1A2XA

Complex of troponin c with a 47 residue (1-47) fragment of troponin i
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
DQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (skeletal muscle/muscle protein)
molecule keywords TROPONIN C
publication title Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 43
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 1998-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1a2xA00
4NQGA 2MJWB 2JXCA 4AQJA 2L50A 1LKJA 1M63B 2KI6C 4U8DA 1F55A 1LA3A 3WHTB 1MXLC 4PE4A 1V1FA 2EC6B 2Y4QA 4MRXA 1YRUB 3AAJA 1ALWA 1YR5A 2FJUB 2HPSA 2VRGA 3JVTC 4I5NB 1DTLA 3WXAA 2KQ6A 1G4YR 3SJSA 1QX7A 2ZRTA 1TCOB 1GJYA 1R6PA 4MVFA 1V1GA 1S5GY 3OB2B 2LP2A 5AERA 1EXRA 2BCBA 2WC8A 3DF0B 1LXFC 2JWWA 2JTZA 2KFFA 1ALVA 1KSMA 3CR5X 3I5IC 2NCOA 1E8AA 1F4QA 2JRFA 2MHHA 1SKTA 2JPTA 2KAVA 2LMTA 2BECA 3VRRA 1SL7A 3EK8A 2BE6A 2EC6C 1H4BA 2LANA 4Q04A 1OMVA 2FCEA 5BPJA 2MLEC 4GNKB 3CS1A 2MAZA 2ZNDA 3ZWHA 2M97A 4NDCA 2M1KB 1DMOA 1QV1A 1F70A 4YGDB 3TDUA 1QLKA 5AEQA 1JFKA 2CT9A 1OMRA 2PMYA 2M29A 5KTYA 4YGBB 1SYMA 1CB1A 2LLTA 1AJ4A 2BE4A 3CR2A 3PALA 1TTXA 1B47A 2JZIA 1JF0A 2BL0B 1CFCA 5B8IB 1LVCD 1TNXA 1IWQA 1KQMB 1DGUA 3CWGA 3BUWB 1K95A 5GQQC 5I2OA 1TNPA 1K2HA 2BBNA 2L2EA 2LLUA 1KFUS 1M31A 1Y0VH 1BT6A 2Y5IA 1PRWA 2WCEA 3PN7C 2O5GA 1KFXS 4PALA 1QIVA 3E3RA 2LCPA 2LVJA 1SW8A 2BKIB 1MWNA 2L4IA 4GAOA 1J1DA 2BL0C 1YX8A 1SCMB 2K8MB 1XFUO 2MRDA 1CNPA 5DKRA 1XK4A 1W7IB 5J3XA 1KQMC 4OR9B 2H2KA 5IBWA 4NDBA 4YGCB 1B9AA 1AK8A 1OZSA 1U5IB 1A03A 3O4YA 1FPWA 2KAYA 1Q80A 2I18A 3HCMA 1H8BA 2TN4A 1A75B 2LNKA 1CFPA 2A4JA 1CFFA 5TNCA 1EL4A 4HREE 1B8CA 4PCWA 3SG4A 2PSRA 1BJFA 1AHRA 2Y1NA 1NCZA 2ZRSA 1UHHA 1A2XA 1GGZA 2K61A 4WQ3A 2NLNA 3BUOB 1TOPA 2FCDA 1QVIZ 4M2QA 1TCFA 3QRXA 4I5JA 4MZLA 1KCYA 2SASA 3EVUA 2AMIA 2HQ8A 3NSKA 3SG6A 4N5XA 1YURA 3EVVA 1MHOA 4PHMA 1DJZA 4I5LB 2LMVA 1UHIA 4UPGA 1EG4A 3LLEA 2E6WA 2Q91A 5D7FA 2LVKA 2MBXA 3TS5B 1SK6D 1N2DA 1F71A 2QACA 3IQQA 1B8LA 1UURA 2JNXA 1RJVA 2M9GA 1CFDA 1NPQA 4MLWA 4GUKA 1TIZA 1KQVA 2L4HA 1EG3A 1NX3A 2KI4B 1IQ3A 1BOCA 1NWDA 3VRNA 2G2BA 1NX0A 1OZOA 2KOTA 1PULA 4OVNF 2O60A 1K93D 3TS5C 4ICBA 2ZKMX 5I2LA 1RECA 2F2PA 1ZACA 1DGVA 3A4UB 3PSRA 3FWBA 3EK4A 2M1UA 5HKYA 3I5GB 1CLMA 2Y1MA 4WRIA 1OE9B 2K2FA 2P6BB 4ORBB 1J7OA 4TNCA 3JTDB 4ORAB 3SG2A 1SL8A 1B8RA 1B7TZ 2KI4C 1JWDA 2BCXA 2PASA 3CR4X 1AUIB 1XVJA 1TN4A 2MA2A 5ER4X 1OSAA 1WDCC 1Y6WA 3BXKA 1FI5A 1OMDA 2F33A 2KDHA 2LUXA 1BG1A 1DJIA 2KGBC 1KFXL 1NP8A 4ORCB 1CMGA 1IGVA 4XYNA 3I5GC 2BBMA 3PATA 2COLB 1DJGA 4D1EA 2KYFA 2PRUA 2BKHB 2M7LA 2L98A 1K94A 3LK0A 4NDDA 1NIWA 1CKKA 5HLVA 4AQIA 2ZNEA 2KGRA 3KF9A 4GBAA 2BCAA 3OB1B 1WLZA 1ZMZA 2K7OA 1NCXA 1YTZC 2LV7A 4P5OE 1VRKA 1IKUA 1S6JA 1M45A 2KAXA 1L2OB 5KSZA 3PLFB 2CBLA 2OPOA 1QATA 1WRLA 2LE9B 3FS7A 1K9PA 1RROA 1YX7A 3KEVA 2F3ZA 3NXAA 2JULA 1XFVO 1A29A 1DF0A 3LL8B 3C1VA 3RM1A 2M7NA 4MBEA 1FBVA 2NXQA 4DCKA 4A4CA 1BF5A 1KWOB 1PVAA 3SG5A 3D0YA 2OS8B 5FYXA 3SG7A 1LA0A 1DJHA 3VRQA 3EK7A 1F8HA 1QLSA 1AVSA 1XK4C 2LMUA 1IG5A 4MZJA 2LHIA 4ZCUA 3GOFA 2KFHA 2M3WA 3KO0A 2K0JA 2JQ6A 3NSOA 4CLNA 1JUOA 2K7DA 5HYDA 1QVIY 3DD4A 2GV5A 3EVRA 1Y1UA 1ZUZA 1RK9A 3BUXB 4XJKA 1QJTA 2R2IA 5DKQA 4CFRA 4CIDA 1JF2A 2KBIA 1K90D 1QASA 2AUCA 2OS8C 2CNPA 1QX2A 4P2YB 4FTGA 3EKJA 4GFTA 3PM8A 2WCBA 2Q4UA 4YI9A 1C7WA 3TDZA 2ZN8A 2CXJA 1PSRA 2JC2A 3DVMA 4HRGA 2E30A 1UHNA 2V53A 3PFVA 3AKAA 3EKHA 3ICBA 3CZTX 1QTXA 1KK7Z 1SCMC 4MN0A 4USLA 4MRYA 4DIRA 4QJ3B 1EH2A 5HLOA 5CSFA 1NSHA 2KNEA 4OCIA 5K89A 2G9BA 1C07A 2KBMA 4N1GA 2WOSA 1QX5B 2HQWA 4QJ4B 2OTGB 3HX4A 1NYAA 2WORA 1F4OA 2PVBA 3TUYB 3WHUB 5AXIA 2H61C 2LHLA 4OKHA 5HKWA 1OOJA 1DJWA 1PALA 1JSAA 4I5KA 4DUQA 4GGFA 1N65A 1XYDA 1B7TY 1WRZA 4YI8A 3H4SE 4JPZB 2JXLA 3BOWA 5ER5A 4BY4A 1EJ3A 2OTGC 4E68A 2L51A 1FI6A 1CM1A 1WRKA 3SIBA 1ZOTB 2KYCA 1N0YA 1S36A 4M2PA 4PHKA 4CFQA 1W7JB 1B1GA 3TZ1A 3O2PA 3O6BA 3OX6A 3BYAA 1S6CA 3WNXB 1KK8B 1UHJA 1F54A 1BU3A 1ODBA 2ZN9A 1M46A 2F2OA 4PE7A 1MQ1A 3RLZA 1DT7B 4YGAA 1KFUL 4HSZA 1CDMA 1J1EA 1DVIA 3BUMB 3CGAA 1DF0B 1TRFA 2GGZA 3NSIA 5I2QA 1FF1A 2NCPA 3F45A 4L9MA 3NSLA 1CTRA 1SY9A 3MSEB 1KK8C 1MXEA 2GGMA 1J7QA 3D0YB 3I5IB 1RWYA 3JTDC 2HETA 4F0ZB 3BUNB 1XFXO 1Y1XA 4OV2A 1K9UA 3I5FB 2I7AA 1KSOA 1IJ6A 3DVKA 2AAOA 5AFPA 4R1EA 1R2UA 1PK0D 3M0WA 4XJKB 3GK2A 3IF7A 1Y1AA 1AJ5A 4JWQA 1QS7A 4MZKA 1SMGA 2DOQA 1K96A 1CDPA 4GGNA 2KQYA 3IQOA 1UP5A 1SR6B 1XFWO 1YRTB 2JT0A 1XA5A 3I5FC 5CSIA 3DVJA 1NUBA 2QPTA 3KPXA 2PALA 4MSPA 1WY9A 1S6IA 2WCFA 1J55A 1RFJA 2M8UA 5PALA 3VROA 2KSPA 1L2OC 1K8UA 1KK7Y 5AANA 2L0PA 3OHMB 1QV0A 2ISDA 1PVBA 1ZFSA 2JT3A 1CLBA 5CPVA 4QJ5B 2L5XB 2JTTA 2LP3A 3PN7B 2B1UA 4YBHB 4BY5A 2F8PA 2IS9A 1IH0A 1SR6C 1C7VA 1S5GZ 1BMOA 3DF0A 1KWOC 4FQOA 4GPLB 1JBAA 1HQVA 1IRJA 4PE0A 1SNLA 2LM5A 1UHKA 1CM4A 3I5HB 1NCYA 3BQ3A 4PHNA 3FWCA 3VGOA 2CTNA 5JJGA 5F6TA 1G33A 1UUSA 1SBJA 3AKBA 1CDNA 2K7BA 1G8IA 4C0KA 1JC2A 1XO5A 4N1FA 2LVVA 2NZ0A 1J7PA 1PSBA 1YVHA 3CTNA 3BOWB 2WNDA 1IJ5A 4MEWA 2K2AA 5G08A 5D69A 1MF8B 4PHJA 4C0JA 1YVLA 3CLNA 1L7ZA 2JNFA 1YUUA 1TNQA 3A8RA 5DKNA 2KHNA 3SIAA 1BODA 5HKZA 2I2RE 3I5HC 1B4CA 3GK1A 4JQ0D 2CCMA 1MUXA 1SPYA 4GGFC 4ZCVA 1RTP1 3LCPC 3D10A 3VRPA 1CDLA 1NX2A 2M0RA 1UWOA 4M2OA 1SL9A 2EHBA 4A4BA 3LK1A 5CSJA 1QIWA 2SCPA 1X02A 2KI6D 3OX5A 3OP0A 3O78A 1A4PA 2RGIA 3GK4X 1BLQA 1S26D 2ZFDA 2JOJA 1MR8A 4ETOA 3TUYC 2KFGA 3K21A 2LAPA 4IL1A 1J7RA 1WLMA 1LINA 5CSNA 2LC5A 2MLFC 4CPVA 1M39A 1AP4A 1XFYO 1D1OA 2LLSA 2M49B 1DJYA 1S1EA 1U5IA 3KHEA 1K9KA 1YUSA 1QXPA 5JOLA 1SCVA 2LUCA 1A75A 2JT8A 3DVEA 5KU1A 1HT9A 1FW4A 5I8NA 2EGDA 4PDZA 3AAKA 1IQ5A 1OQPA 1XFZO 2HF5A 2H61A 4WQ2A 1S3PA 3SG3A 2I94A 1JFJA 1YUTA 4C0LA 1GGWA 1TNWA 4PE1A 2FOTA 4DS7A 2D8NA 1BR4B 2LVIA 1CLLA 2K7CA 3TDIA 2JU0A 1NX1A 2F3YA 1SRAA 4YGEB 3ZNIA 3JVTB 1GQMA 1CMFA 4AOMA 1DJXA 4DRWA 1WDCB 1BR1B 4HRHA 3FIAA 4YRUA
