA 3JC6D 1YQ4A 3UFEA 4PFOA 3WI3A 4ILCA 2BVMA 5L4HA 4TV9E 4AQGA 3ZT6A 3CK6A 2WDVA 5FMNA 3W15B 3NKZA 4IDNA 5JDQA 2XPKA 3GA8A 2K5BB 4UELA 5AQVB 4NXMT 4WBOA 4QH4A 5JR9A 3MKDA 2W0GA 2FJDA 5DABA 5JRCA 4QX8B 4BJMA 2M6IA 1JNZA 2PG8A 2VKHA 3RYHE 5A1LA 3C98B 1UGOA 4OK0A 3N9LA 5KDMC 4L5GA 3JAEA 3QK6A 3L09A 4AKRB 4O4LE 3UU8A 3Q2MA 2IDOB 1E2AA 2CBIA 3P4SA 3N2GE 4CN6A 1CHUA 4CXWA 1HG2A 4Z90A 1LVFA 2BKOA 5DJQC 4NUVA 1XDOA 3UUXB 3P50A 2LRKA 3RIAA 5AQUB 3AAAB
chains in the Genus database with same CATH topology
4U3CA 2V6YA 1YXRA 2MPKA 2K3WA 2WY2A 4ZEYA 4NIQA 1WCRA 4U2YA 2DL1A 3K1SA 5CGMA 2JQHA 3ZT5A 4U2ZA 4CN6A 2CPTA 5FVKA 2JQ9A 3EABA 3ZSTA 4U7IA 4P1NA 2W2UA 4CN4A 4A5XA 5LB7B 2XZEA 4U33A 3ZT6A 3ZT7A 4U7YA 4WZXA 4IT4A 2WWVA 2LRLA 2A9UA 2RPAA 2JQKA 2V6XA 2LRKA 5FVLA 2CRBA 5CJ5A 3ZSSA 2V6YB 4U31A 1WR0A 1WFDA 4CN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3C A;  2V6Y A;  1YXR A;  2MPK A;  2K3W A;  2WY2 A;  4ZEY A;  4NIQ A;  1WCR A;  4U2Y A;  2DL1 A;  3K1S A;  5CGM A;  2JQH A;  3ZT5 A;  4U2Z A;  4CN6 A;  2CPT A;  5FVK A;  2JQ9 A;  3EAB A;  3ZST A;  4U7I A;  4P1N A;  2W2U A;  4CN4 A;  4A5X A;  5LB7 B;  2XZE A;  4U33 A;  3ZT6 A;  3ZT7 A;  4U7Y A;  4WZX A;  4IT4 A;  2WWV A;  2LRL A;  2A9U A;  2RPA A;  2JQK A;  2V6X A;  2LRK A;  5FVL A;  2CRB A;  5CJ5 A;  3ZSS A;  2V6Y B;  4U31 A;  1WR0 A;  1WFD A;  4CN1 A; 
#chains in the Genus database with same CATH topology
 5HXC A;  1H7C A;  4DID B;  1T72 A;  1US7 B;  4UF0 B;  5EK3 A;  1W0B A;  3SS1 A;  1SA0 E;  3I1A A;  3AE2 A;  4A5X A;  4L9I A;  3AAI A;  1G8X A;  1YD8 G;  2XM1 A;  1U5P A;  5LG3 A;  2YDS A;  5FVL A;  2V26 A;  4I43 B;  1ZP0 A;  4ZI2 C;  2LSY A;  2KT9 A;  2D0T A;  4YTM A;  4ZHQ E;  1LVK A;  3JAF A;  1IJ6 A;  5J2T E;  2XAS B;  2N9D A;  2FUP A;  5AQO B;  3UT5 E;  1YKE B;  5HWY A;  2YIN A;  2ZLY A;  3UU6 A;  3ZJ2 A;  4EIW A;  2GK9 A;  4KMC A;  4C91 A;  2JMK A;  2LEH A;  2JMH A;  3RQU A;  2VL0 A;  4PJL A;  3V5S A;  3HKB E;  4CZZ B;  2QA7 A;  2BG9 E;  3Q5E A;  5CJ5 A;  2KND A;  3UQ4 A;  4O4I