2LE9B

Ragec2-s100a13 tetrameric complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Interaction of S100A13 with Receptor for Advanced Glycation End products (RAGE) C2 domain
rcsb
source organism Homo sapiens
molecule tags Membrane protein/metal binding protein
total genus 26
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2le9B00
3I5IC 2M8UA 1V1GA 1H8BA 1TIZA 1QX7A 4MEWA 3ZWHA 1DJGA 5I8NA 1TOPA 2JTZA 3IQOA 4FTGA 1J7OA 3SG3A 1TTXA 1OQPA 1A75A 4N5XA 3SIBA 2KFHA 1BMOA 1CTRA 1QATA 3JTDC 5JOLA 4N1GA 4YGBB 2EHBA 3EK7A 1OMDA 2KYCA 3KHEA 3GK1A 4BY5A 4CPVA 1WRZA 2VRGA 1QVIY 1SY9A 1TN4A 2L51A 2WNDA 1YRUB 3E3RA 5GQQC 1BG1A 2ZN8A 1LVCD 1WY9A 2MAZA 1A03A 1J1EA 4UPGA 1FPWA 2LMUA 4A4CA 4PALA 1GQMA 1NPQA 1XA5A 1BJFA 5G08A 2I7AA 1Y1AA 1CLLA 2I2RE 1NYAA 2ZKMX 3CWGA 1QV1A 1SPYA 5AFPA 1CFPA 1NX3A 5KU1A 5AEQA 2AAOA 5B8IB 2MLEC 3AKAA 3CS1A 3VGOA 3TZ1A 1YVLA 1AK8A 3EK8A 2KI4C 4PE0A 2CBLA 2LLSA 1QV0A 4MN0A 4JQ0D 1SRAA 1UP5A 3EK4A 4F0ZB 1F8HA 1S5GY 3PLFB 1YTZC 2KSPA 4WQ2A 1IKUA 1MQ1A 1SCVA 1A2XA 2JT3A 5IBWA 1QVIZ 1NSHA 2LVJA 3IF7A 4M2QA 2K7OA 3KPXA 1J7RA 2MLFC 1CFCA 1HQVA 1FW4A 4YGEB 2L4IA 2BE6A 4FQOA 1JFKA 2BL0B 2L5XB 2F8PA 3F45A 2O5GA 4GGFA 3BYAA 1IG5A 1WRLA 4GGFC 4M2PA 4JWQA 2L50A 3FS7A 1IQ5A 2CXJA 3BOWB 4GAOA 2L4HA 1Q80A 1OOJA 5D69A 2KGBC 1SL9A 3DF0A 1JSAA 1BF5A 4PHKA 2BBMA 5DKNA 1M46A 2KI6C 1CDMA 1G4YR 1K9KA 2AMIA 2F2PA 2LANA 2KNEA 4OV2A 1JWDA 1RECA 1ALVA 5HYDA 1CMGA 4GNKB 1WDCB 2BCAA 4XJKA 3LL8B 1LA3A 4C0JA 3OB2B 2CCMA 1LXFC 1S5GZ 1A75B 3EVRA 1TNPA 2K2FA 3JTDB 3D10A 1KFXL 1PVAA 2NXQA 1WLMA 2LE9B 1BR4B 3AKBA 3O4YA 1CM1A 5AANA 5FYXA 1SL7A 4DRWA 2ZRSA 3LK0A 2G2BA 4QJ4B 4ZCUA 2BBNA 5I2OA 1GJYA 3LCPC 1ZMZA 1OMVA 2FCEA 2FCDA 2K8MB 1JBAA 2IS9A 1F71A 1UHIA 5KSZA 1K95A 2CT9A 3EKJA 2FOTA 4MRXA 3CGAA 1KFXS 3CR4X 2I94A 1DGUA 1LKJA 1UUSA 3FWCA 1CLBA 4I5LB 2BL0C 2LUCA 3HCMA 4PE4A 1S3PA 3O6BA 1Y1XA 3O78A 2ZFDA 4ORCB 5HLOA 1Y6WA 3CLNA 1LA0A 3OHMB 3GOFA 1W7IB 4HREE 1CDLA 3GK2A 3DVMA 1B8RA 1DJXA 1D1OA 2BECA 2WOSA 5DKQA 2LV7A 1SKTA 1ZFSA 4DIRA 4GFTA 1WDCC 3CTNA 3WHUB 3BQ3A 2JTTA 2M49B 2LC5A 1N2DA 1QXPA 1JF0A 1K90D 1PVBA 4MRYA 3KF9A 3KEVA 1NCZA 5K89A 3DF0B 1XFVO 1X02A 5F6TA 5HKZA 1UHJA 2Y4QA 1RROA 5BPJA 2F3ZA 2M1KB 2LM5A 5J3XA 1NWDA 3GK4X 3OX6A 3A8RA 2JU0A 2KHNA 4D1EA 1K96A 1C7VA 3ICBA 4XJKB 1UHNA 1CKKA 1E8AA 2PALA 1QIVA 2CTNA 1FI6A 4TNCA 1YUUA 3PALA 5CSFA 1G8IA 1NCYA 1G33A 2PSRA 3SG2A 1DVIA 1KQMB 3QRXA 4PDZA 3SG6A 1OSAA 1EH2A 1KK8B 1SCMC 1KSMA 4JPZB 2HETA 1TNWA 1AP4A 4M2OA 2L2EA 1AJ5A 4WRIA 4GUKA 4PE7A 2NCPA 4MZLA 1BR1B 2K7DA 1WLZA 3LK1A 4YGDB 1N0YA 1CM4A 4NQGA 5TNCA 1TCOB 4PCWA 1QJTA 1EJ3A 2LP3A 2BE4A 1H4BA 2O60A 4I5KA 2JQ6A 2QACA 1HT9A 1YUSA 2MJWB 3OB1B 3BUWB 4MBEA 1BLQA 4OCIA 1DF0B 3LLEA 3EKHA 1JFJA 1RK9A 2Y1MA 3BXKA 3PATA 1ZACA 1J1DA 4GPLB 2LMVA 1IRJA 2KQYA 2PASA 3NSOA 5ER5A 1K9UA 1QIWA 2LVKA 3SJSA 3M0WA 3DVKA 2ZNDA 1BT6A 1B47A 4CLNA 4R1EA 3VRQA 4HSZA 1QX2A 1B4CA 1N65A 2K61A 4DCKA 1QASA 1ODBA 1QTXA 5ER4X 1FI5A 1PSBA 1IJ6A 2LMTA 2OTGB 2OS8B 4MLWA 3C1VA 3TDIA 1MF8B 2B1UA 3SG4A 3WHTB 1AHRA 1CB1A 1OE9B 4OVNF 2Q4UA 2BCXA 1S6IA 1IGVA 2F2OA 1A4PA 4WQ3A 2KGRA 2JNFA 4Q04A 1RWYA 2HQ8A 1K93D 1KK7Y 1K8UA 1DJHA 2JT0A 2ISDA 1TNXA 2KI6D 3AAKA 1K9PA 1S1EA 1KFUL 1YUTA 1B7TY 2M97A 2LVVA 3I5FC 1KQMC 3EVUA 1S26D 2K7CA 5CSNA 1KK8C 1C07A 1ZOTB 4GBAA 1OMRA 3TDUA 5HKYA 4BY4A 5PALA 1F4OA 1B9AA 1XYDA 4IL1A 4NDBA 1CFFA 1NP8A 5KTYA 2EGDA 3KO0A 1QLSA 3A4UB 2K0JA 1SBJA 1MWNA 2KBIA 1KFUS 1KWOC 2M7LA 1SCMB 1DF0A 1MR8A 3D0YA 2NZ0A 1NX0A 1GGZA 2GGMA 2OPOA 1GGWA 2NCOA 1KK7Z 1SK6D 1TNQA 2L98A 1L2OB 3IQQA 1L7ZA 1PK0D 4ICBA 1XFZO 3FWBA 2LUXA 3SIAA 3ZNIA 1F55A 1B7TZ 4C0KA 2M0RA 1ALWA 1XFUO 2KFFA 1NCXA 1MXEA 4PHNA 2OTGC 1B8LA 1PALA 2OS8C 1SL8A 1V1FA 3NSLA 3HX4A 1CMFA 2EC6B 1DJZA 3OP0A 4CFRA 1A29A 2Y5IA 2HQWA 3DVEA 2COLB 1XFXO 2LHLA 2BCBA 2PRUA 3I5GC 2F33A 3TS5B 1F70A 1EG4A 5I2QA 1W7JB 4ZCVA 2SCPA 2LHIA 3BUMB 3PN7C 1IH0A 2RGIA 1XK4A 1B1GA 1XO5A 2LLUA 2KAYA 2Y1NA 3TUYC 2H61A 1SNLA 2H61C 1NIWA 4YGCB 1PSRA 4ORBB 2I18A 1R6PA 1AUIB 1MUXA 2BKHB 2MA2A 2JXCA 1S6JA 2ZN9A 2GGZA 3VROA 1QS7A 2MRDA 2LVIA 3VRRA 2G9BA 1BODA 3I5HC 4YBHB 1MHOA 1UURA 4MVFA 1YURA 1OZSA 3SG5A 4DUQA 2M3WA 1CNPA 1R2UA 2D8NA 1DTLA 2AUCA 1TCFA 1NX1A 2CNPA 3I5FB 3NXAA 1KCYA 4I5JA 3O2PA 1AJ4A 1IQ3A 4YI8A 2WC8A 1U5IA 1EG3A 1XFYO 2KQ6A 3K21A 5AXIA 1RTP1 4MZKA 2WCEA 2LLTA 5HKWA 2V53A 4CIDA 3DVJA 3RM1A 3SG7A 3VRNA 4ETOA 1C7WA 1VRKA 4DS7A 1L2OC 3DD4A 1KQVA 1XFWO 1DJYA 3NSKA 1YR5A 2PVBA 4YI9A 4L9MA 1KWOB 1YX7A 1CDPA 1DJWA 4PHJA 4E68A 3D0YB 2JRFA 2JULA 2EC6C 2KFGA 1CDNA 5AERA 5DKRA 4U8DA 1IWQA 1UWOA 3FIAA 4QJ3B 2E30A 2E6WA 1J7PA 1IJ5A 2M29A 3JVTB 3TS5C 2KOTA 2HPSA 2ZNEA 1AVSA 5CSJA 3OX5A 2QPTA 2KAVA 1CLMA 5I2LA 1JUOA 1JF2A 1DGVA 2R2IA 2H2KA 3PM8A 2K7BA 1S6CA 3MSEB 2JOJA 4N1FA 5CPVA 1DT7B 1F54A 2GV5A 2MHHA 4P2YB 4PE1A 4AQIA 1YX8A 4HRGA 4YRUA 1M31A 1PULA 2Q91A 1RJVA 2TN4A 3I5GB 5D7FA 1SR6B 2JPTA 2JC2A 4MSPA 3PN7B 3PSRA 3CR5X 1M45A 1MXLC 3TUYB 1K94A 4GGNA 1PRWA 4XYNA 4MZJA 1J7QA 1B8CA 2HF5A 1DJIA 2BKIB 2LCPA 4I5NB 1F4QA 3I5IB 5CSIA 1XVJA 2KBMA 1S36A 2NLNA 4PHMA 4AQJA 2KYFA 4CFQA 3CZTX 3BUXB 1LINA 3I5HB 2WCFA 3PFVA 2JT8A 2WCBA 2JXLA 1YRTB 1FF1A 1K2HA 1SYMA 2DOQA 3WNXB 4YGAA 3RLZA 2PMYA 3WXAA 1NX2A 2LNKA 4NDDA 1DMOA 3BUOB 1U5IB 1OZOA 4ORAB 1ZUZA 1M63B 2A4JA 2M7NA 4AOMA 1QLKA 4P5OE 4OKHA 1KSOA 1YVHA 2K2AA 2ZRTA 4QJ5B 1SW8A 3NSIA 3BUNB 4HRHA 3JVTC 2MBXA 1M39A 1Y0VH 2L0PA 4NDCA 4USLA 1WRKA 3TDZA 1EL4A 2M1UA 4A4BA 2M9GA 2JNXA 3CR2A 3VRPA 5JJGA 2LP2A 1CFDA 2SASA 3AAJA 2KAXA 2LAPA 3EVVA 1BU3A 2JWWA 1JC2A 2WORA 1EXRA 1UHHA 2F3YA 2KI4B 1FBVA 1RFJA 1TRFA 2JZIA 1SR6C 1BOCA 1Y1UA 3H4SE 1QX5B 1UHKA 4C0LA 4OR9B 1XK4C 1J55A 1NUBA 1SMGA 3BOWA 5HLVA 2KDHA 2P6BB 2FJUB