chains in the Genus database with same CATH superfamily
2P71A 4NQGA 2MJWB 2JXCA 4AQJA 2L50A 1LKJA 1M63B 2KI6C 4U8DA 1F55A 1LA3A 3WHTB 1MXLC 1C3ZA 4PE4A 1V1FA 3S0DA 2EC6B 2Y4QA 4MRXA 1YRUB 3AAJA 1ALWA 1YR5A 2FJUB 2HPSA 2VRGA 3JVTC 3R1OA 4I5NB 1DTLA 3WXAA 2KQ6A 1G4YR 3SJSA 3BJHA 1QX7A 2ZRTA 3L47A 4FQTA 1TCOB 1GJYA 1R6PA 3CZ0A 4MVFA 1V1GA 1S5GY 3OB2B 2LP2A 5AERA 1EXRA 2BCBA 2WC8A 3B7AA 3DF0B 1LXFC 2JWWA 2JTZA 2KFFA 1ALVA 1KSMA 3CR5X 3I5IC 2NCOA 1E8AA 1F4QA 2JRFA 2MHHA 1SKTA 2JPTA 2KAVA 2LMTA 2KLDA 2BECA 3VRRA 1SL7A 3EK8A 2BE6A 2EC6C 3SS4A 1H4BA 2LANA 4Q04A 3K1EA 1OMVA 2FCEA 5BPJA 2MLEC 4GNKB 3CS1A 2MAZA 2ZNDA 3ZWHA 2M97A 4NDCA 2M1KB 1DMOA 1QV1A 3OBVA 1F70A 4YGDB 3TDUA 3S0BA 1QLKA 5AEQA 1JFKA 2CT9A 1OMRA 2PMYA 2M29A 5KTYA 4YGBB 1SYMA 2QDIA 1CB1A 2LLTA 1AJ4A 2KPHA 2BE4A 3CR2A 3PALA 1TTXA 1B47A 2JZIA 1JF0A 2BL0B 1CFCA 5B8IB 1LVCD 1TNXA 1IWQA 1KQMB 2H8VA 3L4LA 1DGUA 3CWGA 3BUWB 1K95A 5GQQC 5I2OA 1TNPA 1K2HA 2BBNA 2L2EA 1LS8A 1KFUS 1M31A 1Y0VH 1BT6A 2LLUA 2QEHA 2WCLA 2Y5IA 1PRWA 2WCEA 2K60A 3PN7C 2O5GA 1KFXS 3UO9A 4PALA 1QIVA 3E3RA 3FE9A 1DC1A 2LCPA 2LVJA 1SW8A 2BKIB 1MWNA 2KLEA 2L4IA 1J1DA 4GAOA 1OOGA 2BL0C 2QEOA 1YX8A 1SCMB 2K8MB 1XFUO 2MRDA 1CNPA 5DKRA 1XK4A 1W7IB 4KYNA 1KQMC 5J3XA 4OR9B 2H2KA 5IBWA 4NDBA 4YGCB 1B9AA 5FI7A 1AK8A 1OZSA 1U5IB 1A03A 3O4YA 1FPWA 2KAYA 1Q80A 2I18A 3HCMA 1H8BA 2TN4A 1A75B 2LNKA 1CFPA 4JKTA 3B86A 3CYZA 2A4JA 1CFFA 5TNCA 1EL4A 4HREE 2JPOA 1B8CA 4PCWA 3SG4A 2PSRA 4F7FA 3O4XA 3FE6A 1BJFA 1AHRA 2Y1NA 1NCZA 2ZRSA 1UHHA 1A2XA 1GGZA 2K61A 4WQ3A 3D76A 2NLNA 3BUOB 1TOPA 2FCDA 1QVIZ 4M2QA 1TCFA 3QRXA 3D75A 4I5JA 4MZLA 1KCYA 2SASA 3DZTA 3EVUA 2AMIA 3NHIA 2HQ8A 3NSKA 3SG6A 1OOIX 4N5XA 1Z4HA 1YURA 3EVVA 1MHOA 4PHMA 1DJZA 4I5LB 2LMVA 1UHIA 4UPGA 1EG4A 3LLEA 2E6WA 2Q91A 5D7FA 2LVKA 2MBXA 3TS5B 1OOFA 1SK6D 3QMEA 1N2DA 1OW4A 1F71A 2QACA 3IQQA 1B8LA 1UURA 2JNXA 1RJVA 2M9GA 1CFDA 2GTEA 1NPQA 4MLWA 4GUKA 1TIZA 3SS3A 2L4HA 1EG3A 1NX3A 2KI4B 1IQ3A 1BOCA 1KQVA 1NWDA 3VRNA 2G2BA 1NX0A 1OZOA 2KOTA 3FE8A 1PULA 4OVNF 2O60A 5DICA 1K93D 3TS5C 4ICBA 2ZKMX 1TUJA 5I2LA 1RECA 2F2PA 1ZACA 1DGVA 3A4UB 3PSRA 3FWBA 3EK4A 3VB1A 2M1UA 5HKYA 3I5GB 1CLMA 2Y1MA 3CDNA 4WRIA 3B88A 2P70A 1OE9B 2K2FA 2P6BB 4ORBB 1J7OA 4TNCA 3JTDB 4ORAB 2QEVA 1SL8A 3SG2A 1B8RA 1B7TZ 2KI4C 1JWDA 2BCXA 2PASA 3BFBA 3CR4X 3S0FA 1AUIB 1XVJA 1TN4A 3B87A 2MA2A 5ER4X 1OSAA 1WDCC 1Y6WA 3BXKA 1FI5A 1OMDA 2F33A 2KDHA 2LUXA 1BG1A 1DJIA 2KGBC 1KFXL 1NP8A 4ORCB 1CMGA 1IGVA 4XYNA 2WCJA 3R1VA 4PT1A 3I5GC 2BBMA 3PATA 2COLB 1DJGA 4D1EA 2KYFA 2PRUA 2BKHB 5EL2A 1T14A 2M7LA 2L98A 1K94A 3LK0A 4INWA 4NDDA 1NIWA 1CKKA 1P28A 5HLVA 4AQIA 2ZNEA 2KGRA 3KF9A 4GBAA 1IIOA 2BCAA 3OB1B 1WLZA 1ZMZA 2K7OA 1NCXA 1YTZC 2LV7A 4P5OE 1VRKA 1IKUA 1S6JA 1M45A 3CZ1A 2KAXA 1L2OB 5KSZA 3PLFB 3OGNA 2CBLA 2OPOA 1QATA 1WRLA 2LE9B 2YGUA 1K9PA 1RROA 1YX7A 3DYEA 3FS7A 3KEVA 2F3ZA 3NXAA 2JULA 1XFVO 3BFAA 1A29A 1DF0A 3LL8B 3C1VA 3RM1A 2M7NA 3NHTA 4MBEA 1FBVA 2NXQA 3BFHA 4A4CA 4DCKA 1BF5A 1KWOB 1PVAA 3SG5A 3D0YA 2OS8B 5FYXA 3SG7A 1LA0A 1DJHA 1DQEA 3L4AA 3VRQA 3EK7A 1F8HA 1QLSA 1AVSA 1XK4C 2LMUA 1IG5A 4MZJA 2LHIA 4ZCUA 3GOFA 2KFHA 2M3WA 3KO0A 2K0JA 2JQ6A 3NSOA 4CLNA 1JUOA 2K7DA 5HYDA 1QVIY 3DD4A 2GV5A 3EVRA 1Y1UA 1ZUZA 1RK9A 3BUXB 4XJKA 1QJTA 2R2IA 5DKQA 4CFRA 4CIDA 1JF2A 2KBIA 1K90D 1QASA 2AUCA 3PJIA 2OS8C 2CNPA 1QX2A 4P2YB 4FTGA 2FJYA 3EKJA 4GFTA 3PM8A 3DY9A 5HL1A 2WCBA 2Q4UA 4YI9A 1C7WA 3TDZA 1C3YA 2ZN8A 2CXJA 1PSRA 2JC2A 3DVMA 4HRGA 2E30A 1UHNA 2V53A 3PFVA 3AKAA 3EKHA 3ICBA 3CZTX 1QTXA 1KK7Z 1SCMC 4MN0A 4USLA 4MRYA 4DIRA 3IVTA 4QJ3B 1EH2A 5HLOA 5CSFA 1NSHA 1DELA 2KNEA 4OCIA 5K89A 2G9BA 2WC6A 3D73A 1C07A 2L2CA 2KBMA 4N1GA 2WOSA 3S0EA 1QX5B 2HQWA 4QJ4B 2OTGB 3HX4A 1NYAA 2WORA 1F4OA 2PVBA 3TUYB 3WHUB 3R1PA 5AXIA 1W9ZA 2H61C 2LHLA 4OKHA 5HKWA 1OOJA 1DJWA 1GM0A 1PALA 1JSAA 4I5KA 4DUQA 4GGFA 1N65A 2WCHA 1XYDA 1B7TY 1WRZA 4YI8A 3H4SE 3N7HA 4JPZB 2JXLA 3BOWA 5ER5A 4BY4A 1EJ3A 2OTGC 3CZ2A 4E68A 2L51A 1FI6A 1CM1A 1WRKA 3PM2A 1TWOA 1ZOTB 3SIBA 2KYCA 4OZDA 1N0YA 1OOHA 1S36A 4M2PA 4PHKA 4CFQA 1W7JB 1B1GA 2QEBA 3TZ1A 3D77A 3O2PA 3EG5B 3O6BA 3OX6A 3BYAA 1S6CA 3WNXB 5D3OA 1KK8B 1UHJA 1F54A 1BU3A 1ODBA 2ZN9A 1M46A 2F2OA 4PE7A 1MQ1A 1XFRA 3RZSA 3RLZA 1DT7B 4YGAA 1KFUL 4HSZA 1CDMA 1J1EA 1DVIA 3BUMB 3R72A 3CGAA 1DF0B 1TRFA 2GGZA 3NSIA 5I2QA 1FF1A 2NCPA 3F45A 4L9MA 3NSLA 1CTRA 1SY9A 3MSEB 1KK8C 1MXEA 2GGMA 2WCMA 1J7QA 3D0YB 3I5IB 1RWYA 3JTDC 3V2LA 2HETA 4F0ZB 3BUNB 1XFXO 1Y1XA 1ORGA 4OV2A 1K9UA 3I5FB 3UNWA 2I7AA 1KSOA 1IJ6A 3DVKA 3S0AA 2AAOA 5AFPA 2ERBA 4R1EA 1R2UA 1PK0D 3M0WA 4XJKB 3GK2A 3IF7A 1Y1AA 1AJ5A 4JWQA 1QS7A 4MZKA 1SMGA 2DOQA 1K96A 1CDPA 4GGNA 2KQYA 4IJ7A 3IQOA 1UP5A 1SR6B 1XFWO 1YRTB 2JT0A 1XA5A 3I5FC 5CSIA 3DVJA 1NUBA 2QPTA 3KPXA 2WCKA 2PALA 4MSPA 1WY9A 5FI2A 1S6IA 2WCFA 1QWVA 1J55A 1RFJA 2M8UA 5PALA 3VROA 2KSPA 1L2OC 1K8UA 1KK7Y 5AANA 2L0PA 3OHMB 1QV0A 2ISDA 1PVBA 1ZFSA 2JT3A 1CLBA 3D78A 5CPVA 4QJ5B 2L5XB 2JTTA 2LP3A 3PN7B 2B1UA 