2LE9B

Ragec2-s100a13 tetrameric complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/metal binding protein
molecule keywords Advanced glycosylation end product-specific receptor
publication title Interaction of S100A13 with Receptor for Advanced Glycation End products (RAGE) C2 domain
rcsb
source organism Homo sapiens
total genus 26
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2le9B00
1U5IB 4N5XA 1DJIA 3PATA 4ORCB 5HYDA 1KSMA 4YGDB 1RWYA 1WDCB 3EKHA 4YBHB 4CFQA 4I5NB 2WORA 1DT7B 1K9KA 1LA3A 1PSRA 2LP3A 2F2PA 3AAKA 2L4HA 5CSIA 2HQ8A 1JBAA 2NXQA 1SY9A 1DJYA 4MRXA 5AANA 3K21A 3OB1B 3QRXA 2Y1MA 4I5KA 1UHJA 3DVEA 1CDLA 4CIDA 1YUTA 1KFXS 1JF2A 2R2IA 5GQQC 1NP8A 5FYXA 1Y6WA 4F0ZB 1M46A 2OTGB 3ZNIA 1WDCC 4NQGA 2AUCA 2CT9A 2LHIA 1XFXO 1TIZA 5KTYA 1YR5A 2H2KA 1WRZA 3D0YB 1F4OA 1LINA 1PULA 2KFFA 4MEWA 1CFCA 1DVIA 1S1EA 1WY9A 3PM8A 2FCDA 1S36A 2BKHB 2LMTA 3KO0A 1EL4A 2JT0A 3WXAA 1CDNA 1QS7A 2Y5IA 2LVJA 2ZNDA 2I7AA 2MLFC 2OTGC 2K7OA 1A29A 1KFUS 1OOJA 2FCEA 1ALVA 1PRWA 2KAYA 4MZJA 1NIWA 1D1OA 2JZIA 5HKYA 3CLNA 2PASA 4AQIA 5IBWA 1DF0A 1TNWA 1YVHA 3CS1A 1B47A 3NSLA 1S6CA 1XO5A 3CR4X 3A4UB 3EK4A 4OCIA 2KI6C 2LLTA 2LP2A 3EKJA 2F3ZA 4I5LB 3AKBA 1ZOTB 4Q04A 1Y1UA 2KI6D 1KK8B 2ISDA 2TN4A 1G33A 2O60A 1AUIB 1LXFC 3SG6A 2JXCA 1F8HA 1SL9A 1ALWA 2D8NA 5G08A 4MSPA 3DF0A 2JRFA 1SK6D 4YI9A 1CB1A 1BT6A 2WOSA 5HLVA 2KFHA 2GGZA 1JWDA 1GJYA 4YGAA 1J1DA 1KK8C 1KWOB 1M31A 1MXEA 1W7IB 1XK4C 2VRGA 1S5GY 1F70A 2LE9B 5AEQA 1FI6A 3DVKA 1S6IA 1XFZO 1QV1A 1BODA 3ICBA 4XYNA 2KAXA 1A75A 2KBIA 2KI4B 1IRJA 5HKZA 3KHEA 4GBAA 1TOPA 4GGFC 1BR4B 1J55A 3BOWB 3D10A 4U8DA 4JPZB 4CPVA 1YUUA 1KWOC 1EH2A 1OE9B 2Q4UA 1CKKA 2I94A 4M2QA 4MBEA 3NSIA 2LMUA 4PE7A 3PFVA 2LC5A 1MXLC 1YX7A 1CFPA 3EVUA 4PE4A 1Q80A 1F54A 3PALA 2KI4C 1QLKA 1KCYA 5D7FA 4NDBA 1QVIZ 1K8UA 3VGOA 1F55A 1YURA 2JQ6A 3BXKA 2B1UA 4E68A 3CTNA 3JVTB 1RJVA 3I5FB 1CMGA 1CDMA 2K7CA 1MQ1A 2A4JA 5DKNA 4PE0A 2F2OA 1WLZA 1HQVA 4UPGA 2H61C 1IGVA 2V53A 1AP4A 2E6WA 2BCXA 4PALA 1F4QA 2ZRTA 3SG3A 1DMOA 1RROA 2JPTA 1G8IA 1SL7A 1BMOA 3JVTC 3DVJA 3I5FC 4BY4A 1GGWA 1UHHA 1HT9A 1NSHA 1PALA 4YGCB 2I18A 2O5GA 2L2EA 1SNLA 1AK8A 2MA2A 1GQMA 2MBXA 1ZACA 1TCFA 2K7DA 3CWGA 2ZN9A 4GPLB 2PVBA 1TRFA 1KQMB 1RTP1 2KDHA 3HCMA 1BF5A 1OZSA 2MRDA 1K9PA 1RECA 1K9UA 2BBNA 5D69A 1YRTB 5I2LA 5BPJA 1YX8A 2LLSA 4M2PA 4PHKA 1FPWA 1Y1AA 1IWQA 1IQ3A 1SL8A 2BCAA 1BG1A 3SG5A 3WHUB 4OR9B 2NCPA 1EG4A 1R2UA 1VRKA 1V1FA 1DJZA 1OMRA 2G2BA 1KQMC 2M8UA 1XFWO 2LM5A 1UHNA 2OS8B 3OP0A 2CCMA 2LHLA 4GFTA 2MLEC 1K90D 2BE6A 3SJSA 1BR1B 2NLNA 1PVAA 2NCOA 1NUBA 4YGBB 2PMYA 3H4SE 1ZFSA 3NSKA 3TZ1A 4PCWA 5DKRA 2LV7A 2EGDA 3TDIA 1EJ3A 1ODBA 1G4YR 2BCBA 3FS7A 3PSRA 2LLUA 2OS8C 1YRUB 2WCEA 4N1FA 1JUOA 5CSNA 2ZFDA 2M3WA 2KQ6A 2L51A 1BLQA 2M49B 1K93D 3A8RA 1IKUA 1SMGA 1FBVA 2JTZA 3VRNA 3VROA 1EG3A 1QTXA 2LANA 4L9MA 4YRUA 1SYMA 3JTDB 3C1VA 1S26D 2HPSA 1K2HA 1PSBA 1DJXA 1S3PA 4OKHA 4OV2A 1J1EA 4HRHA 2DOQA 2PSRA 4HSZA 2JC2A 5AXIA 4WQ3A 4IL1A 3GK1A 1ZUZA 2HETA 3SG7A 3TDUA 2Q91A 3M0WA 3SG4A 4R1EA 1GGZA 2WCBA 3FWCA 3SG2A 4FQOA 1MWNA 2H61A 1OSAA 4A4BA 5JJGA 5I2QA 4MVFA 4ICBA 1FI5A 1CTRA 1R6PA 3JTDC 2HF5A 2L4IA 3KF9A 5AERA 1B9AA 1B7TZ 2ZNEA 2KFGA 1DTLA 1DF0B 1CLLA 1RFJA 2M97A 2F3YA 4YGEB 1MF8B 1TNXA 3I5HB 3TUYB 1B7TY 1UHKA 4AQJA 3DVMA 2CBLA 3HX4A 1AJ5A 5TNCA 1B8RA 4HRGA 4OVNF 2P6BB 2MAZA 3O2PA 1SPYA 2WC8A 2Y4QA 4JWQA 1IH0A 1IQ5A 2BECA 1UHIA 3TDZA 3EVVA 1U5IA 3MSEB 1QJTA 3CZTX 1AJ4A 1CLMA 1CM1A 2PALA 1KFXL 2JXLA 2LMVA 1J7RA 4N1GA 2G9BA 3BQ3A 5HLOA 1WRLA 2ZRSA 3DF0B 3RLZA 3BUOB 3I5HC 2F33A 3ZWHA 3TUYC 1NX3A 3LLEA 1QVIY 3LK1A 2LNKA 1BU3A 3O4YA 1NX2A 4A4CA 2SASA 1LA0A 5AFPA 2GV5A 1IG5A 1SCMB 3GK2A 2LAPA 3AKAA 1PK0D 4YI8A 1J7OA 2SCPA 1QV0A 2WCFA 4XJKB 1Y1XA 1DGVA 2JULA 1XA5A 2FJUB 3CR5X 1CLBA 1YTZC 1SR6B 3BUNB 2L98A 3D0YA 1KFUL 1NX0A 3LK0A 3VRPA 3PN7B 5JOLA 