4EIYA

Crystal structure of the chimeric protein of a2aar-bril in complex with zm241385 at 1.8a resolution
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
405
structure length
390
Chain Sequence
GAPPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Adenosine receptor A2a/Soluble cytochrome b562 chimera
publication title Structural basis for allosteric regulation of GPCRs by sodium ions.
pubmed doi rcsb
source organism Homo sapiens
total genus 173
structure length 390
sequence length 405
ec nomenclature
pdb deposition date 2012-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4eiyA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4eiyA01
4QI1A 1E83A 4AMJA 3PBLA 1BRRA 3DE8A 1IW9A 3RZEA 3QBKA 1F50A 5AZDA 4GP5B 3PXOA 2I20A 256BA 3DDLA 4FPDA 5JUAA 4TL3A 4WAVA 2VT4A 2WJKA 4MD1A 4BEZA 2AT9A 1XMEB 3PWHA 4FAAB 4EIYA 5B34A 5LWEA 5H2HA 4D4XA 2F95A 1VJMA 2F93A 3PQRA 3HASA 4GP8B 3V2YA 1GQAA 3AM6A 1CWQA 4D4NA 2RH1A 2YL1A 3QJSB 1GU8A 1C8SA 2J9BA 5B6WA 5B6VA 1KGBA 4L6RA 4KNFA 3HNIA 3MBVA 3C62A 3M4CA 4LDOA 3ZPQA 5JS5A 3C9LA 1F4ZA 3HAQA 1QPUA 5A44A 1XIOA 4NC3A 3QW1A 3QBGA 3ZQYA 4IAQA 5JLIA 4DKLA 2XLEA 3UG9A 5A8EA 3L1MA 3EMLA 4QIDA 5DHHA 1YZCA 3FOOA 4CDAA 4WW3A 2XLWA 1TN5A 3X3CA 5BR5A 3NS0A 1AT9A 3VGAA 5JT4A 2QPEB 1S51A 3HNJA 3HANA 3HAOA 4XTLA 4CDVA 3OE9A 5G28A 4XTNA 1UCQA 3VVKA 1E84A 4ER9A 2ZFEA 4XTOA 4WGYA 5TGZA 3AYNA 3FOPA 3M4BA 3ZTMA 3NSBA 5KKHA 5G2AA 1RCPA 1E0PA 3VRCA 5B3IA 1APCA 3QBIA 3UTVA 2NTWA 4CX9A 1M0LA 5H2IA 2YDOA 3S8GB 3CAPA 1BRXA 4PXFA 1PXSA 3C63A 1E12A 4QRYA 3DQBA 2QPDB 4U9EA 1S52A 3NY8A 4BVNA 1C3WA 4GBRA 4X1HA 3HARA 3U8PA 1GZMA 2R4RA 3QAPA 1R2NA 4UHRA 4ULVA 1AP9A 1QM8A 3T45A 3S8FB 3S3DB 1HZXA 1QKOA 2KSAA 3OE6A 1S05A 2J4YA 4FBZA 4G70B 3TOLA 2YCWA 4JQ6A 3HNKA 3REYA 5B2NA 1A7VA 5ETZA 1U19A 1EHKB 4CDYA 4N4WA 3UTYA 1XJIA 3VW7A 1QHJA 2I1XA 3NYAA 1CGNA 3EH4B 1S53A 2CCYA 3ODUA 4BWBA 1GUEA 1S8JA 4MBSA 1H2SA 2ZIYA 1KMEA 2Y04A 1KG8A 2I35A 4XT3A 4CJGA 3SN6R 2XL8A 1YYJA 1JFPA 5H2NA 1JV7A 4N4YB 2L6XA 3VHZA 2Y00A 1Q5JA 5A45A 5ITCA 4GP4B 2XLMA 4JEAA 4MD2A 2Z55A 4CIPA 1YYXA 4HWLA 1P8UA 5JJNA 1IW6A 3DE9A 1TN0A 1X0I1 1PY6A 3QJQB 2EI4A 4J4QA 3PDSA 4HYJA 4FA7B 3C9MA 3UONA 4BUOA 3QJUB 4BEYA 5EN0A 1S54A 2ZZLA 2PEDA 5B6YA 3COCA 4XT1A 1UAZA 1BM1A 3KJ6A 5DYSA 2QLAA 1M6TA 5G53A 4AMIA 1BBHA 3A7KA 3RFMA 5G54A 4EA3A 3OE8A 3VG9A 3NY9A 4LDEA 3OE0A 1P8IA 1M0MA 3QAKA 4EJ4A 3UZCA 2YCXA 4N6HA 5AHYA 5G36A 5H2PA 3IQ5A 1X0SA 1FBBA 1CPQA 2JAGA 5H2JA 5JVEA 5ITEA 4X32A 1PXRA 1LN6A 4GPOA 4G7RB 4LDLA 2BRDA 1C8RA 4IARA 4G7SB 3P0GA 1M0KA 4A4MA 3ZWIA 3HNLA 1MQVA 2XLVA 2YCYA 2M3GA 5B0WA 2XL6A 3QVYA 1QQ3A 4DJHA 5H2MA 3M79A 1E85A 5JSLA 1E86A 1JGJA 3NMJA 3V2WA 2JAFA 3M15A 2XM4A 4OV0A 1X0K1 5H2OA 3UZAA 3WQJA 5AX1A 3QW0A 2XLOA 2I21A 5H2LA 2YL0A 3X3BA 3OAXA 2YLDA 2BC5A 2KSYA 1JAFA 3NMIA 2HPYA 4JKVA 3VI0A 4JEBA 4UG2A 2G87A 5H2KA 1L9HA 5DHGA 3IQ6A 2XLHA 1Q5IA 3QVZA 1KG9A 1DZEA 5AX0A 4GRVA 1R84A 1H68A 3CODA 4IB4A 3ZEVA 3EH5B 2LNLA 4XXJA 4MQSA 2YDVA 3TOMA 4PXKA 3QJRB 5B35A 2Y03A 5JJJA 5AHZA 2XLDA 3NMKA 3ZPRA 1P8HA 4KLYA 5B6XA 5C1MA 5JJEA 3UTWA 2J8WA 1O0AA 2YL7A 4G72B 2Z73A 3QJTB 4K5YA 3QBLA 1NBBA 3EH3B 1EKYA 4GYCA 1LM3B 2YKZA 1L0MA 1S8LA 4JR8A 4L35A 1FBKA 2NTUA 3QJVB 2KS9A 4Y9HA 1QKPA 2XM0A 1JV6A 5JP7A 4WGZA 3AYMA 4HYXA 4G7QB 5AWZA 5JRAA 2R4SA 2KSBA 2Y01A 4G71B 1CPRA 3D4SA 1YZAA 1CGOA 4CJOA 3HAPA 2Y02A 2YCZA 5G2DA 1MGYA 3QDCA 1BRDA 5G2CA 2YLIA 1VGOA 4DAJA 2WJLA 5B6ZA 5F8UA 3S3CB 4MQTA 2YL3A 1F88A 3BVDB 5J7AA 2YLGA 1IXFA 3ZQVA 4X31A 5AGFA 4JE9A 4U9DA 3UTXA 3ZTZA 3S3BB 5FJGA 4BV0A 2X72A 5BR2A 3ABWA
chains in the Genus database with same CATH superfamily
4QI1A 1BRRA 3U3FA 1I4ZA 5EK0A 3FHDA 4XPWA 3QBKA 3C8GA 1D0YA 4MVRA 3G4XA 4TL3A 4JCHA 2KGOA 3L34A 3ABMC 3PDMP 3RYLA 2R25A 3N24A 3T6GB 4CS9A 2F95A 3WG7C 3PQRA 1TFKB 2XXAA 1HE9A 2R7TA 2FFHA 2R7XA 3AM6A 2YL1A 4RD9A 3QJSB 4KNVA 1LI5A 5B6WA 3T4RA 4OINF 5COGA 1M2VA 3H2VA 3CEXA 4NTAA 4NQFA 3M4CA 5DQTA 3ZPQA 1LPEA 1U89A 1TQGA 1QPUA 5A44A 4JTCB 4NC3A 3QBGA 2ZD9A 2DI3A 3V5YA 1XZPA 2XLEA 3S0XA 3UG9A 5A8EA 3LEOA 2YEVA 3EMLA 1LE4A 3FOOA 3NRHA 5HSWA 2QUPA 3ABLC 1OCZC 5A6BD 3X3CA 3U9MA 2QPEB 2Q00A 3GEHA 2WZGA 5B1AC 3RVZA 4XTLA 4DVZA 4GYTA 3S28A 4A4AA 4G0HA 2FAPB 4OIQF 3AYNA 3Q6NA 1V55C 2HJ3A 4LERA 3MBGA 4P6IC 2YDOA 1J8MF 3S8GB 4XPXA 2R7QA 4DS7E 4PXFA 4XLNF 2A1DD 3C63A 3NYLA 1TR2A 3POVA 4GBRA 3JYHA 4MVOA 4OIPF 5KYWA 4MW8A 2R7SA 2L6FA 2GWWA 1OCCC 2RSEB 3W8IA 5E33A 1LE2A 3S8FB 1QKOA 4C3DA 2PNOA 1ZU4A 5K0IA 2YCWA 1FMWA 1A7EA 1U19A 3ASOC 4N4WA 3UTYA 1XJIA 2G3VA 4MNDA 2WVQA 3FXHA 1CGNA 3EH4B 1D1BA 3ZVRA 3O39A 4YT2A 2NSGA 2ZIYA 3DJUB 2PFDA 3LLIA 1KG8A 3L8JA 4O6YA 2XL8A 1YYJA 3NYMA 2L6XA 4PJMA 2Y00A 4E17A 2XLMA 4I44A 3LAYA 5KYXB 5DLJA 4E0IA 1YYXA 4HWLA 4CS9C 1Z5ZA 5D91A 1V54C 1TN0A 4U5EE 2EI4A 1OW6A 3C9MA 5L0CA 3QJUB 3EGDB 4P9TA 4BEYA 2ZZLA 2PEDA 5B6YA 4XEFA 4XT1A 