E;  4FJO A;  1D0X A;  3GMI A;  1Y01 A;  4ZI3 C;  4IHJ E;  1FMW A;  4Z91 A;  1SE7 A;  1MIV A;  2UXD T;  1WR6 A;  3AA7 B;  3SWH A;  4U72 A;  1W09 A;  4AKL A;  4ZOL E;  4EYU A;  2XTL A;  5L3B B;  3VRA A;  2UUC T;  2KZ7 B;  4UV8 B;  2HN2 A;  3JAD A;  3MA9 A;  3VR9 A;  1HF8 A;  5LB7 B;  1W9R A;  3A7M A;  5KX5 E;  4YXD A;  5FY0 A;  4ANJ A;  4X65 T;  4GK5 E;  5M4Y A;  3KV5 A;  4LFC T;  4HWF A;  4MLK A;  4V1A v;  4TNV A;  4F6R C;  2CBJ A;  3SFE A;  2WP9 A;  2Y6X A;  4JI1 T;  3N9P A;  3ZMZ B;  4EYY R;  3LBX A;  2LT3 A;  2RA1 A;  4UVB B;  2V6Y B;  4PK4 A;  5HEU A;  5L3G B;  2VUR A;  1IZN B;  4B3T T;  4X66 T;  2WY2 A;  4PK6 A;  2UUA T;  3TLT A;  4X62 T;  3FZL B;  2JRK A;  3ZT5 A;  4DND A;  4O4H E;  4ILA A;  3HKC E;  5LHG B;  1S94 A;  4IE7 A;  1ZKE A;  4YHJ A;  4LF5 T;  2JPF A;  3H3A A;  2XSA A;  2NOX A;  4WW0 A;  3T8O A;  4PNI A;  4DUY T;  3N2K E;  2A2F X;  3S4U A;  4JBW F;  4C90 A;  3AVR A;  4WBN E;  1NEK A;  5HWX A;  5LMU T;  4UIG A;  3MJX A;  3AE9 A;  4YJ3 E;  5AQK B;  4EV6 A;  3JCF A;  4N78 D;  1I94 T;  4JI8 T;  2EHO C;  4HFV A;  2F4V T;  2W00 A;  4AIS A;  2XJ7 A;  5JQG E;  4HWH A;  2KWH A;  3M3Z B;  3EVY A;  4U33 A;  2CE7 A;  4UR9 A;  3PUY F;  2A3D A;  4YSY A;  4ZS2 A;  4DV2 T;  4PJN A;  2LKH A;  1JNR A;  2I0M A;  4DBR A;  3KBU A;  1XMO T;  3AEA A;  4PK5 A;  4A98 A;  4COF A;  3H37 A;  4G2A A;  5FY7 A;  2CA5 A;  3N9Q A;  2IHR 1;  2W66 A;  3X1D A;  3ZSS A;  2N2N A;  3BQI A;  5AQL B;  2XQ4 A;  2HPL A;  4JI6 T;  2BVL A;  1Z8U A;  1J1J A;  3K3N A;  2CM0 A;  2WQY A;  2D9D A;  2BS2 A;  4JI2 T;  4DV6 T;  4LF4 T;  3E0Z A;  2EHO B;  4ZEY A;  1UX4 A;  1J5W A;  5FVK A;  2LSI A;  4NUU A;  4MAL A;  3NZQ A;  4DR6 T;  2VQF T;  2WDQ A;  3Q5W A;  4HFH A;  3L3P A;  4DV0 T;  4AXP A;  1HR0 T;  2XQY A;  4KI0 F;  3T1Y T;  3BK9 A;  4HE8 A;  5LP6 E;  3PDY A;  2LSG A;  4DBQ A;  4ZXL A;  3RC3 A;  3PUV F;  4DV1 T;  4FI5 A;  1OED A;  2H7V C;  2JQQ A;  3PUW F;  3PUX F;  3EDV A;  2BG9 B;  2NW8 A;  3PE0 A;  1MIW A;  2WCA A;  4YFS A;  3G06 A;  4QXB B;  4LF7 T;  