3V5SA

Structure of sodium/calcium exchanger from methanococcus jannaschii
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
Knots found
sequence length
301
structure length
289
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Sodium/Calcium Exchanger
publication title Structural insight into the ion-exchange mechanism of the sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 109
structure length 289
sequence length 301
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3v5sA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 3v5sA02
5JDHA 5JDMA 3V5SA 5JDFA 3V5UA 5HXHA 5HWXA 5HXEA 5JDGA 5JDLA 5JDNA 5HXRA 5HYAA 5JDQA 5HXSA 5HXCA 5HWYA
chains in the Genus database with same CATH superfamily
4ZZBA 4NUUA 1BR4A 1CHUA 2LEHA 4PW8A 5L3GB 3K1SA 5HCJA 5L3EB 4AQGA 5CJ5A 2OV9A 3AE3A 1MMGA 3IF8B 2XQ5A 3PUWF 1IJ5A 2LKGA 2CE7A 5HXSA 4UR9A 2ZLYA 2CEAA 4CN6A 4MBQA 2K5BB 3ZC0A 2W67A 3ZJ2A 2G0UA 5F3JA 4U3CA 3I9YA 2KWIB 1W9RA 3AE8A 2B76A 4F6RC 4IE0A 3PUZF 2ODUA 2LT3A 3AE2A 1HCIA 3SRZA 4G2AA 2QYWA 3OPCA 3PU3A 3P4SA 2LOSA 2D9DA 1W0AA 4IDPA 3RIAA 5IUXA 3ZT7A 1N34T 3K3QC 4XAXB 2K48A 4DV7T 3K3NA 4O4IE 1MNEA 4KI0F 1S94A 3N9OA 2JIWA 2R6GF 3O1IA 2VQFT 2VKDA 4GKJT 3J9X1 4HN9A 5HEJA 2CWYA 4KUMB 2XQ3A 2L3LA 4IL9A 2W62A 3OYZA 4DR1T 2XQ9A 3RIUC 2A3DA 2KZ7B 4YT0A 1SJ8A 2NR4A 2XJ7A 3FBZA 1NEKA 3PE0A 3K8PC 4HEAA 3RF1A 4O4LE 3JAEA 3JADA 2UXBT 2IIUA 4A98A 3QUJA 2XQYA 2XZEA 5FYMA 1UK5A 1HR0T 4YY3T 2A2FX 2WWVA 2DCFA 1LRZA 4DBRA 4QHOA 3AE9A 5AQOB 4EEBA 3N2KE 5JDGA 2YK0A 4HFVA 2WDVA 2C5IT 3MJXA 2AE9A 4EIWA 2K9AA 1WR0A 4LMKA 2K24A 1GQEA 2NTXA 4IREA 3AY5A 4QXCB 2PBIA 3KINB 3A8YC 5AQLB 3RX6A 2BVMA 1X9BA 5AFUL 4ADZA 1MNDA 2BS2A 4HFEA 3WAKA 2WSSV 1CUNA 3H3MA 4EOZB 4HFBA 3HL6A 3VKGA 4LF9T 4CN1A 2ODVA 3PV0F 3ONJA 3LJCA 4HWCA 4ZI2C 3U78A 2CBIA 2E9XA 3VR8A 3C4XA 3UFEA 1HNWT 2ZMAA 2CHNA 1T72A 2JQ9A 3D0TA 1MIYA 4ZS3A 1HX1B 3P8CD 5KX5E 3O1HA 4JEUB 2LOPA 5JQGE 3ZYLA 2UUCT 3WAJA 2IHR1 5LG3A 3HKCE 2H3RA 5DJQC 4HTEA 3ZSSA 4AI6A 3ZEFB 1IJ6A 3C98B 3NWIA 5EK2A 3VRBA 2X0CA 2WMOA 3RLFF 3KV9A 4OFZA 3AAAB 4XZCA 1XMOT 4ASKA 3ONXA 1WCRA 2KLQA 1E7PA 5JR9A 2WU5A 4H9NC 2KMFA 2VL0A 4CXWA 1FEWA 3IHRA 5FZTA 4LF5T 4DBQA 5AQTB 4YSXA 3AA1B 4QH1A 5L3DB 4WYVA 4KP3C 1OWAA 4ZS2A 4ZEYA 2XM2A 2WQYA 4X64T 4DVDA 4B6XA 3SFEA 4V1Av 1XNRT 4QX8B 2Q9QA 3Q5DA 1E2AA 4QXHB 2UUBT 2LSKA 4TZ4C 1EZ3A 4U2ZA 2XTLA 4EZHA 2DI4A 1L0VA 2FBWA 2W61A 4ZOLE 4ERRA 5DABA 2V6XA 2X9YA 2V7LA 1KFYA 4ZI2D 4QX7B 5J1GA 2VASA 3FYQA 4A97A 1HTJF 3ZYKA 2EHOA 1IBKT 1UX5A 4X66T 4A5XA 4UF0A 1WLXA 4IHJE 2XQ7A 2MBGA 3TLVA 3T8OA 1D0XA 1BR0A 2XHEB 3AEAA 3PUAA 3IEEA 4GOUA 3AEDA 3FB2A 5HYAA 3N9LA 1D0ZA 2L8KA 2QVAA 4U2YA 2YDRA 3ZT5A 2LHNA 2V1DB 4H9OC 4EZ4A 3ETUA 4WNKA 2IAKA 4TN7B 3PF0A 4PAGA 4LMLA 4OK0A 2IDOB 2VURA 4UF0B 3QB5K 5AQMB 3FBLA 4HWDA 3AAIA 3F31A 3UU5A 4LFCT 5CA1E 4WBNE 3WI3A 2OLTA 3P7IA 3MXZA 5LGUB 5JRCB 5JDFA 2DLRA 3EDVA 3RRCA 1HNXT 4ISSA 3FXEB 5LHGB 3R84B 3CPZA 3I9WA 2WCAA 2JPFA 2QRXA 3UU8A 4GK5E 4KHPT 1BR2A 4B3TT 3UUNA 5DQWA 2HH7A 3RI5A 1YXRA 5FMNA 2FJBA 4UEMA 2W4XA 4HFDA 1WRDA 2JMHA 1D1BA 2I6HA 3NZPA 3UT5E 3ZLIA 3O1JA 3QNUA 1G73A 1SUMB 1M62A 3LBXB 3MZKB 2D0TA 3ONLC 4JLEA 4P0AA 5KXJA 1D1CA 5L4HA 1FMWA 3M65A 4ZI7E 3S4UA 3N2GE 3JAFA 5GONE 4JI8T 3UUXB 4CXXA 2K3WA 2HHHT 3VHLA 2XY8B 3P50A 3AA7B 5AQIB 4AKHA 1D1AA 1J5WA 2M67A 4FI5A 4X5TA 4AQYT 4KHZF 3RC8A 5ABEA 2D5UA 1YW0A 4P0BA 3ZMVB 5TAOA 1MIVA 3EDUA 4H9QC 2W0GA 2C5KT 3RYIE 4IDOA 3AEEA 2X67A 2V5DA 4WZXA 3DTOA 4IDNA 3EVYA 4TV8E 3NRXA 5EK4A 3CK6A 3ZPOA 3X1DA 5CFBA 3RYFE 1AJ3A 3KVAA 3TLSA 4EXTA 1QUUA 3B57A 2WWUA 4W8PA 2JRKA 3KV5A 3UQ4A 4GK0E 1UX4A 2KWHA 4HFIA 1VCSA 5T1DA 3RGLA 4ZI3C 1NENA 4MHCA 4N78D 4TX5A 4TWDA 3P4PA 3HA4A 2XSBA 2LQUA 1SE7A 5LCYA 4BA9A 2E5VA 2BBHA 5KDMC 4DR7T 3BK9A 2ZM0A 5AQVB 2VKHA 5IWAT 2KBBA 3FZLB 4EAHA 2JJ9A 2DNXA 4EYYR 4H63H 4LF7T 3ZCIA 3HR0A 3C64A 4EEDA 4G63A 4DV3T 5LGNB 3C51A 3SWHA 3SFDA 3RHWA 3ZJ1A 2IC6A 3N5LA 4DO0A 3R6NA 5HWYA 2H89A 1SA0E 4IE6A 4PJNA 3L3PA 2ES0A 3C4WA 4CI3B 1W09A 1WYBA 5HXRA 4EYUA 1YD8G 2NW7A 4U7YA 2X0HA 5FL0A 3ZCJA 2BS4A 3UQ7A 1YKEB 3UUBA 2UXXB 3GMIA 4TNVA 4JI0T 1T8BA 4HE8A 3M1CA 3CWZB 4UIGA 5L2LA 4YTPA 4DV2T 2DL1A 4LF6T 3FZKB 4ZXLA 4H63V 5JDHA 3LG7A 4DR2T 4YFSA 3KV4A 3P4RA 1HF8A 4PJMA 3ANWA 3I1AA 4IE7A 4JI4T 2LSGA 4U33A 5LP6E 1HFAA 4UV9B 2MTCA 2V7MA 1XMQT 3RRWA 2LJLA 2XQ6A 4YTNA 4QH5A 