4YBHB 4BY5A 2F8PA 2PYQA 2IS9A 1IH0A 1SR6C 4INXA 1C7VA 1S5GZ 1BMOA 2WC5A 3D74A 3DF0A 1KWOC 4FQOA 4GPLB 1JBAA 2BAPA 1HQVA 1IRJA 4PE0A 1SNLA 2LM5A 1UHKA 1CM4A 3I5HB 1NCYA 3B6XA 3BQ3A 4PHNA 1SSEB 2PQLA 3FWCA 3VGOA 2CTNA 5JJGA 5F6TA 1G33A 1UUSA 1SBJA 3AKBA 1CDNA 2K7BA 1G8IA 4C0KA 1JC2A 1XO5A 3SS5A 4N1FA 2LVVA 2NZ0A 3NGVA 1J7PA 1PSBA 1YVHA 3CTNA 3BOWB 2WNDA 1IJ5A 4MEWA 3DXLA 2K2AA 5G08A 5D69A 1MF8B 4PHJA 4C0JA 1YVLA 3CLNA 1L7ZA 4JD9A 2JNFA 1YUUA 1TNQA 3A8RA 5DKNA 2KHNA 3SIAA 1BODA 5HKZA 2I2RE 3I5HC 1B4CA 3GK1A 4JQ0D 2CCMA 1MUXA 1SPYA 4GGFC 4ZCVA 1RTP1 3LCPC 3D10A 3VRPA 1CDLA 1NX2A 2M0RA 1UWOA 4M2OA 1SL9A 2EHBA 4A4BA 1DEKA 3LK1A 5CSJA 1QIWA 1TUZA 2SCPA 5FI6A 1X02A 2KI6D 3OX5A 1Z2CB 3OP0A 3O78A 1A4PA 2RGIA 3GK4X 1BLQA 1S26D 2ZFDA 2JOJA 1MR8A 4ETOA 3TUYC 2KFGA 3K21A 2LAPA 4IL1A 1J7RA 1WLMA 1LINA 5CSNA 2LC5A 2MLFC 4CPVA 1M39A 1AP4A 1XFYO 1D1OA 2LLSA 2M49B 1DJYA 1S1EA 1U5IA 3KHEA 1K9KA 1YUSA 1QXPA 5JOLA 1SCVA 2LUCA 1A75A 2JT8A 3DVEA 5KU1A 1HT9A 1FW4A 3Q8IA 2EGDA 4PDZA 5I8NA 5I94A 3AAKA 1IQ5A 1OQPA 1XFZO 2HF5A 2H61A 4WQ2A 1S3PA 3SG3A 2I94A 1JFJA 1YUTA 4C0LA 1GGWA 1TNWA 4PE1A 3CABA 2FOTA 4DS7A 2D8NA 1BR4B 2LVIA 1CLLA 2K7CA 3TDIA 2JU0A 2L5YA 1NX1A 2F3YA 1SRAA 4YGEB 3ZNIA 3JVTB 1GQMA 1CMFA 3S0GA 1DJXA 2BNXA 4AOMA 4DRWA 1WDCB 1BR1B 4HRHA 3FIAA 4YRUA
chains in the Genus database with same CATH topology
4NQGA 2MJWB 2JXCA 4AQJA 2L50A 1LKJA 1M63B 2KI6C 4U8DA 1F55A 1LA3A 3WHTB 1MXLC 4PE4A 1V1FA 2EC6B 2Y4QA 4MRXA 1YRUB 3AAJA 1ALWA 1YR5A 2FJUB 2HPSA 2VRGA 3JVTC 4I5NB 1DTLA 3WXAA 2KQ6A 1G4YR 3SJSA 1QX7A 2ZRTA 1TCOB 1GJYA 1R6PA 4MVFA 1V1GA 1S5GY 3OB2B 2LP2A 5AERA 1EXRA 2BCBA 2WC8A 3DF0B 1LXFC 2JWWA 2JTZA 2KFFA 1ALVA 1KSMA 3CR5X 3I5IC 2NCOA 1E8AA 1F4QA 2JRFA 2MHHA 1SKTA 2JPTA 2KAVA 2LMTA 2BECA 3VRRA 1SL7A 3EK8A 2BE6A 2EC6C 1H4BA 2LANA 4Q04A 1OMVA 2FCEA 5BPJA 2MLEC 4GNKB 3CS1A 2MAZA 2ZNDA 3ZWHA 2M97A 4NDCA 2M1KB 1DMOA 1QV1A 1F70A 4YGDB 3TDUA 1QLKA 5AEQA 1JFKA 2CT9A 1OMRA 2PMYA 2M29A 5KTYA 4YGBB 1SYMA 1CB1A 2LLTA 1AJ4A 2BE4A 3CR2A 3PALA 1TTXA 1B47A 2JZIA 1JF0A 2BL0B 1CFCA 5B8IB 1LVCD 1TNXA 1IWQA 1KQMB 1DGUA 3CWGA 3BUWB 1K95A 5GQQC 5I2OA 1TNPA 1K2HA 2BBNA 2L2EA 2LLUA 1KFUS 1M31A 1Y0VH 1BT6A 2Y5IA 1PRWA 2WCEA 3PN7C 2O5GA 1KFXS 4PALA 1QIVA 3E3RA 2LCPA 2LVJA 1SW8A 2BKIB 1MWNA 2L4IA 4GAOA 1J1DA 2BL0C 1YX8A 1SCMB 2K8MB 1XFUO 2MRDA 1CNPA 5DKRA 1XK4A 1W7IB 5J3XA 1KQMC 4OR9B 2H2KA 5IBWA 4NDBA 4YGCB 1B9AA 1AK8A 1OZSA 1U5IB 1A03A 3O4YA 1FPWA 2KAYA 1Q80A 2I18A 3HCMA 1H8BA 2TN4A 1A75B 2LNKA 1CFPA 2A4JA 1CFFA 5TNCA 1EL4A 4HREE 1B8CA 4PCWA 3SG4A 2PSRA 1BJFA 1AHRA 2Y1NA 1NCZA 2ZRSA 1UHHA 1A2XA 1GGZA 2K61A 4WQ3A 2NLNA 3BUOB 1TOPA 2FCDA 1QVIZ 4M2QA 1TCFA 3QRXA 4I5JA 4MZLA 1KCYA 2SASA 3EVUA 2AMIA 2HQ8A 3NSKA 3SG6A 4N5XA 1YURA 3EVVA 1MHOA 4PHMA 1DJZA 4I5LB 2LMVA 1UHIA 4UPGA 1EG4A 3LLEA 2E6WA 2Q91A 5D7FA 2LVKA 2MBXA 3TS5B 1SK6D 1N2DA 1F71A 2QACA 3IQQA 1B8LA 1UURA 2JNXA 1RJVA 2M9GA 1CFDA 1NPQA 4MLWA 4GUKA 1TIZA 1KQVA 2L4HA 1EG3A 1NX3A 2KI4B 1IQ3A 1BOCA 1NWDA 3VRNA 2G2BA 1NX0A 1OZOA 2KOTA 1PULA 4OVNF 2O60A 1K93D 3TS5C 4ICBA 2ZKMX 5I2LA 1RECA 2F2PA 1ZACA 1DGVA 3A4UB 3PSRA 3FWBA 3EK4A 2M1UA 5HKYA 3I5GB 1CLMA 2Y1MA 4WRIA 1OE9B 2K2FA 2P6BB 4ORBB 1J7OA 4TNCA 3JTDB 4ORAB 3SG2A 1SL8A 1B8RA 1B7TZ 2KI4C 1JWDA 2BCXA 2PASA 3CR4X 1AUIB 1XVJA 1TN4A 2MA2A 5ER4X 1OSAA 1WDCC 1Y6WA 3BXKA 1FI5A 1OMDA 2F33A 2KDHA 2LUXA 1BG1A 1DJIA 2KGBC 1KFXL 1NP8A 4ORCB 1CMGA 1IGVA 4XYNA 3I5GC 2BBMA 3PATA 2COLB 1DJGA 4D1EA 2KYFA 2PRUA 2BKHB 2M7LA 2L98A 1K94A 3LK0A 4NDDA 1NIWA 1CKKA 5HLVA 4AQIA 2ZNEA 2KGRA 3KF9A 4GBAA 2BCAA 3OB1B 1WLZA 1ZMZA 2K7OA 1NCXA 1YTZC 2LV7A 4P5OE 1VRKA 1IKUA 1S6JA 1M45A 2KAXA 1L2OB 5KSZA 3PLFB 2CBLA 2OPOA 1QATA 1WRLA 2LE9B 3FS7A 1K9PA 1RROA 1YX7A 3KEVA 2F3ZA 3NXAA 2JULA 1XFVO 1A29A 1DF0A 3LL8B 3C1VA 3RM1A 2M7NA 4MBEA 1FBVA 2NXQA 4DCKA 4A4CA 1BF5A 1KWOB 1PVAA 3SG5A 3D0YA 2OS8B 5FYXA 3SG7A 1LA0A 1DJHA 3VRQA 3EK7A 1F8HA 1QLSA 1AVSA 1XK4C 2LMUA 1IG5A 4MZJA 2LHIA 4ZCUA 3GOFA 2KFHA 2M3WA 3KO0A 2K0JA 2JQ6A 3NSOA 4CLNA 1JUOA 2K7DA 5HYDA 1QVIY 3DD4A 2GV5A 3EVRA 1Y1UA 1ZUZA 1RK9A 3BUXB 4XJKA 1QJTA 2R2IA 5DKQA 4CFRA 4CIDA 1JF2A 2KBIA 1K90D 1QASA 2AUCA 2OS8C 2CNPA 1QX2A 4P2YB 4FTGA 3EKJA 4GFTA 3PM8A 2WCBA 2Q4UA 4YI9A 1C7WA 3TDZA 2ZN8A 2CXJA 1PSRA 2JC2A 3DVMA 4HRGA 2E30A 1UHNA 2V53A 3PFVA 3AKAA 3EKHA 3ICBA 3CZTX 1QTXA 1KK7Z 1SCMC 4MN0A 4USLA 4MRYA 4DIRA 4QJ3B 1EH2A 5HLOA 5CSFA 1NSHA 2KNEA 4OCIA 5K89A 2G9BA 1C07A 2KBMA 4N1GA 2WOSA 1QX5B 2HQWA 4QJ4B 2OTGB 3HX4A 1NYAA 2WORA 1F4OA 2PVBA 3TUYB 3WHUB 5AXIA 2H61C 2LHLA 4OKHA 5HKWA 1OOJA 1DJWA 1PALA 1JSAA 4I5KA 4DUQA 4GGFA 1N65A 1XYDA 1B7TY 1WRZA 4YI8A 3H4SE 4JPZB 2JXLA 3BOWA 5ER5A 4BY4A 1EJ3A 2OTGC 4E68A 2L51A 1FI6A 1CM1A 1WRKA 3SIBA 1ZOTB 2KYCA 1N0YA 1S36A 4M2PA 4PHKA 4CFQA 1W7JB 1B1GA 3TZ1A 3O2PA 3O6BA 3OX6A 3BYAA 1S6CA 3WNXB 1KK8B 1UHJA 1F54A 1BU3A 1ODBA 2ZN9A 1M46A 2F2OA 4PE7A 1MQ1A 3RLZA 1DT7B 4YGAA 1KFUL 4HSZA 1CDMA 1J1EA 1DVIA 3BUMB 3CGAA 1DF0B 1TRFA 2GGZA 3NSIA 5I2QA 1FF1A 2NCPA 3F45A 4L9MA 3NSLA 1CTRA 1SY9A 3MSEB 1KK8C 1MXEA 2GGMA 1J7QA 3D0YB 3I5IB 1RWYA 3JTDC 2HETA 4F0ZB 3BUNB 1XFXO 1Y1XA 4OV2A 1K9UA 3I5FB 2I7AA 1KSOA 1IJ6A 3DVKA 2AAOA 5AFPA 4R1EA 1R2UA 1PK0D 3M0WA 4XJKB 3GK2A 3IF7A 1Y1AA 1AJ5A 4JWQA 1QS7A 4MZKA 1SMGA 2DOQA 1K96A 1CDPA 4GGNA 2KQYA 3IQOA 1UP5A 1SR6B 1XFWO 1YRTB 2JT0A 1XA5A 3I5FC 5CSIA 3DVJA 1NUBA 2QPTA 3KPXA 2PALA 4MSPA 1WY9A 1S6IA 2WCFA 