chains in the Genus database with same CATH superfamily
3I5IC 3D78A 2M8UA 3K1EA 1V1GA 1H8BA 1TIZA 1C3ZA 1QX7A 4MEWA 4KYNA 3S0GA 3ZWHA 1DJGA 5I8NA 1TOPA 2JTZA 3IQOA 4FTGA 3UNWA 3SG3A 1TTXA 1J7OA 1OQPA 1A75A 4N5XA 3SIBA 2KFHA 1BMOA 1CTRA 1QATA 3JTDC 5JOLA 4N1GA 4YGBB 2EHBA 3EK7A 1OMDA 3CDNA 2KYCA 3KHEA 3DZTA 3GK1A 4BY5A 1WRZA 4CPVA 2VRGA 3CZ2A 3S0AA 1QVIY 1SY9A 1TN4A 2L51A 2WNDA 1YRUB 3E3RA 5GQQC 1BG1A 2ZN8A 1LVCD 1WY9A 3V2LA 2MAZA 1A03A 1J1EA 4UPGA 1FPWA 2LMUA 4A4CA 4PALA 3B86A 1GQMA 1NPQA 1XA5A 1BJFA 5G08A 2I7AA 1Y1AA 1CLLA 2I2RE 1NYAA 2ZKMX 3CWGA 1QV1A 1SPYA 2QDIA 5AFPA 1CFPA 1NX3A 5KU1A 3Q8IA 5AEQA 2AAOA 5B8IB 2MLEC 3AKAA 3CS1A 3VGOA 3TZ1A 1YVLA 1AK8A 3EK8A 2KI4C 3CYZA 4PE0A 2CBLA 2LLSA 1QV0A 4MN0A 4JQ0D 1SRAA 1UP5A 3EK4A 4F0ZB 1F8HA 1S5GY 3PLFB 1YTZC 2KSPA 4WQ2A 5EL2A 1IKUA 1MQ1A 1SCVA 1A2XA 2JT3A 5IBWA 1QVIZ 1NSHA 2LVJA 3IF7A 4M2QA 2K7OA 3KPXA 1J7RA 2MLFC 1CFCA 1HQVA 1FW4A 4YGEB 1W9ZA 2L4IA 2BE6A 4FQOA 1JFKA 2BL0B 2L5XB 1QWVA 2WCMA 1OW4A 2F8PA 3DY9A 3F45A 2O5GA 4GGFA 2ERBA 1IG5A 1WRLA 3BYAA 4GGFC 4M2PA 4JWQA 2L50A 3FS7A 3UO9A 1IQ5A 2CXJA 3BOWB 4GAOA 2L4HA 1Q80A 1OOJA 5D69A 2KGBC 1SL9A 3DF0A 1JSAA 1BF5A 4PHKA 2BBMA 5DKNA 1M46A 2KI6C 3SS5A 1CDMA 1G4YR 1K9KA 2AMIA 2F2PA 2LANA 4INWA 2KNEA 4OV2A 1JWDA 1RECA 1ALVA 5HYDA 1CMGA 4GNKB 1WDCB 2BCAA 4XJKA 3LL8B 1LA3A 4C0JA 3OB2B 2CCMA 1LXFC 1S5GZ 1A75B 3EVRA 1TNPA 2K2FA 3JTDB 3R1VA 4JD9A 3D10A 1KFXL 1PVAA 2NXQA 1WLMA 2LE9B 1BR4B 3AKBA 3O4YA 1CM1A 5AANA 5FYXA 1SL7A 4DRWA 2ZRSA 3LK0A 2G2BA 4QJ4B 4ZCUA 2BBNA 5I2OA 1GJYA 3LCPC 1ZMZA 1OMVA 2FCEA 2FCDA 2P71A 1SSEB 2K8MB 1JBAA 2YGUA 2IS9A 3D75A 1UHIA 1F71A 5KSZA 1K95A 2CT9A 2L2CA 3EKJA 2FOTA 4MRXA 3CGAA 1KFXS 3CR4X 2I94A 1DGUA 1LKJA 1UUSA 3BJHA 3FWCA 1CLBA 4I5LB 2BL0C 2LUCA 3HCMA 4PE4A 1S3PA 3O6BA 1Y1XA 3O78A 2WCLA 2ZFDA 4ORCB 5HLOA 1Y6WA 3CLNA 1LA0A 3OHMB 3GOFA 1W7IB 3D74A 3PJIA 3B88A 4HREE 5D3OA 1CDLA 3GK2A 3DVMA 1B8RA 1XFRA 1DJXA 1D1OA 1Z4HA 2BECA 2WOSA 5DKQA 2LV7A 1SKTA 1ZFSA 4DIRA 4GFTA 1WDCC 3CTNA 3WHUB 3BQ3A 2JTTA 2M49B 1P28A 2LC5A 1N2DA 1QXPA 1JF0A 1K90D 1PVBA 4MRYA 3KF9A 3KEVA 1NCZA 5K89A 3DF0B 1XFVO 1X02A 5F6TA 5HKZA 1UHJA 2Y4QA 1RROA 5BPJA 2F3ZA 2M1KB 2LM5A 5J3XA 3IVTA 1NWDA 3GK4X 3OX6A 3A8RA 2JU0A 2KHNA 3R1PA 1K96A 4D1EA 3DYEA 1C7VA 3ICBA 4XJKB 1UHNA 1CKKA 1E8AA 2PALA 1QIVA 2CTNA 1FI6A 4TNCA 3EG5B 1YUUA 3NGVA 3PALA 5CSFA 1G8IA 1NCYA 1G33A 2PSRA 3SG2A 1DVIA 1KQMB 3QRXA 4PDZA 1DC1A 3SG6A 1OSAA 1EH2A 2BNXA 1KK8B 1SCMC 1KSMA 4JPZB 2HETA 1TNWA 1AP4A 4M2OA 2L2EA 1AJ5A 4WRIA 4GUKA 4PE7A 2KLDA 2NCPA 1DEKA 4MZLA 1BR1B 2K7DA 1WLZA 3LK1A 1LS8A 1N0YA 1CM4A 4NQGA 4YGDB 3FE8A 5TNCA 1TCOB 4PCWA 1QJTA 1EJ3A 2LP3A 2BE4A 1H4BA 2O60A 4I5KA 2JQ6A 2P70A 2QACA 1HT9A 1YUSA 2MJWB 3BFHA 3BUWB 3OB1B 4MBEA 4OCIA 4F7FA 1DF0B 3LLEA 3EKHA 1JFJA 1RK9A 2Y1MA 3BXKA 3PATA 1ZACA 1J1DA 4GPLB 2LMVA 1IRJA 2KQYA 2PASA 3NSOA 5ER5A 1K9UA 1QIWA 2LVKA 3SJSA 2FJYA 3M0WA 3DVKA 2ZNDA 1BT6A 4INXA 1B47A 4CLNA 4R1EA 3VRQA 4HSZA 2K60A 1QX2A 1B4CA 1N65A 2K61A 4DCKA 1QASA 1ODBA 1QTXA 5ER4X 1FI5A 1PSBA 1IJ6A 1Z2CB 2LMTA 2OTGB 2OS8B 4MLWA 3C1VA 3TDIA 1MF8B 2B1UA 4OZDA 3SG4A 1AHRA 3L47A 3WHTB 1BLQA 1CB1A 1OE9B 5HL1A 4OVNF 2Q4UA 2BCXA 1OOFA 3D77A 1S6IA 2WCHA 1IGVA 2F2OA 1A4PA 4WQ3A 2KGRA 2JNFA 4Q04A 1RWYA 2HQ8A 1K93D 1KK7Y 1K8UA 1DJHA 2JT0A 2ISDA 1TNXA 2KI6D 3AAKA 1K9PA 1S1EA 1KFUL 1YUTA 2KPHA 1B7TY 2M97A 2LVVA 3I5FC 1KQMC 3S0FA 3EVUA 1S26D 2K7CA 3CZ0A 5CSNA 2H8VA 1KK8C 1C07A 1ZOTB 4GBAA 1OMRA 3TDUA 5HKYA 4BY4A 5PALA 2QEBA 1C3YA 1F4OA 1B9AA 1XYDA 4IL1A 4NDBA 1CFFA 1NP8A 5KTYA 3PM2A 1DQEA 2EGDA 3KO0A 1QLSA 2BAPA 3A4UB 2K0JA 3N7HA 3QMEA 1SBJA 1MWNA 1TUZA 2KBIA 1KFUS 1KWOC 3BFBA 1SCMB 1DF0A 2M7LA 1MR8A 3D0YA 1IIOA 2JPOA 2NZ0A 1NX0A 1GGZA 5DICA 2GGMA 2OPOA 1GGWA 2NCOA 1KK7Z 1SK6D 1TNQA 2L98A 1L2OB 3IQQA 1L7ZA 1PK0D 4ICBA 1XFZO 3FWBA 2LUXA 3SIAA 3ZNIA 1F55A 1B7TZ 4C0KA 2M0RA 1ALWA 1XFUO 2KFFA 1NCXA 1MXEA 4PHNA 5FI7A 2OTGC 1B8LA 1PALA 2OS8C 1SL8A 1V1FA 2WC6A 3HX4A 3NSLA 1CMFA 2EC6B 1DJZA 3OP0A 4CFRA 1A29A 2Y5IA 2HQWA 3DVEA 2COLB 1XFXO 2LHLA 2BCBA 2PRUA 3I5GC 2F33A 3L4AA 3TS5B 1EG4A 2GTEA 3DXLA 1F70A 5I2QA 1W7JB 4ZCVA 2SCPA 2LHIA 3BUMB 3PN7C 1IH0A 2QEHA 1XK4A 2RGIA 1B1GA 1XO5A 2LLUA 2KAYA 1OOHA 2Y1NA 4IJ7A 3TUYC 2H61A 1SNLA 4JKTA 2H61C 1NIWA 3NHIA 4YGCB 1PSRA 4ORBB 2I18A 1R6PA 1AUIB 1MUXA 2BKHB 2MA2A 2JXCA 1S6JA 2ZN9A 2GGZA 3VROA 1QS7A 2MRDA 3D76A 2LVIA 3FE6A 3VRRA 2PQLA 2G9BA 1BODA 3I5HC 4YBHB 1MHOA 1UURA 3R72A 1YURA 1OZSA 2KLEA 4MVFA 3SG5A 2M3WA 4DUQA 1GM0A 1CNPA 1R2UA 2D8NA 1DTLA 2AUCA 1TCFA 3FE9A 1NX1A 2CNPA 3I5FB 3NXAA 5FI2A 1KCYA 4I5JA 3O2PA 1AJ4A 1IQ3A 4YI8A 2WC8A 3VB1A 1U5IA 1EG3A 1XFYO 2KQ6A 3K21A 3OBVA 5AXIA 1RTP1 4MZKA 2WCEA 2LLTA 5HKWA 2V53A 4CIDA 3DVJA 3D73A 3RM1A 3OGNA 3SG7A 3VRNA 4ETOA 1C7WA 1VRKA 1OOGA 4DS7A 1L2OC 3DD4A 1KQVA 1XFWO 1DJYA 3NSKA 1YR5A 2PVBA 4YI9A 4L9MA 1KWOB 1YX7A 1T14A 1CDPA 1DJWA 4PHJA 4E68A 3B7AA 3D0YB 2JRFA 2JULA 2EC6C 2KFGA 1CDNA 2L5YA 5AERA 5DKRA 2WCJA 4U8DA 1IWQA 1UWOA 3FIAA 4QJ3B 2E30A 1OOIX 2E6WA 1J7PA 1IJ5A 3CZ1A 5I94A 2M29A 