4DRIB 1UAZA 2QLAA 3AQCA 4PJNA 3NYJA 5G54A 4EA3A 4PFPA 3OA1A 5BUOA 4LDEA 4E0HA 2Q4FA 2NG1A 3U2MA 4WJ0A 1Q0MA 2J45A 4O6NA 1RXQA 1X0SA 1CPQA 3KL4A 1ZHZA 1LN6A 3FAJA 4G7ZF 4CS7A 5A6AA 3GODA 2LCHA 3EGDA 1T6UA 4JIOA 2XLVA 4OIRF 1IW7F 3RKOF 1WASA 2CGEA 3QVYA 4AL0A 1JR8A 5H2MA 3ZC4A 1KNYA 3E70C 1E85A 2JAFA 4OV0A 5H2OA 3UZAA 3WQJA 2XLOA 4FAPB 2HMZA 5E3AA 3OAXA 2J0XA 3EPVA 2BC5A 2KSYA 3M1CB 3AG4C 3NMIA 4JKVA 3VI0A 2DYSC 4QI2A 1L3PA 1L9HA 3FVYA 5DHGA 2IYLD 4JJFA 5B3SC 3O10A 2KW3C 1KG9A 3UMIA 3CODA 3UR3C 3B71A 4JCZA 3EH5B 4ULWA 4PACA 4MQSA 3EHMA 3HJCA 1I4YA 4PXKA 3U5SA 5AHZA 3ZPRA 1SR2A 4NTBA 3K1HA 4BJTA 4KLYA 3DI5A 5C1MA 4ONSA 3UTWA 3A9CA 3GORA 2OOCA 2OU6A 3EH2A 3FDQA 4MVQA 3EZHA 4DBRA 2YKZA 4MTOA 4JRZA 1FBKA 3QJVB 1MNEA 4Y9HA 1QKPA 5BQIA 5JP7A 4WGZA 5CI8A 1T5OA 1PD1A 1K40A 3ABKC 2R4SA 1YZAA 1KU2A 1FMVA 2YHSA 2ICWG 1MGYA 3QDCA 2WVOA 2GDCA 3MLGA 1VGOA 4DAJA 3FMSA 1I5NA 1LI7A 3L8IA 4KBLA 2BL2A 4MTFA 2YLGA 3MYFA 1YAUO 1IXFA 4F4BA 3ZQVA 1PV3A 4C7OB 1YJGA 3SZRA 4JE9A 4U9DA 3N2ZB 4YT5A 2W4MA 4BV0A 2EIKC 1T6IA 3NKEA 3JZ0A 1E83A 4AMJA 2R05A 1LS4A 3DE8A 3B0VC 2R7UA 1HMOA 2C04A 1CGME 1F50A 5AZDA 4E18A 4W8PA 256BA 2W45A 3U2LA 2VT4A 2WJKA 1LS1A 2JD3A 2LK4A 2OEXA 5H2HA 3GM1A 3V2YA 3DXJF 2GA0A 3KYJA 1CWQA 2J0WA 1NZEA 3ZDLA 1UFBA 1GU8A 3AG3C 1C8SA 4C7OA 5B6VA 2A6HF 4DBQA 4PK4A 2LQGA 1ZW3A 3HTKC 2EPNA 4UDVA 3C62A 3S29A 3S27A 4PR9A 1OCRC 1C02A 5JS5A 2V26A 3E9VA 1XIOA 5JLIA 1QLEC 4DKLA 3L1MA 2DB4A 5COFA 2HUJA 3GEEA 2J7PD 2J9VA 5KYUB 4G78A 1MNDA 1A41A 2IBFA 2IXNA 5EHHA 1W2WA 1NU9C 4MVUA 2C03A 2BE5F 3VGAA 5JT4A 2UUHA 3HANA 3W2WA 4CDVA 2M4EA 5G28A 4XTNA 3JCUQ 3VVKA 4WGYA 4OD4A 1NLXA 5DS6A 2UUIA 4O6MA 5IY5C 5KKHA 2H7BA 2Q9CA 2NTWA 5H2IA 4IWBA 1TWAA 1SMYF 2LSEA 1BRXA 1ORSC 3R2PA 4U5GA 3WAQA 1OKKA 2TMVP 1S52A 5KYUA 1QSPA 4YL3A 3U9JA 3B9QA 4Z9JA 3U8PA 2R4RA 2HS5A 3QAPA 2PF4E 1V74B 2YRFA 3UGPA 4E7ZA 1R2NA 1MMDA 1IZMA 1AP9A 1WWPA 1HZXA 2KSAA 3OE6A 4CSAA 1S05A 4DXWA 4JQ6A 3AQBA 4I1OB 3REYA 4YL0A 1A7VA 3W2VA 4Q4ZF 3KKBA 4CDYA 2LIGA 2H7VC 4XWJA 2I1XA 5COMA 2CCYA 1A0BA 3HLZA 2XS1A 3JT1A 3OWTA 1KMEA 2YZSA 2I35A 4HEAJ 3GWLA 1Z6AA 2Q9BA 2QY9A 3VHZA 4BJ6C 4AX2A 3TD7A 4GP4B 1RKCA 4MD2A 1WTYA 2Z55A 3ZSUA 2KK1A 4B6IA 2R7OA 4BJ1A 5A6JA 1A7DA 2R7WA 1IW6A 1VK5A 3DE9A 1D0XA 4HYJA 3ZG1A 3X1OA 4BUOA 4CS8C 1Q0FA 4YWQA 3RW0A 1ZW2A 4H54A 2RD9A 4QI0A 5DYSA 1BBHA 2I8BA 3RFMA 4C3BA 1HY5A 3CQZA 3OE8A 3VG9A 1ST6A 1O5HA 2L7AA 2LFDA 1P8IA 3X2QC 4I1MA 3TK0A 4EWCA 4N6HA 2OKUA 5KYYB 5G36A 4U5BE 4XLPF 3B29A 1SZIA 2IXOA 4KC9A 3SP1A 1VOMA 4U5FE 1QZXA 3DM9B 4BJ5A 3Q7GA 2BRDA 4YK5A 2AU5A 2L81A 4H4KC 4BPMA 4CIHA 4A4MA 3ZWIA 3HNLA 5GPGB 2KNHA 1MQVA 1Z7Qc 1ZYRF 5D92A 2MWQA 1G4WR 3BRJA 2Q3TA 4YT4A 3VM6A 3JRTA 3M79A 2Y39A 3AGTA 4IRUA 5JSLA 5BQGA 3V2WA 3M15A 3O55A 2CYDA 1PD0A 3QW0A 1VYIA 2DYRC 2I21A 1SYQA 3WHNA 2YL0A 3GEIA 2YLDA 2P0NA 2VH3A 3N0TA 1ZVZA 3UMHA 2R7RA 2IXMA 4RDAA 1MMGA 2CDQA 3JSEO 3LJBA 1Q5IA 1XZQA 1JPNA 4GRVA 2NPUA 1H68A 3H65A 4IB4A 4ANJA 1G8XA 1NFNA 3TOMA 3QJRB 2ASRA 4CSAC 1YVIA 2YVKA 1RMVA 1U0BB 2YL7A 4EBJA 4GQHA 3IQCA 2Z73A 3QBLA 1NBBA 3VF0A 3EH3B 1OW7A 1L0MA 4EBKA 3RF3A 1NFOA 4W8KA 1JV6A 2EPOA 2EPMX 4HYXA 5JRAA 4G71B 3D4SA 2A0UA 2KQ9A 2ZPAA 5G2DA 3F46A 1ZHTA 1BRDA 3O6XA 2IM8A 2Y3BA 2W9YA 3QZCA 2WJLA 5B6ZA 2AWCA 2JPUA 3W8HA 3DM5A 4MQTA 2E87A 1F88A 3BVDB 5J7AA 5KYXA 4K7BA 3C18A 4E7SA 1VMAA 3UTXA 5F5FA 3LNRA 3ZTZA 4MTGA 5FJGA 2X72A 1D1CA 3PBLA 4YL1A 1XWJA 4GP5B 3PXOA 3MYIA 4G7OF 3DDLA 2VCBA 1Y6DA 4MD1A 4XEKA 4BEZA 1F1MA 4FAAB 3G50A 4EIYA 5B34A 5T3WA 2WVNA 1OQCA 1VJMA 2F93A 5L3VA 3HASA 4GP8B 4P9FA 1RJ9B 4A2NB 2RH1A 1TKNA 5FZTA 2J9BA 4G7HF 1KGBA 1KTMA 3S9OA 4KNFA 3C8GD 3F47A 5A6BA 3MBVA 3EHNA 4EBBA 4LDOA 2XS8A 2DGJA 1F4ZA 3HAQA 4PFOA 3SXYA 1ZZPA 4C3EA 2KSFA 4IAQA 2NUTB 4Q5SF 1D0ZA 2A69F 1Q0KA 3C8ZA 4QIDA 4IJJA 4M63A 1Q0GA 2ZXOA 5DHHA 2GFHA 2V3CC 4DOZA 4HFFB 4AL1A 5FCLA 1HMDA 1R4TA 3LUTB 1AT9A 3ZIBA 3SXZA 2MYSA 3HNJA 1HE1A 3UGOA 1VLSA 3V7OA 3HKKA 1V4AA 2AVKA 3MX3A 4J30B 1E84A 2ZFEA 5TGZA 4MS2A 4I3MA 5A69A 3FOPA 3M4BA 3ZTMA 3NSBA 5G2AA 2HV6A 5DS4A 2KYHA 1RCPA 5B3IA 5T1DB 1ZHWA 1WATA 1T6QA 2WB7A 3SXKA 1NU7D 1PXSA 3RIPA 2GAQA 2H7OA 2HMQA 2ETSA 1E12A 2QPDB 4U9EA 3I5QA 4JVSA 4BVNA 1C3WA 1ZHYA 5DS5A 3K7DA 4X1HA 3HARA 4FX5A 2AP3A 4XPYA 4ULVA 1ORYA 4XEVA 1QM8A 1YDIA 2EIMC 1WGWA 1JPJA 3TQOA 3AJMA 2J4YA 3C7JA 4KI2A 5B2NA 5ETZA 1BDJB 2IOQA 1TWHA 2KJGA 1QHJA 4AE4B 2VASA 1S53A 3ODUA 5CIVA 4BWBA 1GUEA 1S8JA 4MBSA 2OJQA 4IAOA 3EFOB 1UG7A 3SN6R 2X0CA 1JV7A 4N4YB 4YT8A 4OD5A 4NTFA 2P1AA 1Q5JA 2J9WA 1OXBA 5ITCA 4JEAA 4QDLA 3TULA 4FESA 3G4ZA 2L6GA 1G4US 1M57C 3GWNA 3IEEA 2AWYA 4AK9A 1TWGA 3T6JA 2WZFA 3PDSA 2ZXPA 5EN0A 1S54A 3COCA 1YA7O 2VCCA 4LDRA 1M6TA 1WOLA 3MFNA 4AMIA 2F22A 3A7KA 3EFOA 3JYYA 2ZXRA 3NY9A 3OE0A 2CNWA 2M64A 1M0MA 2WL8A 3L0IA 4CBEA 3QAKA 2VCAA 3UZCA 5TJ5E 5DVWA 2YCXA 1OR2A 2HSQA 5L0JA 5AHYA 2XXAB 1RKEB 3IQ5A 