4C90A 2J62A 4X65T 3AXJA 4HWIB 2MPKA 4QXBB 5EK3A 4DV6T 3HI2A 5ADXL 4YJ3E 4QH4A 5H6RB 2E9XC 3K3OA 3VJZA 3AT7A 4EGWA 2D0UA 2YN6A 2A9UA 3PU8A 2IUBA 3PHF1 2UXNB 4H9RC 2IC9A 2KINB 4KX6A 2J1DG 2LLYA 4DV0T 2H88A 1KK7A 2C0SA 1KF6A 3ZSTA 1N36T 3AECA 5AQRB 3AEGA 1MMAA 1SJ7A 5FXXA 2BBJA 2CBJA 4JI2T 4WW0A 2NW8A 2ZM2A 5JR9C 2E9XB 4KMCA 3L09A 2LHRA 4IE5A 2Y48B 2KXPB 4CI1B 1QSDA 5HXCA 3U3IA 3M3ZB 2CXFA 5EZYE 4JBWF 5FY1A 3LK42 3AA0B 5AQSB 4ZHQE 1VOMA 4UV8B 1KEYA 4X62T 1KNPA 5LHHB 1N33T 3N9PA 4Z8XA 2HN1A 2UXCT 3OVUA 1D0YA 3W15B 3ZT6A 3WURA 4I50E 2Q9QC 4C91A 3EAMA 2V6YA 2WDQA 3O9XA 1WYCA 4U72A 1IBMT 1LVFA 2WP9A 3KBUA 3LK2B 4NXMT 2Y8DA 5JR9B 2GK9A 3MACA 3ZMUB 5LMUT 5DQVA 4DR4T 2VVSA 2LSIA 4O4HE 5HEHA 5FVLA 2BKPA 4O2AE 1M7KA 2CLYC 2E9XD 4CZZB 2XASB 3LDQB 4O8SA 5JREA 1UGOA 4B3MT 1OEDA 5JDMA 3IBPA 2EHOC 4ILCA 3J7Yq 3KDSE 2YINA 2V6YB 1FIOA 3LK3B 2PTFA 4F8HA 2J4GA 5ABFA 2Q9QB 5AQGB 3ZYMA 2H7OA 1E1HB 4YXDA 3PUVF 4TUYE 5L3CB 4B3ST 5BMVE 5FVKA 2WMNA 2M6BA 1XWMA 4B3RT 3V5UA 4PJJA 2XSAA 5LNKA 1J5ET 3N9MA 3C50A 4COFA 3JC6C 5AQFB 5LJNA 4UVAB 5AQJB 5HAXA 4DR5T 2CMRA 2CLYB 2YKSA 5FXWA 1XZYA 3AAEB 3A5XA 2EHOB 5HXEA 3EUHA 4L5GA 5HEGA 1UUSA 5E0OA 2VWAA 2VKOA 1UURA 4DV1T 5JTGA 2LRKA 3PURA 4PFOA 4ISTA 4A56A 2N1GA 4DUZT 2MOZA 3EI0A 5C8YE 4JUYA 2KSRA 4MLKA 3N2OA 3AE6A 3PUSA 5HWXA 2Q9QD 3KFWX 5JDNA 3BQLA 4K0UA 2WZIA 4LMJA 2YEVC 1WFDA 5FY0A 2V7KA 3TKLB 4NXNT 3P4WA 4TWHA 4AQFA 2HPLA 3OYXA 2UXDT 3AE7A 2V26A 1US7B 3DYJA 2E2AA 3ZKRA 4MFRA 1R8IA 2NTYA 2RP4A 3ETVA 2QA7A 4TV9E 5AQPB 3H37A 2V7IA 1Z0PA 4IT4A 4U74A 1UCUA 2LSYA 2EHOD 4NPPA 3UU6A 4O2BE 4HGAA 2RA1A 5J0ZA 3CX7B 5FP3A 4PJLA 1HX8A 5LXTE 5AQUB 2X9HA 2BG9A 3Q9DA 5ABHA 2LE8A 4GYRA 2X0LB 2OA5A 3NRYA 3L39A 3Q5XA 5IHYA 2NP9A 1ZV4X 2IW5B 2JQHA 3ZMTB 3A7MA 4I43B 3GN5A 3RC3A 3ESLA 1OXZA 3VKHA 2F4VT 2ZM6T 5LJMA 3IA3A 3E08A 2KT9A 2CRBA 5FXVA 5HEOA 3CIRA 3FZMB 4NUVA 2FUPA 4PFPA 4L9IA 4J2CA 4ECGA 4NIQA 4AKGA 1XDPA 3F2EA 5A1LA 3NBXX 4YLHA 3GN5B 5H6QB 3SOLA 3BQIA 1MMNA 3AA6B 4E7SA 1ZP0A 5BR8T 5LHIB 2WBLA 3CKDA 3UUMA 2VVNA 4CXYA 3UTKA 3N9QA 1WR6A 4YHHT 4BAYB 2BDEA 4JYAT 3Q5EA 1ZEEA 3P4QA 1LVKA 3TLTA 2PFVA 3RKGA 2UUAT 4F7GB 3Q2MA 3MA9A 4ILBA 4X1YE 1W0BA 1VCTA 4MALA 4DV5T 4UVBB 2JQKA 2B1EA 1SHZC 5CA0E 2NW9A 4Q25A 3PUXF 2XQAA 5M4YA 4I0UA 2ACXA 1Y64B 1KNZA 3ZN1B 4UVCB 4DUYT 5L3FB 2CXDA 4IGUA 2W66A 4XBFB 3ABVA 2L7NA 3PTRB 4HFCA 2QGSA 3N9NA 3O4XE 3KVBA 4U31A 1BR1A 1QLBA 1MMDA 3QC9A 4EB6E 2YDSA 4HKAA 4ONRA 4PK5A 2WDRA 2ZM8A 4TNWA 1NWMX 2C5JA 2L9QA 3FXDB 5AQKB 5HCMA 3ZMZB 3AEBA 4AKIA 5AQQB 4YJ2E 3CQXC 3UULA 3AE4A 2XAFB 3ZMSB 2ACZA 2WM9A 1ZKEA 2X9XA 4DNDA 4BJNA 4TWFA 3RPUA 4ZZCA 3PUQA 4UELA 5F8PA 2AXDS 2XAQB 3E0ZA 1JNZA 2VL8A 2LKHA 2LM9A 2W2UA 4ZI3D 3GWHA 3RIUA 4P1NA 3HKEE 3PDYA 2XUEA 2LRLA 4CI2B 3CMLA 2H7VC 4GYSA 4PK6A 3LFMA 3HKDE 3Q5WA 4LFBT 4JV5T 4UXNB 2CM0A 3LSVA 5JH7E 4OHFA 2DWKA 4Z91A 2E5LT 4DV4T 5LA6E 2NOXA 5L3BB 5C2TA 1LKXA 3OTOT 3UU3A 2XQ8A 1IZNB 2KNDA 1FJGT 2A72A 3MKDA 3ANWB 2HPJA 2Z6EA 3CX8B 1HS7A 3G06A 3PJAJ 4H9SE 3RYHE 3EABA 5ABGA 3L8RA 3UU4A 2XAGB 3OBVE 2Y6XA 2WS3A 3RH3A 4H9PC 2BKOA 1X79A 5IYZE 4WBOA 3VU7H 3WSCA 2VB6A 3H3AA 2IMLA 3C4ZA 3NVOA 2FJDA 3AXJB 1I94T 2JQQA 4IIJE 3NKZA 2MAWA 1T7SA 2VKJA 4YSZA 5LB7B 2LSJA 1XNQT 3BQKA 4O4JE 5JDLA 2X51A 5FKYA 4JI7T 4HFHA 1XDOA 2PJQA 2P9BA 4ANJA 3SS1A 1HG5A 2YU1A 3RYCE 5J2UE 2X68A 4HWFA 4JI1T 2MYSA 2KGXA 1YQ4A 3VR9A 2M6IA 1FMVA 1G8XA 4JI3T 2LM2A 2BVLA 3NZQA 2XAJB 4IDZA 2V7JA 4X1IE 3AB3B 1IAPA 2V8SV 2XQ4A 2FJAA 2X0YA 4BJMA 5FY7A 3TLWA 2WZHA 4PK4A 5HEUA 4IL4A 4YSYA 2V5CA 2I0MA 2BS3A 2HN2A 4AXPA 5J2TE 2YDQA 4YTMA 1OEDC 3PUYF 1OEDE 3T1YT 5FL1A 1O3XA 4JEHB 2YOEA 4LFAT 3CX6B 4QKNA 4DMVA 3QOFA 1V9DA 5L47A 3AVRA 3EHZA 3HKBE 3PUGA 2WAUA 4OX9T 4ILUA 3RIFA 5F5WA 4YHJA 3MK7C 3KBTA 2BKNA 1HNZT 3ZN0B 1J1JA 2RPAA 4Z90A 3V5SA 1YKHB 5C3JA 2X66A 3AEFA 4EV6A 1MIWA 3I0OA 3OKQA 1IBLT 5LG4A 1OEDB 2MTQA 4DIDB 2N9DA 4AIUA 4M1PA 1Z8UA 4KBMB 4IE4A 3RQUA 3TLUA 4GKKT 1I6ZA 3I0QA 4GIWA 2XM1A 1ZOYA 2PG8A 5ABFB 4X20E 2L10A 3E22E 4HWHA 3DP7A 4IDQA 5HXHA 4L0RA 5JRCA 3GA8A 3QK6A 2DHRA 4OYKA 5LBQB 1DU2A 2CCQA 3OJAA 4JI6T 3RQWA 3KV6A 5AQHB 4U7IA 1H7CA 4AQFC 3B5MA 1Y01A 2VK9A 2CPTA 1S35A 2WB5A 3FHNA 2NWBA 5LGTB 4QWNB 3ZC1A 5JVDE 5LYJE 4OYJA 2CWOA 4FJOA 1ZHCA 3LBXA 2DWGA 3AE1A 3B13A 4AKLA 5JDQA 5FXZA 3RKOA 2CXLA 3QB5A 3VRAA 3UFGA 3DJBA 2BG9C 4DR3T 2VQET 4X1KE 2BG9E 2CA5A 4I55E 1YQ3A 5LBMA 3JCFA 5ETWA 2N2NA 2XPKA 3AE5A 3PJAA 4JI5T 2J47A 4CQIA 5KMGP 2FJEA 3JC6D 1NAFA 4LF8T 2BZBA 2WU2A 3CQCB 2KVPA 4DMWA 1VRBA 3FZHB 2UU9T 4I4TE 2W63A 4AISA 3AVSA 1JNRA 1U5PA 3CVRA 2SPCA 4BGOA 2E8IA 2BG9B 2CHOA 2WY2A 5FNVE 2YU2A 5L4EA 5AQNB 3FZFB 2X9WA 5CGMA 1T98A 2XAHB 1N32T 4E7ZA 4PNIA 4ILAA 4DR6T 4LF4T 2D2SA 2JMKA 1HG2A 4K0KT 3CQGB 5LMNT 1U4QA 4CN4A 2W00A 4P09A 1B7TA 3T1HT 5CB4E 5LOVE 2I59A 3F57A 4AKRB 1KNRA