2LUXA 4MN0A 2K0JA 1XVJA 2KGRA 5PALA 3I5IB 1NYAA 2EC6B 5ER5A 1KK7Z 2JWWA 3GK4X 1QX5B 2LCPA 1Y0VH 1SCMC 1E8AA 1SRAA 4DCKA 2BL0B 2L5XB 2L0PA 4NDCA 1A03A 3BYAA 1MHOA 4CLNA 4MLWA 1CMFA 1A2XA 4QJ5B 1H8BA 1MR8A 3FIAA 5F6TA 1SR6C 1YUSA 1K96A 5CSJA 1KSOA 2JTTA 2COLB 1TNQA 3PN7C 5CPVA 4DUQA 4QJ4B 1NCXA 1AVSA 1M63B 4C0JA 2CNPA 1N2DA 1QIWA 2EC6C 3I5IC 3O6BA 4TNCA 4ZCUA 1LVCD 3E3RA 1DGUA 1TCOB 2F8PA 3LL8B 4DIRA 2JT3A 4GNKB 4WRIA 2BL0C 2M0RA 2KAVA 1F71A 4MZLA 2KSPA 1C07A 2HQWA 3KPXA 2JU0A 1UP5A 2KOTA 1L2OB 1QX7A 2BE4A 4FTGA 4C0LA 1J7PA 1XK4A 4JQ0D 1DJHA 3O78A 1AHRA 1UWOA 3AAJA 1TTXA 2KYCA 4D1EA 5I8NA 2Y1NA 4PHJA 2OPOA 2M7LA 3KEVA 2NZ0A 1QIVA 1DJWA 1B4CA 1N65A 1UURA 4ZCVA 1JFKA 4GGFA 3TS5B 3BUMB 2M1KB 1QATA 1K95A 4GAOA 1QASA 1QXPA 1RK9A 3VRQA 2K8MB 3VRRA 1L2OC 2M1UA 2JOJA 2QPTA 5J3XA 1SCVA 1M39A 3NSOA 4MZKA 2BKIB 4BY5A 1WRKA 2ZKMX 2WNDA 3F45A 1NCZA 2LUCA 1XFUO 3EK8A 2M9GA 3EVRA 2JNFA 3BOWA 3TS5C 5HKWA 2E30A 4M2OA 3OX5A 3GOFA 4NDDA 3BUWB 2AMIA 2JT8A 3WNXB 4C0KA 2KGBC 2KHNA 1N0YA 3OHMB 1W7JB 4DS7A 2JNXA 2L50A 1IJ6A 2AAOA 2LVIA 2EHBA 2LVVA 1XFYO 2M7NA 4WQ2A 3IQOA 4ETOA 1NX1A 1BJFA 1UUSA 1K94A 3OX6A 5ER4X 1A4PA 1B8CA 4P2YB 1JC2A 2GGMA 4PHNA 2QACA 4ORBB 2MJWB 1NWDA 3WHTB 3FWBA 1LKJA 1L7ZA 3CGAA 3CR2A 1SKTA 2K7BA 2KQYA 2K2FA 5B8IB 1BOCA 1S5GZ 3PLFB 1C7VA 3DD4A 3BUXB 4MRYA 5KU1A 4XJKA 3SIBA 1WLMA 3IF7A 5DKQA 3OB2B 1CFDA 3NXAA 1B8LA 3RM1A 2LVKA 1SW8A 1JF0A 1YVLA 1H4BA 1OMDA 2RGIA 4CFRA 4HREE 2KNEA 1QX2A 1NCYA 2K61A 1J7QA 1OQPA 3SIAA 1B1GA 2CTNA 2IS9A 3IQQA 4PDZA 1MUXA 4GGNA 1C7WA 1ZMZA 3I5GB 1QLSA 2M29A 1CDPA 1FF1A 1DJGA 1EXRA 1JFJA 2MHHA 1IJ5A 2CXJA 4AOMA 2FOTA 2ZN8A 2KYFA 2BBMA 1XFVO 1S6JA 1TN4A 1V1GA 4QJ3B 2PRUA 1OMVA 4PHMA 1OZOA 5KSZA 1A75B 3LCPC 5I2OA 1CNPA 1SBJA 4GUKA 3EK7A 3I5GC 1FW4A 1JSAA 1CM4A 1TNPA 1X02A 1CFFA 5K89A 1M45A 2KBMA 1KK7Y 4DRWA 4P5OE 1NPQA 4USLA 2I2RE 4PE1A 1PVBA 2K2AA 4ORAB 5CSFA 1KQVA 1XYDA 4I5JA