2LP4A 4MVZA 5H2JA 1EA8A 4GEHA 4X32A 5L0GA 2Q7RA 1QKRA 4GPOA 4G7RB 5KYNA 1O87A 4LDLA 3IQTA 1M0KA 1OXKA 2YCYA 2M3GA 4LACB 3GM2A 1GM5A 1QQ3A 3TJ6A 4ZLCA 1E86A 3NMJA 2IXPA 2XM4A 4Z9IA 3NG1A 2J46A 3KPHA 3SYNA 1JAFA 3V5ZA 2HPYA 3KH2A 1ZU5A 2WZLA 5H2KA 1RKEA 3IQ6A 1GGQA 2XLHA 4EHPA 3QVZA 3KMIA 1DZEA 3T9OA 1T9KA 1HW1A 5EGYA 2Y69C 2Y3HA 4X0RA 3RVYA 4MQ9F 4O7GA 5B35A 2X51A 1P8HA 5JJEA 2J8WA 4JZAA 1O0AA 4G72B 2D4UA 3TJ5A 4GYCA 4R32A 1LM3B 3SNHA 1K04A 1S8LA 4JR8A 3FAPB 2KS9A 2G62A 2OJED 3Q6MA 1OR3A 5KYWB 2QE9A 3AYMA 2Z15A 2KSBA 2Y01A 2Y3GA 1AEPA 3ITFA 4KNWA 4CJOA 1Z63A 4HFKB 4LLCA 3V5XA 2J9UA 3ATPA 4JJGA 1MMNA 1T01A 1B68A 4DVYP 5AGFA 5AC4A 2R02A 3S3BB 1BR2A 1AUEA 2XSEA 2HZ8A 1TFOB 2XL6A 4DRHB 5BR2A 4NY3A 2OCCC 1E2XA 2P6VA 1SF8A 1EI7A 3SXMA 3CSKA 1IW9A 3UMKA 3RZEA 4FWVA 4NCQA 4JW1A 1LVKA 2I20A 4LLEA 1VB5A 2OEVA 4FPDA 5JUAA 4WAVA 3OEOA 3EG9B 2AT9A 1XMEB 2YQYA 3PWHA 2HFIA 1DOWA 2W4BA 3PHF2 4JTDB 5LWEA 4D4XA 1ORJA 1O3UA 1FNTc 5KYYA 1GQAA 4D4NA 2J7PA 3DWWA 3QMKA 2EINC 4J7TA 4K1OA 2VB6A 4HE8D 4L6RA 4DJ9A 3HNIA 5L0FA 2A0BA 3IPMO 2EPKX 2JX0A 3I4UA 3DMDA 3A11A 5F5HA 3EZIA 3NKDA 3C9LA 1OW8A 4MW3A 1MMAA 3W4YA 2PP4A 3QW1A 1EQ1A 3ZQYA 1JOGA 3EJNA 3KYIA 4XQ1A 5F28E 3EG9A 2QTVA 1YZCA 1C17M 4CDAA 2PBEA 4WW3A 2XLWA 4U5DE 1BZ4A 1TN5A 3SEOA 1R5ID 3DAFA 1H9TA 5BR5A 3NS0A 4RBNA 2PX0A 1S51A 3HAOA 3CAXA 3DD7A 1H6GA 3OE9A 1UCQA 1Q0DA 4ER9A 4XTOA 3IHUA 1BR4A 1VYKA 1NG1A 3JSZA 3U8VA 1E0PA 3VRCA 1APCA 3QBIA 1J8YF 3UTVA 3LS0A 4CX9A 3EGXB 1M0LA 4U5HA 1TWCA 1H7IA 1Z23A 1M56C 2Y3DA 3CAPA 2LD6A 4QRYA 3DQBA 3NY8A 5E3CA 3AG2C 4LDKA 1GZMA 1Z3IX 1U6HA 4JURI 3RQEA 2XRHA 5L0DA 4UHRA 3K1IA 3T45A 3S3DB 3DAGA 2FGYA 4JTAB 2MHRA 2CNWD 4FBZA 4G70B 3TOLA 3HNKA 2H8AA 5L0IA 3GM3A 2G3KA 1EHKB 1GS9A 4Z9HA 3LESA 3S90A 3VW7A 3K66A 1OKKD 1VLTA 3K6BA 1FTSA 3NYAA 3EGXA 4O79A 4BJ5C 4U5CE 1H2SA 2YWAA 4YN0B 3PMRA 2Y04A 4EUKB 4XT3A 4CJGA 3Q7LA 1JFPA 5H2NA 1S7ZA 2R03A 1H9GA 2B0HA 2R9RB 4PJLA 5A45A 3S84A 1YARO 3RFYA 3JTLO 3K33A 4ZLDA 4CIPA 4OIOF 1P8UA 5JJNA 2L9JA 3DJNB 1AVOB 5DQZA 2HJMA 1X0I1 1PY6A 3QJQB 4J4QA 1FR0A 2HSBA 1RJ9A 3AOUA 1HW2A 2L6HA 4FA7B 3UONA 1C03A 1NSGB 1JRAA 3GANA 3WODF 1L7CA 1D1AA 2OQMA 3AG1C 2ZXWC 1BM1A 3KJ6A 5G53A 5BQHA 1K05A 3BEHA 3UNGC 5B1BC 3J06A 1ZHXA 1M2OA 2D5RB 1FAPB 3ECSA 4EJ4A 2XL4A 2NUTA 1G5ZA 5L3QA 5H2PA 1FBBA 5T3TA 2JAGA 1FFHA 5JVEA 5ITEA 3EQLF 1PXRA 4N6CA 2NUPB 3JRMO 1C8RA 4IARA 4G7SB 3P0GA 4EKWA 3U0CA 2EPLX 3NDBB 4N06A 3T6BA 5B0WA 3B0UX 3DZAA 4Q7CA 4DJHA 2VC9A 5HV9A 1JMWA 2HV7A 4BJ6A 1N1CA 1JGJA 5E2QA 1X0K1 4BEJA 1LKXA 2EILC 5AX1A 2P61A 5H2LA 2A68F 1DOVA 3X3BA 4WABA 1WN0A 4DRJB 4BG0A 1OCOC 2O9XA 4MVSA 2NSFA 2OG2A 4JEBA 3RQGA 4UG2A 2G87A 4XTKA 2EIJC 3RQFA 3R7CA 1YLMA 2KC3A 4CS8A 5AX0A 1R84A 3VYWA 2A6EF 3ZEVA 3EH1A 2LNLA 4XXJA 3PCVA 1LIHA 2NUPA 3DKAA 4K0DA 2YDVA 3K1IC 1QVXA 3B0PA 3VAYA 2Y03A 5JJJA 2XLDA 3NMKA 3H2UA 3QTHA 2B0JA 4YJWA 5B6XA 5A6KA 5CI9A 2I15A 2QNLA 2Q9AA 2PX3A 4J32B 3I5PA 4J7YA 3QJTB 4K5YA 1EKYA 3U3BA 4AE4A 5AC5A 4L35A 4JC7A 2NTUA 4MVMA 3LS1A 3C8GB 2XM0A 2LFFA 4G7QB 5AWZA 5L0HA 1CPRA 2R7VA 1FFTC 2P7VA 1CGOA 3LLKA 4BEMJ 3HAPA 2Y02A 2YCZA 5G2CA 2YLIA 3AGUA 3US6A 5F8UA 3S3CB 3LEVA 2YL3A 1VTMP 3CZ6A 1PCXA 2CW0F 3RH3A 4X31A 1Y4CA 1YA9A 2HKVA 4LDQA 1M2VB 4PJJA 3ASNC 4IGGA 3ABWA 3LNMB 1BR1A
chains in the Genus database with same CATH topology
4QI1A 1E83A 4AMJA 3PBLA 1BRRA 3DE8A 1IW9A 3RZEA 3QBKA 1F50A 5AZDA 4GP5B 3PXOA 2I20A 256BA 3DDLA 4FPDA 5JUAA 4TL3A 4WAVA 2VT4A 2WJKA 4MD1A 4BEZA 2AT9A 1XMEB 3PWHA 4FAAB 4EIYA 5B34A 5LWEA 5H2HA 4D4XA 2F95A 1VJMA 2F93A 3PQRA 3HASA 4GP8B 3V2YA 1GQAA 3AM6A 1CWQA 4D4NA 2RH1A 2YL1A 3QJSB 1GU8A 1C8SA 2J9BA 5B6WA 5B6VA 1KGBA 4L6RA 4KNFA 3HNIA 3MBVA 3C62A 3M4CA 4LDOA 3ZPQA 5JS5A 3C9LA 1F4ZA 3HAQA 1QPUA 5A44A 1XIOA 4NC3A 3QW1A 3QBGA 3ZQYA 4IAQA 5JLIA 4DKLA 2XLEA 3UG9A 5A8EA 3L1MA 3EMLA 4QIDA 5DHHA 1YZCA 3FOOA 4CDAA 4WW3A 2XLWA 1TN5A 3X3CA 5BR5A 3NS0A 1AT9A 3VGAA 5JT4A 2QPEB 1S51A 3HNJA 3HANA 3HAOA 4XTLA 4CDVA 3OE9A 5G28A 4XTNA 1UCQA 3VVKA 1E84A 4ER9A 2ZFEA 4XTOA 4WGYA 5TGZA 3AYNA 3FOPA 3M4BA 3ZTMA 3NSBA 5KKHA 5G2AA 1RCPA 1E0PA 3VRCA 5B3IA 1APCA 3QBIA 3UTVA 2NTWA 4CX9A 1M0LA 5H2IA 2YDOA 3S8GB 3CAPA 4DS7E 1BRXA 4PXFA 1PXSA 3C63A 1E12A 4QRYA 3DQBA 2QPDB 4U9EA 1S52A 3NY8A 4BVNA 1C3WA 4GBRA 4X1HA 3HARA 3U8PA 1GZMA 2R4RA 3QAPA 1R2NA 4UHRA 4ULVA 1AP9A 1QM8A 3T45A 3S8FB 3S3DB 1HZXA 1QKOA 2KSAA 3OE6A 1S05A 2J4YA 4FBZA 4G70B 3TOLA 2YCWA 4JQ6A 3HNKA 3REYA 5B2NA 1A7VA 5ETZA 1U19A 1EHKB 4CDYA 4N4WA 3UTYA 1XJIA 3VW7A 1QHJA 2I1XA 3NYAA 1CGNA 3EH4B 1S53A 2CCYA 3ODUA 4BWBA 1GUEA 1S8JA 4MBSA 1H2SA 2ZIYA 1KMEA 2Y04A 1KG8A 2I35A 4XT3A 4CJGA 3SN6R 2XL8A 1YYJA 1JFPA 5H2NA 1JV7A 4N4YB 2L6XA 3VHZA 2Y00A 1Q5JA 5A45A 5ITCA 4GP4B 2XLMA 4JEAA 4MD2A 2Z55A 4CIPA 1YYXA 4HWLA 1P8UA 5JJNA 1IW6A 3DE9A 1TN0A 1X0I1 1PY6A 3QJQB 2EI4A 4J4QA 3PDSA 4HYJA 4FA7B 3C9MA 3UONA 4BUOA 3QJUB 