1J55A 1RFJA 2M8UA 5PALA 3VROA 2KSPA 1L2OC 1K8UA 1KK7Y 5AANA 2L0PA 3OHMB 1QV0A 2ISDA 1PVBA 1ZFSA 2JT3A 1CLBA 5CPVA 4QJ5B 2L5XB 2JTTA 2LP3A 3PN7B 2B1UA 4YBHB 4BY5A 2F8PA 2IS9A 1IH0A 1SR6C 1C7VA 1S5GZ 1BMOA 3DF0A 1KWOC 4FQOA 4GPLB 1JBAA 1HQVA 1IRJA 4PE0A 1SNLA 2LM5A 1UHKA 1CM4A 3I5HB 1NCYA 3BQ3A 4PHNA 3FWCA 3VGOA 2CTNA 5JJGA 5F6TA 1G33A 1UUSA 1SBJA 3AKBA 1CDNA 2K7BA 1G8IA 4C0KA 1JC2A 1XO5A 4N1FA 2LVVA 2NZ0A 1J7PA 1PSBA 1YVHA 3CTNA 3BOWB 2WNDA 1IJ5A 4MEWA 2K2AA 5G08A 5D69A 1MF8B 4PHJA 4C0JA 1YVLA 3CLNA 1L7ZA 2JNFA 1YUUA 1TNQA 3A8RA 5DKNA 2KHNA 3SIAA 1BODA 5HKZA 2I2RE 3I5HC 1B4CA 3GK1A 4JQ0D 2CCMA 1MUXA 1SPYA 4GGFC 4ZCVA 1RTP1 3LCPC 3D10A 3VRPA 1CDLA 1NX2A 2M0RA 1UWOA 4M2OA 1SL9A 2EHBA 4A4BA 3LK1A 5CSJA 1QIWA 2SCPA 1X02A 2KI6D 3OX5A 3OP0A 3O78A 1A4PA 2RGIA 3GK4X 1BLQA 1S26D 2ZFDA 2JOJA 1MR8A 4ETOA 3TUYC 2KFGA 3K21A 2LAPA 4IL1A 1J7RA 1WLMA 1LINA 5CSNA 2LC5A 2MLFC 4CPVA 1M39A 1AP4A 1XFYO 1D1OA 2LLSA 2M49B 1DJYA 1S1EA 1U5IA 3KHEA 1K9KA 1YUSA 1QXPA 5JOLA 1SCVA 2LUCA 1A75A 2JT8A 3DVEA 5KU1A 1HT9A 1FW4A 5I8NA 2EGDA 4PDZA 3AAKA 1IQ5A 1OQPA 1XFZO 2HF5A 2H61A 4WQ2A 1S3PA 3SG3A 2I94A 1JFJA 1YUTA 4C0LA 1GGWA 1TNWA 4PE1A 2FOTA 4DS7A 2D8NA 1BR4B 2LVIA 1CLLA 2K7CA 3TDIA 2JU0A 1NX1A 2F3YA 1SRAA 4YGEB 3ZNIA 3JVTB 1GQMA 1CMFA 4AOMA 1DJXA 4DRWA 1WDCB 1BR1B 4HRHA 3FIAA 4YRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQG A;  2MJW B;  2JXC A;  4AQJ A;  2L50 A;  1LKJ A;  1M63 B;  2KI6 C;  4U8D A;  1F55 A;  1LA3 A;  3WHT B;  1MXL C;  4PE4 A;  1V1F A;  2EC6 B;  2Y4Q A;  4MRX A;  1YRU B;  3AAJ A;  1ALW A;  1YR5 A;  2FJU B;  2HPS A;  2VRG A;  3JVT C;  4I5N B;  1DTL A;  3WXA A;  2KQ6 A;  1G4Y R;  3SJS A;  1QX7 A;  2ZRT A;  1TCO B;  1GJY A;  1R6P A;  4MVF A;  1V1G A;  1S5G Y;  3OB2 B;  2LP2 A;  5AER A;  1EXR A;  2BCB A;  2WC8 A;  3DF0 B;  1LXF C;  2JWW A;  2JTZ A;  2KFF A;  1ALV A;  1KSM A;  3CR5 X;  3I5I C;  2NCO A;  1E8A A;  1F4Q A;  2JRF A;  2MHH A;  1SKT A;  2JPT A;  2KAV A;  2LMT A;  2BEC A;  3VRR A;  1SL7 A;  3EK8 A;  2BE6 A;  2EC6 C;  1H4B A;  2LAN A;  4Q04 A;  1OMV A;  2FCE A;  5BPJ A;  2MLE C;  4GNK B;  3CS1 A;  2MAZ A;  2ZND A;  3ZWH A;  2M97 A;  4NDC A;  2M1K B;  1DMO A;  1QV1 A;  1F70 A;  4YGD B;  3TDU A;  1QLK A;  5AEQ A;  1JFK A;  2CT9 A;  1OMR A;  2PMY A;  2M29 A;  5KTY A;  4YGB B;  1SYM A;  1CB1 A;  2LLT A;  1AJ4 A;  2BE4 A;  3CR2 A;  3PAL A;  1TTX A;  1B47 A;  2JZI A;  1JF0 A;  2BL0 B;  1CFC A;  5B8I B;  1LVC D;  1TNX A;  1IWQ A;  1KQM B;  1DGU A;  3CWG A;  3BUW B;  1K95 A;  5GQQ C;  5I2O A;  1TNP A;  1K2H A;  2BBN A;  2L2E A;  2LLU A;  1KFU S;  1M31 A;  1Y0V H;  1BT6 A;  2Y5I A;  1PRW A;  2WCE A;  3PN7 C;  2O5G A;  1KFX S;  4PAL A;  1QIV A;  3E3R A;  2LCP A;  2LVJ A;  1SW8 A;  2BKI B;  1MWN A;  2L4I A;  4GAO A;  1J1D A;  2BL0 C;  1YX8 A;  1SCM B;  2K8M B;  1XFU O;  2MRD A;  1CNP A;  5DKR A;  1XK4 A;  1W7I B;  5J3X A;  1KQM C;  4OR9 B;  2H2K A;  5IBW A;  4NDB A;  4YGC B;  1B9A A;  1AK8 A;  1OZS A;  1U5I B;  1A03 A;  3O4Y A;  1FPW A;  2KAY A;  1Q80 A;  2I18 A;  3HCM A;  1H8B A;  2TN4 A;  1A75 B;  2LNK A;  1CFP A;  2A4J A;  1CFF A;  5TNC A;  1EL4 A;  4HRE E;  1B8C A;  4PCW A;  3SG4 A;  2PSR A;  1BJF A;  1AHR A;  2Y1N A;  1NCZ A;  2ZRS A;  1UHH A;  1A2X A;  1GGZ A;  2K61 A;  4WQ3 A;  2NLN A;  3BUO B;  1TOP A;  2FCD A;  1QVI Z;  4M2Q A;  1TCF A;  3QRX A;  4I5J A;  4MZL A;  1KCY A;  2SAS A;  3EVU A;  2AMI A;  2HQ8 A;  3NSK A;  3SG6 A;  4N5X A;  1YUR A;  3EVV A;  1MHO A;  4PHM A;  1DJZ A;  4I5L B;  2LMV A;  1UHI A;  4UPG A;  1EG4 A;  3LLE A;  2E6W A;  2Q91 A;  5D7F A;  2LVK A;  2MBX A;  3TS5 B;  1SK6 D;  1N2D A;  1F71 A;  2QAC A;  3IQQ A;  1B8L A;  1UUR A;  2JNX A;  1RJV A;  2M9G A;  1CFD A;  1NPQ A;  4MLW A;  4GUK A;  1TIZ A;  1KQV A;  2L4H A;  1EG3 A;  1NX3 A;  2KI4 B;  1IQ3 A;  1BOC A;  1NWD A;  3VRN A;  2G2B A;  1NX0 A;  1OZO A;  2KOT A;  1PUL A;  4OVN F;  2O60 A;  1K93 D;  3TS5 C;  4ICB A;  2ZKM X;  5I2L A;  1REC A;  2F2P A;  1ZAC A;  1DGV A;  3A4U B;  3PSR A;  3FWB A;  3EK4 A;  2M1U A;  5HKY A;  3I5G B;  1CLM A;  2Y1M A;  4WRI A;  1OE9 B;  2K2F A;  2P6B B;  4ORB B;  1J7O A;  4TNC A;  3JTD B;  4ORA B;  3SG2 A;  1SL8 A;  1B8R A;  1B7T Z;  2KI4 C;  1JWD A;  2BCX A;  2PAS A;  3CR4 X;  1AUI B;  1XVJ A;  1TN4 A;  2MA2 A;  5ER4 X;  1OSA A;  1WDC C;  1Y6W A;  3BXK A;  1FI5 A;  1OMD A;  2F33 A;  2KDH A;  2LUX A;  1BG1 A;  1DJI A;  2KGB C;  1KFX L;  1NP8 A;  4ORC B;  1CMG A;  1IGV A;  4XYN A;  3I5G C;  2BBM A;  3PAT A;  2COL B;  1DJG A;  4D1E A;  2KYF A;  2PRU A;  2BKH B;  2M7L A;  2L98 A;  1K94 A;  3LK0 A;  4NDD A;  1NIW A;  1CKK A;  5HLV A;  4AQI A;  2ZNE A;  2KGR A;  3KF9 A;  4GBA A;  2BCA A;  3OB1 B;  1WLZ A;  1ZMZ A;  2K7O A;  1NCX A;  1YTZ C;  2LV7 A;  4P5O E;  1VRK A;  1IKU A;  1S6J A;  1M45 A;  2KAX A;  1L2O B;  5KSZ A;  3PLF B;  2CBL A;  2OPO A;  1QAT A;  1WRL A;  2LE9 B;  3FS7 A;  1K9P A;  1RRO A;  1YX7 A;  3KEV A;  2F3Z A;  3NXA A;  2JUL A;  1XFV O;  1A29 A;  1DF0 A;  3LL8 B;  3C1V A;  3RM1 A;  2M7N A;  4MBE A;  1FBV A;  2NXQ A;  4DCK A;  4A4C A;  1BF5 A;  1KWO B;  1PVA A;  3SG5 A;  3D0Y A;  2OS8 B;  5FYX A;  3SG7 A;  1LA0 A;  1DJH A;  3VRQ A;  3EK7 A;  1F8H A;  1QLS A;  1AVS A;  1XK4 C;  2LMU A;  1IG5 A;  4MZJ A;  2LHI A;  4ZCU A;  3GOF A;  2KFH A;  2M3W A;  3KO0 A;  2K0J A;  2JQ6 A;  3NSO A;  4CLN A;  1JUO A;  2K7D A;  5HYD A;  1QVI Y;  