chains in the Genus database with same CATH superfamily
1U5IB 4N5XA 1DJIA 3PATA 4ORCB 5HYDA 1KSMA 4YGDB 1RWYA 1WDCB 3EKHA 4YBHB 1T14A 4I5NB 2WORA 4CFQA 1DT7B 1K9KA 1LA3A 1PSRA 2WCMA 2LP3A 2F2PA 3AAKA 2L4HA 5CSIA 2HQ8A 1JBAA 2NXQA 1SY9A 1DJYA 4MRXA 5AANA 3K21A 3OB1B 3QRXA 2WC6A 2Y1MA 4I5KA 1UHJA 3DVEA 1CDLA 4CIDA 3NHTA 1YUTA 1KFXS 1JF2A 2R2IA 2YGUA 5GQQC 1NP8A 5FYXA 3L4AA 3R72A 1Y6WA 4F0ZB 1M46A 2OTGB 3ZNIA 1WDCC 4NQGA 2AUCA 2CT9A 2LHIA 1XFXO 1TIZA 5KTYA 1YR5A 2H2KA 1WRZA 3D0YB 1F4OA 1LINA 1PULA 2KFFA 4KYNA 4MEWA 1DVIA 1CFCA 1S1EA 1WY9A 3PM8A 1OOIX 3DZTA 2FCDA 1S36A 2BKHB 2LMTA 3KO0A 1EL4A 2JT0A 3WXAA 1OOFA 1DC1A 1CDNA 1GM0A 1QS7A 2Y5IA 2LVJA 2ZNDA 2I7AA 2MLFC 2OTGC 2K7OA 1A29A 1KFUS 1OOJA 2FCEA 1ALVA 1PRWA 2KAYA 4MZJA 1NIWA 1D1OA 2JZIA 5HKYA 3CLNA 2PASA 3R1OA 4AQIA 5IBWA 1DF0A 1TNWA 1YVHA 3CS1A 1B47A 3NSLA 1S6CA 1XO5A 3CR4X 3A4UB 3EK4A 4OCIA 2KI6C 2LLTA 2LP2A 3EKJA 2F3ZA 4I5LB 3AKBA 1ZOTB 4Q04A 1Y1UA 2KI6D 3CZ0A 3O4XA 1KK8B 2L2CA 2ISDA 2TN4A 1G33A 2O60A 1LS8A 1AUIB 1LXFC 3SG6A 2JXCA 3OGNA 1F8HA 1SL9A 1ALWA 2D8NA 5G08A 4MSPA 3DF0A 2JRFA 1SK6D 4YI9A 1CB1A 1BT6A 2WOSA 5HLVA 2KFHA 2GGZA 1JWDA 1GJYA 4YGAA 1J1DA 1KK8C 1KWOB 1M31A 1MXEA 1W7IB 1XK4C 2VRGA 1S5GY 2PYQA 1F70A 3D78A 1DEKA 2LE9B 5AEQA 1FI6A 3DVKA 1S6IA 1XFZO 1QV1A 1BODA 3ICBA 3SS3A 4XYNA 2KAXA 1A75A 2KBIA 2KI4B 1IRJA 5HKZA 3KHEA 5I94A 4ZCUA 3S0AA 4GBAA 1TOPA 4GGFC 1BR4B 1J55A 3BOWB 3D10A 3B87A 4JPZB 4U8DA 4CPVA 3UO9A 1YUUA 1KWOC 2QDIA 3BFHA 1EH2A 1OE9B 2Q4UA 1CKKA 2I94A 4M2QA 4MBEA 3NSIA 2LMUA 4PE7A 3PFVA 1QWVA 2LC5A 1MXLC 1YX7A 1CFPA 3EVUA 4PE4A 1Q80A 3DXLA 1F54A 3PALA 2KI4C 1QLKA 3FE6A 5D7FA 1KCYA 4NDBA 1QVIZ 1K8UA 3VGOA 1F55A 1YURA 2JQ6A 3BXKA 2B1UA 4E68A 3CTNA 3JVTB 1RJVA 1TUJA 3I5FB 1CMGA 2GTEA 3D77A 2K60A 3NHIA 3R1PA 1CDMA 2K7CA 1MQ1A 2A4JA 5DKNA 4PE0A 2F2OA 1WLZA 1HQVA 3L4LA 4UPGA 2H61C 5FI6A 1IGVA 2V53A 1AP4A 2E6WA 2BCXA 4PALA 1F4QA 2ZRTA 3SG3A 1DMOA 