4BEYA 5EN0A 1S54A 2ZZLA 2PEDA 5B6YA 3COCA 4XT1A 1UAZA 1BM1A 3KJ6A 5DYSA 2QLAA 1M6TA 5G53A 4AMIA 1BBHA 3A7KA 3RFMA 5G54A 4EA3A 3OE8A 3VG9A 3NY9A 4LDEA 3OE0A 1P8IA 1M0MA 3QAKA 4EJ4A 3UZCA 2YCXA 4N6HA 5AHYA 5G36A 5H2PA 3IQ5A 1X0SA 1FBBA 1CPQA 2JAGA 5H2JA 5JVEA 5ITEA 4X32A 1PXRA 1LN6A 4GPOA 4G7RB 4LDLA 2BRDA 1C8RA 4IARA 4G7SB 3P0GA 1M0KA 4A4MA 3ZWIA 3HNLA 1MQVA 2XLVA 2YCYA 2M3GA 5B0WA 2XL6A 3QVYA 1QQ3A 4DJHA 5H2MA 3M79A 1E85A 5JSLA 1E86A 1JGJA 3NMJA 3V2WA 2JAFA 3M15A 2XM4A 4OV0A 1X0K1 5H2OA 3UZAA 3WQJA 5AX1A 3QW0A 2XLOA 2I21A 5H2LA 2YL0A 3X3BA 3OAXA 2YLDA 2BC5A 2KSYA 1JAFA 3NMIA 2HPYA 4JKVA 3VI0A 4JEBA 4UG2A 2G87A 5H2KA 1L9HA 5DHGA 3IQ6A 2XLHA 1Q5IA 3QVZA 1KG9A 1DZEA 5AX0A 4GRVA 1R84A 1H68A 3CODA 4IB4A 3ZEVA 3EH5B 2LNLA 4XXJA 4MQSA 2YDVA 3TOMA 4PXKA 3QJRB 5B35A 2Y03A 5JJJA 5AHZA 2XLDA 3NMKA 3ZPRA 1P8HA 4KLYA 5B6XA 5C1MA 5JJEA 3UTWA 2J8WA 1O0AA 2YL7A 4G72B 2Z73A 3QJTB 4K5YA 3QBLA 1NBBA 3EH3B 1EKYA 4GYCA 1LM3B 2YKZA 1L0MA 1S8LA 4JR8A 4L35A 1FBKA 2NTUA 3QJVB 2KS9A 4Y9HA 1QKPA 2XM0A 1JV6A 5JP7A 4WGZA 3AYMA 4HYXA 4G7QB 5AWZA 5JRAA 2R4SA 2KSBA 2Y01A 4G71B 1CPRA 3D4SA 1YZAA 1CGOA 4CJOA 3HAPA 2Y02A 2YCZA 5G2DA 1MGYA 3QDCA 1BRDA 5G2CA 2YLIA 1VGOA 4DAJA 2WJLA 5B6ZA 5F8UA 3S3CB 4MQTA 2YL3A 1F88A 3BVDB 5J7AA 2YLGA 1IXFA 3ZQVA 4X31A 5AGFA 4JE9A 4U9DA 3UTXA 3ZTZA 3S3BB 5FJGA 4BV0A 2X72A 5BR2A 3ABWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QI1 A;  1E83 A;  4AMJ A;  3PBL A;  1BRR A;  3DE8 A;  1IW9 A;  3RZE A;  3QBK A;  1F50 A;  5AZD A;  4GP5 B;  3PXO A;  2I20 A;  256B A;  3DDL A;  4FPD A;  5JUA A;  4TL3 A;  4WAV A;  2VT4 A;  2WJK A;  4MD1 A;  4BEZ A;  2AT9 A;  1XME B;  3PWH A;  4FAA B;  4EIY A;  5B34 A;  5LWE A;  5H2H A;  4D4X A;  2F95 A;  1VJM A;  2F93 A;  3PQR A;  3HAS A;  4GP8 B;  3V2Y A;  1GQA A;  3AM6 A;  1CWQ A;  4D4N A;  2RH1 A;  2YL1 A;  3QJS B;  1GU8 A;  1C8S A;  2J9B A;  5B6W A;  5B6V A;  1KGB A;  4L6R A;  4KNF A;  3HNI A;  3MBV A;  3C62 A;  3M4C A;  4LDO A;  3ZPQ A;  5JS5 A;  3C9L A;  1F4Z A;  3HAQ A;  1QPU A;  5A44 A;  1XIO A;  4NC3 A;  3QW1 A;  3QBG A;  3ZQY A;  4IAQ A;  5JLI A;  4DKL A;  2XLE A;  3UG9 A;  5A8E A;  3L1M A;  3EML A;  4QID A;  5DHH A;  1YZC A;  3FOO A;  4CDA A;  4WW3 A;  2XLW A;  1TN5 A;  3X3C A;  5BR5 A;  3NS0 A;  1AT9 A;  3VGA A;  5JT4 A;  2QPE B;  1S51 A;  3HNJ A;  3HAN A;  3HAO A;  4XTL A;  4CDV A;  3OE9 A;  5G28 A;  4XTN A;  1UCQ A;  3VVK A;  1E84 A;  4ER9 A;  2ZFE A;  4XTO A;  4WGY A;  5TGZ A;  3AYN A;  3FOP A;  3M4B A;  3ZTM A;  3NSB A;  5KKH A;  5G2A A;  1RCP A;  1E0P A;  3VRC A;  5B3I A;  1APC A;  3QBI A;  3UTV A;  2NTW A;  4CX9 A;  1M0L A;  5H2I A;  2YDO A;  3S8G B;  3CAP A;  1BRX A;  4PXF A;  1PXS A;  3C63 A;  1E12 A;  4QRY A;  3DQB A;  2QPD B;  4U9E A;  1S52 A;  3NY8 A;  4BVN A;  1C3W A;  4GBR A;  4X1H A;  3HAR A;  3U8P A;  1GZM A;  2R4R A;  3QAP A;  1R2N A;  4UHR A;  4ULV A;  1AP9 A;  1QM8 A;  3T45 A;  3S8F B;  3S3D B;  1HZX A;  1QKO A;  2KSA A;  3OE6 A;  1S05 A;  2J4Y A;  4FBZ A;  4G70 B;  3TOL A;  2YCW A;  4JQ6 A;  3HNK A;  3REY A;  5B2N A;  1A7V A;  5ETZ A;  1U19 A;  1EHK B;  4CDY A;  4N4W A;  3UTY A;  1XJI A;  3VW7 A;  1QHJ A;  2I1X A;  3NYA A;  1CGN A;  3EH4 B;  1S53 A;  2CCY A;  3ODU A;  4BWB A;  1GUE A;  1S8J A;  4MBS A;  1H2S A;  2ZIY A;  1KME A;  2Y04 A;  1KG8 A;  2I35 A;  4XT3 A;  4CJG A;  3SN6 R;  2XL8 A;  1YYJ A;  1JFP A;  5H2N A;  1JV7 A;  4N4Y B;  2L6X A;  3VHZ A;  2Y00 A;  1Q5J A;  5A45 A;  5ITC A;  4GP4 B;  2XLM A;  4JEA A;  4MD2 A;  2Z55 A;  4CIP A;  1YYX A;  4HWL A;  1P8U A;  5JJN A;  1IW6 A;  3DE9 A;  1TN0 A;  1X0I 1;  1PY6 A;  3QJQ B;  2EI4 A;  4J4Q A;  3PDS A;  4HYJ A;  4FA7 B;  3C9M A;  3UON A;  4BUO A;  3QJU B;  4BEY A;  5EN0 A;  1S54 A;  2ZZL A;  2PED A;  5B6Y A;  3COC A;  4XT1 A;  1UAZ A;  1BM1 A;  3KJ6 A;  5DYS A;  2QLA A;  1M6T A;  5G53 A;  4AMI A;  1BBH A;  3A7K A;  3RFM A;  5G54 A;  4EA3 A;  3OE8 A;  3VG9 A;  3NY9 A;  4LDE A;  3OE0 A;  1P8I A;  1M0M A;  3QAK A;  4EJ4 A;  3UZC A;  2YCX A;  4N6H A;  5AHY A;  5G36 A;  5H2P A;  3IQ5 A;  1X0S A;  1FBB A;  1CPQ A;  2JAG A;  5H2J A;  5JVE A;  5ITE A;  4X32 A;  1PXR A;  1LN6 A;  4GPO A;  4G7R B;  4LDL A;  2BRD A;  1C8R A;  4IAR A;  4G7S B;  3P0G A;  1M0K A;  4A4M A;  3ZWI A;  3HNL A;  1MQV A;  2XLV A;  2YCY A;  2M3G A;  5B0W A;  2XL6 A;  3QVY A;  1QQ3 A;  4DJH A;  5H2M A;  3M79 A;  1E85 A;  5JSL A;  1E86 A;  1JGJ A;  3NMJ A;  3V2W A;  2JAF A;  3M15 A;  2XM4 A;  4OV0 A;  1X0K 1;  5H2O A;  3UZA A;  3WQJ A;  5AX1 A;  3QW0 A;  2XLO A;  2I21 A;  5H2L A;  2YL0 A;  3X3B A;  3OAX A;  2YLD A;  2BC5 A;  2KSY A;  1JAF A;  3NMI A;  2HPY A;  4JKV A;  3VI0 A;  4JEB A;  4UG2 A;  2G87 A;  5H2K A;  1L9H A;  5DHG A;  3IQ6 A;  2XLH A;  1Q5I A;  3QVZ A;  1KG9 A;  1DZE A;  5AX0 A;  4GRV A;  1R84 A;  1H68 A;  3COD A;  4IB4 A;  3ZEV A;  3EH5 B;  2LNL A;  4XXJ A;  4MQS A;  2YDV A;  3TOM A;  4PXK A;  3QJR B;  5B35 A;  2Y03 A;  5JJJ A;  5AHZ A;  2XLD A;  3NMK A;  3ZPR A;  1P8H A;  4KLY A;  5B6X A;  5C1M A;  5JJE A;  3UTW A;  2J8W A;  1O0A A;  2YL7 A;  4G72 B;  2Z73 A;  3QJT B;  4K5Y A;  3QBL A;  1NBB A;  3EH3 B;  1EKY A;  4GYC A;  1LM3 B;  2YKZ A;  1L0M A;  1S8L A;  4JR8 A;  4L35 A;  1FBK A;  2NTU A;  3QJV B;  2KS9 A;  4Y9H A;  1QKP A;  2XM0 A;  1JV6 A;  5JP7 A;  4WGZ A;  3AYM A;  4HYX A;  4G7Q B;  5AWZ A;  5JRA A;  2R4S A;  2KSB A;  2Y01 A;  4G71 B;  1CPR A;  3D4S A;  1YZA A;  1CGO A;  4CJO A;  3HAP A;  2Y02 A;  2YCZ A;  5G2D A;  1MGY A;  3QDC A;  1BRD A;  5G2C A;  2YLI A;  1VGO A;  4DAJ A;  2WJL A;  5B6Z A;  5F8U A;  3S3C B;  4MQT A;  2YL3 A;  1F88 A;  3BVD B;  5J7A A;  2YLG A;  1IXF A;  3ZQV A;  4X31 A;  5AGF A;  4JE9 A;  4U9D A;  3UTX A;  3ZTZ A;  3S3B B;  5FJG A;  4BV0 A;  2X72 A;  5BR2 A;  3ABW A; 
#chains in the Genus database with same CATH topology
 4QI1 A;  1BRR A;  3U3F A;  1I4Z A;  5EK0 A;  3FHD A;  4XPW A;  3QBK A;  3C8G A;  1D0Y A;  4MVR A;  3G4X A;  4TL3 A;  4JCH A;  2KGO A;  3L34 A;  3ABM C;  3PDM P;  3RYL A;  2R25 A;  3N24 A;  3T6G B;  4CS9 A;  2F95 A;  3WG7 C;  3PQR A;  1TFK B;  2XXA A;  1HE9 A;  2R7T A;  2FFH A;  2R7X A;  3AM6 A;  2YL1 A;  4RD9 A;  3QJS B;  4KNV A;  1LI5 A;  5B6W A;  3T4R A;  4OIN F;  5COG A;  1M2V A;  3H2V A;  3CEX A;  4NTA A;  4NQF A;  3M4C A;  5DQT A;  3ZPQ A;  1LPE A;  1U89 A;  1TQG A;  1QPU A;  5A44 A;  4JTC B;  4NC3 A;  3QBG A;  2ZD9 A;  2DI3 A;  3V5Y A;  1XZP A;  2XLE A;  3S0X A;  3UG9 A;  5A8E A;  3LEO A;  2YEV A;  3EML A;  1LE4 A;  3FOO A;  3NRH A;  5HSW A;  2QUP A;  3ABL C;  1OCZ C;  5A6B D;  3X3C A;  3U9M A;  2QPE B;  2Q00 A;  3GEH A;  2WZG A;  5B1A C;  3RVZ A;  4XTL A;  4DVZ A;  4GYT A;  3S28 A;  4A4A A;  4G0H A;  2FAP B;  4OIQ F;  3AYN A;  3Q6N A;  1V55 C;  2HJ3 A;  4LER A;  3MBG A;  4P6I C;  2YDO A;  1J8M F;  3S8G B;  4XPX A;  2R7Q A;  4DS7 E;  4PXF A;  4XLN F;  2A1D D;  3C63 A;  3NYL A;  1TR2 A;  3POV A;  4GBR A;  3JYH A;  4MVO A;  4OIP F;  5KYW A;  4MW8 A;  2R7S A;  2L6F A;  2GWW A;  1OCC C;  2RSE B;  3W8I A;  5E33 A;  1LE2 A;  3S8F B;  1QKO A;  4C3D A;  2PNO A;  1ZU4 A;  5K0I A;  2YCW A;  1FMW A;  1A7E A;  1U19 A;  3ASO C;  4N4W A;  3UTY A;  1XJI A;  2G3V A;  4MND A;  2WVQ A;  3FXH A;  1CGN A;  3EH4 B;  1D1B A;  3ZVR A;  3O39 A;  4YT2 A;  2NSG A;  2ZIY A;  3DJU B;  2PFD A;  3LLI A;  1KG8 A;  3L8J A;  4O6Y A;  2XL8 A;  1YYJ A;  3NYM A;  2L6X A;  4PJM A;  2Y00 A;  4E17 A;  2XLM A;  4I44 A;  3LAY A;  5KYX B;  5DLJ A;  4E0I A;  1YYX A;  4HWL A;  4CS9 C;  1Z5Z A;  5D91 A;  1V54 C;  1TN0 A;  4U5E E;  2EI4 A;  1OW6 A;  3C9M A;  5L0C A;  3QJU B;  3EGD B;  4P9T A;  4BEY A;  2ZZL A;  2PED A;  5B6Y A;  4XEF A;  4XT1 A;  4DRI B;  1UAZ A;  2QLA A;  3AQC A;  4PJN A;  3NYJ A;  5G54 A;  4EA3 A;  4PFP A;  3OA1 A;  5BUO A;  4LDE A;  4E0H A;  2Q4F A;  2NG1 A;  3U2M A;  4WJ0 A;  1Q0M A;  2J45 A;  4O6N A;  1RXQ A;  1X0S A;  1CPQ A;  3KL4 A;  1ZHZ A;  1LN6 A;  3FAJ A;  4G7Z F;  4CS7 A;  5A6A A;  3GOD A;  2LCH A;  3EGD A;  1T6U A;  4JIO A;  2XLV A;  4OIR F;  1IW7 F;  3RKO F;  1WAS A;  2CGE A;  3QVY A;  4AL0 A;  1JR8 A;  5H2M A;  3ZC4 A;  1KNY A;  3E70 C;  1E85 A;  2JAF A;  4OV0 A;  5H2O A;  3UZA A;  3WQJ A;  2XLO A;  4FAP B;  2HMZ A;  5E3A A;  3OAX A;  2J0X A;  3EPV A;  2BC5 A;  2KSY A;  3M1C B;  3AG4 C;  3NMI A;  4JKV A;  3VI0 A;  2DYS C;  4QI2 A;  1L3P A;  1L9H A;  3FVY A;  5DHG A;  2IYL D;  4JJF A;  5B3S C;  3O10 A;  2KW3 C;  1KG9 A;  3UMI A;  3COD A;  3UR3 C;  3B71 A;  4JCZ A;  3EH5 B;  4ULW A;  4PAC A;  4MQS A;  3EHM A;  3HJC A;  1I4Y A;  4PXK A;  3U5S A;  5AHZ A;  3ZPR A;  1SR2 A;  4NTB A;  3K1H A;  4BJT A;  4KLY A;  3DI5 A;  5C1M A;  4ONS A;  3UTW A;  3A9C A;  3GOR A;  2OOC A;  2OU6 A;  3EH2 A;  3FDQ A;  4MVQ A;  3EZH A;  4DBR A;  2YKZ A;  4MTO A;  4JRZ A;  1FBK A;  3QJV B;  1MNE A;  4Y9H A;  1QKP A;  5BQI A;  5JP7 A;  4WGZ A;  5CI8 A;  1T5O A;  1PD1 A;  1K40 A;  3ABK C;  2R4S A;  1YZA A;  1KU2 A;  1FMV A;  2YHS A;  2ICW G;  1MGY A;  3QDC A;  2WVO A;  2GDC A;  3MLG A;  1VGO A;  4DAJ A;  3FMS A;  1I5N A;  1LI7 A;  3L8I A;  4KBL A;  2BL2 A;  4MTF A;  2YLG A;  3MYF A;  1YAU O;  1IXF A;  4F4B A;  3ZQV A;  1PV3 A;  4C7O B;  1YJG A;  3SZR A;  4JE9 A;  4U9D A;  3N2Z B;  4YT5 A;  2W4M A;  4BV0 A;  2EIK C;  1T6I A;  3NKE A;  3JZ0 A;  1E83 A;  4AMJ A;  2R05 A;  1LS4 A;  3DE8 A;  3B0V C;  2R7U A;  1HMO A;  2C04 A;  1CGM E;  1F50 A;  5AZD A;  4E18 A;  4W8P A;  256B A;  2W45 A;  3U2L A;  2VT4 A;  2WJK A;  1LS1 A;  2JD3 A;  2LK4 A;  2OEX A;  5H2H A;  3GM1 A;  3V2Y A;  3DXJ F;  2GA0 A;  3KYJ A;  1CWQ A;  2J0W A;  1NZE A;  3ZDL A;  1UFB A;  1GU8 A;  3AG3 C;  1C8S A;  4C7O A;  5B6V A;  2A6H F;  4DBQ A;  4PK4 A;  2LQG A;  1ZW3 A;  3HTK C;  2EPN A;  4UDV A;  3C62 A;  3S29 A;  3S27 