chains in the Genus database with same CATH topology
4Z8XA 5LGUB 5JRCB 5JDFA 2DLRA 4NUUA 3EDVA 3RRCA 1D0YA 1BR4A 2LEHA 3PDYA 3W15B 2XUEA 3WURA 4ISSA 4PW8A 4I50E 5L3GB 4CI2B 2Q9QC 3FXEB 3CMLA 2H7VC 4C91A 5LHGB 4GYSA 4PK6A 5L3EB 3R84B 3LFMA 3O9XA 3HKDE 3CPZA 3Q5WA 1WYCA 4U72A 4AQGA 3I9WA 4UXNB 2CM0A 2JPFA 1LVFA 4GK5E 4OHFA 5JH7E 2DWKA 3KBUA 3LK2B 1BR2A 2Y8DA 3UUNA 5JR9B 2GK9A 5DQWA 5LA6E 2NOXA 3MACA 3ZMUB 5L3BB 1MMGA 3IF8B 2HH7A 1LKXA 5DQVA 5FMNA 2LSIA 4O4HE 4UEMA 1IJ5A 4O2AE 2CE7A 2CLYC 5HXSA 2E9XD 4CZZB 2ZLYA 1IZNB 1WRDA 2KNDA 2CEAA 2JMHA 2XASB 4MBQA 1D1BA 2A72A 2K5BB 3NZPA 4O8SA 3UT5E 3ZLIA 3MKDA 5JREA 3ZC0A 3ANWB 2HPJA 2Z6EA 3CX8B 3ZJ2A 2G0UA 5JDMA 1HS7A 3IBPA 3O1JA 4H9SE 3RYHE 5F3JA 2EHOC 3I9YA 2KWIB 1G73A 3J7Yq 3KDSE 2YINA 2XAGB 3LBXB 3MZKB 1FIOA 2D0TA 3LK3B 4JLEA 3OBVE 2Y6XA 4F6RC 3RH3A 4P0AA 4IE0A 4H9PC 1D1CA 2ODUA 2LT3A 2Q9QB 3ZYMA 1FMWA 1E1HB 1X79A 2H7OA 1HCIA 3M65A 5IYZE 3SRZA 4G2AA 4ZI7E 3S4UA 4WBOA 4TUYE 3VU7H 5L3CB 2VB6A 3WSCA 3N2GE 5BMVE 3H3AA 3PU3A 3C4ZA 5GONE 2WMNA 3UUXB 2LOSA 4CXXA 3V5UA 2JQQA 4PJJA 3VHLA 4IIJE 5LNKA 3N9MA 3C50A 2VKJA 3JC6C 5LJNA 4UVAB 3K3QC 5HAXA 3AA7B 4XAXB 4AKHA 2LSJA 2K48A 2CMRA 1D1AA 2M67A 3K3NA 2CLYB 4O4IE 3BQKA 4FI5A 4O4JE 5JDLA 2X51A 3RC8A 1MNEA 1S94A 2D5UA 3N9OA 5FXWA 1YW0A 4P0BA 3O1IA 3ZMVB 2VKDA 3AAEB 3A5XA 2PJQA 5TAOA 1MIVA 2P9BA 3EDUA 4ANJA 4H9QC 2W0GA 4HN9A 3J9X1 2EHOB 2CWYA 2C5KT 4KUMB 5HXEA 3EUHA 4L5GA 3SS1A 3RYIE 2L3LA 5E0OA 2VWAA 2W62A 3OYZA 2VKOA 1HG5A 2YU1A 2X67A 3RYCE 5J2UE 2A3DA 2X68A 3DTOA 3PURA 3EVYA 2KZ7B 4TV8E 2MYSA 4PFOA 4ISTA 4A56A 3NRXA 5EK4A 2N1GA 3ZPOA 2MOZA 3FBZA 5C8YE 1FMVA 4JUYA 1G8XA 4MLKA 3RYFE 3PE0A 3N2OA 1AJ3A 3KVAA 3PUSA 2BVLA 3K8PC 5HWXA 2Q9QD 4HEAA 3KFWX 3NZQA 4EXTA 5JDNA 4O4LE 3BQLA 1QUUA 2XAJB 2WWUA 3B57A 4K0UA 2JRKA 4IDZA 2V7JA 2YEVC 4X1IE 3AB3B 3KV5A 3QUJA 5FY0A 2V7KA 1IAPA 3TKLB 2XQYA 5FYMA 4GK0E 4AQFA 1UX4A 2KWHA 4BJMA 2A2FX 5FY7A 5T1DA 2DCFA 1LRZA 2HPLA 3OYXA 4QHOA 4DBRA 4PK4A 2V26A 4ZI3C 1US7B 4MHCA 4N78D 4MFRA 2NTYA 2RP4A 3N2KE 3ETVA 4TX5A 5JDGA 2QA7A 2YK0A 4HFVA 4AXPA 2C5IT 3MJXA 5J2TE 4TV9E 4EIWA 2K9AA 3HA4A 3H37A 2LQUA 2K24A 2V7IA 5LCYA 1Z0PA 4U74A 2NTXA 4BA9A 5KDMC 1UCUA 2LSYA 3BK9A 2EHOD 2ZM0A 1O3XA 4JEHB 4QXCB 3CX6B 4QKNA 2PBIA 4O2BE 3KINB 4DMVA 4HGAA 3RX6A 2RA1A 1V9DA 2VKHA 3AVRA 2BVMA 3HKBE 3PUGA 2WAUA 3CX7B 5FP3A 4PJLA 1HX8A 5LXTE 5AFUL 4ADZA 1MNDA 4ILUA 2X9HA 4EAHA 2JJ9A 3WAKA 2WSSV 1CUNA 2DNXA 4YHJA 4EOZB 3Q9DA 4EYYR 3HL6A 2LE8A 4H63H 3MK7C 4GYRA 3VKGA 2X0LB 2OA5A 2ODVA 3NRYA 3Q5XA 3ZCIA 3HR0A 3C64A 2NP9A 5IHYA 1ZV4X 2IW5B 3KBTA 3ZMTB 3LJCA 4G63A 3ZN0B 4ZI2C 4I43B 5LGNB 3GN5A 3C51A 3U78A 3V5SA 3RC3A 3SWHA 1YKHB 2E9XA 3C4XA 3UFEA 2X66A 3ZJ1A 3ESLA 2IC6A 2ZMAA 1MIWA 1OXZA 3I0OA 3N5LA 3OKQA 3VKHA 4DO0A 5LG4A 3R6NA 2MTQA 5LJMA 3D0TA 5HWYA 1MIYA 4ZS3A 2N9DA 3P8CD 4PJNA 1SA0E 4IE6A 3L3PA 4M1PA 3E08A 4KBMB 2ES0A 2KT9A 5KX5E 4IE4A 5FXVA 3O1HA 3C4WA 3I0QA 4JEUB 4CI3B 1WYBA 4GIWA 4NUVA 2LOPA 5JQGE 4PFPA 4L9IA 4J2CA 4ECGA 2PG8A 3ZYLA 4AKGA 4X20E 5HXRA 4EYUA 3WAJA 1YD8G 3E22E 3DP7A 3HKCE 2H3RA 5DJQC 4HTEA 3F2EA 4L0RA 5HXHA 3ZEFB 5JRCA 4AI6A 3GA8A 3C98B 1IJ6A 2NW7A 3QK6A 5EK2A 2DHRA 5A1LA 4OYKA 3NBXX 5LBQB 3ZCJA 2WMOA 2CCQA 3KV9A 4YLHA 3OJAA 3GN5B 4OFZA 1YKEB 5H6QB 3SOLA 3KV6A 3BQIA 3AAAB 4XZCA 2UXXB 1MMNA 3AA6B 4E7SA 4ASKA 3GMIA 3ONXA 2KLQA 5LHIB 2WBLA 3CKDA 4HE8A 3M1CA 3CWZB 3UUMA 4UIGA 5JR9A 5L2LA 4H9NC 1H7CA 4CXYA 2KMFA 4CXWA 4AQFC 3UTKA 1FEWA 3IHRA 4DBQA 2VK9A 3N9QA 4H63V 1WR6A 1S35A 4BAYB 2BDEA 3FHNA 5JDHA 3LG7A 2NWBA 4YFSA 3AA1B 3KV4A 5LGTB 1ZEEA 1HF8A 4QWNB 3ZC1A 4PJMA 5JVDE 5L3DB 3ANWA 3I1AA 5LYJE 4KP3C 4OYJA 4IE7A 1LVKA 1OWAA 4ZS2A 2PFVA 2LSGA 5LP6E 1HFAA 2CWOA 4FJOA 4UV9B 2MTCA 1ZHCA 3Q2MA 3LBXA 2DWGA 3MA9A 3B13A 4AKLA 4X1YE 4DVDA 4B6XA 4MALA 4V1Av 5JDQA 2V7MA 4QX8B 5FXZA 3RKOA 2CXLA 2Q9QA 3RRWA 2LJLA 4QXHB 4UVBB 2LSKA 3DJBA 4TZ4C 1EZ3A 2B1EA 2XTLA 4C90A 1SHZC 4X1KE 4EZHA 