1RROA 2JPTA 3NGVA 1G8IA 1SL7A 1BMOA 2WC5A 3JVTC 3DVJA 3I5FC 3DYEA 4BY4A 1GGWA 1UHHA 1HT9A 1NSHA 1PALA 4YGCB 2I18A 2O5GA 2L2EA 1SNLA 1AK8A 2MA2A 1GQMA 2MBXA 1ZACA 1TCFA 2K7DA 3CWGA 3R1VA 2ZN9A 4GPLB 2PVBA 1TRFA 1KQMB 1RTP1 2KDHA 3HCMA 1BF5A 1OZSA 3FE9A 2MRDA 1K9PA 1RECA 1K9UA 1Z2CB 4F7FA 2BBNA 5D69A 1YRTB 5I2LA 5BPJA 1OOGA 1YX8A 2LLSA 4M2PA 4PHKA 1FPWA 1Y1AA 1IWQA 1C3ZA 1IQ3A 1SL8A 2BCAA 1BG1A 3SG5A 3WHUB 4OR9B 2NCPA 1EG4A 1R2UA 1VRKA 1V1FA 3D75A 1DJZA 2P71A 1OMRA 2G2BA 1KQMC 2M8UA 1XFWO 2LM5A 1UHNA 2OS8B 3OP0A 2CCMA 2LHLA 4GFTA 2MLEC 1K90D 2BE6A 3SJSA 1BR1B 3BFAA 2NLNA 1PVAA 2NCOA 1NUBA 2ERBA 2PMYA 4YGBB 3H4SE 1ZFSA 3NSKA 2KPHA 3TZ1A 4PCWA 5DKRA 2LV7A 3B6XA 2EGDA 3TDIA 1EJ3A 1ODBA 1G4YR 2BCBA 3FS7A 3PSRA 2LLUA 2OS8C 1YRUB 1C3YA 2WCEA 4N1FA 1JUOA 3N7HA 5CSNA 2ZFDA 2M3WA 2KQ6A 2L51A 3SS4A 1BLQA 2M49B 1K93D 3A8RA 1IKUA 1SMGA 1FBVA 2JTZA 3VRNA 3VROA 1EG3A 1QTXA 2LANA 4L9MA 3OBVA 4YRUA 1XFRA 3CZ2A 1SYMA 4FQTA 3JTDB 3C1VA 1S26D 2HPSA 1K2HA 1PSBA 4INWA 1DJXA 1S3PA 4OKHA 4OV2A 1J1EA 4HRHA 2DOQA 2PSRA 4HSZA 2JC2A 5AXIA 4WQ3A 3S0GA 4IL1A 3GK1A 1ZUZA 2HETA 3DY9A 5EL2A 3SG7A 2Q91A 3TDUA 3M0WA 3PJIA 3SG4A 2PQLA 4OZDA 1GGZA 4R1EA 2WCBA 3FWCA 3SG2A 4FQOA 1MWNA 2H61A 1OSAA 4A4BA 5JJGA 5I2QA 4JKTA 4MVFA 4ICBA 1FI5A 2JPOA 1CTRA 1R6PA 3JTDC 2HF5A 2L4IA 3KF9A 1SSEB 3FE8A 5AERA 2WCKA 1B9AA 1B7TZ 2ZNEA 2KFGA 1DTLA 1DF0B 1CLLA 1RFJA 2M97A 3B7AA 2F3YA 3D74A 1MF8B 4YGEB 1TNXA 3I5HB 3TUYB 1B7TY 1UHKA 4AQJA 3DVMA 2CBLA 3Q8IA 3HX4A 1AJ5A 5TNCA 1B8RA 3D76A 4HRGA 4OVNF 2P6BB 2MAZA 3O2PA 1SPYA 2WC8A 2Y4QA 4JWQA 1IH0A 1IQ5A 2BECA 1UHIA 3EG5B 3EVVA 3TDZA 1U5IA 3MSEB 1QJTA 3CZTX 1AJ4A 1CLMA 1CM1A 2PALA 1KFXL 2JXLA 2LMVA 1J7RA 4N1GA 2G9BA 3BQ3A 3CZ1A 5HLOA 3B88A 1WRLA 2ZRSA 3DF0B 3RLZA 3BUOB 3I5HC 2F33A 3ZWHA 3TUYC 1NX3A 3LLEA 1QVIY 3LK1A 2LNKA 1BU3A 3O4YA 1NX2A 4A4CA 2SASA 1LA0A 5AFPA 2GV5A 3BJHA 1IG5A 1DELA 1SCMB 3GK2A 2LAPA 3AKAA 1PK0D 