3DD4 A;  2GV5 A;  3EVR A;  1Y1U A;  1ZUZ A;  1RK9 A;  3BUX B;  4XJK A;  1QJT A;  2R2I A;  5DKQ A;  4CFR A;  4CID A;  1JF2 A;  2KBI A;  1K90 D;  1QAS A;  2AUC A;  2OS8 C;  2CNP A;  1QX2 A;  4P2Y B;  4FTG A;  3EKJ A;  4GFT A;  3PM8 A;  2WCB A;  2Q4U A;  4YI9 A;  1C7W A;  3TDZ A;  2ZN8 A;  2CXJ A;  1PSR A;  2JC2 A;  3DVM A;  4HRG A;  2E30 A;  1UHN A;  2V53 A;  3PFV A;  3AKA A;  3EKH A;  3ICB A;  3CZT X;  1QTX A;  1KK7 Z;  1SCM C;  4MN0 A;  4USL A;  4MRY A;  4DIR A;  4QJ3 B;  1EH2 A;  5HLO A;  5CSF A;  1NSH A;  2KNE A;  4OCI A;  5K89 A;  2G9B A;  1C07 A;  2KBM A;  4N1G A;  2WOS A;  1QX5 B;  2HQW A;  4QJ4 B;  2OTG B;  3HX4 A;  1NYA A;  2WOR A;  1F4O A;  2PVB A;  3TUY B;  3WHU B;  5AXI A;  2H61 C;  2LHL A;  4OKH A;  5HKW A;  1OOJ A;  1DJW A;  1PAL A;  1JSA A;  4I5K A;  4DUQ A;  4GGF A;  1N65 A;  1XYD A;  1B7T Y;  1WRZ A;  4YI8 A;  3H4S E;  4JPZ B;  2JXL A;  3BOW A;  5ER5 A;  4BY4 A;  1EJ3 A;  2OTG C;  4E68 A;  2L51 A;  1FI6 A;  1CM1 A;  1WRK A;  3SIB A;  1ZOT B;  2KYC A;  1N0Y A;  1S36 A;  4M2P A;  4PHK A;  4CFQ A;  1W7J B;  1B1G A;  3TZ1 A;  3O2P A;  3O6B A;  3OX6 A;  3BYA A;  1S6C A;  3WNX B;  1KK8 B;  1UHJ A;  1F54 A;  1BU3 A;  1ODB A;  2ZN9 A;  1M46 A;  2F2O A;  4PE7 A;  1MQ1 A;  3RLZ A;  1DT7 B;  4YGA A;  1KFU L;  4HSZ A;  1CDM A;  1J1E A;  1DVI A;  3BUM B;  3CGA A;  1DF0 B;  1TRF A;  2GGZ A;  3NSI A;  5I2Q A;  1FF1 A;  2NCP A;  3F45 A;  4L9M A;  3NSL A;  1CTR A;  1SY9 A;  3MSE B;  1KK8 C;  1MXE A;  2GGM A;  1J7Q A;  3D0Y B;  3I5I B;  1RWY A;  3JTD C;  2HET A;  4F0Z B;  3BUN B;  1XFX O;  1Y1X A;  4OV2 A;  1K9U A;  3I5F B;  2I7A A;  1KSO A;  1IJ6 A;  3DVK A;  2AAO A;  5AFP A;  4R1E A;  1R2U A;  1PK0 D;  3M0W A;  4XJK B;  3GK2 A;  3IF7 A;  1Y1A A;  1AJ5 A;  4JWQ A;  1QS7 A;  4MZK A;  1SMG A;  2DOQ A;  1K96 A;  1CDP A;  4GGN A;  2KQY A;  3IQO A;  1UP5 A;  1SR6 B;  1XFW O;  1YRT B;  2JT0 A;  1XA5 A;  3I5F C;  5CSI A;  3DVJ A;  1NUB A;  2QPT A;  3KPX A;  2PAL A;  4MSP A;  1WY9 A;  1S6I A;  2WCF A;  1J55 A;  1RFJ A;  2M8U A;  5PAL A;  3VRO A;  2KSP A;  1L2O C;  1K8U A;  1KK7 Y;  5AAN A;  2L0P A;  3OHM B;  1QV0 A;  2ISD A;  1PVB A;  1ZFS A;  2JT3 A;  1CLB A;  5CPV A;  4QJ5 B;  2L5X B;  2JTT A;  2LP3 A;  3PN7 B;  2B1U A;  4YBH B;  4BY5 A;  2F8P A;  2IS9 A;  1IH0 A;  1SR6 C;  1C7V A;  1S5G Z;  1BMO A;  3DF0 A;  1KWO C;  4FQO A;  4GPL B;  1JBA A;  1HQV A;  1IRJ A;  4PE0 A;  1SNL A;  2LM5 A;  1UHK A;  1CM4 A;  3I5H B;  1NCY A;  3BQ3 A;  4PHN A;  3FWC A;  3VGO A;  2CTN A;  5JJG A;  5F6T A;  1G33 A;  1UUS A;  1SBJ A;  3AKB A;  1CDN A;  2K7B A;  1G8I A;  4C0K A;  1JC2 A;  1XO5 A;  4N1F A;  2LVV A;  2NZ0 A;  1J7P A;  1PSB A;  1YVH A;  3CTN A;  3BOW B;  2WND A;  1IJ5 A;  4MEW A;  2K2A A;  5G08 A;  5D69 A;  1MF8 B;  4PHJ A;  4C0J A;  1YVL A;  3CLN A;  1L7Z A;  2JNF A;  1YUU A;  1TNQ A;  3A8R A;  5DKN A;  2KHN A;  3SIA A;  1BOD A;  5HKZ A;  2I2R E;  3I5H C;  1B4C A;  3GK1 A;  4JQ0 D;  2CCM A;  1MUX A;  1SPY A;  4GGF C;  4ZCV A;  1RTP 1;  3LCP C;  3D10 A;  3VRP A;  1CDL A;  1NX2 A;  2M0R A;  1UWO A;  4M2O A;  1SL9 A;  2EHB A;  4A4B A;  3LK1 A;  5CSJ A;  1QIW A;  2SCP A;  1X02 A;  2KI6 D;  3OX5 A;  3OP0 A;  3O78 A;  1A4P A;  2RGI A;  3GK4 X;  1BLQ A;  1S26 D;  2ZFD A;  2JOJ A;  1MR8 A;  4ETO A;  3TUY C;  2KFG A;  3K21 A;  2LAP A;  4IL1 A;  1J7R A;  1WLM A;  1LIN A;  5CSN A;  2LC5 A;  2MLF C;  4CPV A;  1M39 A;  1AP4 A;  1XFY O;  1D1O A;  2LLS A;  2M49 B;  1DJY A;  1S1E A;  1U5I A;  3KHE A;  1K9K A;  1YUS A;  1QXP A;  5JOL A;  1SCV A;  2LUC A;  1A75 A;  2JT8 A;  3DVE A;  5KU1 A;  1HT9 A;  1FW4 A;  5I8N A;  2EGD A;  4PDZ A;  3AAK A;  1IQ5 A;  1OQP A;  1XFZ O;  2HF5 A;  2H61 A;  4WQ2 A;  1S3P A;  3SG3 A;  2I94 A;  1JFJ A;  1YUT A;  4C0L A;  1GGW A;  1TNW A;  4PE1 A;  2FOT A;  4DS7 A;  2D8N A;  1BR4 B;  2LVI A;  1CLL A;  2K7C A;  3TDI A;  2JU0 A;  1NX1 A;  2F3Y A;  1SRA A;  4YGE B;  3ZNI A;  3JVT B;  1GQM A;  1CMF A;  4AOM A;  1DJX A;  4DRW A;  1WDC B;  1BR1 B;  4HRH A;  3FIA A;  4YRU A; 
#chains in the Genus database with same CATH topology
 2P71 A;  4NQG A;  2MJW B;  2JXC A;  4AQJ A;  2L50 A;  1LKJ A;  1M63 B;  2KI6 C;  4U8D A;  1F55 A;  1LA3 A;  3WHT B;  1MXL C;  1C3Z A;  4PE4 A;  1V1F A;  3S0D A;  2EC6 B;  2Y4Q A;  4MRX A;  1YRU B;  3AAJ A;  1ALW A;  1YR5 A;  2FJU B;  2HPS A;  2VRG A;  3JVT C;  3R1O A;  4I5N B;  1DTL A;  3WXA A;  2KQ6 A;  1G4Y R;  3SJS A;  3BJH A;  1QX7 A;  2ZRT A;  3L47 A;  4FQT A;  1TCO B;  1GJY A;  1R6P A;  3CZ0 A;  4MVF A;  1V1G A;  1S5G Y;  3OB2 B;  2LP2 A;  5AER A;  1EXR A;  2BCB A;  2WC8 A;  3B7A A;  3DF0 B;  1LXF C;  2JWW A;  2JTZ A;  2KFF A;  1ALV A;  1KSM A;  3CR5 X;  3I5I C;  2NCO A;  1E8A A;  1F4Q A;  2JRF A;  2MHH A;  1SKT A;  2JPT A;  2KAV A;  2LMT A;  2KLD A;  2BEC A;  3VRR A;  1SL7 A;  3EK8 A;  2BE6 A;  2EC6 C;  3SS4 A;  1H4B A;  2LAN A;  4Q04 A;  3K1E A;  1OMV A;  2FCE A;  5BPJ A;  2MLE C;  4GNK B;  3CS1 A;  2MAZ A;  2ZND A;  3ZWH A;  2M97 A;  4NDC A;  2M1K B;  1DMO A;  1QV1 A;  3OBV A;  1F70 A;  4YGD B;  3TDU A;  3S0B A;  1QLK A;  5AEQ A;  1JFK A;  2CT9 A;  1OMR A;  2PMY A;  2M29 A;  5KTY A;  4YGB B;  1SYM A;  2QDI A;  1CB1 A;  2LLT A;  1AJ4 A;  2KPH A;  2BE4 A;  3CR2 A;  3PAL A;  1TTX A;  1B47 A;  2JZI A;  1JF0 A;  2BL0 B;  1CFC A;  5B8I B;  1LVC D;  1TNX A;  1IWQ A;  1KQM B;  2H8V A;  3L4L A;  1DGU A;  3CWG A;  3BUW