2CLY C;  4HTE A;  5FL1 A;  3RYC E;  2NP9 A;  2H89 A;  5IYZ E;  2NW7 A;  3LSV A;  4DMW A;  3RF1 A;  4YSX A;  2XSB A;  4HFE A;  2IC9 A;  3P8C D;  3UUL A;  4BAY B;  3RRC A;  4EEB A;  3CQX C;  3ZST A;  4OX9 T;  2WZH A;  3HI2 A;  2CXL A;  3N9M A;  4MFR A;  3QOF A;  4CN1 A;  3RHW A;  3I9Y A;  3RIF A;  2PFV A;  1XDP A;  3SOL A;  3TLS A;  2BZB A;  4O2A E;  2CLY B;  4ILU A;  2E9X B;  4OHF A;  2CRB A;  4ZI2 D;  1UCU A;  1Z0P A;  3ZYM A;  4DR2 T;  2M6B A;  3AA1 B;  3ZMT B;  2B1E A;  3CQG B;  2CWY A;  4KHZ F;  4DR1 T;  3C51 A;  1L0V A;  5HCJ A;  3AA6 B;  1XWM A;  5JDG A;  4HFC A;  3VRB A;  4DVD A;  3FZK B;  2H3R A;  2DWG A;  3RIU C;  4AKI A;  5AFU L;  3RC8 A;  3GN5 B;  3MK7 C;  2MBG A;  4H9N C;  1FEW A;  2VL8 A;  3C4X A;  3AE8 A;  3VKG A;  4X64 T;  3D0T A;  4PAG A;  5IHY A;  1HS7 A;  4GYS A;  2NR4 A;  3DTO A;  2K48 A;  2LOP A;  4DMV A;  3HKE E;  2Y8D A;  5FY1 A;  2VQE T;  2E5L T;  2E8I A;  3QB5 K;  2CCQ A;  5JRC B;  3N5L A;  4HKA A;  1QSD A;  2Q9Q D;  4HWC A;  2LM9 A;  4AKH A;  1QLB A;  2YK0 A;  1X9B A;  2MYS A;  3I0Q A;  5LGN B;  4ZZC A;  3ZCI A;  1LKX A;  2PJQ A;  1T98 A;  4TWH A;  3TKL B;  3ZC1 A;  3ZPO A;  2LLY A;  2IIU A;  4IE4 A;  4XAX B;  3WAJ A;  3UUM A;  3PU3 A;  4Q25 A;  3CX6 B;  3RRW A;  2WAU A;  3PUZ F;  2W63 A;  2AE9 A;  5CGM A;  1SHZ C;  4UF0 A;  5J2U E;  2XQ3 A;  5AQS B;  4GK0 E;  5EZY E;  3RKG A;  4JI0 T;  3CKD A;  1HTJ F;  2XQ7 A;  4HFD A;  2L9Q A;  2ACZ A;  4JYA T;  1T7S A;  3Q5D A;  5BR8 T;  3R6N A;  4X1Y E;  5HAX A;  4CI3 B;  3PUQ A;  2FJA A;  3OKQ A;  5LCY A;  5F8P A;  4AI6 A;  4LML A;  1AJ3 A;  3IF8 B;  4OYK A;  2J1D G;  4U31 A;  4QHO A;  3A8Y C;  2LSK A;  2JIW A;  3T1H T;  3UU5 A;  4JEU B;  3OJA A;  3FB2 A;  4GYR A;  4B3M T;  5ADX L;  2X51 A;  4DV5 T;  5LBM A;  3VR8 A;  2ZM0 A;  5CA0 E;  3UUB A;  1IJ5 A;  1WYC A;  2ZMA A;  4CXX A;  4JI4 T;  5FYM A;  2C5K T;  3F31 A;  3TLW A;  4P1N A;  1NAF A;  2KXP B;  3OBV E;  4YT0 A;  4UXN B;  1MMA A;  2YKS A;  3AE1 A;  3B13 A;  4LMJ A;  3RX6 A;  1WCR A;  3KFW X;  2MAW A;  2FJE