4YI8A 1J7OA 2SCPA 1QV0A 2WCFA 4XJKB 1Y1XA 1DGVA 1ORGA 2JULA 3S0EA 3VB1A 1XA5A 2FJUB 3CR5X 1CLBA 1YTZC 1SR6B 3BUNB 2L98A 3D0YA 1TWOA 1KFUL 1NX0A 3LK0A 3SS5A 3VRPA 3PN7B 5JOLA 2LUXA 4MN0A 2K0JA 1XVJA 2KGRA 5PALA 3I5IB 1NYAA 2EC6B 2P70A 5ER5A 3UNWA 1KK7Z 2JWWA 3CYZA 1QX5B 2LCPA 3GK4X 1Y0VH 2QEHA 1SCMC 1E8AA 1SRAA 4DCKA 2BL0B 2L5XB 2L0PA 4NDCA 3V2LA 1A03A 3BYAA 1MHOA 3K1EA 4CLNA 4MLWA 5HL1A 1CMFA 1A2XA 4QJ5B 1H8BA 1MR8A 3FIAA 5F6TA 1SR6C 1YUSA 3QMEA 1K96A 5CSJA 3RZSA 1KSOA 2JTTA 2COLB 1TNQA 3PN7C 5CPVA 4DUQA 4QJ4B 1NCXA 1AVSA 1M63B 1P28A 2CNPA 1N2DA 1QIWA 2EC6C 2WCJA 3I5IC 3O6BA 4TNCA 2BAPA 1LVCD 3E3RA 1DGUA 1TCOB 2F8PA 2H8VA 3LL8B 4DIRA 2JT3A 4GNKB 4WRIA 2BL0C 2M0RA 5D3OA 2KAVA 1F71A 3CDNA 4MZLA 2KSPA 2QEVA 1C07A 2HQWA 3KPXA 2JU0A 1UP5A 2KOTA 1L2OB 1QX7A 2BE4A 4FTGA 4C0LA 1J7PA 1XK4A 4JQ0D 1DJHA 3O78A 1AHRA 1UWOA 1Z4HA 1TTXA 2KYCA 3AAJA 4D1EA 5I8NA 2Y1NA 4PHJA 2OPOA 2M7LA 3KEVA 2NZ0A 1QIVA 1DJWA 1B4CA 1N65A 1UURA 1W9ZA 2KLEA 1JFKA 4GGFA 4ZCVA 3TS5B 3BUMB 2KLDA 2M1KB 1QATA 1K95A 4GAOA 1QASA 1QXPA 1RK9A 3VRQA 2K8MB 3VRRA 1L2OC 2M1UA 2JOJA 2QPTA 5J3XA 1SCVA 1TUZA 1M39A 3NSOA 4MZKA 2BKIB 4BY5A 1WRKA 2ZKMX 2WNDA 3F45A 1NCZA 2LUCA 1XFUO 4JD9A 3EK8A 2M9GA 3EVRA 5FI2A 2JNFA 3BOWA 3TS5C 5HKWA 3IVTA 4C0JA 2E30A 4M2OA 3OX5A 3GOFA 5FI7A 4NDDA 2L5YA 3BUWB 3BFBA 1OOHA 2AMIA 2JT8A 3WNXB 4C0KA 2KGBC 2KHNA 1N0YA 3OHMB 1W7JB 3S0DA 2JNXA 4DS7A 2L50A 1IJ6A 2AAOA 2LVIA 2EHBA 2LVVA 1XFYO 2M7NA 4WQ2A 3IQOA 4ETOA 1NX1A 1BJFA 1UUSA 1K94A 3OX6A 1IIOA 5ER4X 1A4PA 1B8CA 2WCHA 4P2YB 1JC2A 2GGMA 4PHNA 2QACA 4ORBB 2MJWB 3S0FA 1NWDA 3WHTB 3FWBA 1LKJA 1L7ZA 3CGAA 3CR2A 1SKTA 2K7BA 2KQYA 2QEBA 2QEOA 2K2FA 5B8IB 1BOCA 1S5GZ 3PLFB 3B86A 1C7VA 3DD4A 3BUXB 3D73A 3L47A 4MRYA 5KU1A 4XJKA 3SIBA 1WLMA 3IF7A 5DKQA 3OB2B 1CFDA 3NXAA 1B8LA 3RM1A 2LVKA 3S0BA 1SW8A 1JF0A 4PT1A 1YVLA 1H4BA 1OMDA 2RGIA 4CFRA 2FJYA 4HREE 2KNEA 1QX2A 1NCYA 2K61A 1J7QA 