B;  1K95 A;  5GQQ C;  5I2O A;  1TNP A;  1K2H A;  2BBN A;  2L2E A;  1LS8 A;  1KFU S;  1M31 A;  1Y0V H;  1BT6 A;  2LLU A;  2QEH A;  2WCL A;  2Y5I A;  1PRW A;  2WCE A;  2K60 A;  3PN7 C;  2O5G A;  1KFX S;  3UO9 A;  4PAL A;  1QIV A;  3E3R A;  3FE9 A;  1DC1 A;  2LCP A;  2LVJ A;  1SW8 A;  2BKI B;  1MWN A;  2KLE A;  2L4I A;  1J1D A;  4GAO A;  1OOG A;  2BL0 C;  2QEO A;  1YX8 A;  1SCM B;  2K8M B;  1XFU O;  2MRD A;  1CNP A;  5DKR A;  1XK4 A;  1W7I B;  4KYN A;  1KQM C;  5J3X A;  4OR9 B;  2H2K A;  5IBW A;  4NDB A;  4YGC B;  1B9A A;  5FI7 A;  1AK8 A;  1OZS A;  1U5I B;  1A03 A;  3O4Y A;  1FPW A;  2KAY A;  1Q80 A;  2I18 A;  3HCM A;  1H8B A;  2TN4 A;  1A75 B;  2LNK A;  1CFP A;  4JKT A;  3B86 A;  3CYZ A;  2A4J A;  1CFF A;  5TNC A;  1EL4 A;  4HRE E;  2JPO A;  1B8C A;  4PCW A;  3SG4 A;  2PSR A;  4F7F A;  3O4X A;  3FE6 A;  1BJF A;  1AHR A;  2Y1N A;  1NCZ A;  2ZRS A;  1UHH A;  1A2X A;  1GGZ A;  2K61 A;  4WQ3 A;  3D76 A;  2NLN A;  3BUO B;  1TOP A;  2FCD A;  1QVI Z;  4M2Q A;  1TCF A;  3QRX A;  3D75 A;  4I5J A;  4MZL A;  1KCY A;  2SAS A;  3DZT A;  3EVU A;  2AMI A;  3NHI A;  2HQ8 A;  3NSK A;  3SG6 A;  1OOI X;  4N5X A;  1Z4H A;  1YUR A;  3EVV A;  1MHO A;  4PHM A;  1DJZ A;  4I5L B;  2LMV A;  1UHI A;  4UPG A;  1EG4 A;  3LLE A;  2E6W A;  2Q91 A;  5D7F A;  2LVK A;  2MBX A;  3TS5 B;  1OOF A;  1SK6 D;  3QME A;  1N2D A;  1OW4 A;  1F71 A;  2QAC A;  3IQQ A;  1B8L A;  1UUR A;  2JNX A;  1RJV A;  2M9G A;  1CFD A;  2GTE A;  1NPQ A;  4MLW A;  4GUK A;  1TIZ A;  3SS3 A;  2L4H A;  1EG3 A;  1NX3 A;  2KI4 B;  1IQ3 A;  1BOC A;  1KQV A;  1NWD A;  3VRN A;  2G2B A;  1NX0 A;  1OZO A;  2KOT A;  3FE8 A;  1PUL A;  4OVN F;  2O60 A;  5DIC A;  1K93 D;  3TS5 C;  4ICB A;  2ZKM X;  1TUJ A;  5I2L A;  1REC A;  2F2P A;  1ZAC A;  1DGV A;  3A4U B;  3PSR A;  3FWB A;  3EK4 A;  3VB1 A;  2M1U A;  5HKY A;  3I5G B;  1CLM A;  2Y1M A;  3CDN A;  4WRI A;  3B88 A;  2P70 A;  1OE9 B;  2K2F A;  2P6B B;  4ORB B;  1J7O A;  4TNC A;  3JTD B;  4ORA B;  2QEV A;  1SL8 A;  3SG2 A;  1B8R A;  1B7T Z;  2KI4 C;  1JWD A;  2BCX A;  2PAS A;  3BFB A;  3CR4 X;  3S0F A;  1AUI B;  1XVJ A;  1TN4 A;  3B87 A;  2MA2 A;  5ER4 X;  1OSA A;  1WDC C;  1Y6W A;  3BXK A;  1FI5 A;  1OMD A;  2F33 A;  2KDH A;  2LUX A;  1BG1 A;  1DJI A;  2KGB C;  1KFX L;  1NP8 A;  4ORC B;  1CMG A;  1IGV A;  4XYN A;  2WCJ A;  3R1V A;  4PT1 A;  3I5G C;  2BBM A;  3PAT A;  2COL B;  1DJG A;  4D1E A;  2KYF A;  2PRU A;  2BKH B;  5EL2 A;  1T14 A;  2M7L A;  2L98 A;  1K94 A;  3LK0 A;  4INW A;  4NDD A;  1NIW A;  1CKK A;  1P28 A;  5HLV A;  4AQI A;  2ZNE A;  2KGR A;  3KF9 A;  4GBA A;  1IIO A;  2BCA A;  3OB1 B;  1WLZ A;  1ZMZ A;  2K7O A;  1NCX A;  1YTZ C;  2LV7 A;  4P5O E;  1VRK A;  1IKU A;  1S6J A;  1M45 A;  3CZ1 A;  2KAX A;  1L2O B;  5KSZ A;  3PLF B;  3OGN A;  2CBL A;  2OPO A;  1QAT A;  1WRL A;  2LE9 B;  2YGU A;  1K9P A;  1RRO A;  1YX7 A;  3DYE A;  3FS7 A;  3KEV A;  2F3Z A;  3NXA A;  2JUL A;  1XFV O;  3BFA A;  1A29 A;  1DF0 A;  3LL8 B;  3C1V A;  3RM1 A;  2M7N A;  3NHT A;  4MBE A;  1FBV A;  2NXQ A;  3BFH A;  4A4C A;  4DCK A;  1BF5 A;  1KWO B;  1PVA A;  3SG5 A;  3D0Y A;  2OS8 B;  5FYX A;  3SG7 A;  1LA0 A;  1DJH A;  1DQE A;  3L4A A;  3VRQ A;  3EK7 A;  1F8H A;  1QLS A;  1AVS A;  1XK4 C;  2LMU A;  1IG5 A;  4MZJ A;  2LHI A;  4ZCU A;  3GOF A;  2KFH A;  2M3W A;  3KO0 A;  2K0J A;  2JQ6 A;  3NSO A;  4CLN A;  1JUO A;  2K7D A;  5HYD A;  1QVI Y;  3DD4 A;  2GV5 A;  3EVR A;  1Y1U A;  1ZUZ A;  1RK9 A;  3BUX B;  4XJK A;  1QJT A;  2R2I A;  5DKQ A;  4CFR A;  4CID A;  1JF2 A;  2KBI A;  1K90 D;  1QAS A;  2AUC A;  3PJI A;  2OS8 C;  2CNP A;  1QX2 A;  4P2Y B;  4FTG A;  2FJY A;  3EKJ A;  4GFT A;  3PM8 A;  3DY9 A;  5HL1 A;  2WCB A;  2Q4U A;  4YI9 A;  1C7W A;  3TDZ A;  1C3Y A;  2ZN8 A;  2CXJ A;  1PSR A;  2JC2 A;  3DVM A;  4HRG A;  2E30 A;  1UHN A;  2V53 A;  3PFV A;  3AKA A;  3EKH A;  3ICB A;  3CZT X;  1QTX A;  1KK7 Z;  1SCM C;  4MN0 A;  4USL A;  4MRY A;  4DIR A;  3IVT A;  4QJ3 B;  1EH2 A;  5HLO A;  5CSF A;  1NSH A;  1DEL A;  2KNE A;  4OCI A;  5K89 A;  2G9B A;  2WC6 A;  3D73 A;  1C07 A;  2L2C A;  2KBM A;  4N1G A;  2WOS A;  3S0E A;  1QX5 B;  2HQW A;  4QJ4 B;  2OTG B;  3HX4 A;  1NYA A;  2WOR A;  1F4O A;  2PVB A;  3TUY B;  3WHU B;  3R1P A;  5AXI A;  1W9Z A;  2H61 C;  2LHL A;  4OKH A;  5HKW A;  1OOJ A;  1DJW A;  1GM0 A;  1PAL A;  1JSA A;  4I5K A;  4DUQ A;  4GGF A;  1N65 A;  2WCH A;  1XYD A;  1B7T Y;  1WRZ A;  4YI8 A;  3H4S E;  3N7H A;  4JPZ B;  2JXL A;  3BOW A;  5ER5 A;  4BY4 A;  1EJ3 A;  2OTG C;  3CZ2 A;  4E68 A;  2L51 A;  1FI6 A;  1CM1 A;  1WRK A;  3PM2 A;  1TWO A;  1ZOT B;  3SIB A;  2KYC A;  4OZD A;  1N0Y A;  1OOH A;  1S36 A;  4M2P A;  4PHK A;  4CFQ A;  1W7J B;  1B1G A;  2QEB A;  3TZ1 A;  3D77 A;  3O2P A;  3EG5 B;  3O6B A;  3OX6 A;  3BYA A;  1S6C A;  3WNX B;  5D3O A;  1KK8 B;  1UHJ A;  1F54 A;  1BU3 A;  1ODB A;  2ZN9 A;  1M46 A;  2F2O A;  4PE7 A;  1MQ1 A;  1XFR A;  3RZS A;  3RLZ A;  1DT7 B;  4YGA A;  1KFU L;  4HSZ A;  1CDM A;  1J1E A;  1DVI A;  3BUM B;  3R72 A;  3CGA A;  1DF0 B;  1TRF A;  2GGZ A;  3NSI A;  5I2Q A;  1FF1 A;  2NCP A;  3F45 A;  4L9M A;  3NSL A;  1CTR A;  1SY9 A;  3MSE B;  1KK8 C;  1MXE A;  2GGM A;  2WCM A;  1J7Q A;  3D0Y B;  3I5I B;  1RWY A;  3JTD C;  3V2L A;  2HET A;  4F0Z B;  3BUN B;  1XFX O;  1Y1X A;  1ORG A;  4OV2 A;  1K9U A;  3I5F B;  3UNW A;  2I7A A;  1KSO A;  1IJ6 A;  3DVK A;  