2CA5A 2DI4A 2W61A 5CA0E 2NW9A 4ZOLE 4I55E 4QXBB 5EK3A 5LBMA 3HI2A 5ETWA 4ERRA 5ADXL 5M4YA 2N2NA 2ACXA 5DABA 1Y64B 4YJ3E 1KNZA 3ZN1B 5H6RB 4UVCB 2E9XC 2V7LA 2X9YA 3K3OA 4ZI2D 4QX7B 5L3FB 4CQIA 5KMGP 2CXDA 5J1GA 2VASA 3VJZA 4IGUA 4XBFB 3JC6D 3AT7A 3PTRB 1NAFA 2D0UA 2QGSA 3N9NA 3O4XE 1HTJF 3KVBA 3ZYKA 2BZBA 3CQCB 3PU8A 1BR1A 3PHF1 2UXNB 4H9RC 2IC9A 2EHOA 1MMDA 2KINB 4DMWA 1VRBA 3QC9A 4I4TE 4EB6E 2J1DG 1UX5A 2W63A 4HKAA 4ONRA 3AVSA 1KK7A 1U5PA 3CVRA 4PK5A 4UF0A 2C0SA 1WLXA 2ZM8A 4IHJE 1NWMX 2C5JA 2SPCA 2L9QA 3FXDB 2MBGA 3T8OA 1D0XA 1BR0A 4BGOA 3ZMZB 2E8IA 1MMAA 2XHEB 4AKIA 3PUAA 4YJ2E 3IEEA 3CQXC 5FXXA 4GOUA 5FNVE 3FB2A 2YU2A 3UULA 5HYAA 3N9LA 1D0ZA 2L8KA 2X9WA 2XAFB 3ZMSB 2LHNA 4WW0A 2NW8A 2WM9A 2ZM2A 1ZKEA 5JR9C 1T98A 2X9XA 2V1DB 2XAHB 2E9XB 4H9OC 4DNDA 4EZ4A 4BJNA 4E7ZA 3ETUA 4KMCA 4PNIA 3L09A 4WNKA 2LHRA 4IE5A 3RPUA 2Y48B 2IAKA 4TN7B 3PF0A 2KXPB 4PAGA 4CI1B 1QSDA 2D2SA 2JMKA 5HXCA 3U3IA 2CXFA 3PUQA 4UELA 1HG2A 4OK0A 5EZYE 5F8PA 2XAQB 3E0ZA 3CQGB 1U4QA 3LK42 2VL8A 4UF0B 3AA0B 5FY1A 2LM9A 2W00A 3FBLA 4ZHQE 1VOMA 1B7TA 3AAIA 4P09A 3F31A 4UV8B 5CB4E 5LOVE 4WBNE 5CA1E 2I59A 3WI3A 4ZI3D 3F57A 3GWHA 4AKRB 5LHHB 3HKEE 3P7IA 3MXZA 3N9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JDH A;  5JDM A;  3V5S A;  5JDF A;  3V5U A;  5HXH A;  5HWX A;  5HXE A;  5JDG A;  5JDL A;  5JDN A;  5HXR A;  5HYA A;  5JDQ A;  5HXS A;  5HXC A;  5HWY A; 
#chains in the Genus database with same CATH topology
 4ZZB A;  4NUU A;  1BR4 A;  1CHU A;  2LEH A;  4PW8 A;  5L3G B;  3K1S A;  5HCJ A;  5L3E B;  4AQG A;  5CJ5 A;  2OV9 A;  3AE3 A;  1MMG A;  3IF8 B;  2XQ5 A;  3PUW F;  1IJ5 A;  2LKG A;  2CE7 A;  5HXS A;  4UR9 A;  2ZLY A;  2CEA A;  4CN6 A;  4MBQ A;  2K5B B;  3ZC0 A;  2W67 A;  3ZJ2 A;  2G0U A;  5F3J A;  4U3C A;  3I9Y A;  2KWI B;  1W9R A;  3AE8 A;  2B76 A;  4F6R C;  4IE0 A;  3PUZ F;  2ODU A;  2LT3 A;  3AE2 A;  1HCI A;  3SRZ A;  4G2A A;  2QYW A;  3OPC A;  3PU3 A;  3P4S A;  2LOS A;  2D9D A;  1W0A A;  4IDP A;  3RIA A;  5IUX A;  3ZT7 A;  1N34 T;  3K3Q C;  4XAX B;  2K48 A;  4DV7 T;  3K3N A;  4O4I E;  1MNE A;  4KI0 F;  1S94 A;  3N9O A;  2JIW A;  2R6G F;  3O1I A;  2VQF T;  2VKD A;  4GKJ T;  3J9X 1;  4HN9 A;  5HEJ A;  2CWY A;  4KUM B;  2XQ3 A;  2L3L A;  4IL9 A;  2W62 A;  3OYZ A;  4DR1 T;  2XQ9 A;  3RIU C;  2A3D A;  2KZ7 B;  4YT0 A;  1SJ8 A;  2NR4 A;  2XJ7 A;  3FBZ A;  1NEK A;  3PE0 A;  3K8P C;  4HEA A;  3RF1 A;  4O4L E;  3JAE A;  3JAD A;  2UXB T;  2IIU A;  4A98 A;  3QUJ A;  2XQY A;  2XZE A;  5FYM A;  1UK5 A;  1HR0 T;  4YY3 T;  2A2F X;  2WWV A;  2DCF A;  1LRZ A;  4DBR A;  4QHO A;  3AE9 A;  5AQO B;  4EEB A;  3N2K E;  5JDG A;  2YK0 A;  4HFV A;  2WDV A;  2C5I T;  3MJX A;  2AE9 A;  4EIW A;  2K9A A;  1WR0 A;  4LMK A;  2K24 A;  1GQE A;  2NTX A;  4IRE A;  3AY5 A;  4QXC B;  2PBI A;  3KIN B;  3A8Y C;  5AQL B;  3RX6 A;  2BVM A;  1X9B A;  5AFU L;  4ADZ A;  1MND A;  2BS2 A;  4HFE A;  3WAK A;  2WSS V;  1CUN A;  3H3M A;  4EOZ B;  4HFB A;  3HL6 A;  3VKG A;  4LF9 T;  4CN1 A;  2ODV A;  3PV0 F;  3ONJ A;  3LJC A;  4HWC A;  4ZI2 C;  3U78 A;  2CBI A;  2E9X A;  3VR8 A;  3C4X A;  3UFE A;  1HNW T;  2ZMA A;  2CHN A;  1T72 A;  2JQ9 A;  3D0T A;  1MIY A;  4ZS3 A;  1HX1 B;  3P8C D;  5KX5 E;  3O1H A;  4JEU B;  2LOP A;  5JQG E;  3ZYL A;  2UUC T;  3WAJ A;  2IHR 1;  5LG3 A;  3HKC E;  2H3R A;  5DJQ C;  4HTE A;  3ZSS A;  4AI6 A;  3ZEF B;  1IJ6 A;  3C98 B;  3NWI A;  5EK2 A;  3VRB A;  2X0C A;  2WMO A;  3RLF F;  3KV9 A;  4OFZ A;  3AAA B;  4XZC A;  1XMO T;  4ASK A;  3ONX A;  1WCR A;  2KLQ A;  1E7P A;  5JR9 A;  2WU5 A;  4H9N C;  2KMF A;  2VL0 A;  4CXW A;  1FEW A;  3IHR A;  5FZT A;  4LF5 T;  4DBQ A;  5AQT B;  4YSX A;  3AA1 B;  4QH1 A;  5L3D B;  4WYV A;  4KP3 C;  1OWA A;  4ZS2 A;  4ZEY A;  2XM2 A;  2WQY A;  4X64 T;  4DVD A;  4B6X A;  3SFE A;  4V1A v;  1XNR T;  4QX8 B;  2Q9Q A;  3Q5D A;  1E2A A;  4QXH B;  2UUB T;  2LSK A;  4TZ4 C;  1EZ3 A;  4U2Z A;  2XTL A;  4EZH A;  2DI4 A;  1L0V A;  2FBW A;  2W61 A;  4ZOL E;  4ERR A;  5DAB A;  2V6X A;  2X9Y A;  2V7L A;  1KFY A;  4ZI2 D;  4QX7 B;  5J1G A;  2VAS A;  3FYQ A;  4A97 A;  1HTJ F;  3ZYK A;  2EHO A;  1IBK T;  1UX5 A;  4X66 T;  4A5X A;  4UF0 A;  1WLX A;  4IHJ E;  2XQ7 A;  2MBG A;  3TLV A;  3T8O A;  1D0X A;  1BR0 A;  2XHE B;  3AEA A;  3PUA A;  3IEE A;  4GOU A;  3AED A;  3FB2 A;  5HYA A;  3N9L A;  1D0Z A;  2L8K A;  2QVA