A;  4PR9 A;  1OCR C;  1C02 A;  5JS5 A;  2V26 A;  3E9V A;  1XIO A;  5JLI A;  1QLE C;  4DKL A;  3L1M A;  2DB4 A;  5COF A;  2HUJ A;  3GEE A;  2J7P D;  2J9V A;  5KYU B;  4G78 A;  1MND A;  1A41 A;  2IBF A;  2IXN A;  5EHH A;  1W2W A;  1NU9 C;  4MVU A;  2C03 A;  2BE5 F;  3VGA A;  5JT4 A;  2UUH A;  3HAN A;  3W2W A;  4CDV A;  2M4E A;  5G28 A;  4XTN A;  3JCU Q;  3VVK A;  4WGY A;  4OD4 A;  1NLX A;  5DS6 A;  2UUI A;  4O6M A;  5IY5 C;  5KKH A;  2H7B A;  2Q9C A;  2NTW A;  5H2I A;  4IWB A;  1TWA A;  1SMY F;  2LSE A;  1BRX A;  1ORS C;  3R2P A;  4U5G A;  3WAQ A;  1OKK A;  2TMV P;  1S52 A;  5KYU A;  1QSP A;  4YL3 A;  3U9J A;  3B9Q A;  4Z9J A;  3U8P A;  2R4R A;  2HS5 A;  3QAP A;  2PF4 E;  1V74 B;  2YRF A;  3UGP A;  4E7Z A;  1R2N A;  1MMD A;  1IZM A;  1AP9 A;  1WWP A;  1HZX A;  2KSA A;  3OE6 A;  4CSA A;  1S05 A;  4DXW A;  4JQ6 A;  3AQB A;  4I1O B;  3REY A;  4YL0 A;  1A7V A;  3W2V A;  4Q4Z F;  3KKB A;  4CDY A;  2LIG A;  2H7V C;  4XWJ A;  2I1X A;  5COM A;  2CCY A;  1A0B A;  3HLZ A;  2XS1 A;  3JT1 A;  3OWT A;  1KME A;  2YZS A;  2I35 A;  4HEA J;  3GWL A;  1Z6A A;  2Q9B A;  2QY9 A;  3VHZ A;  4BJ6 C;  4AX2 A;  3TD7 A;  4GP4 B;  1RKC A;  4MD2 A;  1WTY A;  2Z55 A;  3ZSU A;  2KK1 A;  4B6I A;  2R7O A;  4BJ1 A;  5A6J A;  1A7D A;  2R7W A;  1IW6 A;  1VK5 A;  3DE9 A;  1D0X A;  4HYJ A;  3ZG1 A;  3X1O A;  4BUO A;  4CS8 C;  1Q0F A;  4YWQ A;  3RW0 A;  1ZW2 A;  4H54 A;  2RD9 A;  4QI0 A;  5DYS A;  1BBH A;  2I8B A;  3RFM A;  4C3B A;  1HY5 A;  3CQZ A;  3OE8 A;  3VG9 A;  1ST6 A;  1O5H A;  2L7A A;  2LFD A;  1P8I A;  3X2Q C;  4I1M A;  3TK0 A;  4EWC A;  4N6H A;  2OKU A;  5KYY B;  5G36 A;  4U5B E;  4XLP F;  3B29 A;  1SZI A;  2IXO A;  4KC9 A;  3SP1 A;  1VOM A;  4U5F E;  1QZX A;  3DM9 B;  4BJ5 A;  3Q7G A;  2BRD A;  4YK5 A;  2AU5 A;  2L81 A;  4H4K C;  4BPM A;  4CIH A;  4A4M A;  3ZWI A;  3HNL A;  5GPG B;  2KNH A;  1MQV A;  1Z7Q c;  1ZYR F;  5D92 A;  2MWQ A;  1G4W R;  3BRJ A;  2Q3T A;  4YT4 A;  3VM6 A;  3JRT A;  3M79 A;  2Y39 A;  3AGT A;  4IRU A;  5JSL A;  5BQG A;  3V2W A;  3M15 A;  3O55 A;  2CYD A;  1PD0 A;  3QW0 A;  1VYI A;  2DYR C;  2I21 A;  1SYQ A;  3WHN A;  2YL0 A;  3GEI A;  2YLD A;  2P0N A;  2VH3 A;  3N0T A;  1ZVZ A;  3UMH A;  2R7R A;  2IXM A;  4RDA A;  1MMG A;  2CDQ A;  3JSE O;  3LJB A;  1Q5I A;  1XZQ A;  1JPN A;  4GRV A;  2NPU A;  1H68 A;  3H65 A;  4IB4 A;  4ANJ A;  1G8X A;  1NFN A;  3TOM A;  3QJR B;  2ASR A;  4CSA C;  1YVI A;  2YVK A;  1RMV A;  1U0B B;  2YL7 A;  4EBJ A;  4GQH A;  3IQC A;  2Z73 A;  3QBL A;  1NBB A;  3VF0 A;  3EH3 B;  1OW7 A;  1L0M A;  4EBK A;  3RF3 A;  1NFO A;  4W8K A;  1JV6 A;  2EPO A;  2EPM X;  4HYX A;  5JRA A;  4G71 B;  3D4S A;  2A0U A;  2KQ9 A;  2ZPA A;  5G2D A;  3F46 A;  1ZHT A;  1BRD A;  3O6X A;  2IM8 A;  2Y3B A;  2W9Y A;  3QZC A;  2WJL A;  5B6Z A;  2AWC A;  2JPU A;  3W8H A;  3DM5 A;  4MQT A;  2E87 A;  1F88 A;  3BVD B;  5J7A A;  5KYX A;  4K7B A;  3C18 A;  4E7S A;  1VMA A;  3UTX A;  5F5F A;  3LNR A;  3ZTZ A;  4MTG A;  5FJG A;  2X72 A;  1D1C A;  3PBL A;  4YL1 A;  1XWJ A;  4GP5 B;  3PXO A;  3MYI A;  4G7O F;  3DDL A;  2VCB A;  1Y6D A;  4MD1 A;  4XEK A;  4BEZ A;  1F1M A;  4FAA B;  3G50 A;  4EIY A;  5B34 A;  5T3W A;  2WVN A;  1OQC A;  1VJM A;  2F93 A;  5L3V A;  3HAS A;  4GP8 B;  4P9F A;  1RJ9 B;  4A2N B;  2RH1 A;  1TKN A;  5FZT A;  2J9B A;  4G7H F;  1KGB A;  1KTM A;  3S9O A;  4KNF A;  3C8G D;  3F47 A;  5A6B A;  3MBV A;  3EHN A;  4EBB A;  4LDO A;  2XS8 A;  2DGJ A;  1F4Z A;  3HAQ A;  4PFO A;  3SXY A;  1ZZP A;  4C3E A;  2KSF A;  4IAQ A;  2NUT B;  4Q5S F;  1D0Z A;  2A69 F;  1Q0K A;  3C8Z A;  4QID A;  4IJJ A;  4M63 A;  1Q0G A;  2ZXO A;  5DHH A;  2GFH A;  2V3C C;  4DOZ A;  4HFF B;  4AL1 A;  5FCL A;  1HMD A;  1R4T A;  3LUT B;  1AT9 A;  3ZIB A;  3SXZ A;  2MYS A;  3HNJ A;  1HE1 A;  3UGO A;  1VLS A;  3V7O A;  3HKK A;  1V4A A;  2AVK A;  3MX3 A;  4J30 B;  1E84 A;  2ZFE A;  5TGZ A;  4MS2 A;  4I3M A;  5A69 A;  3FOP A;  3M4B A;  3ZTM A;  3NSB A;  5G2A A;  2HV6 A;  5DS4 A;  2KYH A;  1RCP A;  5B3I A;  5T1D B;  1ZHW A;  1WAT A;  1T6Q A;  2WB7 A;  3SXK A;  1NU7 D;  1PXS A;  3RIP A;  2GAQ A;  2H7O A;  2HMQ A;  2ETS A;  1E12 A;  2QPD B;  4U9E A;  3I5Q A;  4JVS A;  4BVN A;  1C3W A;  1ZHY A;  5DS5 A;  3K7D A;  4X1H A;  3HAR A;  4FX5 A;  2AP3 A;  4XPY A;  4ULV A;  1ORY A;  4XEV A;  1QM8 A;  1YDI A;  2EIM C;  1WGW A;  1JPJ A;  3TQO A;  3AJM A;  2J4Y A;  3C7J A;  4KI2 A;  5B2N A;  5ETZ A;  1BDJ B;  2IOQ A;  1TWH A;  2KJG A;  1QHJ A;  4AE4 B;  2VAS A;  1S53 A;  3ODU A;  5CIV A;  4BWB A;  1GUE A;  1S8J A;  4MBS A;  2OJQ A;  4IAO A;  3EFO B;  1UG7 A;  3SN6 R;  2X0C A;  1JV7 A;  4N4Y B;  4YT8 A;  4OD5 A;  4NTF A;  2P1A A;  1Q5J A;  2J9W A;  1OXB A;  5ITC A;  4JEA A;  4QDL A;  3TUL A;  4FES A;  3G4Z A;  2L6G A;  1G4U S;  1M57 C;  3GWN A;  3IEE A;  2AWY A;  4AK9 A;  1TWG A;  3T6J A;  2WZF A;  3PDS