3JVTB 3TS5C 2KOTA 2HPSA 3R1OA 2ZNEA 1AVSA 5CSJA 1TWOA 3OX5A 3S0EA 2QPTA 2KAVA 1CLMA 5I2LA 1JUOA 1JF2A 1DGVA 2R2IA 2H2KA 3PM8A 2K7BA 1S6CA 3MSEB 2JOJA 4N1FA 5CPVA 4FQTA 1DT7B 1F54A 2GV5A 2MHHA 4P2YB 4PE1A 4AQIA 1YX8A 4HRGA 4YRUA 1M31A 1PULA 2Q91A 3BFAA 1RJVA 2TN4A 3I5GB 5D7FA 1SR6B 2JPTA 2JC2A 1TUJA 3NHTA 4MSPA 3PN7B 3PSRA 3CR5X 1M45A 1MXLC 3TUYB 1K94A 4GGNA 1PRWA 4XYNA 4MZJA 1J7QA 1B8CA 2HF5A 1DJIA 2BKIB 2LCPA 4I5NB 1F4QA 3I5IB 5CSIA 2WCKA 1XVJA 2KBMA 1S36A 2NLNA 2PYQA 4PHMA 3SS3A 2KYFA 4AQJA 4CFQA 3CZTX 3BUXB 1LINA 3I5HB 2WCFA 3PFVA 2JT8A 2WCBA 3O4XA 2JXLA 1YRTB 1FF1A 1K2HA 2WC5A 1SYMA 2DOQA 3WNXB 4YGAA 5FI6A 3RLZA 2QEOA 2PMYA 3WXAA 1NX2A 2LNKA 4NDDA 1DMOA 3BUOB 1U5IB 1OZOA 4ORAB 1ZUZA 1M63B 2A4JA 2M7NA 4AOMA 1QLKA 4P5OE 1DELA 4OKHA 1KSOA 1YVHA 2K2AA 2ZRTA 4QJ5B 1SW8A 3NSIA 3BUNB 4HRHA 3JVTC 2MBXA 1M39A 1Y0VH 2L0PA 4NDCA 4USLA 1WRKA 1ORGA 1EL4A 3TDZA 2M1UA 4A4BA 2QEVA 4PT1A 2M9GA 3B6XA 2JNXA 3CR2A 3S0DA 3VRPA 3CABA 5JJGA 2LP2A 1CFDA 3RZSA 2SASA 3AAJA 2KAXA 2LAPA 3EVVA 1BU3A 3L4LA 2JWWA 1JC2A 2WORA 1EXRA 1UHHA 2F3YA 2KI4B 1FBVA 1RFJA 1TRFA 2JZIA 1SR6C 1BOCA 3B87A 1Y1UA 3H4SE 1QX5B 1UHKA 4C0LA 4OR9B 1XK4C 1J55A 1NUBA 1SMGA 3BOWA 3S0BA 5HLVA 2KDHA 3SS4A 2P6BB 2FJUB
chains in the Genus database with same CATH topology
3I5IC 2M8UA 1V1GA 1H8BA 1TIZA 1QX7A 4MEWA 3ZWHA 1DJGA 5I8NA 1TOPA 2JTZA 3IQOA 4FTGA 1J7OA 3SG3A 1TTXA 1OQPA 1A75A 4N5XA 3SIBA 2KFHA 1BMOA 1CTRA 1QATA 3JTDC 5JOLA 4N1GA 4YGBB 2EHBA 3EK7A 1OMDA 2KYCA 3KHEA 3GK1A 4BY5A 4CPVA 1WRZA 2VRGA 1QVIY 1SY9A 1TN4A 2L51A 2WNDA 1YRUB 3E3RA 5GQQC 1BG1A 2ZN8A 1LVCD 1WY9A 2MAZA 1A03A 1J1EA 4UPGA 1FPWA 2LMUA 4A4CA 4PALA 1GQMA 1NPQA 1XA5A 1BJFA 5G08A 2I7AA 1Y1AA 1CLLA 2I2RE 1NYAA 2ZKMX 3CWGA 1QV1A 1SPYA 5AFPA 1CFPA 1NX3A 5KU1A 5AEQA 2AAOA 5B8IB 2MLEC 3AKAA 3CS1A 3VGOA 3TZ1A 1YVLA 1AK8A 3EK8A 2KI4C 4PE0A 2CBLA 2LLSA 1QV0A 4MN0A 4JQ0D 1SRAA 1UP5A 3EK4A 4F0ZB 1F8HA 1S5GY 3PLFB 1YTZC 2KSPA 4WQ2A 1IKUA 1MQ1A 1SCVA 1A2XA 2JT3A 5IBWA 1QVIZ 1NSHA 2LVJA 3IF7A 4M2QA 2K7OA 3KPXA 1J7RA 2MLFC 1CFCA 1HQVA 1FW4A 4YGEB 2L4IA 2BE6A 4FQOA 1JFKA 2BL0B 2L5XB 2F8PA 3F45A 2O5GA 4GGFA 3BYAA 1IG5A 1WRLA 4GGFC 4M2PA 4JWQA 2L50A 3FS7A 1IQ5A 2CXJA 3BOWB 4GAOA 2L4HA 1Q80A 1OOJA 5D69A 2KGBC 1SL9A 3DF0A 1JSAA 1BF5A 4PHKA 2BBMA 5DKNA 1M46A 2KI6C 1CDMA 1G4YR 1K9KA 2AMIA 2F2PA 2LANA 2KNEA 4OV2A 1JWDA 1RECA 1ALVA 5HYDA 1CMGA 4GNKB 1WDCB 2BCAA 4XJKA 3LL8B 1LA3A 4C0JA 3OB2B 2CCMA 1LXFC 1S5GZ 1A75B 3EVRA 1TNPA 2K2FA 3JTDB 3D10A 1KFXL 1PVAA 2NXQA 1WLMA 2LE9B 1BR4B 3AKBA 3O4YA 1CM1A 5AANA 5FYXA 1SL7A 4DRWA 2ZRSA 3LK0A 2G2BA 4QJ4B 4ZCUA 2BBNA 5I2OA 1GJYA 3LCPC 1ZMZA 1OMVA 2FCEA 2FCDA 2K8MB 1JBAA 2IS9A 1F71A 1UHIA 5KSZA 1K95A 2CT9A 3EKJA 2FOTA 4MRXA 3CGAA 1KFXS 3CR4X 2I94A 1DGUA 1LKJA 1UUSA 3FWCA 1CLBA 4I5LB 2BL0C 2LUCA 3HCMA 4PE4A 1S3PA 3O6BA 1Y1XA 3O78A 2ZFDA 4ORCB 5HLOA 1Y6WA 3CLNA 1LA0A 3OHMB 3GOFA 1W7IB 4HREE 1CDLA 3GK2A 3DVMA 1B8RA 1DJXA 1D1OA 2BECA 2WOSA 5DKQA 2LV7A 1SKTA 1ZFSA 4DIRA 4GFTA 1WDCC 3CTNA 3WHUB 3BQ3A 2JTTA 2M49B 2LC5A 1N2DA 1QXPA 1JF0A 1K90D 1PVBA 4MRYA 3KF9A 3KEVA 1NCZA 5K89A 3DF0B 1XFVO 1X02A 5F6TA 5HKZA 1UHJA 2Y4QA 1RROA 5BPJA 2F3ZA 2M1KB 2LM5A 5J3XA 1NWDA 3GK4X 3OX6A 3A8RA 2JU0A 2KHNA 4D1EA 1K96A 1C7VA 3ICBA 4XJKB 1UHNA 1CKKA 1E8AA 2PALA 1QIVA 2CTNA 1FI6A 4TNCA 1YUUA 3PALA 5CSFA 1G8IA 1NCYA 1G33A 2PSRA 3SG2A 1DVIA 1KQMB 3QRXA 4PDZA 3SG6A 1OSAA 1EH2A 1KK8B 1SCMC 1KSMA 4JPZB 2HETA 1TNWA 1AP4A 4M2OA 2L2EA 1AJ5A 4WRIA 4GUKA 4PE7A 2NCPA 4MZLA 1BR1B 2K7DA 1WLZA 3LK1A 4YGDB 1N0YA 1CM4A 4NQGA 5TNCA 1TCOB 4PCWA 1QJTA 1EJ3A 2LP3A 2BE4A 1H4BA 2O60A 4I5KA 2JQ6A 2QACA 1HT9A 1YUSA 2MJWB 3OB1B 3BUWB 4MBEA 1BLQA 4OCIA 1DF0B 3LLEA 3EKHA 1JFJA 1RK9A 2Y1MA 3BXKA 3PATA 1ZACA 1J1DA 4GPLB 2LMVA 1IRJA 2KQYA 2PASA 3NSOA 5ER5A 1K9UA 1QIWA 2LVKA 3SJSA 3M0WA 3DVKA 2ZNDA 1BT6A 1B47A 4CLNA 4R1EA 3VRQA 4HSZA 1QX2A 1B4CA 1N65A 2K61A 4DCKA 1QASA 1ODBA 1QTXA 5ER4X 1FI5A 1PSBA 1IJ6A 2LMTA 2OTGB 2OS8B 4MLWA 3C1VA 3TDIA 1MF8B 2B1UA 3SG4A 3WHTB 1AHRA 1CB1A 1OE9B 4OVNF 2Q4UA 2BCXA 1S6IA 1IGVA 2F2OA 1A4PA 4WQ3A 2KGRA 2JNFA 4Q04A 1RWYA 2HQ8A 1K93D 1KK7Y 1K8UA 1DJHA 2JT0A 2ISDA 1TNXA 2KI6D 3AAKA 1K9PA 1S1EA 1KFUL 1YUTA 1B7TY 2M97A 2LVVA 3I5FC 1KQMC 3EVUA 1S26D 2K7CA 5CSNA 1KK8C 1C07A 1ZOTB 4GBAA 1OMRA 3TDUA 5HKYA 4BY4A 5PALA 1F4OA 1B9AA 1XYDA 4IL1A 4NDBA 1CFFA 1NP8A 5KTYA 2EGDA 3KO0A 1QLSA 3A4UB 2K0JA 1SBJA 1MWNA 2KBIA 1KFUS 1KWOC 2M7LA 1SCMB 1DF0A 1MR8A 3D0YA 2NZ0A 1NX0A 1GGZA 2GGMA 2OPOA 1GGWA 2NCOA 1KK7Z 1SK6D 1TNQA 2L98A 1L2OB 3IQQA 1L7ZA 1PK0D 4ICBA 1XFZO 3FWBA 2LUXA 3SIAA 3ZNIA 1F55A 1B7TZ 4C0KA 2M0RA 1ALWA 1XFUO 2KFFA 1NCXA 1MXEA 4PHNA 2OTGC 1B8LA 1PALA 2OS8C 1SL8A 1V1FA 3NSLA 3HX4A 1CMFA 2EC6B 1DJZA 3OP0A 4CFRA 1A29A 2Y5IA 2HQWA 3DVEA 2COLB 1XFXO 2LHLA 2BCBA 2PRUA 3I5GC 2F33A 3TS5B 1F70A 1EG4A 5I2QA 1W7JB 4ZCVA 2SCPA 2LHIA 3BUMB 3PN7C 1IH0A 2RGIA 1XK4A 1B1GA 1XO5A 2LLUA 2KAYA 2Y1NA 3TUYC 2H61A 1SNLA 2H61C 1NIWA 4YGCB 1PSRA 4ORBB 2I18A 1R6PA 1AUIB 1MUXA 2BKHB 2MA2A 2JXCA 1S6JA 2ZN9A 2GGZA 3VROA 1QS7A 2MRDA 2LVIA 3VRRA 2G9BA 1BODA 3I5HC 4YBHB 1MHOA 1UURA 4MVFA 1YURA 1OZSA 3SG5A 4DUQA 2M3WA 1CNPA 1R2UA 2D8NA 1DTLA 2AUCA 1TCFA 1NX1A 2CNPA 3I5FB 3NXAA 1KCYA 4I5JA 3O2PA 1AJ4A 1IQ3A 4YI8A 2WC8A 1U5IA 1EG3A 1XFYO 2KQ6A 3K21A 5AXIA 1RTP1 4MZKA 2WCEA 2LLTA 5HKWA 2V53A 4CIDA 3DVJA 3RM1A 3SG7A 3VRNA 4ETOA 1C7WA 1VRKA 4DS7A 1L2OC 3DD4A 1KQVA 