A;  4U2Y A;  2YDR A;  3ZT5 A;  2LHN A;  2V1D B;  4H9O C;  4EZ4 A;  3ETU A;  4WNK A;  2IAK A;  4TN7 B;  3PF0 A;  4PAG A;  4LML A;  4OK0 A;  2IDO B;  2VUR A;  4UF0 B;  3QB5 K;  5AQM B;  3FBL A;  4HWD A;  3AAI A;  3F31 A;  3UU5 A;  4LFC T;  5CA1 E;  4WBN E;  3WI3 A;  2OLT A;  3P7I A;  3MXZ A;  5LGU B;  5JRC B;  5JDF A;  2DLR A;  3EDV A;  3RRC A;  1HNX T;  4ISS A;  3FXE B;  5LHG B;  3R84 B;  3CPZ A;  3I9W A;  2WCA A;  2JPF A;  2QRX A;  3UU8 A;  4GK5 E;  4KHP T;  1BR2 A;  4B3T T;  3UUN A;  5DQW A;  2HH7 A;  3RI5 A;  1YXR A;  5FMN A;  2FJB A;  4UEM A;  2W4X A;  4HFD A;  1WRD A;  2JMH A;  1D1B A;  2I6H A;  3NZP A;  3UT5 E;  3ZLI A;  3O1J A;  3QNU A;  1G73 A;  1SUM B;  1M62 A;  3LBX B;  3MZK B;  2D0T A;  3ONL C;  4JLE A;  4P0A A;  5KXJ A;  1D1C A;  5L4H A;  1FMW A;  3M65 A;  4ZI7 E;  3S4U A;  3N2G E;  3JAF A;  5GON E;  4JI8 T;  3UUX B;  4CXX A;  2K3W A;  2HHH T;  3VHL A;  2XY8 B;  3P50 A;  3AA7 B;  5AQI B;  4AKH A;  1D1A A;  1J5W A;  2M67 A;  4FI5 A;  4X5T A;  4AQY T;  4KHZ F;  3RC8 A;  5ABE A;  2D5U A;  1YW0 A;  4P0B A;  3ZMV B;  5TAO A;  1MIV A;  3EDU A;  4H9Q C;  2W0G A;  2C5K T;  3RYI E;  4IDO A;  3AEE A;  2X67 A;  2V5D A;  4WZX A;  3DTO A;  4IDN A;  3EVY A;  4TV8 E;  3NRX A;  5EK4 A;  3CK6 A;  3ZPO A;  3X1D A;  5CFB A;  3RYF E;  1AJ3 A;  3KVA A;  3TLS A;  4EXT A;  1QUU A;  3B57 A;  2WWU A;  4W8P A;  2JRK A;  3KV5 A;  3UQ4 A;  4GK0 E;  1UX4 A;  2KWH A;  4HFI A;  1VCS A;  5T1D A;  3RGL A;  4ZI3 C;  1NEN A;  4MHC A;  4N78 D;  4TX5 A;  4TWD A;  3P4P A;  3HA4 A;  2XSB A;  2LQU A;  1SE7 A;  5LCY A;  4BA9 A;  2E5V A;  2BBH A;  5KDM C;  4DR7 T;  3BK9 A;  2ZM0 A;  5AQV B;  2VKH A;  5IWA T;  2KBB A;  3FZL B;  4EAH A;  2JJ9 A;  2DNX A;  4EYY R;  4H63 H;  4LF7 T;  3ZCI A;  3HR0 A;  3C64 A;  4EED A;  4G63 A;  4DV3 T;  5LGN B;  3C51 A;  3SWH A;  3SFD A;  3RHW A;  3ZJ1 A;  2IC6 A;  3N5L A;  4DO0 A;  3R6N A;  5HWY A;  2H89 A;  1SA0 E;  4IE6 A;  4PJN A;  3L3P A;  2ES0 A;  3C4W A;  4CI3 B;  1W09 A;  1WYB A;  5HXR A;  4EYU A;  1YD8 G;  2NW7 A;  4U7Y A;  2X0H A;  5FL0 A;  3ZCJ A;  2BS4 A;  3UQ7 A;  1YKE B;  3UUB A;  2UXX B;  3GMI A;  4TNV A;  4JI0 T;  1T8B A;  4HE8 A;  3M1C A;  3CWZ B;  4UIG A;  5L2L A;  4YTP A;  4DV2 T;  2DL1 A;  4LF6 T;  3FZK B;  4ZXL A;  4H63 V;  5JDH A;  3LG7 A;  4DR2 T;  4YFS A;  3KV4 A;  3P4R A;  1HF8 A;  4PJM A;  3ANW A;  3I1A A;  4IE7 A;  4JI4 T;  2LSG A;  4U33 A;  5LP6 E;  1HFA A;  4UV9 B;  2MTC A;  2V7M A;  1XMQ T;  3RRW A;  2LJL A;  2XQ6 A;  4YTN A;  4QH5 A;  4C90 A;  2J62 A;  4X65 T;  3AXJ A;  4HWI B;  2MPK A;  4QXB B;  5EK3 A;  4DV6 T;  3HI2 A;  5ADX L;  4YJ3 E;  4QH4 A;  5H6R B;  2E9X C;  3K3O A;  3VJZ A;  3AT7 A;  4EGW A;  2D0U A;  2YN6 A;  2A9U A;  3PU8 A;  2IUB A;  3PHF 1;  2UXN B;  4H9R C;  2IC9 A;  2KIN B;  4KX6 A;  2J1D G;  2LLY A;  4DV0 T;  2H88 A;  1KK7 A;  2C0S A;  1KF6 A;  3ZST A;  1N36 T;  3AEC A;  5AQR B;  3AEG A;  1MMA A;  1SJ7 A;  5FXX A;  2BBJ A;  2CBJ A;  4JI2 T;  4WW0 A;  2NW8 A;  2ZM2 A;  5JR9 C;  2E9X B;  4KMC A;  3L09 A;  2LHR A;  4IE5 A;  2Y48 B;  2KXP B;  4CI1 B;  1QSD A;  5HXC A;  3U3I A;  3M3Z B;  2CXF A;  5EZY E;  4JBW F;  5FY1 A;  3LK4 2;  3AA0 B;  5AQS B;  4ZHQ E;  1VOM A;  4UV8 B;  1KEY A;  4X62 T;  1KNP A;  5LHH B;  1N33 T;  3N9P A;  4Z8X A;  2HN1 A;  2UXC T;  3OVU A;  1D0Y A;  3W15 B;  3ZT6 A;  3WUR A;  4I50 E;  2Q9Q C;  4C91 A;  3EAM A;  2V6Y A;  2WDQ A;  3O9X A;  1WYC A;  4U72 A;  1IBM T;  1LVF A;  2WP9 A;  3KBU A;  3LK2 B;  4NXM T;  2Y8D A;  5JR9 B;  2GK9 A;  3MAC A;  3ZMU B;  5LMU T;  5DQV A;  4DR4 T;  2VVS A;  2LSI A;  4O4H E;  5HEH A;  5FVL A;  2BKP A;  4O2A E;  1M7K A;  2CLY C;  2E9X D;  4CZZ B;  2XAS B;  3LDQ B;  4O8S A;  5JRE A;  1UGO A;  4B3M T;  1OED A;  5JDM A;  3IBP A;  2EHO C;  4ILC A;  3J7Y q;  3KDS E;  2YIN A;  2V6Y B;  1FIO A;  3LK3 B;  2PTF A;  4F8H A;  2J4G A;  5ABF A;  2Q9Q B;  5AQG B;  3ZYM A;  2H7O A;  1E1H B;  4YXD A;  3PUV F;  4TUY E;  5L3C B;  4B3S T;  5BMV E;  5FVK A;  2WMN A;  2M6B A;  1XWM A;  4B3R T;  3V5U A;  4PJJ A;  2XSA A;  5LNK A;  1J5E T;  3N9M A;  3C50 A;  4COF A;  3JC6 C;  5AQF B;  5LJN A;  4UVA B;  5AQJ B;  5HAX A;  4DR5 T;  2CMR A;  2CLY B;  2YKS A;  5FXW A;  1XZY A;  3AAE B;  3A5X A;  2EHO B;  5HXE A;  3EUH A;  4L5G A;  5HEG A;  1UUS A;  5E0O A;  2VWA A;  2VKO A;  1UUR A;  4DV1 T;  5JTG A;  2LRK