A;  5AQQ B;  2UXB T;  5C3J A;  5HXS A;  1D1C A;  1W0A A;  3F2E A;  2XZE A;  5EK2 A;  2OV9 A;  2WWV A;  2VKO A;  3MZK B;  1B7T A;  4DR3 T;  3H3M A;  2ACX A;  2IC6 A;  3KBT A;  3EHZ A;  5LHI B;  2LJL A;  2BKP A;  3I0O A;  1KFY A;  3K3O A;  1WYB A;  4U7Y A;  4A97 A;  1BR2 A;  5HEH A;  5HEO A;  3SRZ A;  2V1D B;  2HN1 A;  2V6Y A;  2W67 A;  4DR7 T;  4I50 E;  4YHH T;  5AQT B;  3AE4 A;  2E2A A;  4CQI A;  5AQJ B;  4EXT A;  2Q9Q A;  5AQG B;  2XQA A;  3FHN A;  1N36 T;  2WMO A;  1YW0 A;  2LSJ A;  2D5U A;  3FZF B;  2R6G F;  2I6H A;  3DP7 A;  2V5D A;  3KDS E;  5FXX A;  2LHR A;  1O3X A;  4HWI B;  1VCS A;  5FXV A;  1M7K A;  1YQ3 A;  3OPC A;  2V7I A;  1IBM T;  4GKK T;  2BBH A;  2CHO A;  2PTF A;  3K3Q C;  4DV3 T;  5CFB A;  3P4Q A;  4UVC B;  2L3L A;  5LXT E;  5L3D B;  3UU4 A;  5JDL A;  2YN6 A;  4NXN T;  3O9X A;  5F5W A;  2FBW A;  5HXR A;  4I55 E;  3PV0 F;  3I9W A;  2PBI A;  4ZI7 E;  2E9X D;  2WZI A;  2V7M A;  2UUB T;  2C5I T;  3LK4 2;  3CQC B;  4IRE A;  3MAC A;  4H9S E;  4IDO A;  3CML A;  5FXW A;  4F8H A;  5HXH A;  2X0H A;  5AQP B;  4JLE A;  5IWA T;  3IA3 A;  2V6X A;  3QC9 A;  4DR5 T;  5AQM B;  3M65 A;  2YEV C;  4AQF C;  2IAK A;  3WAK A;  4IL9 A;  2H88 A;  2VVS A;  3C50 A;  2OA5 A;  5LGU B;  4BJN A;  5H6Q B;  4TWF A;  3QNU A;  1NEN A;  4O2B E;  3PJA A;  2BKN A;  3C4Z A;  5LNK A;  3AXJ B;  5JDN A;  5JVD E;  5TAO A;  1S35 A;  5EK4 A;  2B76 A;  3AEB A;  4Z8X A;  4QX7 B;  2X68 A;  5AQN B;  4DR4 T;  2CXF A;  2ZM6 T;  4KBM B;  5LMN T;  5ABF B;  3J9X 1;  3RYI E;  1SUM B;  2XAG B;  4EAH A;  4TNW A;  3UUN A;  4H9O C;  2IW5 B;  2WM9 A;  3C64 A;  3Q9D A;  1HX1 B;  1MNE A;  1WRD A;  4IT4 A;  4JEH B;  3ONJ A;  2ZM2 A;  2J4G A;  4MBQ A;  2NWB A;  3PUA A;  3U78 A;  4DV4 T;  4LF9 T;  2BG9 A;  4YJ2 E;  4LF8 T;  2MTQ A;  4WZX A;  3P4P A;  2X9H A;  4EGW A;  1XMQ T;  1M62 A;  3AEC A;  2BS4 A;  4CXY A;  3ANW B;  2K3W A;  2YOE A;  3E22 E;  1OWA A;  4U2Z A;  4ERR A;  5JDH A;  4K0U A;  1N32 T;  1N34 T;  2WBL A;  3KVA A;  3L39 A;  4CN4 A;  1HFA A;  5C2T A;  3ZN1 B;  