1XFWO 1DJYA 3NSKA 1YR5A 2PVBA 4YI9A 4L9MA 1KWOB 1YX7A 1CDPA 1DJWA 4PHJA 4E68A 3D0YB 2JRFA 2JULA 2EC6C 2KFGA 1CDNA 5AERA 5DKRA 4U8DA 1IWQA 1UWOA 3FIAA 4QJ3B 2E30A 2E6WA 1J7PA 1IJ5A 2M29A 3JVTB 3TS5C 2KOTA 2HPSA 2ZNEA 1AVSA 5CSJA 3OX5A 2QPTA 2KAVA 1CLMA 5I2LA 1JUOA 1JF2A 1DGVA 2R2IA 2H2KA 3PM8A 2K7BA 1S6CA 3MSEB 2JOJA 4N1FA 5CPVA 1DT7B 1F54A 2GV5A 2MHHA 4P2YB 4PE1A 4AQIA 1YX8A 4HRGA 4YRUA 1M31A 1PULA 2Q91A 1RJVA 2TN4A 3I5GB 5D7FA 1SR6B 2JPTA 2JC2A 4MSPA 3PN7B 3PSRA 3CR5X 1M45A 1MXLC 3TUYB 1K94A 4GGNA 1PRWA 4XYNA 4MZJA 1J7QA 1B8CA 2HF5A 1DJIA 2BKIB 2LCPA 4I5NB 1F4QA 3I5IB 5CSIA 1XVJA 2KBMA 1S36A 2NLNA 4PHMA 4AQJA 2KYFA 4CFQA 3CZTX 3BUXB 1LINA 3I5HB 2WCFA 3PFVA 2JT8A 2WCBA 2JXLA 1YRTB 1FF1A 1K2HA 1SYMA 2DOQA 3WNXB 4YGAA 3RLZA 2PMYA 3WXAA 1NX2A 2LNKA 4NDDA 1DMOA 3BUOB 1U5IB 1OZOA 4ORAB 1ZUZA 1M63B 2A4JA 2M7NA 4AOMA 1QLKA 4P5OE 4OKHA 1KSOA 1YVHA 2K2AA 2ZRTA 4QJ5B 1SW8A 3NSIA 3BUNB 4HRHA 3JVTC 2MBXA 1M39A 1Y0VH 2L0PA 4NDCA 4USLA 1WRKA 3TDZA 1EL4A 2M1UA 4A4BA 2M9GA 2JNXA 3CR2A 3VRPA 5JJGA 2LP2A 1CFDA 2SASA 3AAJA 2KAXA 2LAPA 3EVVA 1BU3A 2JWWA 1JC2A 2WORA 1EXRA 1UHHA 2F3YA 2KI4B 1FBVA 1RFJA 1TRFA 2JZIA 1SR6C 1BOCA 1Y1UA 3H4SE 1QX5B 1UHKA 4C0LA 4OR9B 1XK4C 1J55A 1NUBA 1SMGA 3BOWA 5HLVA 2KDHA 2P6BB 2FJUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5I C;  2M8U A;  1V1G A;  1H8B A;  1TIZ A;  1QX7 A;  4MEW A;  3ZWH A;  1DJG A;  5I8N A;  1TOP A;  2JTZ A;  3IQO A;  4FTG A;  1J7O A;  3SG3 A;  1TTX A;  1OQP A;  1A75 A;  4N5X A;  3SIB A;  2KFH A;  1BMO A;  1CTR A;  1QAT A;  3JTD C;  5JOL A;  4N1G A;  4YGB B;  2EHB A;  3EK7 A;  1OMD A;  2KYC A;  3KHE A;  3GK1 A;  4BY5 A;  4CPV A;  1WRZ A;  2VRG A;  1QVI Y;  1SY9 A;  1TN4 A;  2L51 A;  2WND A;  1YRU B;  3E3R A;  5GQQ C;  1BG1 A;  2ZN8 A;  1LVC D;  1WY9 A;  2MAZ A;  1A03 A;  1J1E A;  4UPG A;  1FPW A;  2LMU A;  4A4C A;  4PAL A;  1GQM A;  1NPQ A;  1XA5 A;  1BJF A;  5G08 A;  2I7A A;  1Y1A A;  1CLL A;  2I2R E;  1NYA A;  2ZKM X;  3CWG A;  1QV1 A;  1SPY A;  5AFP A;  1CFP A;  1NX3 A;  5KU1 A;  5AEQ A;  2AAO A;  5B8I B;  2MLE C;  3AKA A;  3CS1 A;  3VGO A;  3TZ1 A;  1YVL A;  1AK8 A;  3EK8 A;  2KI4 C;  4PE0 A;  2CBL A;  2LLS A;  1QV0 A;  4MN0 A;  4JQ0 D;  1SRA A;  1UP5 A;  3EK4 A;  4F0Z B;  1F8H A;  1S5G Y;  3PLF B;  1YTZ C;  2KSP A;  4WQ2 A;  1IKU A;  1MQ1 A;  1SCV A;  1A2X A;  2JT3 A;  5IBW A;  1QVI Z;  1NSH A;  2LVJ A;  3IF7 A;  4M2Q A;  2K7O A;  3KPX A;  1J7R A;  2MLF C;  1CFC A;  1HQV A;  1FW4 A;  4YGE B;  2L4I A;  2BE6 A;  4FQO A;  1JFK A;  2BL0 B;  2L5X B;  2F8P A;  3F45 A;  2O5G A;  4GGF A;  3BYA A;  1IG5 A;  1WRL A;  4GGF C;  4M2P A;  4JWQ A;  2L50 A;  3FS7 A;  1IQ5 A;  2CXJ A;  3BOW B;  4GAO A;  2L4H A;  1Q80 A;  1OOJ A;  5D69 A;  2KGB C;  1SL9 A;  3DF0 A;  1JSA A;  1BF5 A;  4PHK A;  2BBM A;  5DKN A;  1M46 A;  2KI6 C;  1CDM A;  1G4Y R;  1K9K A;  2AMI A;  2F2P A;  2LAN A;  2KNE A;  4OV2 A;  1JWD A;  1REC A;  1ALV A;  5HYD A;  1CMG A;  4GNK B;  1WDC B;  2BCA A;  4XJK A;  3LL8 B;  1LA3 A;  4C0J A;  3OB2 B;  2CCM A;  1LXF C;  1S5G Z;  1A75 B;  3EVR A;  1TNP A;  2K2F A;  3JTD B;  3D10 A;  1KFX L;  1PVA A;  2NXQ A;  1WLM A;  2LE9 B;  1BR4 B;  3AKB A;  3O4Y A;  1CM1 A;  5AAN A;  5FYX A;  1SL7 A;  4DRW A;  2ZRS A;  3LK0 A;  2G2B A;  4QJ4 B;  4ZCU A;  2BBN A;  5I2O A;  1GJY A;  3LCP C;  1ZMZ A;  1OMV A;  2FCE A;  2FCD A;  2K8M B;  1JBA A;  2IS9 A;  1F71 A;  1UHI A;  5KSZ A;  1K95 A;  2CT9 A;  3EKJ A;  2FOT A;  4MRX A;  3CGA A;  1KFX S;  3CR4 X;  2I94 A;  1DGU A;  1LKJ A;  1UUS A;  3FWC A;  1CLB A;  4I5L B;  2BL0 C;  2LUC A;  3HCM A;  4PE4 A;  1S3P A;  3O6B A;  1Y1X A;  3O78 A;  2ZFD A;  4ORC B;  5HLO A;  1Y6W A;  3CLN A;  1LA0 A;  3OHM B;  3GOF A;  1W7I B;  4HRE E;  1CDL A;  3GK2 A;  3DVM A;  1B8R A;  1DJX A;  1D1O A;  2BEC A;  2WOS A;  5DKQ A;  2LV7 A;  1SKT A;  1ZFS A;  4DIR A;  4GFT A;  1WDC C;  3CTN A;  3WHU B;  3BQ3 A;  2JTT A;  2M49 B;  2LC5 A;  1N2D A;  1QXP A;  1JF0 A;  1K90 D;  1PVB A;  4MRY A;  3KF9 A;  3KEV A;  1NCZ A;  5K89 A;  3DF0 B;  1XFV O;  1X02 A;  5F6T A;  5HKZ A;  1UHJ A;  2Y4Q A;  1RRO A;  5BPJ A;  2F3Z A;  2M1K B;  2LM5 A;  5J3X A;  1NWD A;  3GK4 X;  3OX6 A;  3A8R A;  2JU0 A;  2KHN A;  4D1E A;  1K96 A;  1C7V A;  3ICB A;  4XJK B;  1UHN A;  1CKK A;  1E8A A;  2PAL A;  1QIV A;  2CTN A;  1FI6 A;  4TNC A;  1YUU A;  3PAL A;  5CSF A;  1G8I A;  1NCY A;  1G33 A;  2PSR A;  3SG2 A;  1DVI A;  1KQM B;  3QRX A;  4PDZ A;  3SG6 A;  1OSA A;  1EH2 A;  1KK8 B;  1SCM C;  1KSM A;  4JPZ B;  2HET A;  1TNW A;  1AP4 A;  4M2O A;  2L2E A;  1AJ5 A;  4WRI A;  4GUK A;  4PE7 A;  2NCP A;  4MZL A;  1BR1 B;  2K7D A;  1WLZ A;  3LK1 A;  4YGD B;  1N0Y A;  1CM4 A;  4NQG A;  5TNC A;  1TCO B;  4PCW A;  1QJT A;  1EJ3 A;  2LP3 A;  2BE4 A;  1H4B A;  2O60 A;  4I5K A;  2JQ6 A;  2QAC A;  1HT9 A;  1YUS A;  2MJW B;  3OB1 B;  3BUW B;  4MBE A;  1BLQ A;  4OCI A;  1DF0 B;  3LLE A;  3EKH A;  1JFJ A;  1RK9 A;  2Y1M A;  3BXK A;  3PAT A;  1ZAC A;  1J1D A;  4GPL B;  2LMV A;  1IRJ A;  2KQY A;  2PAS A;  3NSO A;  5ER5 A;  1K9U A;  1QIW A;  2LVK A;  3SJS A;  3M0W A;  3DVK A;  2ZND A;  1BT6 A;  1B47 A;  4CLN A;  4R1E A;  3VRQ A;  4HSZ A;  1QX2 A;  1B4C A;  1N65 A;  2K61 A;  4DCK A;  1QAS A;  1ODB A;  1QTX A;  5ER4 X;  1FI5 A;  1PSB A;  1IJ6 A;  2LMT A;  2OTG B;  2OS8 B;  4MLW A;  3C1V A;  3TDI A;  1MF8 B;  2B1U A;  3SG4 A;  3WHT B;  1AHR