A;  3PUR A;  4PFO A;  4IST A;  4A56 A;  2N1G A;  4DUZ T;  2MOZ A;  3EI0 A;  5C8Y E;  4JUY A;  2KSR A;  4MLK A;  3N2O A;  3AE6 A;  3PUS A;  5HWX A;  2Q9Q D;  3KFW X;  5JDN A;  3BQL A;  4K0U A;  2WZI A;  4LMJ A;  2YEV C;  1WFD A;  5FY0 A;  2V7K A;  3TKL B;  4NXN T;  3P4W A;  4TWH A;  4AQF A;  2HPL A;  3OYX A;  2UXD T;  3AE7 A;  2V26 A;  1US7 B;  3DYJ A;  2E2A A;  3ZKR A;  4MFR A;  1R8I A;  2NTY A;  2RP4 A;  3ETV A;  2QA7 A;  4TV9 E;  5AQP B;  3H37 A;  2V7I A;  1Z0P A;  4IT4 A;  4U74 A;  1UCU A;  2LSY A;  2EHO D;  4NPP A;  3UU6 A;  4O2B E;  4HGA A;  2RA1 A;  5J0Z A;  3CX7 B;  5FP3 A;  4PJL A;  1HX8 A;  5LXT E;  5AQU B;  2X9H A;  2BG9 A;  3Q9D A;  5ABH A;  2LE8 A;  4GYR A;  2X0L B;  2OA5 A;  3NRY A;  3L39 A;  3Q5X A;  5IHY A;  2NP9 A;  1ZV4 X;  2IW5 B;  2JQH A;  3ZMT B;  3A7M A;  4I43 B;  3GN5 A;  3RC3 A;  3ESL A;  1OXZ A;  3VKH A;  2F4V T;  2ZM6 T;  5LJM A;  3IA3 A;  3E08 A;  2KT9 A;  2CRB A;  5FXV A;  5HEO A;  3CIR A;  3FZM B;  4NUV A;  2FUP A;  4PFP A;  4L9I A;  4J2C A;  4ECG A;  4NIQ A;  4AKG A;  1XDP A;  3F2E A;  5A1L A;  3NBX X;  4YLH A;  3GN5 B;  5H6Q B;  3SOL A;  3BQI A;  1MMN A;  3AA6 B;  4E7S A;  1ZP0 A;  5BR8 T;  5LHI B;  2WBL A;  3CKD A;  3UUM A;  2VVN A;  4CXY A;  3UTK A;  3N9Q A;  1WR6 A;  4YHH T;  4BAY B;  2BDE A;  4JYA T;  3Q5E A;  1ZEE A;  3P4Q A;  1LVK A;  3TLT A;  2PFV A;  3RKG A;  2UUA T;  4F7G B;  3Q2M A;  3MA9 A;  4ILB A;  4X1Y E;  1W0B A;  1VCT A;  4MAL A;  4DV5 T;  4UVB B;  2JQK A;  2B1E A;  1SHZ C;  5CA0 E;  2NW9 A;  4Q25 A;  3PUX F;  2XQA A;  5M4Y A;  4I0U A;  2ACX A;  1Y64 B;  1KNZ A;  3ZN1 B;  4UVC B;  4DUY T;  5L3F B;  2CXD A;  4IGU A;  2W66 A;  4XBF B;  3ABV A;  2L7N A;  3PTR B;  4HFC A;  2QGS A;  3N9N A;  3O4X E;  3KVB A;  4U31 A;  1BR1 A;  1QLB A;  1MMD A;  3QC9 A;  4EB6 E;  2YDS A;  4HKA A;  4ONR A;  4PK5 A;  2WDR A;  2ZM8 A;  4TNW A;  1NWM X;  2C5J A;  2L9Q A;  3FXD B;  5AQK B;  5HCM A;  3ZMZ B;  3AEB A;  4AKI A;  5AQQ B;  4YJ2 E;  3CQX C;  3UUL A;  3AE4 A;  2XAF B;  3ZMS B;  2ACZ A;  2WM9 A;  1ZKE A;  2X9X A;  4DND A;  4BJN A;  4TWF A;  3RPU A;  4ZZC A;  3PUQ A;  4UEL A;  5F8P A;  2AXD S;  2XAQ B;  3E0Z A;  1JNZ A;  2VL8 A;  2LKH A;  2LM9 A;  2W2U A;  4ZI3 D;  3GWH A;  3RIU A;  4P1N A;  3HKE E;  3PDY A;  2XUE A;  2LRL A;  4CI2 B;  3CML A;  2H7V C;  4GYS A;  4PK6 A;  3LFM A;  3HKD E;  3Q5W A;  4LFB T;  4JV5 T;  4UXN B;  2CM0 A;  3LSV A;  5JH7 E;  4OHF A;  2DWK A;  4Z91 A;  2E5L T;  4DV4 T;  5LA6 E;  2NOX A;  5L3B B;  5C2T A;  1LKX A;  3OTO T;  3UU3 A;  2XQ8 A;  1IZN B;  2KND A;  1FJG T;  2A72 A;  3MKD A;  3ANW B;  2HPJ A;  2Z6E A;  3CX8 B;  1HS7 A;  3G06 A;  3PJA J;  4H9S E;  3RYH E;  3EAB A;  5ABG A;  3L8R A;  3UU4 A;  2XAG B;  3OBV E;  2Y6X A;  2WS3 A;  3RH3 A;  4H9P C;  2BKO A;  1X79 A;  5IYZ E;  4WBO A;  3VU7 H;  3WSC A;  2VB6 A;  3H3A A;  2IML A;  3C4Z A;  3NVO A;  2FJD A;  3AXJ B;  1I94 T;  2JQQ A;  4IIJ E;  3NKZ A;  2MAW A;  1T7S A;  2VKJ A;  4YSZ A;  5LB7 B;  2LSJ A;  1XNQ T;  3BQK A;  4O4J E;  5JDL A;  2X51 A;  5FKY A;  4JI7 T;  4HFH A;  1XDO A;  2PJQ A;  2P9B A;  4ANJ A;  3SS1 A;  1HG5 A;  2YU1 A;  3RYC E;  5J2U E;  2X68 A;  4HWF A;  4JI1 T;  2MYS A;  2KGX A;  1YQ4 A;  3VR9 A;  2M6I A;  1FMV A;  1G8X A;  4JI3 T;  2LM2 A;  2BVL A;  3NZQ A;  2XAJ B;  4IDZ A;  2V7J A;  4X1I E;  3AB3 B;  1IAP A;  2V8S V;  2XQ4 A;  2FJA A;  2X0Y A;  4BJM A;  5FY7 A;  3TLW A;  2WZH A;  4PK4 A;  5HEU A;  4IL4 A;  4YSY A;  2V5C A;  2I0M A;  2BS3 A;  2HN2 A;  4AXP A;  5J2T E;  2YDQ A;  4YTM A;  1OED C;  3PUY F;  1OED E;  3T1Y T;  5FL1 A;  1O3X A;  4JEH B;  2YOE A;  4LFA T;  3CX6 B;  4QKN A;  4DMV A;  3QOF A;  1V9D A;  5L47 A;  3AVR A;  3EHZ A;  3HKB E;  3PUG A;  2WAU A;  4OX9 T;  4ILU A;  3RIF A;  5F5W A;  4YHJ A;  3MK7 C;  3KBT A;  2BKN A;  1HNZ T;  3ZN0 B;  1J1J A;  2RPA A;  4Z90 A;  3V5S A;  1YKH B;  5C3J A;  2X66 A;  3AEF A;  4EV6 A;  1MIW A;  3I0O A;  3OKQ A;  1IBL T;  5LG4 A;  1OED B;  2MTQ A;  4DID B;  2N9D A;  4AIU A;  4M1P A;  1Z8U A;  4KBM B;  4IE4 A;  3RQU A;  3TLU A;  4GKK T;  1I6Z A;  3I0Q A;  4GIW A;  2XM1 A;  1ZOY A;  2PG8 A;  5ABF B;  4X20 E;  2L10 A;  3E22 E;  4HWH A;  3DP7 A;  4IDQ A;  5HXH A;  4L0R A;  5JRC A;  3GA8 A;  3QK6 A;  2DHR A;  4OYK A;  5LBQ B;  1DU2 A;  2CCQ A;  3OJA A;  4JI6 T;  3RQW A;  3KV6 A;  5AQH B;  4U7I A;  1H7C A;  4AQF C;  