A;  2ZXP A;  5EN0 A;  1S54 A;  3COC A;  1YA7 O;  2VCC A;  4LDR A;  1M6T A;  1WOL A;  3MFN A;  4AMI A;  2F22 A;  3A7K A;  3EFO A;  3JYY A;  2ZXR A;  3NY9 A;  3OE0 A;  2CNW A;  2M64 A;  1M0M A;  2WL8 A;  3L0I A;  4CBE A;  3QAK A;  2VCA A;  3UZC A;  5TJ5 E;  5DVW A;  2YCX A;  1OR2 A;  2HSQ A;  5L0J A;  5AHY A;  2XXA B;  1RKE B;  3IQ5 A;  2LP4 A;  4MVZ A;  5H2J A;  1EA8 A;  4GEH A;  4X32 A;  5L0G A;  2Q7R A;  1QKR A;  4GPO A;  4G7R B;  5KYN A;  1O87 A;  4LDL A;  3IQT A;  1M0K A;  1OXK A;  2YCY A;  2M3G A;  4LAC B;  3GM2 A;  1GM5 A;  1QQ3 A;  3TJ6 A;  4ZLC A;  1E86 A;  3NMJ A;  2IXP A;  2XM4 A;  4Z9I A;  3NG1 A;  2J46 A;  3KPH A;  3SYN A;  1JAF A;  3V5Z A;  2HPY A;  3KH2 A;  1ZU5 A;  2WZL A;  5H2K A;  1RKE A;  3IQ6 A;  1GGQ A;  2XLH A;  4EHP A;  3QVZ A;  3KMI A;  1DZE A;  3T9O A;  1T9K A;  1HW1 A;  5EGY A;  2Y69 C;  2Y3H A;  4X0R A;  3RVY A;  4MQ9 F;  4O7G A;  5B35 A;  2X51 A;  1P8H A;  5JJE A;  2J8W A;  4JZA A;  1O0A A;  4G72 B;  2D4U A;  3TJ5 A;  4GYC A;  4R32 A;  1LM3 B;  3SNH A;  1K04 A;  1S8L A;  4JR8 A;  3FAP B;  2KS9 A;  2G62 A;  2OJE D;  3Q6M A;  1OR3 A;  5KYW B;  2QE9 A;  3AYM A;  2Z15 A;  2KSB A;  2Y01 A;  2Y3G A;  1AEP A;  3ITF A;  4KNW A;  4CJO A;  1Z63 A;  4HFK B;  4LLC A;  3V5X A;  2J9U A;  3ATP A;  4JJG A;  1MMN A;  1T01 A;  1B68 A;  4DVY P;  5AGF A;  5AC4 A;  2R02 A;  3S3B B;  1BR2 A;  1AUE A;  2XSE A;  2HZ8 A;  1TFO B;  2XL6 A;  4DRH B;  5BR2 A;  4NY3 A;  2OCC C;  1E2X A;  2P6V A;  1SF8 A;  1EI7 A;  3SXM A;  3CSK A;  1IW9 A;  3UMK A;  3RZE A;  4FWV A;  4NCQ A;  4JW1 A;  1LVK A;  2I20 A;  4LLE A;  1VB5 A;  2OEV A;  4FPD A;  5JUA A;  4WAV A;  3OEO A;  3EG9 B;  2AT9 A;  1XME B;  2YQY A;  3PWH A;  2HFI A;  1DOW A;  2W4B A;  3PHF 2;  4JTD B;  5LWE A;  4D4X A;  1ORJ A;  1O3U A;  1FNT c;  5KYY A;  1GQA A;  4D4N A;  2J7P A;  3DWW A;  3QMK A;  2EIN C;  4J7T A;  4K1O A;  2VB6 A;  4HE8 D;  4L6R A;  4DJ9 A;  3HNI A;  5L0F A;  2A0B A;  3IPM O;  2EPK X;  2JX0 A;  3I4U A;  3DMD A;  3A11 A;  5F5H A;  3EZI A;  3NKD A;  3C9L A;  1OW8 A;  4MW3 A;  1MMA A;  3W4Y A;  2PP4 A;  3QW1 A;  1EQ1 A;  3ZQY A;  1JOG A;  3EJN A;  3KYI A;  4XQ1 A;  5F28 E;  3EG9 A;  2QTV A;  1YZC A;  1C17 M;  4CDA A;  2PBE A;  4WW3 A;  2XLW A;  4U5D E;  1BZ4 A;  1TN5 A;  3SEO A;  1R5I D;  3DAF A;  1H9T A;  5BR5 A;  3NS0 A;  4RBN A;  2PX0 A;  1S51 A;  3HAO A;  3CAX A;  3DD7 A;  1H6G A;  3OE9 A;  1UCQ A;  1Q0D A;  4ER9 A;  4XTO A;  3IHU A;  1BR4 A;  1VYK A;  1NG1 A;  3JSZ A;  3U8V A;  1E0P A;  3VRC A;  1APC A;  3QBI A;  1J8Y F;  3UTV A;  3LS0 A;  4CX9 A;  3EGX B;  1M0L A;  4U5H A;  1TWC A;  1H7I A;  1Z23 A;  1M56 C;  2Y3D A;  3CAP A;  2LD6 A;  4QRY A;  3DQB A;  3NY8 A;  5E3C A;  3AG2 C;  4LDK A;  1GZM A;  1Z3I X;  1U6H A;  4JUR I;  3RQE A;  2XRH A;  5L0D A;  4UHR A;  3K1I A;  3T45 A;  3S3D B;  3DAG A;  2FGY A;  4JTA B;  2MHR A;  2CNW D;  4FBZ A;  4G70 B;  3TOL A;  3HNK A;  2H8A A;  5L0I A;  3GM3 A;  2G3K A;  1EHK B;  1GS9 A;  4Z9H A;  3LES A;  3S90 A;  3VW7 A;  3K66 A;  1OKK D;  1VLT A;  3K6B A;  1FTS A;  3NYA A;  3EGX A;  4O79 A;  4BJ5 C;  4U5C E;  1H2S A;  2YWA A;  4YN0 B;  3PMR A;  2Y04 A;  4EUK B;  4XT3 A;  4CJG A;  3Q7L A;  1JFP A;  5H2N A;  1S7Z A;  2R03 A;  1H9G A;  2B0H A;  2R9R B;  4PJL A;  5A45 A;  3S84 A;  1YAR O;  3RFY A;  3JTL O;  3K33 A;  4ZLD A;  4CIP A;  4OIO F;  1P8U A;  5JJN A;  2L9J A;  3DJN B;  1AVO B;  5DQZ A;  2HJM A;  1X0I 1;  1PY6 A;  3QJQ B;  4J4Q A;  1FR0 A;  2HSB A;  1RJ9 A;  3AOU A;  1HW2 A;  2L6H A;  4FA7 B;  3UON A;  1C03 A;  1NSG B;  1JRA A;  3GAN A;  3WOD F;  1L7C A;  1D1A A;  2OQM A;  3AG1 C;  2ZXW C;  1BM1 A;  3KJ6 A;  5G53 A;  5BQH A;  1K05 A;  3BEH A;  3UNG C;  5B1B C;  3J06 A;  1ZHX A;  1M2O A;  2D5R B;  1FAP B;  3ECS A;  4EJ4 A;  2XL4 A;  2NUT A;  1G5Z A;  5L3Q A;  5H2P A;  1FBB A;  5T3T A;  2JAG A;  1FFH A;  5JVE A;  5ITE A;  3EQL F;  1PXR A;  4N6C A;  2NUP B;  3JRM O;  1C8R A;  4IAR A;  4G7S B;  3P0G A;  4EKW A;  3U0C A;  2EPL X;  3NDB B;  4N06 A;  3T6B A;  5B0W A;  3B0U X;  3DZA A;  4Q7C A;  4DJH A;  2VC9 A;  5HV9 A;  1JMW A;  2HV7 A;  4BJ6 A;  1N1C A;  1JGJ A;  5E2Q A;  1X0K 1;  4BEJ A;  1LKX A;  2EIL C;  5AX1 A;  2P61 A;  5H2L A;  2A68 F;  1DOV A;  3X3B A;  4WAB A;  1WN0 A;  4DRJ B;  4BG0 A;  1OCO C;  2O9X A;  4MVS A;  2NSF A;  2OG2 A;  4JEB A;  3RQG A;  4UG2 A;  2G87 A;  4XTK A;  2EIJ C;  3RQF A;  3R7C A;  1YLM A;  2KC3 A;  4CS8 A;  5AX0 A;  1R84 A;  3VYW A;  2A6E F;  3ZEV A;  3EH1 A;  2LNL A;  4XXJ A;  3PCV A;  1LIH A;  2NUP A;  3DKA A;  4K0D A;  2YDV A;  3K1I C;  1QVX A;  3B0P A;  3VAY A;  2Y03 A;  5JJJ A;  2XLD A;  3NMK A;  3H2U A;  3QTH A;  2B0J A;  4YJW A;  5B6X A;  5A6K A;  5CI9 A;  2I15 A;  2QNL A;  2Q9A A;  2PX3 A;  4J32 B;  3I5P A;  4J7Y A;  3QJT B;  4K5Y A;  1EKY A;  3U3B A;  4AE4 A;  5AC5 A;  4L35 A;  4JC7 A;  2NTU A;  4MVM A;  3LS1 A;  3C8G B;  2XM0 A;  2LFF A;  4G7Q B;  5AWZ A;  5L0H A;  1CPR A;  2R7V A;  1FFT C;  2P7V A;  1CGO A;  3LLK A;  4BEM J;  3HAP A;  2Y02 A;  2YCZ A;  5G2C A;  2YLI A;  3AGU A;  3US6 A;  5F8U A;  3S3C B;  3LEV A;  2YL3 A;  1VTM P;  3CZ6 A;  1PCX A;  2CW0 F;  3RH3 A;  4X31 A;  1Y4C A;  1YA9 A;  2HKV A;  4LDQ A;  1M2V B;  4PJJ A;  3ASN C;  4IGG A;  3ABW A;  3LNM B;  1BR1 A; 
#chains in the Genus database with same CATH homology
 4QI1 A;  1E83 A;  4AMJ A;  3PBL A;  1BRR A;  3DE8 A;  1IW9 A;  3RZE A;  3QBK A;  1F50 A;  5AZD A;  4GP5 B;  3PXO A;  2I20 A;  256B A;  3DDL A;  4FPD A;  5JUA A;  4TL3 A;  4WAV A;  2VT4 A;  2WJK A;  4MD1 A;  4BEZ A;  2AT9 A;  1XME B;  3PWH A;  4FAA B;  4EIY A;  5B34 A;  5LWE A;  5H2H A;  4D4X A;  2F95 A;  1VJM A;  2F93 A;  3PQR A;  3HAS A;  4GP8 B;  3V2Y A;  1GQA A;  3AM6 A;  1CWQ A;  4D4N A;  2RH1 A;  2YL1 A;  3QJS B;  1GU8 A;  1C8S A;  2J9B A;  5B6W A;  5B6V A;  1KGB A;  4L6R A;  4KNF A;  3HNI A;  3MBV A;  3C62 A;  3M4C A;  4LDO A;  3ZPQ A;  5JS5 A;  3C9L A;  1F4Z A;  3HAQ A;  1QPU A;  5A44 A;  1XIO A;  4NC3 A;  3QW1 A;  3QBG A;  3ZQY A;  4IAQ A;  5JLI A;  4DKL A;  2XLE A;  3UG9 A;  5A8E A;  3L1M A;  3EML A;  4QID A;  5DHH A;  1YZC A;  3FOO A;  4CDA A;  4WW3 A;  2XLW A;  1TN5 A;  3X3C A;  5BR5 A;  3NS0 A;  1AT9 A;  3VGA A;  5JT4 A;  2QPE B;  1S51 A;  3HNJ A;  3HAN A;  3HAO A;  4XTL A;  4CDV A;  3OE9 A;  5G28 A;  4XTN A;  1UCQ A;  3VVK A;  1E84 A;  4ER9 A;  2ZFE A;  4XTO A;  4WGY A;  5TGZ A;  3AYN A;  3FOP A;  3M4B A;  3ZTM A;  3NSB A;  5KKH A;  5G2A A;  1RCP A;  1E0P A;  3VRC A;  5B3I A;  1APC A;  3QBI A;  3UTV A;  2NTW A;  4CX9 A;  1M0L A;  5H2I A;  2YDO A;  3S8G B;  3CAP A;  4DS7 E;  1BRX A;  4PXF A;  1PXS A;  3C63 A;  1E12 A;  4QRY A;  3DQB A;  2QPD B;  4U9E A;  1S52 A;  3NY8 A;  4BVN A;  1C3W A;  4GBR A;  4X1H A;  3HAR A;  3U8P A;  1GZM A;  2R4R A;  3QAP A;  1R2N A;  4UHR A;  4ULV A;  1AP9 A;  1QM8 A;  3T45 A;  3S8F B;  3S3D B;  1HZX A;  1QKO A;  2KSA A;  3OE6 A;  1S05 A;  2J4Y A;  4FBZ A;  4G70 B;  3TOL A;  2YCW A;  4JQ6 A;  3HNK A;  3REY A;  5B2N A;  1A7V A;  5ETZ A;  1U19 A;  1EHK B;  4CDY A;  4N4W A;  3UTY A;  1XJI A;  3VW7 A;  1QHJ A;  2I1X A;  3NYA A;  1CGN A;  3EH4 B;  1S53 A;  2CCY A;  3ODU A;  4BWB A;  1GUE A;  1S8J A;  4MBS A;  1H2S A;  2ZIY A;  1KME A;  2Y04 A;  1KG8 A;  2I35 A;  4XT3 A;  4CJG A;  3SN6 R;  2XL8 A;  1YYJ A;  1JFP A;  5H2N A;  1JV7 A;  4N4Y B;  2L6X A;  3VHZ A;  2Y00 A;  1Q5J A;  5A45 A;  5ITC A;  4GP4 B;  2XLM A;  4JEA A;  4MD2 A;  2Z55 A;  4CIP A;  1YYX A;  4HWL A;  1P8U A;  5JJN A;  1IW6 A;  3DE9 A;  1TN0 A;  1X0I 1;  1PY6 A;  3QJQ B;  2EI4 A;  4J4Q A;  3PDS A;  4HYJ A;  4FA7 B;  3C9M A;  3UON A;  4BUO A;  3QJU B;  4BEY A;  5EN0 A;  1S54 A;  2ZZL A;  2PED A;  5B6Y A;  3COC A;  4XT1 A;  1UAZ A;  1BM1 A;  3KJ6 A;  5DYS A;  2QLA A;  1M6T A;  5G53 A;  4AMI A;  1BBH A;  3A7K A;  3RFM A;  5G54 A;  4EA3 A;  3OE8 A;  3VG9 A;  3NY9 A;  4LDE A;  3OE0 A;  1P8I A;  1M0M A;  3QAK A;  4EJ4 A;  3UZC A;  2YCX A;  4N6H A;  5AHY A;  5G36 A;  5H2P A;  3IQ5 A;  1X0S A;  1FBB A;  1CPQ A;  2JAG A;  5H2J A;  5JVE A;  5ITE A;  4X32 A;  1PXR A;  1LN6 A;  4GPO A;  4G7R B;  4LDL A;  2BRD A;  1C8R A;  4IAR A;  4G7S B;  3P0G A;  1M0K A;  4A4M A;  3ZWI A;  3HNL A;  1MQV A;  2XLV A;  2YCY A;  2M3G A;  5B0W A;  2XL6 A;  3QVY A;  1QQ3 A;  4DJH A;  5H2M A;  3M79 A;  1E85 A;  5JSL A;  1E86 A;  1JGJ A;  3NMJ A;  3V2W A;  2JAF A;  3M15 A;  2XM4 A;  4OV0 A;  1X0K 1;  5H2O A;  3UZA A;  3WQJ A;  5AX1 A;  3QW0 A;  2XLO A;  2I21 A;  5H2L A;  2YL0 A;  3X3B A;  3OAX A;  2YLD A;  2BC5 A;  2KSY A;  1JAF A;  3NMI A;  2HPY A;  4JKV A;  3VI0 A;  4JEB A;  4UG2 A;  2G87 A;  5H2K A;  1L9H A;  5DHG A;  3IQ6 A;  2XLH A;  1Q5I A;  3QVZ A;  1KG9 A;  1DZE A;  5AX0 A;  4GRV A;  1R84 A;  1H68 A;  3COD A;  4IB4 A;  3ZEV A;  3EH5 B;  2LNL A;  4XXJ A;  4MQS A;  2YDV A;  3TOM A;  4PXK A;  3QJR B;  5B35 A;  2Y03 A;  5JJJ A;  5AHZ A;  2XLD A;  3NMK A;  3ZPR A;  1P8H A;  4KLY A;  5B6X A;  5C1M A;  5JJE A;  3UTW A;  2J8W A;  1O0A A;  2YL7 A;  4G72 B;  2Z73 A;  3QJT B;  4K5Y A;  3QBL A;  1NBB A;  3EH3 B;  1EKY A;  4GYC A;  1LM3 B;  2YKZ A;  1L0M A;  1S8L A;  4JR8 A;  4L35 A;  1FBK A;  2NTU A;  3QJV B;  2KS9 A;  4Y9H A;  1QKP A;  2XM0 A;  1JV6 A;  5JP7 A;  4WGZ A;  3AYM A;  4HYX A;  4G7Q B;  5AWZ A;  5JRA A;  2R4S A;  2KSB A;  2Y01 A;  4G71 B;  1CPR A;  3D4S A;  1YZA A;  1CGO A;  4CJO A;  3HAP A;  2Y02 A;  2YCZ A;  5G2D A;  1MGY A;  3QDC A;  1BRD A;  5G2C A;  2YLI A;  1VGO A;  4DAJ A;  2WJL A;  5B6Z A;  5F8U A;  3S3C B;  4MQT A;  2YL3 A;  1F88 A;  3BVD B;  5J7A A;  2YLG A;  1IXF A;  3ZQV A;  4X31 A;  5AGF A;  4JE9 A;  4U9D A;  3UTX A;  3ZTZ A;  3S3B B;  5FJG A;  4BV0 A;  2X72 A;  5BR2 A;  3ABW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...