3S0A A;  2AAO A;  5AFP A;  2ERB A;  4R1E A;  1R2U A;  1PK0 D;  3M0W A;  4XJK B;  3GK2 A;  3IF7 A;  1Y1A A;  1AJ5 A;  4JWQ A;  1QS7 A;  4MZK A;  1SMG A;  2DOQ A;  1K96 A;  1CDP A;  4GGN A;  2KQY A;  4IJ7 A;  3IQO A;  1UP5 A;  1SR6 B;  1XFW O;  1YRT B;  2JT0 A;  1XA5 A;  3I5F C;  5CSI A;  3DVJ A;  1NUB A;  2QPT A;  3KPX A;  2WCK A;  2PAL A;  4MSP A;  1WY9 A;  5FI2 A;  1S6I A;  2WCF A;  1QWV A;  1J55 A;  1RFJ A;  2M8U A;  5PAL A;  3VRO A;  2KSP A;  1L2O C;  1K8U A;  1KK7 Y;  5AAN A;  2L0P A;  3OHM B;  1QV0 A;  2ISD A;  1PVB A;  1ZFS A;  2JT3 A;  1CLB A;  3D78 A;  5CPV A;  4QJ5 B;  2L5X B;  2JTT A;  2LP3 A;  3PN7 B;  2B1U A;  4YBH B;  4BY5 A;  2F8P A;  2PYQ A;  2IS9 A;  1IH0 A;  1SR6 C;  4INX A;  1C7V A;  1S5G Z;  1BMO A;  2WC5 A;  3D74 A;  3DF0 A;  1KWO C;  4FQO A;  4GPL B;  1JBA A;  2BAP A;  1HQV A;  1IRJ A;  4PE0 A;  1SNL A;  2LM5 A;  1UHK A;  1CM4 A;  3I5H B;  1NCY A;  3B6X A;  3BQ3 A;  4PHN A;  1SSE B;  2PQL A;  3FWC A;  3VGO A;  2CTN A;  5JJG A;  5F6T A;  1G33 A;  1UUS A;  1SBJ A;  3AKB A;  1CDN A;  2K7B A;  1G8I A;  4C0K A;  1JC2 A;  1XO5 A;  3SS5 A;  4N1F A;  2LVV A;  2NZ0 A;  3NGV A;  1J7P A;  1PSB A;  1YVH A;  3CTN A;  3BOW B;  2WND A;  1IJ5 A;  4MEW A;  3DXL A;  2K2A A;  5G08 A;  5D69 A;  1MF8 B;  4PHJ A;  4C0J A;  1YVL A;  3CLN A;  1L7Z A;  4JD9 A;  2JNF A;  1YUU A;  1TNQ A;  3A8R A;  5DKN A;  2KHN A;  3SIA A;  1BOD A;  5HKZ A;  2I2R E;  3I5H C;  1B4C A;  3GK1 A;  4JQ0 D;  2CCM A;  1MUX A;  1SPY A;  4GGF C;  4ZCV A;  1RTP 1;  3LCP C;  3D10 A;  3VRP A;  1CDL A;  1NX2 A;  2M0R A;  1UWO A;  4M2O A;  1SL9 A;  2EHB A;  4A4B A;  1DEK A;  3LK1 A;  5CSJ A;  1QIW A;  1TUZ A;  2SCP A;  5FI6 A;  1X02 A;  2KI6 D;  3OX5 A;  1Z2C B;  3OP0 A;  3O78 A;  1A4P A;  2RGI A;  3GK4 X;  1BLQ A;  1S26 D;  2ZFD A;  2JOJ A;  1MR8 A;  4ETO A;  3TUY C;  2KFG A;  3K21 A;  2LAP A;  4IL1 A;  1J7R A;  1WLM A;  1LIN A;  5CSN A;  2LC5 A;  2MLF C;  4CPV A;  1M39 A;  1AP4 A;  1XFY O;  1D1O A;  2LLS A;  2M49 B;  1DJY A;  1S1E A;  1U5I A;  3KHE A;  1K9K A;  1YUS A;  1QXP A;  5JOL A;  1SCV A;  2LUC A;  1A75 A;  2JT8 A;  3DVE A;  5KU1 A;  1HT9 A;  1FW4 A;  3Q8I A;  2EGD A;  4PDZ A;  5I8N A;  5I94 A;  3AAK A;  1IQ5 A;  1OQP A;  1XFZ O;  2HF5 A;  2H61 A;  4WQ2 A;  1S3P A;  3SG3 A;  2I94 A;  1JFJ A;  1YUT A;  4C0L A;  1GGW A;  1TNW A;  4PE1 A;  3CAB A;  2FOT A;  4DS7 A;  2D8N A;  1BR4 B;  2LVI A;  1CLL A;  2K7C A;  3TDI A;  2JU0 A;  2L5Y A;  1NX1 A;  2F3Y A;  1SRA A;  4YGE B;  3ZNI A;  3JVT B;  1GQM A;  1CMF A;  3S0G A;  1DJX A;  2BNX A;  4AOM A;  4DRW A;  1WDC B;  1BR1 B;  4HRH A;  3FIA A;  4YRU A; 
#chains in the Genus database with same CATH homology
 4NQG A;  2MJW B;  2JXC A;  4AQJ A;  2L50 A;  1LKJ A;  1M63 B;  2KI6 C;  4U8D A;  1F55 A;  1LA3 A;  3WHT B;  1MXL C;  4PE4 A;  1V1F A;  2EC6 B;  2Y4Q A;  4MRX A;  1YRU B;  3AAJ A;  1ALW A;  1YR5 A;  2FJU B;  2HPS A;  2VRG A;  3JVT C;  4I5N B;  1DTL A;  3WXA A;  2KQ6 A;  1G4Y R;  3SJS A;  1QX7 A;  2ZRT A;  1TCO B;  1GJY A;  1R6P A;  4MVF A;  1V1G A;  1S5G Y;  3OB2 B;  2LP2 A;  5AER A;  1EXR A;  2BCB A;  2WC8 A;  3DF0 B;  1LXF C;  2JWW A;  2JTZ A;  2KFF A;  1ALV A;  1KSM A;  3CR5 X;  3I5I C;  2NCO A;  1E8A A;  1F4Q A;  2JRF A;  2MHH A;  1SKT A;  2JPT A;  2KAV A;  2LMT A;  2BEC A;  3VRR A;  1SL7 A;  3EK8 A;  2BE6 A;  2EC6 C;  1H4B A;  2LAN A;  4Q04 A;  1OMV A;  2FCE A;  5BPJ A;  2MLE C;  4GNK B;  3CS1 A;  2MAZ A;  2ZND A;  3ZWH A;  2M97 A;  4NDC A;  2M1K B;  1DMO A;  1QV1 A;  1F70 A;  4YGD B;  3TDU A;  1QLK A;  5AEQ A;  1JFK A;  2CT9 A;  1OMR A;  2PMY A;  2M29 A;  5KTY A;  4YGB B;  1SYM A;  1CB1 A;  2LLT A;  1AJ4 A;  2BE4 A;  3CR2 A;  3PAL A;  1TTX A;  1B47 A;  2JZI A;  1JF0 A;  2BL0 B;  1CFC A;  5B8I B;  1LVC D;  1TNX A;  1IWQ A;  1KQM B;  1DGU A;  3CWG A;  3BUW B;  1K95 A;  5GQQ C;  5I2O A;  1TNP A;  1K2H A;  2BBN A;  2L2E A;  2LLU A;  1KFU S;  1M31 A;  1Y0V H;  1BT6 A;  2Y5I A;  1PRW A;  2WCE A;  3PN7 C;  2O5G A;  1KFX S;  4PAL A;  1QIV A;  3E3R A;  2LCP A;  2LVJ A;  1SW8 A;  2BKI B;  1MWN A;  2L4I A;  4GAO A;  1J1D A;  2BL0 C;  1YX8 A;  1SCM B;  2K8M B;  1XFU O;  2MRD A;  1CNP A;  5DKR A;  1XK4 A;  1W7I B;  5J3X A;  1KQM C;  4OR9 B;  2H2K A;  5IBW A;  4NDB A;  4YGC B;  1B9A A;  1AK8 A;  1OZS A;  1U5I B;  1A03 A;  3O4Y A;  1FPW A;  2KAY A;  1Q80 A;  2I18 A;  3HCM A;  1H8B A;  2TN4 A;  1A75 B;  2LNK A;  1CFP A;  2A4J A;  1CFF A;  5TNC A;  1EL4 A;  4HRE E;  1B8C A;  4PCW A;  3SG4 A;  2PSR A;  1BJF A;  1AHR A;  2Y1N A;  1NCZ A;  2ZRS A;  1UHH A;  1A2X A;  1GGZ A;  2K61 A;  4WQ3 A;  2NLN A;  3BUO B;  1TOP A;  2FCD A;  1QVI Z;  4M2Q A;  1TCF A;  3QRX A;  4I5J A;  4MZL A;  1KCY A;  2SAS A;  3EVU A;  2AMI A;  2HQ8 A;  3NSK A;  3SG6 A;  4N5X A;  1YUR A;  3EVV A;  1MHO A;  4PHM A;  1DJZ A;  4I5L B;  2LMV A;  1UHI A;  4UPG A;  1EG4 A;  3LLE A;  2E6W A;  2Q91 A;  5D7F A;  2LVK A;  2MBX A;  3TS5 B;  1SK6 D;  1N2D A;  1F71 A;  2QAC A;  3IQQ A;  1B8L A;  1UUR A;  2JNX A;  1RJV A;  2M9G A;  1CFD A;  1NPQ A;  4MLW A;  4GUK A;  1TIZ A;  1KQV A;  2L4H A;  1EG3 A;  1NX3 A;  2KI4 B;  1IQ3 A;  1BOC A;  1NWD A;  3VRN A;  2G2B A;  1NX0 A;  1OZO A;  2KOT A;  1PUL A;  4OVN F;  2O60 A;  1K93 D;  3TS5 C;  4ICB A;  2ZKM X;  5I2L A;  1REC A;  2F2P A;  1ZAC A;  1DGV A;  3A4U B;  3PSR A;  3FWB A;  3EK4 A;  2M1U A;  5HKY A;  3I5G B;  1CLM A;  2Y1M A;  