3B5M A;  1Y01 A;  2VK9 A;  2CPT A;  1S35 A;  2WB5 A;  3FHN A;  2NWB A;  5LGT B;  4QWN B;  3ZC1 A;  5JVD E;  5LYJ E;  4OYJ A;  2CWO A;  4FJO A;  1ZHC A;  3LBX A;  2DWG A;  3AE1 A;  3B13 A;  4AKL A;  5JDQ A;  5FXZ A;  3RKO A;  2CXL A;  3QB5 A;  3VRA A;  3UFG A;  3DJB A;  2BG9 C;  4DR3 T;  2VQE T;  4X1K E;  2BG9 E;  2CA5 A;  4I55 E;  1YQ3 A;  5LBM A;  3JCF A;  5ETW A;  2N2N A;  2XPK A;  3AE5 A;  3PJA A;  4JI5 T;  2J47 A;  4CQI A;  5KMG P;  2FJE A;  3JC6 D;  1NAF A;  4LF8 T;  2BZB A;  2WU2 A;  3CQC B;  2KVP A;  4DMW A;  1VRB A;  3FZH B;  2UU9 T;  4I4T E;  2W63 A;  4AIS A;  3AVS A;  1JNR A;  1U5P A;  3CVR A;  2SPC A;  4BGO A;  2E8I A;  2BG9 B;  2CHO A;  2WY2 A;  5FNV E;  2YU2 A;  5L4E A;  5AQN B;  3FZF B;  2X9W A;  5CGM A;  1T98 A;  2XAH B;  1N32 T;  4E7Z A;  4PNI A;  4ILA A;  4DR6 T;  4LF4 T;  2D2S A;  2JMK A;  1HG2 A;  4K0K T;  3CQG B;  5LMN T;  1U4Q A;  4CN4 A;  2W00 A;  4P09 A;  1B7T A;  3T1H T;  5CB4 E;  5LOV E;  2I59 A;  3F57 A;  4AKR B;  1KNR A; 
#chains in the Genus database with same CATH homology
 4Z8X A;  5LGU B;  5JRC B;  5JDF A;  2DLR A;  4NUU A;  3EDV A;  3RRC A;  1D0Y A;  1BR4 A;  2LEH A;  3PDY A;  3W15 B;  2XUE A;  3WUR A;  4ISS A;  4PW8 A;  4I50 E;  5L3G B;  4CI2 B;  2Q9Q C;  3FXE B;  3CML A;  2H7V C;  4C91 A;  5LHG B;  4GYS A;  4PK6 A;  5L3E B;  3R84 B;  3LFM A;  3O9X A;  3HKD E;  3CPZ A;  3Q5W A;  1WYC A;  4U72 A;  4AQG A;  3I9W A;  4UXN B;  2CM0 A;  2JPF A;  1LVF A;  4GK5 E;  4OHF A;  5JH7 E;  2DWK A;  3KBU A;  3LK2 B;  1BR2 A;  2Y8D A;  3UUN A;  5JR9 B;  2GK9 A;  5DQW A;  5LA6 E;  2NOX A;  3MAC A;  3ZMU B;  5L3B B;  1MMG A;  3IF8 B;  2HH7 A;  1LKX A;  5DQV A;  5FMN A;  2LSI A;  4O4H E;  4UEM A;  1IJ5 A;  4O2A E;  2CE7 A;  2CLY C;  5HXS A;  2E9X D;  4CZZ B;  2ZLY A;  1IZN B;  1WRD A;  2KND A;  2CEA A;  2JMH A;  2XAS B;  4MBQ A;  1D1B A;  2A72 A;  2K5B B;  3NZP A;  4O8S A;  3UT5 E;  3ZLI A;  3MKD A;  5JRE A;  3ZC0 A;  3ANW B;  2HPJ A;  2Z6E A;  3CX8 B;  3ZJ2 A;  2G0U A;  5JDM A;  1HS7 A;  3IBP A;  3O1J A;  4H9S E;  3RYH E;  5F3J A;  2EHO C;  3I9Y A;  2KWI B;  1G73 A;  3J7Y q;  3KDS E;  2YIN A;  2XAG B;  3LBX B;  3MZK B;  1FIO A;  2D0T A;  3LK3 B;  4JLE A;  3OBV E;  2Y6X A;  4F6R C;  3RH3 A;  4P0A A;  4IE0 A;  4H9P C;  1D1C A;  2ODU A;  2LT3 A;  2Q9Q B;  3ZYM A;  1FMW A;  1E1H B;  1X79 A;  2H7O A;  1HCI A;  3M65 A;  5IYZ E;  3SRZ A;  4G2A A;  4ZI7 E;  3S4U A;  4WBO A;  4TUY E;  3VU7 H;  5L3C B;  2VB6 A;  3WSC A;  3N2G E;  5BMV E;  3H3A A;  3PU3 A;  3C4Z A;  5GON E;  2WMN A;  3UUX B;  2LOS A;  4CXX A;  3V5U A;  2JQQ A;  4PJJ A;  3VHL A;  4IIJ E;  5LNK A;  3N9M A;  3C50 A;  2VKJ A;  3JC6 C;  5LJN A;  4UVA B;  3K3Q C;  5HAX A;  3AA7 B;  4XAX B;  4AKH A;  2LSJ A;  2K48 A;  2CMR A;  1D1A A;  2M67 A;  3K3N A;  2CLY B;  4O4I E;  3BQK A;  4FI5 A;  4O4J E;  5JDL A;  2X51 A;  3RC8 A;  1MNE A;  1S94 A;  2D5U A;  3N9O A;  5FXW A;  1YW0 A;  4P0B A;  3O1I A;  3ZMV B;  2VKD A;  3AAE B;  3A5X A;  2PJQ A;  5TAO A;  1MIV A;  2P9B A;  3EDU A;  4ANJ A;  4H9Q C;  2W0G A;  4HN9 A;  3J9X 1;  2EHO B;  2CWY A;  2C5K T;  4KUM B;  5HXE A;  3EUH A;  4L5G A;  3SS1 A;  3RYI E;  2L3L A;  5E0O A;  2VWA A;  2W62 A;  3OYZ A;  2VKO A;  1HG5 A;  2YU1 A;  2X67 A;  3RYC E;  5J2U E;  2A3D A;  2X68 A;  3DTO A;  3PUR A;  3EVY A;  2KZ7 B;  4TV8 E;  2MYS A;  4PFO A;  4IST A;  4A56 A;  3NRX A;  5EK4 A;  2N1G A;  3ZPO A;  2MOZ A;  3FBZ A;  5C8Y E;  1FMV A;  4JUY A;  1G8X A;  4MLK A;  3RYF E;  3PE0 A;  3N2O A;  1AJ3 A;  3KVA A;  3PUS A;  2BVL A;  3K8P C;  5HWX A;  2Q9Q D;  4HEA A;  3KFW X;  3NZQ A;  4EXT A;  5JDN A;  4O4L E;  3BQL A;  1QUU A;  2XAJ B;  2WWU A;  3B57 A;  4K0U A;  2JRK A;  4IDZ A;  2V7J A;  2YEV C;  4X1I E;  3AB3 B;  3KV5 A;  3QUJ A;  5FY0 A;  2V7K A;  1IAP A;  3TKL B;  2XQY A;  5FYM A;  4GK0 E;  4AQF A;  1UX4 A;  2KWH A;  4BJM A;  2A2F X;  5FY7 A;  5T1D A;  2DCF A;  1LRZ A;  2HPL A;  3OYX A;  4QHO A;  4DBR A;  4PK4 A;  2V26 A;  4ZI3 C;  1US7 B;  4MHC A;  4N78 D;  4MFR A;  2NTY A;  2RP4 A;  3N2K E;  3ETV A;  4TX5 A;  5JDG A;  2QA7 A;  2YK0 A;  4HFV A;  4AXP A;  2C5I T;  3MJX A;  5J2T E;  4TV9 E;  4EIW A;  2K9A A;  3HA4 A;  3H37 A;  2LQU A;  2K24 A;  2V7I A;  5LCY A;  1Z0P A;  4U74 A;  2NTX A;  4BA9 A;  5KDM C;  1UCU A;  2LSY A;  3BK9 A;  2EHO D;  2ZM0 A;  1O3X A;  4JEH B;  4QXC B;  3CX6 B;  