A;  1CB1 A;  1OE9 B;  4OVN F;  2Q4U A;  2BCX A;  1S6I A;  1IGV A;  2F2O A;  1A4P A;  4WQ3 A;  2KGR A;  2JNF A;  4Q04 A;  1RWY A;  2HQ8 A;  1K93 D;  1KK7 Y;  1K8U A;  1DJH A;  2JT0 A;  2ISD A;  1TNX A;  2KI6 D;  3AAK A;  1K9P A;  1S1E A;  1KFU L;  1YUT A;  1B7T Y;  2M97 A;  2LVV A;  3I5F C;  1KQM C;  3EVU A;  1S26 D;  2K7C A;  5CSN A;  1KK8 C;  1C07 A;  1ZOT B;  4GBA A;  1OMR A;  3TDU A;  5HKY A;  4BY4 A;  5PAL A;  1F4O A;  1B9A A;  1XYD A;  4IL1 A;  4NDB A;  1CFF A;  1NP8 A;  5KTY A;  2EGD A;  3KO0 A;  1QLS A;  3A4U B;  2K0J A;  1SBJ A;  1MWN A;  2KBI A;  1KFU S;  1KWO C;  2M7L A;  1SCM B;  1DF0 A;  1MR8 A;  3D0Y A;  2NZ0 A;  1NX0 A;  1GGZ A;  2GGM A;  2OPO A;  1GGW A;  2NCO A;  1KK7 Z;  1SK6 D;  1TNQ A;  2L98 A;  1L2O B;  3IQQ A;  1L7Z A;  1PK0 D;  4ICB A;  1XFZ O;  3FWB A;  2LUX A;  3SIA A;  3ZNI A;  1F55 A;  1B7T Z;  4C0K A;  2M0R A;  1ALW A;  1XFU O;  2KFF A;  1NCX A;  1MXE A;  4PHN A;  2OTG C;  1B8L A;  1PAL A;  2OS8 C;  1SL8 A;  1V1F A;  3NSL A;  3HX4 A;  1CMF A;  2EC6 B;  1DJZ A;  3OP0 A;  4CFR A;  1A29 A;  2Y5I A;  2HQW A;  3DVE A;  2COL B;  1XFX O;  2LHL A;  2BCB A;  2PRU A;  3I5G C;  2F33 A;  3TS5 B;  1F70 A;  1EG4 A;  5I2Q A;  1W7J B;  4ZCV A;  2SCP A;  2LHI A;  3BUM B;  3PN7 C;  1IH0 A;  2RGI A;  1XK4 A;  1B1G A;  1XO5 A;  2LLU A;  2KAY A;  2Y1N A;  3TUY C;  2H61 A;  1SNL A;  2H61 C;  1NIW A;  4YGC B;  1PSR A;  4ORB B;  2I18 A;  1R6P A;  1AUI B;  1MUX A;  2BKH B;  2MA2 A;  2JXC A;  1S6J A;  2ZN9 A;  2GGZ A;  3VRO A;  1QS7 A;  2MRD A;  2LVI A;  3VRR A;  2G9B A;  1BOD A;  3I5H C;  4YBH B;  1MHO A;  1UUR A;  4MVF A;  1YUR A;  1OZS A;  3SG5 A;  4DUQ A;  2M3W A;  1CNP A;  1R2U A;  2D8N A;  1DTL A;  2AUC A;  1TCF A;  1NX1 A;  2CNP A;  3I5F B;  3NXA A;  1KCY A;  4I5J A;  3O2P A;  1AJ4 A;  1IQ3 A;  4YI8 A;  2WC8 A;  1U5I A;  1EG3 A;  1XFY O;  2KQ6 A;  3K21 A;  5AXI A;  1RTP 1;  4MZK A;  2WCE A;  2LLT A;  5HKW A;  2V53 A;  4CID A;  3DVJ A;  3RM1 A;  3SG7 A;  3VRN A;  4ETO A;  1C7W A;  1VRK A;  4DS7 A;  1L2O C;  3DD4 A;  1KQV A;  1XFW O;  1DJY A;  3NSK A;  1YR5 A;  2PVB A;  4YI9 A;  4L9M A;  1KWO B;  1YX7 A;  1CDP A;  1DJW A;  4PHJ A;  4E68 A;  3D0Y B;  2JRF A;  2JUL A;  2EC6 C;  2KFG A;  1CDN A;  5AER A;  5DKR A;  4U8D A;  1IWQ A;  1UWO A;  3FIA A;  4QJ3 B;  2E30 A;  2E6W A;  1J7P A;  1IJ5 A;  2M29 A;  3JVT B;  3TS5 C;  2KOT A;  2HPS A;  2ZNE A;  1AVS A;  5CSJ A;  3OX5 A;  2QPT A;  2KAV A;  1CLM A;  5I2L A;  1JUO A;  1JF2 A;  1DGV A;  2R2I A;  2H2K A;  3PM8 A;  2K7B A;  1S6C A;  3MSE B;  2JOJ A;  4N1F A;  5CPV A;  1DT7 B;  1F54 A;  2GV5 A;  2MHH A;  4P2Y B;  4PE1 A;  4AQI A;  1YX8 A;  4HRG A;  4YRU A;  1M31 A;  1PUL A;  2Q91 A;  1RJV A;  2TN4 A;  3I5G B;  5D7F A;  1SR6 B;  2JPT A;  2JC2 A;  4MSP A;  3PN7 B;  3PSR A;  3CR5 X;  1M45 A;  1MXL C;  3TUY B;  1K94 A;  4GGN A;  1PRW A;  4XYN A;  4MZJ A;  1J7Q A;  1B8C A;  2HF5 A;  1DJI A;  2BKI B;  2LCP A;  4I5N B;  1F4Q A;  3I5I B;  5CSI A;  1XVJ A;  2KBM A;  1S36 A;  2NLN A;  4PHM A;  4AQJ A;  2KYF A;  4CFQ A;  3CZT X;  3BUX B;  1LIN A;  3I5H B;  2WCF A;  3PFV A;  2JT8 A;  2WCB A;  2JXL A;  1YRT B;  1FF1 A;  1K2H A;  1SYM A;  2DOQ A;  3WNX B;  4YGA A;  3RLZ A;  2PMY A;  3WXA A;  1NX2 A;  2LNK A;  4NDD A;  1DMO A;  3BUO B;  1U5I B;  1OZO A;  4ORA B;  1ZUZ A;  1M63 B;  2A4J A;  2M7N A;  4AOM A;  1QLK A;  4P5O E;  4OKH A;  1KSO A;  1YVH A;  2K2A A;  2ZRT A;  4QJ5 B;  1SW8 A;  3NSI A;  3BUN B;  4HRH A;  3JVT C;  2MBX A;  1M39 A;  1Y0V H;  2L0P A;  4NDC A;  4USL A;  1WRK A;  3TDZ A;  1EL4 A;  2M1U A;  4A4B A;  2M9G A;  2JNX A;  3CR2 A;  3VRP A;  5JJG A;  2LP2 A;  1CFD A;  2SAS A;  3AAJ A;  2KAX A;  2LAP A;  3EVV A;  1BU3 A;  2JWW A;  1JC2 A;  2WOR A;  1EXR A;  1UHH A;  2F3Y A;  2KI4 B;  1FBV A;  1RFJ A;  1TRF A;  2JZI A;  1SR6 C;  1BOC A;  1Y1U A;  3H4S E;  1QX5 B;  1UHK A;  4C0L A;  4OR9 B;  1XK4 C;  1J55 A;  1NUB A;  1SMG A;  3BOW A;  5HLV A;  2KDH A;  2P6B B;  2FJU B; 
#chains in the Genus database with same CATH topology
 3I5I C;  3D78 A;  2M8U A;  3K1E A;  1V1G A;  1H8B A;  1TIZ A;  1C3Z A;  1QX7 A;  4MEW A;  4KYN A;  3S0G A;  3ZWH A;  1DJG A;  5I8N A;  1TOP A;  2JTZ A;  3IQO A;  4FTG A;  3UNW A;  3SG3 A;  1TTX A;  1J7O A;  1OQP A;  1A75 A;  4N5X A;  3SIB A;  2KFH A;  1BMO A;  1CTR A;  1QAT A;  3JTD C;  5JOL A;  4N1G A;  4YGB B;  2EHB A;  3EK7 A;  1OMD A;  3CDN A;  2KYC A;  3KHE A;  3DZT A;  3GK1 A;  4BY5 A;  1WRZ A;  4CPV A;  2VRG A;  3CZ2 A;  3S0A A;  1QVI Y;  1SY9 A;  1TN4 A;  2L51 A;  2WND A;  1YRU B;  3E3R A;  5GQQ C;  1BG1 A;  2ZN8 A;  1LVC D;  1WY9 A;  3V2L A;  2MAZ A;  1A03 A;  1J1E A;  4UPG A;  1FPW A;  2LMU A;  4A4C A;  4PAL A;  3B86 A;  1GQM A;  1NPQ A;  1XA5 A;  1BJF A;  5G08 A;  2I7A A;  1Y1A A;  1CLL A;  2I2R E;  1NYA A;  2ZKM X;  3CWG A;  1QV1 A;  1SPY A;  2QDI A;  5AFP A;  1CFP A;  1NX3 A;  5KU1 A;  3Q8I A;  5AEQ A;  2AAO A;  5B8I B;  2MLE C;  3AKA A;  3CS1 A;  3VGO A;  3TZ1 A;  1YVL A;  1AK8 A;  3EK8 A;  2KI4 C;  3CYZ A;  4PE0 A;  2CBL A;  2LLS A;  1QV0 A;  4MN0 A;  4JQ0 D;  1SRA A;  1UP5 A;  3EK4 A;  4F0Z B;  1F8H A;  1S5G Y;  3PLF B;  1YTZ C;  2KSP A;  4WQ2 A;  5EL2 A;  1IKU A;  1MQ1 A;  1SCV A;  1A2X A;  2JT3 A;  5IBW A;  1QVI Z;  1NSH A;  2LVJ A;  3IF7 A;  4M2Q A;  2K7O A;  3KPX A;  1J7R A;  2MLF C;  1CFC A;  1HQV A;  1FW4 A;  4YGE B;  1W9Z A;  2L4I