3N9O A;  4JUY A;  4OFZ A;  2VK9 A;  1IAP A;  2VKD A;  3AED A;  3AA0 B;  1X79 A;  3N2O A;  4L0R A;  1BR1 A;  4U2Y A;  5HEG A;  1XNQ T;  1Y64 B;  5L4E A;  4CI1 B;  3UTK A;  5FL0 A;  3VU7 H;  5JH7 E;  2J62 A;  2FJB A;  3ZYK A;  1GQE A;  3PUS A;  2YDQ A;  3AEE A;  2JJ9 A;  4U3C A;  4TX5 A;  2UXX B;  4B3R T;  2X9W A;  4HEA A;  3KV4 A;  2CWO A;  4EZ4 A;  1KNR A;  3HKD E;  5JR9 C;  4UVA B;  4TV8 E;  4ILB A;  2KLQ A;  2X0L B;  1MMG A;  3UU3 A;  3O1I A;  3ZC0 A;  2E9X A;  3CVR A;  4IE5 A;  2MPK A;  5LA6 E;  1EZ3 A;  3AVS A;  3LDQ B;  4KHP T;  4XZC A;  2NTX A;  4U7I A;  2LOS A;  3IBP A;  1QUU A;  2H7O A;  2WS3 A;  2VWA A;  1D1A A;  2W61 A;  2P9B A;  3ESL A;  2CHN A;  3RH3 A;  3AEG A;  4EZH A;  4IDP A;  1BR4 A;  2BS3 A;  3R84 B;  4QXC B;  4OYJ A;  2DL1 A;  4DO0 A;  4JI7 T;  4B3S T;  2WU5 A;  3GN5 A;  4NPP A;  4JI3 T;  4EB6 E;  1T8B A;  2DNX A;  2SPC A;  3OYX A;  5J1G A;  4ZZB A;  4AIU A;  4ZI3 D;  5JR9 B;  4X20 E;  4KUM B;  2XAH B;  1ZOY A;  3O4X E;  2KIN B;  4H9P C;  2WDR A;  5AQF B;  1NWM X;  4K0K T;  4CI2 B;  2QGS A;  4ASK A;  1MMD A;  4YLH A;  3TLV A;  5ABG A;  3OYZ A;  4UV9 B;  3RPU A;  3LK3 B;  2CMR A;  3F57 A;  2MOZ A;  4E7Z A;  3PUR A;  4I0U A;  5E0O A;  5JTG A;  3RIU A;  2D0U A;  4IE0 A;  3ZJ1 A;  4J2C A;  3O1H A;  3E08 A;  3FZM B;  1UUR A;  3RYF E;  1KK7 A;  1UK5 A;  4QH5 A;  2LM2 A;  2M67 A;  4I4T E;  1MND A;  4X1I E;  4IE6 A;  1D0Y A;  3NVO A;  3ZMV B;  3UQ7 A;  3ONL C;  3HA4 A;  1LRZ A;  5ETW A;  5BMV E;  3C4W A;  1VRB A;  2JQ9 A;  2HPJ A;  4MHC A;  3CWZ B;  3DJB A;  2C0S A;  4ZS3 A;  2XQ5 A;  4P09 A;  3ZT7 A;  1IBL T;  5CB4 E;  1YXR A;  3FXD B;  3CX8 B;  2G0U A;  1FMV A;  3JC6 C;  4YTN A;  3PU8 A;  2VVN A;  2XQ8 A;  1J5E T;  2XM2 A;  3NZP A;  4TUY E;  3P7I A;  5JRE A;  3AE6 A;  1WR0 A;  2L8K A;  1E1H B;  2LE8 A;  2IUB A;  2EHO D;  2XQ6 A;  1V9D A;  2IML A;  3B57 A;  4LFA T;  4PJM A;  1HX8 A;  1OED E;  4YSZ A;  3ZCJ A;  2N1G A;  3AB3 B;  2LRL A;  3NBX X;  2VKJ A;  4TWD A;  4ISS A;  3P4W A;  4HFI A;  1KF6 A;  2ODU A;  4EOZ B;  2X66 A;  3ZEF B;  2V5C A;  4H9R C;  3CIR A;  1MMN A;  2DWK A;  2Q9Q C;  5L47 A;  2JQK A;  1IBK T;  4UEM A;  2XAQ B;  3FZH B;  5DQV A;  5L3F B;  2ES0 A;  2DCF A;  5F3J A;  2CPT A;  2WSS V;  2Z6E A;  3SFD A;  2KSR A;  4IGU A;  3PUG A;  2NW9 A;  5HXE A;  2UXC T;  2XAF B;  5KMG P;  3OVU A;  2JQH A;  4PJJ A;  3ZN0 B;  4DV7 T;  4O8S A;  2NTY A;  3TLU A;  4QXH B;  3AAE B;  5H6R B;  3FBZ A;  3LBX B;  4LF6 T;  2DI4 A;  2YU1 A;  4EED A;  2YU2 A;  3NWI A;  4B6X A;  5JDF A;  1HNX T;  1BR0 A;  5IUX A;  2KWI B;  2K9A A;  5L3C B;  2WU2 A;  3RI5 A;  3EDU A;  3IHR A;  1WFD A;  2RP4 A;  1I6Z A;  2HH7 A;  2BBJ A;  4P0A A;  4O4J E;  3FBL A;  4YY3 T;  4AKG A;  5GON E;  3PJA J;  2Q9Q B;  4WYV A;  1MIY A;  5ABH A;  2AXD S;  2WWU A;  5HCM A;  4IIJ E;  3FXE B;  2YDR A;  3B5M A;  1HNZ T;  3KIN B;  4HFB A;  4IST A;  2Y48 B;  5LJM A;  4LFB T;  2UU9 T;  1XNR T;  4U74 A;  3K8P C;  3LG7 A;  2V7K A;  3AEF A;  4M1P A;  1ZV4 X;  4GIW A;  2I59 A;  3ZYL A;  3LJC A;  1G73 A;  5JDM A;  4H63 H;  1UUS A;  3K1S A;  3ZMS B;  3EAB A;  5DQW A;  2XAJ B;  3NRX A;  5AQH B;  2RPA A;  3BQK A;  3QB5 A;  2J47 A;  1FIO A;  3BQL A;  1ZHC A;  2BDE A;  3ZMU B;  4PW8 A;  2K24 A;  2V7L A;  1D1B A;  3LFM A;  4GOU A;  5KXJ A;  3AE5 A;  2W62 A;  3P4R A;  4X5T A;  4H9Q C;  5C8Y E;  4QH1 A;  2ODV A;  1CUN A;  5HYA A;  1OED C;  4DUZ T;  5FP3 A;  5FNV E;  1UX5 A;  1KNZ A;  2VB6 A;  2CXD A;  4TN7 B;  2EHO A;  2LHN A;  4IDZ A;  4AQY T;  2BG9 C;  1DU2 A;  3AXJ A;  1N33 T;  2E5V A;  3QUJ A;  1U4Q A;  3AE3 A;  3RGL A;  2D2S A;  4YTP A;  1FJG T;  3RQW A;  4TZ4 C;  4HN9 A;  5LYJ E;  5ABF A;  1VCT A;  3ZKR A;  3AE7 A;  4ADZ A;  5LBQ B;  3OTO T;  1OXZ A;  5LG4 A;  2ZM8 A;  2X0Y A;  1VOM A;  2W4X A;  2W2U A;  2UXN B;  3EAM A;  2XY8 B;  3CPZ A;  3VKH A;  2HHH T;  3RLF F;  1WLX A;  1KEY A;  5FXZ A;  3KV9 A;  3KVB A;  2KMF A;  2DHR A;  2XQ9 A;  4KP3 C;  5LHH B;  4AQF A;  5L3E B;  1KNP A;  3A5X A;  4JV5 T;  3O1J A;  2C5J A;  2XHE B;  3N9N A;  3GWH A;  1OED B;  1R8I A;  5LGT B;  4JI5 T;  3ANW A;  