4QKN A;  2PBI A;  4O2B E;  3KIN B;  4DMV A;  4HGA A;  3RX6 A;  2RA1 A;  1V9D A;  2VKH A;  3AVR A;  2BVM A;  3HKB E;  3PUG A;  2WAU A;  3CX7 B;  5FP3 A;  4PJL A;  1HX8 A;  5LXT E;  5AFU L;  4ADZ A;  1MND A;  4ILU A;  2X9H A;  4EAH A;  2JJ9 A;  3WAK A;  2WSS V;  1CUN A;  2DNX A;  4YHJ A;  4EOZ B;  3Q9D A;  4EYY R;  3HL6 A;  2LE8 A;  4H63 H;  3MK7 C;  4GYR A;  3VKG A;  2X0L B;  2OA5 A;  2ODV A;  3NRY A;  3Q5X A;  3ZCI A;  3HR0 A;  3C64 A;  2NP9 A;  5IHY A;  1ZV4 X;  2IW5 B;  3KBT A;  3ZMT B;  3LJC A;  4G63 A;  3ZN0 B;  4ZI2 C;  4I43 B;  5LGN B;  3GN5 A;  3C51 A;  3U78 A;  3V5S A;  3RC3 A;  3SWH A;  1YKH B;  2E9X A;  3C4X A;  3UFE A;  2X66 A;  3ZJ1 A;  3ESL A;  2IC6 A;  2ZMA A;  1MIW A;  1OXZ A;  3I0O A;  3N5L A;  3OKQ A;  3VKH A;  4DO0 A;  5LG4 A;  3R6N A;  2MTQ A;  5LJM A;  3D0T A;  5HWY A;  1MIY A;  4ZS3 A;  2N9D A;  3P8C D;  4PJN A;  1SA0 E;  4IE6 A;  3L3P A;  4M1P A;  3E08 A;  4KBM B;  2ES0 A;  2KT9 A;  5KX5 E;  4IE4 A;  5FXV A;  3O1H A;  3C4W A;  3I0Q A;  4JEU B;  4CI3 B;  1WYB A;  4GIW A;  4NUV A;  2LOP A;  5JQG E;  4PFP A;  4L9I A;  4J2C A;  4ECG A;  2PG8 A;  3ZYL A;  4AKG A;  4X20 E;  5HXR A;  4EYU A;  3WAJ A;  1YD8 G;  3E22 E;  3DP7 A;  3HKC E;  2H3R A;  5DJQ C;  4HTE A;  3F2E A;  4L0R A;  5HXH A;  3ZEF B;  5JRC A;  4AI6 A;  3GA8 A;  3C98 B;  1IJ6 A;  2NW7 A;  3QK6 A;  5EK2 A;  2DHR A;  5A1L A;  4OYK A;  3NBX X;  5LBQ B;  3ZCJ A;  2WMO A;  2CCQ A;  3KV9 A;  4YLH A;  3OJA A;  3GN5 B;  4OFZ A;  1YKE B;  5H6Q B;  3SOL A;  3KV6 A;  3BQI A;  3AAA B;  4XZC A;  2UXX B;  1MMN A;  3AA6 B;  4E7S A;  4ASK A;  3GMI A;  3ONX A;  2KLQ A;  5LHI B;  2WBL A;  3CKD A;  4HE8 A;  3M1C A;  3CWZ B;  3UUM A;  4UIG A;  5JR9 A;  5L2L A;  4H9N C;  1H7C A;  4CXY A;  2KMF A;  4CXW A;  4AQF C;  3UTK A;  1FEW A;  3IHR A;  4DBQ A;  2VK9 A;  3N9Q A;  4H63 V;  1WR6 A;  1S35 A;  4BAY B;  2BDE A;  3FHN A;  5JDH A;  3LG7 A;  2NWB A;  4YFS A;  3AA1 B;  3KV4 A;  5LGT B;  1ZEE A;  1HF8 A;  4QWN B;  3ZC1 A;  4PJM A;  5JVD E;  5L3D B;  3ANW A;  3I1A A;  5LYJ E;  4KP3 C;  4OYJ A;  4IE7 A;  1LVK A;  1OWA A;  4ZS2 A;  2PFV A;  2LSG A;  5LP6 E;  1HFA A;  2CWO A;  4FJO A;  4UV9 B;  2MTC A;  1ZHC A;  3Q2M A;  3LBX A;  2DWG A;  3MA9 A;  3B13 A;  4AKL A;  4X1Y E;  4DVD A;  4B6X A;  4MAL A;  4V1A v;  5JDQ A;  2V7M A;  4QX8 B;  5FXZ A;  3RKO A;  2CXL A;  2Q9Q A;  3RRW A;  2LJL A;  4QXH B;  4UVB B;  2LSK A;  3DJB A;  4TZ4 C;  1EZ3 A;  2B1E A;  2XTL A;  4C90 A;  1SHZ C;  4X1K E;  4EZH A;  2CA5 A;  2DI4 A;  2W61 A;  5CA0 E;  2NW9 A;  4ZOL E;  4I55 E;  4QXB B;  5EK3 A;  5LBM A;  3HI2 A;  5ETW A;  4ERR A;  5ADX L;  5M4Y A;  2N2N A;  2ACX A;  5DAB A;  1Y64 B;  4YJ3 E;  1KNZ A;  3ZN1 B;  5H6R B;  4UVC B;  2E9X C;  2V7L A;  2X9Y A;  3K3O A;  4ZI2 D;  4QX7 B;  5L3F B;  4CQI A;  5KMG P;  2CXD A;  5J1G A;  2VAS A;  3VJZ A;  4IGU A;  4XBF B;  3JC6 D;  3AT7 A;  3PTR B;  1NAF A;  2D0U A;  2QGS A;  3N9N A;  3O4X E;  1HTJ F;  3KVB A;  3ZYK A;  2BZB A;  3CQC B;  3PU8 A;  1BR1 A;  3PHF 1;  2UXN B;  4H9R C;  2IC9 A;  2EHO A;  1MMD A;  2KIN B;  4DMW A;  1VRB A;  3QC9 A;  4I4T E;  4EB6 E;  2J1D G;  1UX5 A;  2W63 A;  4HKA A;  4ONR A;  3AVS A;  1KK7 A;  1U5P A;  3CVR A;  4PK5 A;  4UF0 A;  2C0S A;  1WLX A;  2ZM8 A;  4IHJ E;  1NWM X;  2C5J A;  2SPC A;  2L9Q A;  3FXD B;  2MBG A;  3T8O A;  1D0X A;  1BR0 A;  4BGO A;  3ZMZ B;  2E8I A;  1MMA A;  2XHE B;  4AKI A;  3PUA A;  4YJ2 E;  3IEE A;  3CQX C;  5FXX A;  4GOU A;  5FNV E;  3FB2 A;  2YU2 A;  3UUL A;  5HYA A;  3N9L A;  1D0Z A;  2L8K A;  2X9W A;  2XAF B;  3ZMS B;  2LHN A;  4WW0 A;  2NW8 A;  2WM9 A;  2ZM2 A;  1ZKE A;  5JR9 C;  1T98 A;  2X9X A;  2V1D B;  2XAH B;  2E9X B;  4H9O C;  4DND A;  4EZ4 A;  4BJN A;  4E7Z A;  3ETU A;  4KMC A;  4PNI A;  3L09 A;  4WNK A;  2LHR A;  4IE5 A;  3RPU A;  2Y48 B;  2IAK A;  4TN7 B;  3PF0 A;  2KXP B;  4PAG A;  4CI1 B;  1QSD A;  2D2S A;  2JMK A;  5HXC A;  3U3I A;  2CXF A;  3PUQ A;  4UEL A;  1HG2 A;  4OK0 A;  5EZY E;  5F8P A;  2XAQ B;  3E0Z A;  3CQG B;  1U4Q A;  3LK4 2;  2VL8 A;  4UF0 B;  3AA0 B;  5FY1 A;  2LM9 A;  2W00 A;  3FBL A;  4ZHQ E;  1VOM A;  1B7T A;  3AAI A;  4P09 A;  3F31 A;  4UV8 B;  5CB4 E;  5LOV E;  4WBN E;  5CA1 E;  2I59 A;  3WI3 A;  4ZI3 D;  3F57 A;  3GWH A;  4AKR B;  5LHH B;  3HKE E;  3P7I A;  3MXZ A;  3N9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...