A;  2BE6 A;  4FQO A;  1JFK A;  2BL0 B;  2L5X B;  1QWV A;  2WCM A;  1OW4 A;  2F8P A;  3DY9 A;  3F45 A;  2O5G A;  4GGF A;  2ERB A;  1IG5 A;  1WRL A;  3BYA A;  4GGF C;  4M2P A;  4JWQ A;  2L50 A;  3FS7 A;  3UO9 A;  1IQ5 A;  2CXJ A;  3BOW B;  4GAO A;  2L4H A;  1Q80 A;  1OOJ A;  5D69 A;  2KGB C;  1SL9 A;  3DF0 A;  1JSA A;  1BF5 A;  4PHK A;  2BBM A;  5DKN A;  1M46 A;  2KI6 C;  3SS5 A;  1CDM A;  1G4Y R;  1K9K A;  2AMI A;  2F2P A;  2LAN A;  4INW A;  2KNE A;  4OV2 A;  1JWD A;  1REC A;  1ALV A;  5HYD A;  1CMG A;  4GNK B;  1WDC B;  2BCA A;  4XJK A;  3LL8 B;  1LA3 A;  4C0J A;  3OB2 B;  2CCM A;  1LXF C;  1S5G Z;  1A75 B;  3EVR A;  1TNP A;  2K2F A;  3JTD B;  3R1V A;  4JD9 A;  3D10 A;  1KFX L;  1PVA A;  2NXQ A;  1WLM A;  2LE9 B;  1BR4 B;  3AKB A;  3O4Y A;  1CM1 A;  5AAN A;  5FYX A;  1SL7 A;  4DRW A;  2ZRS A;  3LK0 A;  2G2B A;  4QJ4 B;  4ZCU A;  2BBN A;  5I2O A;  1GJY A;  3LCP C;  1ZMZ A;  1OMV A;  2FCE A;  2FCD A;  2P71 A;  1SSE B;  2K8M B;  1JBA A;  2YGU A;  2IS9 A;  3D75 A;  1UHI A;  1F71 A;  5KSZ A;  1K95 A;  2CT9 A;  2L2C A;  3EKJ A;  2FOT A;  4MRX A;  3CGA A;  1KFX S;  3CR4 X;  2I94 A;  1DGU A;  1LKJ A;  1UUS A;  3BJH A;  3FWC A;  1CLB A;  4I5L B;  2BL0 C;  2LUC A;  3HCM A;  4PE4 A;  1S3P A;  3O6B A;  1Y1X A;  3O78 A;  2WCL A;  2ZFD A;  4ORC B;  5HLO A;  1Y6W A;  3CLN A;  1LA0 A;  3OHM B;  3GOF A;  1W7I B;  3D74 A;  3PJI A;  3B88 A;  4HRE E;  5D3O A;  1CDL A;  3GK2 A;  3DVM A;  1B8R A;  1XFR A;  1DJX A;  1D1O A;  1Z4H A;  2BEC A;  2WOS A;  5DKQ A;  2LV7 A;  1SKT A;  1ZFS A;  4DIR A;  4GFT A;  1WDC C;  3CTN A;  3WHU B;  3BQ3 A;  2JTT A;  2M49 B;  1P28 A;  2LC5 A;  1N2D A;  1QXP A;  1JF0 A;  1K90 D;  1PVB A;  4MRY A;  3KF9 A;  3KEV A;  1NCZ A;  5K89 A;  3DF0 B;  1XFV O;  1X02 A;  5F6T A;  5HKZ A;  1UHJ A;  2Y4Q A;  1RRO A;  5BPJ A;  2F3Z A;  2M1K B;  2LM5 A;  5J3X A;  3IVT A;  1NWD A;  3GK4 X;  3OX6 A;  3A8R A;  2JU0 A;  2KHN A;  3R1P A;  1K96 A;  4D1E A;  3DYE A;  1C7V A;  3ICB A;  4XJK B;  1UHN A;  1CKK A;  1E8A A;  2PAL A;  1QIV A;  2CTN A;  1FI6 A;  4TNC A;  3EG5 B;  1YUU A;  3NGV A;  3PAL A;  5CSF A;  1G8I A;  1NCY A;  1G33 A;  2PSR A;  3SG2 A;  1DVI A;  1KQM B;  3QRX A;  4PDZ A;  1DC1 A;  3SG6 A;  1OSA A;  1EH2 A;  2BNX A;  1KK8 B;  1SCM C;  1KSM A;  4JPZ B;  2HET A;  1TNW A;  1AP4 A;  4M2O A;  2L2E A;  1AJ5 A;  4WRI A;  4GUK A;  4PE7 A;  2KLD A;  2NCP A;  1DEK A;  4MZL A;  1BR1 B;  2K7D A;  1WLZ A;  3LK1 A;  1LS8 A;  1N0Y A;  1CM4 A;  4NQG A;  4YGD B;  3FE8 A;  5TNC A;  1TCO B;  4PCW A;  1QJT A;  1EJ3 A;  2LP3 A;  2BE4 A;  1H4B A;  2O60 A;  4I5K A;  2JQ6 A;  2P70 A;  2QAC A;  1HT9 A;  1YUS A;  2MJW B;  3BFH A;  3BUW B;  3OB1 B;  4MBE A;  4OCI A;  4F7F A;  1DF0 B;  3LLE A;  3EKH A;  1JFJ A;  1RK9 A;  2Y1M A;  3BXK A;  3PAT A;  1ZAC A;  1J1D A;  4GPL B;  2LMV A;  1IRJ A;  2KQY A;  2PAS A;  3NSO A;  5ER5 A;  1K9U A;  1QIW A;  2LVK A;  3SJS A;  2FJY A;  3M0W A;  3DVK A;  2ZND A;  1BT6 A;  4INX A;  1B47 A;  4CLN A;  4R1E A;  3VRQ A;  4HSZ A;  2K60 A;  1QX2 A;  1B4C A;  1N65 A;  2K61 A;  4DCK A;  1QAS A;  1ODB A;  1QTX A;  5ER4 X;  1FI5 A;  1PSB A;  1IJ6 A;  1Z2C B;  2LMT A;  2OTG B;  2OS8 B;  4MLW A;  3C1V A;  3TDI A;  1MF8 B;  2B1U A;  4OZD A;  3SG4 A;  1AHR A;  3L47 A;  3WHT B;  1BLQ A;  1CB1 A;  1OE9 B;  5HL1 A;  4OVN F;  2Q4U A;  2BCX A;  1OOF A;  3D77 A;  1S6I A;  2WCH A;  1IGV A;  2F2O A;  1A4P A;  4WQ3 A;  2KGR A;  2JNF A;  4Q04 A;  1RWY A;  2HQ8 A;  1K93 D;  1KK7 Y;  1K8U A;  1DJH A;  2JT0 A;  2ISD A;  1TNX A;  2KI6 D;  3AAK A;  1K9P A;  1S1E A;  1KFU L;  1YUT A;  2KPH A;  1B7T Y;  2M97 A;  2LVV A;  3I5F C;  1KQM C;  3S0F A;  3EVU A;  1S26 D;  2K7C A;  3CZ0 A;  5CSN A;  2H8V A;  1KK8 C;  1C07 A;  1ZOT B;  4GBA A;  1OMR A;  3TDU A;  5HKY A;  4BY4 A;  5PAL A;  2QEB A;  1C3Y A;  1F4O A;  1B9A A;  1XYD A;  4IL1 A;  4NDB A;  1CFF A;  1NP8 A;  5KTY A;  3PM2 A;  1DQE A;  2EGD A;  3KO0 A;  1QLS A;  2BAP A;  3A4U B;  2K0J A;  3N7H A;  3QME A;  1SBJ A;  1MWN A;  1TUZ A;  2KBI A;  1KFU S;  1KWO C;  3BFB A;  1SCM B;  1DF0 A;  2M7L A;  1MR8 A;  3D0Y A;  1IIO A;  2JPO A;  2NZ0 A;  1NX0 A;  1GGZ A;  5DIC A;  2GGM A;  2OPO A;  1GGW A;  2NCO A;  1KK7 Z;  1SK6 D;  1TNQ A;  2L98 A;  1L2O B;  3IQQ A;  1L7Z A;  1PK0 D;  4ICB A;  1XFZ O;  3FWB A;  2LUX A;  3SIA A;  3ZNI A;  1F55 A;  1B7T Z;  4C0K A;  2M0R A;  1ALW A;  1XFU O;  2KFF A;  1NCX A;  1MXE A;  4PHN A;  5FI7 A;  2OTG C;  1B8L A;  1PAL A;  2OS8 C;  1SL8 A;  1V1F A;  2WC6 A;  3HX4 A;  3NSL A;  1CMF A;  2EC6 B;  1DJZ A;  3OP0 A;  4CFR A;  1A29 A;  2Y5I A;  2HQW A;  3DVE A;  2COL B;  1XFX O;  2LHL A;  2BCB A;  2PRU A;  3I5G C;  2F33 A;  3L4A A;  3TS5 B;  1EG4 A;  2GTE A;  3DXL A;  1F70 A;  5I2Q A;  1W7J B;  4ZCV A;  2SCP A;  2LHI A;  3BUM B;  3PN7 C;  1IH0 A;  2QEH A;  1XK4 A;  2RGI A;  1B1G A;  1XO5 A;  2LLU A;  2KAY A;  1OOH A;  2Y1N A;  4IJ7 A;  3TUY C;  2H61 A;  1SNL A;  4JKT A;  2H61 C;  1NIW A;  3NHI A;  4YGC B;  1PSR A;  4ORB B;  2I18 A;  1R6P A;  1AUI B;  1MUX A;  2BKH B;  2MA2 A;  2JXC A;  1S6J A;  2ZN9 A;  2GGZ A;  3VRO A;  1QS7 A;  2MRD A;  3D76 A;  2LVI A;  3FE6 A;  3VRR A;  2PQL A;  2G9B A;  1BOD A;  3I5H C;  4YBH B;  1MHO A;  1UUR A;  3R72 A;  1YUR A;  1OZS A;  2KLE A;  4MVF A;  3SG5 A;  2M3W A;  4DUQ A;  1GM0 A;  1CNP A;  1R2U A;  2D8N A;  1DTL A;  2AUC A;  1TCF A;  3FE9 A;  