1OQPA 3SIAA 1B1GA 2CTNA 2IS9A 2BNXA 3IQQA 4IJ7A 4PDZA 1MUXA 4GGNA 1DQEA 1C7WA 1ZMZA 3I5GB 1QLSA 2M29A 1CDPA 1FF1A 1DJGA 1EXRA 1JFJA 2MHHA 4INXA 1IJ5A 2CXJA 4AOMA 2FOTA 2ZN8A 2KYFA 2BBMA 1XFVO 1S6JA 1TN4A 1V1GA 4QJ3B 2PRUA 1OMVA 1OW4A 4PHMA 1OZOA 5KSZA 1A75B 3LCPC 5I2OA 1CNPA 1SBJA 4GUKA 3EK7A 3I5GC 1FW4A 1JSAA 1CM4A 3PM2A 5DICA 1TNPA 1X02A 1CFFA 5K89A 1M45A 2KBMA 3CABA 1KK7Y 4DRWA 4P5OE 1NPQA 4USLA 2I2RE 4PE1A 1PVBA 2K2AA 4ORAB 2WCLA 5CSFA 1KQVA 1XYDA 4I5JA
chains in the Genus database with same CATH topology
1U5IB 4N5XA 1DJIA 3PATA 4ORCB 5HYDA 1KSMA 4YGDB 1RWYA 1WDCB 3EKHA 4YBHB 4CFQA 4I5NB 2WORA 1DT7B 1K9KA 1LA3A 1PSRA 2LP3A 2F2PA 3AAKA 2L4HA 5CSIA 2HQ8A 1JBAA 2NXQA 1SY9A 1DJYA 4MRXA 5AANA 3K21A 3OB1B 3QRXA 2Y1MA 4I5KA 1UHJA 3DVEA 1CDLA 4CIDA 1YUTA 1KFXS 1JF2A 2R2IA 5GQQC 1NP8A 5FYXA 1Y6WA 4F0ZB 1M46A 2OTGB 3ZNIA 1WDCC 4NQGA 2AUCA 2CT9A 2LHIA 1XFXO 1TIZA 5KTYA 1YR5A 2H2KA 1WRZA 3D0YB 1F4OA 1LINA 1PULA 2KFFA 4MEWA 1CFCA 1DVIA 1S1EA 1WY9A 3PM8A 2FCDA 1S36A 2BKHB 2LMTA 3KO0A 1EL4A 2JT0A 3WXAA 1CDNA 1QS7A 2Y5IA 2LVJA 2ZNDA 2I7AA 2MLFC 2OTGC 2K7OA 1A29A 1KFUS 1OOJA 2FCEA 1ALVA 1PRWA 2KAYA 4MZJA 1NIWA 1D1OA 2JZIA 5HKYA 3CLNA 2PASA 4AQIA 5IBWA 1DF0A 1TNWA 1YVHA 3CS1A 1B47A 3NSLA 1S6CA 1XO5A 3CR4X 3A4UB 3EK4A 4OCIA 2KI6C 2LLTA 2LP2A 3EKJA 2F3ZA 4I5LB 3AKBA 1ZOTB 4Q04A 1Y1UA 2KI6D 1KK8B 2ISDA 2TN4A 1G33A 2O60A 1AUIB 1LXFC 3SG6A 2JXCA 1F8HA 1SL9A 1ALWA 2D8NA 5G08A 4MSPA 3DF0A 2JRFA 1SK6D 4YI9A 1CB1A 1BT6A 2WOSA 5HLVA 2KFHA 2GGZA 1JWDA 1GJYA 4YGAA 1J1DA 1KK8C 1KWOB 1M31A 1MXEA 1W7IB 1XK4C 2VRGA 1S5GY 1F70A 2LE9B 5AEQA 1FI6A 3DVKA 1S6IA 1XFZO 1QV1A 1BODA 3ICBA 4XYNA 2KAXA 1A75A 2KBIA 2KI4B 1IRJA 5HKZA 3KHEA 4GBAA 1TOPA 4GGFC 1BR4B 1J55A 3BOWB 3D10A 4U8DA 4JPZB 4CPVA 1YUUA 1KWOC 1EH2A 1OE9B 2Q4UA 1CKKA 2I94A 4M2QA 4MBEA 3NSIA 2LMUA 4PE7A 3PFVA 2LC5A 1MXLC 1YX7A 1CFPA 3EVUA 4PE4A 1Q80A 1F54A 3PALA 2KI4C 1QLKA 1KCYA 