4WRI A;  1OE9 B;  2K2F A;  2P6B B;  4ORB B;  1J7O A;  4TNC A;  3JTD B;  4ORA B;  3SG2 A;  1SL8 A;  1B8R A;  1B7T Z;  2KI4 C;  1JWD A;  2BCX A;  2PAS A;  3CR4 X;  1AUI B;  1XVJ A;  1TN4 A;  2MA2 A;  5ER4 X;  1OSA A;  1WDC C;  1Y6W A;  3BXK A;  1FI5 A;  1OMD A;  2F33 A;  2KDH A;  2LUX A;  1BG1 A;  1DJI A;  2KGB C;  1KFX L;  1NP8 A;  4ORC B;  1CMG A;  1IGV A;  4XYN A;  3I5G C;  2BBM A;  3PAT A;  2COL B;  1DJG A;  4D1E A;  2KYF A;  2PRU A;  2BKH B;  2M7L A;  2L98 A;  1K94 A;  3LK0 A;  4NDD A;  1NIW A;  1CKK A;  5HLV A;  4AQI A;  2ZNE A;  2KGR A;  3KF9 A;  4GBA A;  2BCA A;  3OB1 B;  1WLZ A;  1ZMZ A;  2K7O A;  1NCX A;  1YTZ C;  2LV7 A;  4P5O E;  1VRK A;  1IKU A;  1S6J A;  1M45 A;  2KAX A;  1L2O B;  5KSZ A;  3PLF B;  2CBL A;  2OPO A;  1QAT A;  1WRL A;  2LE9 B;  3FS7 A;  1K9P A;  1RRO A;  1YX7 A;  3KEV A;  2F3Z A;  3NXA A;  2JUL A;  1XFV O;  1A29 A;  1DF0 A;  3LL8 B;  3C1V A;  3RM1 A;  2M7N A;  4MBE A;  1FBV A;  2NXQ A;  4DCK A;  4A4C A;  1BF5 A;  1KWO B;  1PVA A;  3SG5 A;  3D0Y A;  2OS8 B;  5FYX A;  3SG7 A;  1LA0 A;  1DJH A;  3VRQ A;  3EK7 A;  1F8H A;  1QLS A;  1AVS A;  1XK4 C;  2LMU A;  1IG5 A;  4MZJ A;  2LHI A;  4ZCU A;  3GOF A;  2KFH A;  2M3W A;  3KO0 A;  2K0J A;  2JQ6 A;  3NSO A;  4CLN A;  1JUO A;  2K7D A;  5HYD A;  1QVI Y;  3DD4 A;  2GV5 A;  3EVR A;  1Y1U A;  1ZUZ A;  1RK9 A;  3BUX B;  4XJK A;  1QJT A;  2R2I A;  5DKQ A;  4CFR A;  4CID A;  1JF2 A;  2KBI A;  1K90 D;  1QAS A;  2AUC A;  2OS8 C;  2CNP A;  1QX2 A;  4P2Y B;  4FTG A;  3EKJ A;  4GFT A;  3PM8 A;  2WCB A;  2Q4U A;  4YI9 A;  1C7W A;  3TDZ A;  2ZN8 A;  2CXJ A;  1PSR A;  2JC2 A;  3DVM A;  4HRG A;  2E30 A;  1UHN A;  2V53 A;  3PFV A;  3AKA A;  3EKH A;  3ICB A;  3CZT X;  1QTX A;  1KK7 Z;  1SCM C;  4MN0 A;  4USL A;  4MRY A;  4DIR A;  4QJ3 B;  1EH2 A;  5HLO A;  5CSF A;  1NSH A;  2KNE A;  4OCI A;  5K89 A;  2G9B A;  1C07 A;  2KBM A;  4N1G A;  2WOS A;  1QX5 B;  2HQW A;  4QJ4 B;  2OTG B;  3HX4 A;  1NYA A;  2WOR A;  1F4O A;  2PVB A;  3TUY B;  3WHU B;  5AXI A;  2H61 C;  2LHL A;  4OKH A;  5HKW A;  1OOJ A;  1DJW A;  1PAL A;  1JSA A;  4I5K A;  4DUQ A;  4GGF A;  1N65 A;  1XYD A;  1B7T Y;  1WRZ A;  4YI8 A;  3H4S E;  4JPZ B;  2JXL A;  3BOW A;  5ER5 A;  4BY4 A;  1EJ3 A;  2OTG C;  4E68 A;  2L51 A;  1FI6 A;  1CM1 A;  1WRK A;  3SIB A;  1ZOT B;  2KYC A;  1N0Y A;  1S36 A;  4M2P A;  4PHK A;  4CFQ A;  1W7J B;  1B1G A;  3TZ1 A;  3O2P A;  3O6B A;  3OX6 A;  3BYA A;  1S6C A;  3WNX B;  1KK8 B;  1UHJ A;  1F54 A;  1BU3 A;  1ODB A;  2ZN9 A;  1M46 A;  2F2O A;  4PE7 A;  1MQ1 A;  3RLZ A;  1DT7 B;  4YGA A;  1KFU L;  4HSZ A;  1CDM A;  1J1E A;  1DVI A;  3BUM B;  3CGA A;  1DF0 B;  1TRF A;  2GGZ A;  3NSI A;  5I2Q A;  1FF1 A;  2NCP A;  3F45 A;  4L9M A;  3NSL A;  1CTR A;  1SY9 A;  3MSE B;  1KK8 C;  1MXE A;  2GGM A;  1J7Q A;  3D0Y B;  3I5I B;  1RWY A;  3JTD C;  2HET A;  4F0Z B;  3BUN B;  1XFX O;  1Y1X A;  4OV2 A;  1K9U A;  3I5F B;  2I7A A;  1KSO A;  1IJ6 A;  3DVK A;  2AAO A;  5AFP A;  4R1E A;  1R2U A;  1PK0 D;  3M0W A;  4XJK B;  3GK2 A;  3IF7 A;  1Y1A A;  1AJ5 A;  4JWQ A;  1QS7 A;  4MZK A;  1SMG A;  2DOQ A;  1K96 A;  1CDP A;  4GGN A;  2KQY A;  3IQO A;  1UP5 A;  1SR6 B;  1XFW O;  1YRT B;  2JT0 A;  1XA5 A;  3I5F C;  5CSI A;  3DVJ A;  1NUB A;  2QPT A;  3KPX A;  2PAL A;  4MSP A;  1WY9 A;  1S6I A;  2WCF A;  1J55 A;  1RFJ A;  2M8U A;  5PAL A;  3VRO A;  2KSP A;  1L2O C;  1K8U A;  1KK7 Y;  5AAN A;  2L0P A;  3OHM B;  1QV0 A;  2ISD A;  1PVB A;  1ZFS A;  2JT3 A;  1CLB A;  5CPV A;  4QJ5 B;  2L5X B;  2JTT A;  2LP3 A;  3PN7 B;  2B1U A;  4YBH B;  4BY5 A;  2F8P A;  2IS9 A;  1IH0 A;  1SR6 C;  1C7V A;  1S5G Z;  1BMO A;  3DF0 A;  1KWO C;  4FQO A;  4GPL B;  1JBA A;  1HQV A;  1IRJ A;  4PE0 A;  1SNL A;  2LM5 A;  1UHK A;  1CM4 A;  3I5H B;  1NCY A;  3BQ3 A;  4PHN A;  3FWC A;  3VGO A;  2CTN A;  5JJG A;  5F6T A;  1G33 A;  1UUS A;  1SBJ A;  3AKB A;  1CDN A;  2K7B A;  1G8I A;  4C0K A;  1JC2 A;  1XO5 A;  4N1F A;  2LVV A;  2NZ0 A;  1J7P A;  1PSB A;  1YVH A;  3CTN A;  3BOW B;  2WND A;  1IJ5 A;  4MEW A;  2K2A A;  5G08 A;  5D69 A;  1MF8 B;  4PHJ A;  4C0J A;  1YVL A;  3CLN A;  1L7Z A;  2JNF A;  1YUU A;  1TNQ A;  3A8R A;  5DKN A;  2KHN A;  3SIA A;  1BOD A;  5HKZ A;  2I2R E;  3I5H C;  1B4C A;  3GK1 A;  4JQ0 D;  2CCM A;  1MUX A;  1SPY A;  4GGF C;  4ZCV A;  1RTP 1;  3LCP C;  3D10 A;  3VRP A;  1CDL A;  1NX2 A;  2M0R A;  1UWO A;  4M2O A;  1SL9 A;  2EHB A;  4A4B A;  3LK1 A;  5CSJ A;  1QIW A;  2SCP A;  1X02 A;  2KI6 D;  3OX5 A;  3OP0 A;  3O78 A;  1A4P A;  2RGI A;  3GK4 X;  1BLQ A;  1S26 D;  2ZFD A;  2JOJ A;  1MR8 A;  4ETO A;  3TUY C;  2KFG A;  3K21 A;  2LAP A;  4IL1 A;  1J7R A;  1WLM A;  1LIN A;  5CSN A;  2LC5 A;  2MLF C;  4CPV A;  1M39 A;  1AP4 A;  1XFY O;  1D1O A;  2LLS A;  2M49 B;  1DJY A;  1S1E A;  1U5I A;  3KHE A;  1K9K A;  1YUS A;  1QXP A;  5JOL A;  1SCV A;  2LUC A;  1A75 A;  2JT8 A;  3DVE A;  5KU1 A;  1HT9 A;  1FW4 A;  5I8N A;  2EGD A;  4PDZ A;  3AAK A;  1IQ5 A;  1OQP A;  1XFZ O;  2HF5 A;  2H61 A;  4WQ2 A;  1S3P A;  3SG3 A;  2I94 A;  1JFJ A;  1YUT A;  4C0L A;  1GGW A;  1TNW A;  4PE1 A;  2FOT A;  4DS7 A;  2D8N A;  1BR4 B;  2LVI A;  1CLL A;  2K7C A;  3TDI A;  2JU0 A;  1NX1 A;  2F3Y A;  1SRA A;  4YGE B;  3ZNI A;  3JVT B;  1GQM A;  1CMF A;  4AOM A;  1DJX A;  4DRW A;  1WDC B;  1BR1 B;  4HRH A;  3FIA A;  4YRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...