1NX1 A;  2CNP A;  3I5F B;  3NXA A;  5FI2 A;  1KCY A;  4I5J A;  3O2P A;  1AJ4 A;  1IQ3 A;  4YI8 A;  2WC8 A;  3VB1 A;  1U5I A;  1EG3 A;  1XFY O;  2KQ6 A;  3K21 A;  3OBV A;  5AXI A;  1RTP 1;  4MZK A;  2WCE A;  2LLT A;  5HKW A;  2V53 A;  4CID A;  3DVJ A;  3D73 A;  3RM1 A;  3OGN A;  3SG7 A;  3VRN A;  4ETO A;  1C7W A;  1VRK A;  1OOG A;  4DS7 A;  1L2O C;  3DD4 A;  1KQV A;  1XFW O;  1DJY A;  3NSK A;  1YR5 A;  2PVB A;  4YI9 A;  4L9M A;  1KWO B;  1YX7 A;  1T14 A;  1CDP A;  1DJW A;  4PHJ A;  4E68 A;  3B7A A;  3D0Y B;  2JRF A;  2JUL A;  2EC6 C;  2KFG A;  1CDN A;  2L5Y A;  5AER A;  5DKR A;  2WCJ A;  4U8D A;  1IWQ A;  1UWO A;  3FIA A;  4QJ3 B;  2E30 A;  1OOI X;  2E6W A;  1J7P A;  1IJ5 A;  3CZ1 A;  5I94 A;  2M29 A;  3JVT B;  3TS5 C;  2KOT A;  2HPS A;  3R1O A;  2ZNE A;  1AVS A;  5CSJ A;  1TWO A;  3OX5 A;  3S0E A;  2QPT A;  2KAV A;  1CLM A;  5I2L A;  1JUO A;  1JF2 A;  1DGV A;  2R2I A;  2H2K A;  3PM8 A;  2K7B A;  1S6C A;  3MSE B;  2JOJ A;  4N1F A;  5CPV A;  4FQT A;  1DT7 B;  1F54 A;  2GV5 A;  2MHH A;  4P2Y B;  4PE1 A;  4AQI A;  1YX8 A;  4HRG A;  4YRU A;  1M31 A;  1PUL A;  2Q91 A;  3BFA A;  1RJV A;  2TN4 A;  3I5G B;  5D7F A;  1SR6 B;  2JPT A;  2JC2 A;  1TUJ A;  3NHT A;  4MSP A;  3PN7 B;  3PSR A;  3CR5 X;  1M45 A;  1MXL C;  3TUY B;  1K94 A;  4GGN A;  1PRW A;  4XYN A;  4MZJ A;  1J7Q A;  1B8C A;  2HF5 A;  1DJI A;  2BKI B;  2LCP A;  4I5N B;  1F4Q A;  3I5I B;  5CSI A;  2WCK A;  1XVJ A;  2KBM A;  1S36 A;  2NLN A;  2PYQ A;  4PHM A;  3SS3 A;  2KYF A;  4AQJ A;  4CFQ A;  3CZT X;  3BUX B;  1LIN A;  3I5H B;  2WCF A;  3PFV A;  2JT8 A;  2WCB A;  3O4X A;  2JXL A;  1YRT B;  1FF1 A;  1K2H A;  2WC5 A;  1SYM A;  2DOQ A;  3WNX B;  4YGA A;  5FI6 A;  3RLZ A;  2QEO A;  2PMY A;  3WXA A;  1NX2 A;  2LNK A;  4NDD A;  1DMO A;  3BUO B;  1U5I B;  1OZO A;  4ORA B;  1ZUZ A;  1M63 B;  2A4J A;  2M7N A;  4AOM A;  1QLK A;  4P5O E;  1DEL A;  4OKH A;  1KSO A;  1YVH A;  2K2A A;  2ZRT A;  4QJ5 B;  1SW8 A;  3NSI A;  3BUN B;  4HRH A;  3JVT C;  2MBX A;  1M39 A;  1Y0V H;  2L0P A;  4NDC A;  4USL A;  1WRK A;  1ORG A;  1EL4 A;  3TDZ A;  2M1U A;  4A4B A;  2QEV A;  4PT1 A;  2M9G A;  3B6X A;  2JNX A;  3CR2 A;  3S0D A;  3VRP A;  3CAB A;  5JJG A;  2LP2 A;  1CFD A;  3RZS A;  2SAS A;  3AAJ A;  2KAX A;  2LAP A;  3EVV A;  1BU3 A;  3L4L A;  2JWW A;  1JC2 A;  2WOR A;  1EXR A;  1UHH A;  2F3Y A;  2KI4 B;  1FBV A;  1RFJ A;  1TRF A;  2JZI A;  1SR6 C;  1BOC A;  3B87 A;  1Y1U A;  3H4S E;  1QX5 B;  1UHK A;  4C0L A;  4OR9 B;  1XK4 C;  1J55 A;  1NUB A;  1SMG A;  3BOW A;  3S0B A;  5HLV A;  2KDH A;  3SS4 A;  2P6B B;  2FJU B; 
#chains in the Genus database with same CATH homology
 3I5I C;  2M8U A;  1V1G A;  1H8B A;  1TIZ A;  1QX7 A;  4MEW A;  3ZWH A;  1DJG A;  5I8N A;  1TOP A;  2JTZ A;  3IQO A;  4FTG A;  1J7O A;  3SG3 A;  1TTX A;  1OQP A;  1A75 A;  4N5X A;  3SIB A;  2KFH A;  1BMO A;  1CTR A;  1QAT A;  3JTD C;  5JOL A;  4N1G A;  4YGB B;  2EHB A;  3EK7 A;  1OMD A;  2KYC A;  3KHE A;  3GK1 A;  4BY5 A;  4CPV A;  1WRZ A;  2VRG A;  1QVI Y;  1SY9 A;  1TN4 A;  2L51 A;  2WND A;  1YRU B;  3E3R A;  5GQQ C;  1BG1 A;  2ZN8 A;  1LVC D;  1WY9 A;  2MAZ A;  1A03 A;  1J1E A;  4UPG A;  1FPW A;  2LMU A;  4A4C A;  4PAL A;  1GQM A;  1NPQ A;  1XA5 A;  1BJF A;  5G08 A;  2I7A A;  1Y1A A;  1CLL A;  2I2R E;  1NYA A;  2ZKM X;  3CWG A;  1QV1 A;  1SPY A;  5AFP A;  1CFP A;  1NX3 A;  5KU1 A;  5AEQ A;  2AAO A;  5B8I B;  2MLE C;  3AKA A;  3CS1 A;  3VGO A;  3TZ1 A;  1YVL A;  1AK8 A;  3EK8 A;  2KI4 C;  4PE0 A;  2CBL A;  2LLS A;  1QV0 A;  4MN0 A;  4JQ0 D;  1SRA A;  1UP5 A;  3EK4 A;  4F0Z B;  1F8H A;  1S5G Y;  3PLF B;  1YTZ C;  2KSP A;  4WQ2 A;  1IKU A;  1MQ1 A;  1SCV A;  1A2X A;  2JT3 A;  5IBW A;  1QVI Z;  1NSH A;  2LVJ A;  3IF7 A;  4M2Q A;  2K7O A;  3KPX A;  1J7R A;  2MLF C;  1CFC A;  1HQV A;  1FW4 A;  4YGE B;  2L4I A;  2BE6 A;  4FQO A;  1JFK A;  2BL0 B;  2L5X B;  2F8P A;  3F45 A;  2O5G A;  4GGF A;  3BYA A;  1IG5 A;  1WRL A;  4GGF C;  4M2P A;  4JWQ A;  2L50 A;  3FS7 A;  1IQ5 A;  2CXJ A;  3BOW B;  4GAO A;  2L4H A;  1Q80 A;  1OOJ A;  5D69 A;  2KGB C;  1SL9 A;  3DF0 A;  1JSA A;  1BF5 A;  4PHK A;  2BBM A;  5DKN A;  1M46 A;  2KI6 C;  1CDM A;  1G4Y R;  1K9K A;  2AMI A;  2F2P A;  2LAN A;  2KNE A;  4OV2 A;  1JWD A;  1REC A;  1ALV A;  5HYD A;  1CMG A;  4GNK B;  1WDC B;  2BCA A;  4XJK A;  3LL8 B;  1LA3 A;  4C0J A;  3OB2 B;  2CCM A;  1LXF C;  1S5G Z;  1A75 B;  3EVR A;  1TNP A;  2K2F A;  3JTD B;  3D10 A;  1KFX L;  1PVA A;  2NXQ A;  1WLM A;  2LE9 B;  1BR4 B;  3AKB A;  3O4Y A;  1CM1 A;  5AAN A;  5FYX A;  1SL7 A;  4DRW A;  2ZRS A;  3LK0 A;  2G2B A;  4QJ4 B;  4ZCU A;  2BBN A;  5I2O A;  1GJY A;  3LCP C;  1ZMZ A;  1OMV A;  2FCE A;  2FCD A;  2K8M B;  1JBA A;  2IS9 A;  1F71 A;  1UHI A;  5KSZ A;  1K95 A;  2CT9 A;  3EKJ A;  2FOT A;  4MRX A;  3CGA A;  1KFX S;  3CR4 X;  2I94 A;  1DGU A;  1LKJ A;  1UUS A;  3FWC A;  1CLB A;  4I5L B;  2BL0 C;  2LUC A;  3HCM A;  4PE4 A;  1S3P A;  3O6B A;  1Y1X A;  3O78 A;  2ZFD A;  4ORC B;  5HLO A;  1Y6W A;  3CLN A;  1LA0 A;  3OHM B;  3GOF A;  1W7I B;  4HRE E;  1CDL A;  3GK2 A;  3DVM A;  1B8R A;  1DJX A;  1D1O A;  2BEC A;  2WOS A;  5DKQ A;  2LV7 A;  1SKT A;  1ZFS A;  4DIR A;  4GFT A;  1WDC C;  3CTN A;  3WHU B;  3BQ3 A;  2JTT A;  2M49 B;  2LC5 A;  1N2D A;  1QXP A;  1JF0 A;  1K90 D;  1PVB A;  4MRY A;  3KF9 A;  3KEV A;  1NCZ A;  5K89 A;  3DF0 