3ETU A;  4IL4 A;  1HNW T;  3LK2 B;  4A56 A;  3U3I A;  5FKY A;  5HEJ A;  3VHL A;  4HGA A;  2E9X C;  3ABV A;  3HL6 A;  4KX6 A;  2QYW A;  2QRX A;  4QKN A;  5CA1 E;  3IEE A;  2WMN A;  3Q5X A;  4QWN B;  3UFG A;  3EUH A;  5AQR B;  3ZLI A;  4XBF B;  2VAS A;  2CEA A;  2V8S V;  3ONX A;  4BA9 A;  4HWD A;  3V5U A;  3CX7 B;  4WNK A;  3KV6 A;  4LMK A;  4IDQ A;  5J0Z A;  1D0Z A;  2WB5 A;  4PFP A;  5ABE A;  4H63 V;  4GKJ T;  3EI0 A;  5L2L A;  1YKH B;  3L8R A;  2V7J A;  4G63 A;  5LOV E;  2OLT A;  2A9U A;  4X1K E;  3RKO A;  5LJN A;  1XZY A;  3PTR B;  3NRY A;  1HG5 A;  4E7S A;  4NIQ A;  3J7Y q;  2DLR A;  1HCI A;  1ZEE A;  3ETV A;  2LKG A;  3HR0 A;  2A72 A;  2X9Y A;  2QVA A;  3MXZ A;  4P0B A;  2XUE A;  5AQI B;  2X67 A;  2X9X A;  1E7P A;  3JC6 D;  1YQ4 A;  3UFE A;  4PFO A;  3WI3 A;  4ILC A;  2BVM A;  5L4H A;  4TV9 E;  4AQG A;  3ZT6 A;  3CK6 A;  2WDV A;  5FMN A;  3W15 B;  3NKZ A;  4IDN A;  5JDQ A;  2XPK A;  3GA8 A;  2K5B B;  4UEL A;  5AQV B;  4NXM T;  4WBO A;  4QH4 A;  5JR9 A;  3MKD A;  2W0G A;  2FJD A;  5DAB A;  5JRC A;  4QX8 B;  4BJM A;  2M6I A;  1JNZ A;  2PG8 A;  2VKH A;  3RYH E;  5A1L A;  3C98 B;  1UGO A;  4OK0 A;  3N9L A;  5KDM C;  4L5G A;  3JAE A;  3QK6 A;  3L09 A;  4AKR B;  4O4L E;  3UU8 A;  3Q2M A;  2IDO B;  1E2A A;  2CBI A;  3P4S A;  3N2G E;  4CN6 A;  1CHU A;  4CXW A;  1HG2 A;  4Z90 A;  1LVF A;  2BKO A;  5DJQ C;  4NUV A;  1XDO A;  3UUX B;  3P50 A;  2LRK A;  3RIA A;  5AQU B;  3AAA B; 
#chains in the Genus database with same CATH homology
 4U3C A;  2V6Y A;  1YXR A;  2MPK A;  2K3W A;  2WY2 A;  4ZEY A;  4NIQ A;  1WCR A;  4U2Y A;  2DL1 A;  3K1S A;  5CGM A;  2JQH A;  3ZT5 A;  4U2Z A;  4CN6 A;  2CPT A;  5FVK A;  2JQ9 A;  3EAB A;  3ZST A;  4U7I A;  4P1N A;  2W2U A;  4CN4 A;  4A5X A;  5LB7 B;  2XZE A;  4U33 A;  3ZT6 A;  3ZT7 A;  4U7Y A;  4WZX A;  4IT4 A;  2WWV A;  2LRL A;  2A9U A;  2RPA A;  2JQK A;  2V6X A;  2LRK A;  5FVL A;  2CRB A;  5CJ5 A;  3ZSS A;  2V6Y B;  4U31 A;  1WR0 A;  1WFD A;  4CN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...