B;  1XFV O;  1X02 A;  5F6T A;  5HKZ A;  1UHJ A;  2Y4Q A;  1RRO A;  5BPJ A;  2F3Z A;  2M1K B;  2LM5 A;  5J3X A;  1NWD A;  3GK4 X;  3OX6 A;  3A8R A;  2JU0 A;  2KHN A;  4D1E A;  1K96 A;  1C7V A;  3ICB A;  4XJK B;  1UHN A;  1CKK A;  1E8A A;  2PAL A;  1QIV A;  2CTN A;  1FI6 A;  4TNC A;  1YUU A;  3PAL A;  5CSF A;  1G8I A;  1NCY A;  1G33 A;  2PSR A;  3SG2 A;  1DVI A;  1KQM B;  3QRX A;  4PDZ A;  3SG6 A;  1OSA A;  1EH2 A;  1KK8 B;  1SCM C;  1KSM A;  4JPZ B;  2HET A;  1TNW A;  1AP4 A;  4M2O A;  2L2E A;  1AJ5 A;  4WRI A;  4GUK A;  4PE7 A;  2NCP A;  4MZL A;  1BR1 B;  2K7D A;  1WLZ A;  3LK1 A;  4YGD B;  1N0Y A;  1CM4 A;  4NQG A;  5TNC A;  1TCO B;  4PCW A;  1QJT A;  1EJ3 A;  2LP3 A;  2BE4 A;  1H4B A;  2O60 A;  4I5K A;  2JQ6 A;  2QAC A;  1HT9 A;  1YUS A;  2MJW B;  3OB1 B;  3BUW B;  4MBE A;  1BLQ A;  4OCI A;  1DF0 B;  3LLE A;  3EKH A;  1JFJ A;  1RK9 A;  2Y1M A;  3BXK A;  3PAT A;  1ZAC A;  1J1D A;  4GPL B;  2LMV A;  1IRJ A;  2KQY A;  2PAS A;  3NSO A;  5ER5 A;  1K9U A;  1QIW A;  2LVK A;  3SJS A;  3M0W A;  3DVK A;  2ZND A;  1BT6 A;  1B47 A;  4CLN A;  4R1E A;  3VRQ A;  4HSZ A;  1QX2 A;  1B4C A;  1N65 A;  2K61 A;  4DCK A;  1QAS A;  1ODB A;  1QTX A;  5ER4 X;  1FI5 A;  1PSB A;  1IJ6 A;  2LMT A;  2OTG B;  2OS8 B;  4MLW A;  3C1V A;  3TDI A;  1MF8 B;  2B1U A;  3SG4 A;  3WHT B;  1AHR A;  1CB1 A;  1OE9 B;  4OVN F;  2Q4U A;  2BCX A;  1S6I A;  1IGV A;  2F2O A;  1A4P A;  4WQ3 A;  2KGR A;  2JNF A;  4Q04 A;  1RWY A;  2HQ8 A;  1K93 D;  1KK7 Y;  1K8U A;  1DJH A;  2JT0 A;  2ISD A;  1TNX A;  2KI6 D;  3AAK A;  1K9P A;  1S1E A;  1KFU L;  1YUT A;  1B7T Y;  2M97 A;  2LVV A;  3I5F C;  1KQM C;  3EVU A;  1S26 D;  2K7C A;  5CSN A;  1KK8 C;  1C07 A;  1ZOT B;  4GBA A;  1OMR A;  3TDU A;  5HKY A;  4BY4 A;  5PAL A;  1F4O A;  1B9A A;  1XYD A;  4IL1 A;  4NDB A;  1CFF A;  1NP8 A;  5KTY A;  2EGD A;  3KO0 A;  1QLS A;  3A4U B;  2K0J A;  1SBJ A;  1MWN A;  2KBI A;  1KFU S;  1KWO C;  2M7L A;  1SCM B;  1DF0 A;  1MR8 A;  3D0Y A;  2NZ0 A;  1NX0 A;  1GGZ A;  2GGM A;  2OPO A;  1GGW A;  2NCO A;  1KK7 Z;  1SK6 D;  1TNQ A;  2L98 A;  1L2O B;  3IQQ A;  1L7Z A;  1PK0 D;  4ICB A;  1XFZ O;  3FWB A;  2LUX A;  3SIA A;  3ZNI A;  1F55 A;  1B7T Z;  4C0K A;  2M0R A;  1ALW A;  1XFU O;  2KFF A;  1NCX A;  1MXE A;  4PHN A;  2OTG C;  1B8L A;  1PAL A;  2OS8 C;  1SL8 A;  1V1F A;  3NSL A;  3HX4 A;  1CMF A;  2EC6 B;  1DJZ A;  3OP0 A;  4CFR A;  1A29 A;  2Y5I A;  2HQW A;  3DVE A;  2COL B;  1XFX O;  2LHL A;  2BCB A;  2PRU A;  3I5G C;  2F33 A;  3TS5 B;  1F70 A;  1EG4 A;  5I2Q A;  1W7J B;  4ZCV A;  2SCP A;  2LHI A;  3BUM B;  3PN7 C;  1IH0 A;  2RGI A;  1XK4 A;  1B1G A;  1XO5 A;  2LLU A;  2KAY A;  2Y1N A;  3TUY C;  2H61 A;  1SNL A;  2H61 C;  1NIW A;  4YGC B;  1PSR A;  4ORB B;  2I18 A;  1R6P A;  1AUI B;  1MUX A;  2BKH B;  2MA2 A;  2JXC A;  1S6J A;  2ZN9 A;  2GGZ A;  3VRO A;  1QS7 A;  2MRD A;  2LVI A;  3VRR A;  2G9B A;  1BOD A;  3I5H C;  4YBH B;  1MHO A;  1UUR A;  4MVF A;  1YUR A;  1OZS A;  3SG5 A;  4DUQ A;  2M3W A;  1CNP A;  1R2U A;  2D8N A;  1DTL A;  2AUC A;  1TCF A;  1NX1 A;  2CNP A;  3I5F B;  3NXA A;  1KCY A;  4I5J A;  3O2P A;  1AJ4 A;  1IQ3 A;  4YI8 A;  2WC8 A;  1U5I A;  1EG3 A;  1XFY O;  2KQ6 A;  3K21 A;  5AXI A;  1RTP 1;  4MZK A;  2WCE A;  2LLT A;  5HKW A;  2V53 A;  4CID A;  3DVJ A;  3RM1 A;  3SG7 A;  3VRN A;  4ETO A;  1C7W A;  1VRK A;  4DS7 A;  1L2O C;  3DD4 A;  1KQV A;  1XFW O;  1DJY A;  3NSK A;  1YR5 A;  2PVB A;  4YI9 A;  4L9M A;  1KWO B;  1YX7 A;  1CDP A;  1DJW A;  4PHJ A;  4E68 A;  3D0Y B;  2JRF A;  2JUL A;  2EC6 C;  2KFG A;  1CDN A;  5AER A;  5DKR A;  4U8D A;  1IWQ A;  1UWO A;  3FIA A;  4QJ3 B;  2E30 A;  2E6W A;  1J7P A;  1IJ5 A;  2M29 A;  3JVT B;  3TS5 C;  2KOT A;  2HPS A;  2ZNE A;  1AVS A;  5CSJ A;  3OX5 A;  2QPT A;  2KAV A;  1CLM A;  5I2L A;  1JUO A;  1JF2 A;  1DGV A;  2R2I A;  2H2K A;  3PM8 A;  2K7B A;  1S6C A;  3MSE B;  2JOJ A;  4N1F A;  5CPV A;  1DT7 B;  1F54 A;  2GV5 A;  2MHH A;  4P2Y B;  4PE1 A;  4AQI A;  1YX8 A;  4HRG A;  4YRU A;  1M31 A;  1PUL A;  2Q91 A;  1RJV A;  2TN4 A;  3I5G B;  5D7F A;  1SR6 B;  2JPT A;  2JC2 A;  4MSP A;  3PN7 B;  3PSR A;  3CR5 X;  1M45 A;  1MXL C;  3TUY B;  1K94 A;  4GGN A;  1PRW A;  4XYN A;  4MZJ A;  1J7Q A;  1B8C A;  2HF5 A;  1DJI A;  2BKI B;  2LCP A;  4I5N B;  1F4Q A;  3I5I B;  5CSI A;  1XVJ A;  2KBM A;  1S36 A;  2NLN A;  4PHM A;  4AQJ A;  2KYF A;  4CFQ A;  3CZT X;  3BUX B;  1LIN A;  3I5H B;  2WCF A;  3PFV A;  2JT8 A;  2WCB A;  2JXL A;  1YRT B;  1FF1 A;  1K2H A;  1SYM A;  2DOQ A;  3WNX B;  4YGA A;  3RLZ A;  2PMY A;  3WXA A;  1NX2 A;  2LNK A;  4NDD A;  1DMO A;  3BUO B;  1U5I B;  1OZO A;  4ORA B;  1ZUZ A;  1M63 B;  2A4J A;  2M7N A;  4AOM A;  1QLK A;  4P5O E;  4OKH A;  1KSO A;  1YVH A;  2K2A A;  2ZRT A;  4QJ5 B;  1SW8 A;  3NSI A;  3BUN B;  4HRH A;  3JVT C;  2MBX A;  1M39 A;  1Y0V H;  2L0P A;  4NDC A;  4USL A;  1WRK A;  3TDZ A;  1EL4 A;  2M1U A;  4A4B A;  2M9G A;  2JNX A;  3CR2 A;  3VRP A;  5JJG A;  2LP2 A;  1CFD A;  2SAS A;  3AAJ A;  2KAX A;  2LAP A;  3EVV A;  1BU3 A;  2JWW A;  1JC2 A;  2WOR A;  1EXR A;  1UHH A;  2F3Y A;  2KI4 B;  1FBV A;  1RFJ A;  1TRF A;  2JZI A;  1SR6 C;  1BOC A;  1Y1U A;  3H4S E;  1QX5 B;  1UHK A;  4C0L A;  4OR9 B;  1XK4 C;  1J55 A;  1NUB A;  1SMG A;  3BOW A;  5HLV A;  2KDH A;  2P6B B;  2FJU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...