5D7FA 4NDBA 1QVIZ 1K8UA 3VGOA 1F55A 1YURA 2JQ6A 3BXKA 2B1UA 4E68A 3CTNA 3JVTB 1RJVA 3I5FB 1CMGA 1CDMA 2K7CA 1MQ1A 2A4JA 5DKNA 4PE0A 2F2OA 1WLZA 1HQVA 4UPGA 2H61C 1IGVA 2V53A 1AP4A 2E6WA 2BCXA 4PALA 1F4QA 2ZRTA 3SG3A 1DMOA 1RROA 2JPTA 1G8IA 1SL7A 1BMOA 3JVTC 3DVJA 3I5FC 4BY4A 1GGWA 1UHHA 1HT9A 1NSHA 1PALA 4YGCB 2I18A 2O5GA 2L2EA 1SNLA 1AK8A 2MA2A 1GQMA 2MBXA 1ZACA 1TCFA 2K7DA 3CWGA 2ZN9A 4GPLB 2PVBA 1TRFA 1KQMB 1RTP1 2KDHA 3HCMA 1BF5A 1OZSA 2MRDA 1K9PA 1RECA 1K9UA 2BBNA 5D69A 1YRTB 5I2LA 5BPJA 1YX8A 2LLSA 4M2PA 4PHKA 1FPWA 1Y1AA 1IWQA 1IQ3A 1SL8A 2BCAA 1BG1A 3SG5A 3WHUB 4OR9B 2NCPA 1EG4A 1R2UA 1VRKA 1V1FA 1DJZA 1OMRA 2G2BA 1KQMC 2M8UA 1XFWO 2LM5A 1UHNA 2OS8B 3OP0A 2CCMA 2LHLA 4GFTA 2MLEC 1K90D 2BE6A 3SJSA 1BR1B 2NLNA 1PVAA 2NCOA 1NUBA 4YGBB 2PMYA 3H4SE 1ZFSA 3NSKA 3TZ1A 4PCWA 5DKRA 2LV7A 2EGDA 3TDIA 1EJ3A 1ODBA 1G4YR 2BCBA 3FS7A 3PSRA 2LLUA 2OS8C 1YRUB 2WCEA 4N1FA 1JUOA 5CSNA 2ZFDA 2M3WA 2KQ6A 2L51A 1BLQA 2M49B 1K93D 3A8RA 1IKUA 1SMGA 1FBVA 2JTZA 3VRNA 3VROA 1EG3A 1QTXA 2LANA 4L9MA 4YRUA 1SYMA 3JTDB 3C1VA 1S26D 2HPSA 1K2HA 1PSBA 1DJXA 1S3PA 4OKHA 4OV2A 1J1EA 4HRHA 2DOQA 2PSRA 4HSZA 2JC2A 5AXIA 4WQ3A 4IL1A 3GK1A 1ZUZA 2HETA 3SG7A 3TDUA 2Q91A 3M0WA 3SG4A 4R1EA 1GGZA 2WCBA 3FWCA 3SG2A 4FQOA 1MWNA 2H61A 1OSAA 4A4BA 5JJGA 5I2QA 4MVFA 4ICBA 1FI5A 1CTRA 1R6PA 3JTDC 2HF5A 2L4IA 3KF9A 5AERA 1B9AA 1B7TZ 2ZNEA 2KFGA 1DTLA 1DF0B 1CLLA 1RFJA 2M97A 2F3YA 4YGEB 1MF8B 1TNXA 3I5HB 3TUYB 1B7TY 1UHKA 4AQJA 3DVMA 2CBLA 3HX4A 1AJ5A 5TNCA 1B8RA 4HRGA 4OVNF 2P6BB 2MAZA 3O2PA 1SPYA 2WC8A 2Y4QA 4JWQA 1IH0A 1IQ5A 2BECA 1UHIA 3TDZA 3EVVA 1U5IA 3MSEB 1QJTA 3CZTX 1AJ4A 1CLMA 1CM1A 2PALA 1KFXL 2JXLA 2LMVA 1J7RA 4N1GA 2G9BA 3BQ3A 5HLOA 1WRLA 2ZRSA 3DF0B 3RLZA 3BUOB 3I5HC 2F33A 3ZWHA 3TUYC 1NX3A 3LLEA 1QVIY 3LK1A 2LNKA 1BU3A 3O4YA 1NX2A 4A4CA 2SASA 1LA0A 5AFPA 2GV5A 1IG5A 1SCMB 3GK2A 2LAPA 3AKAA 1PK0D 4YI8A 1J7OA 2SCPA 1QV0A 2WCFA 4XJKB 1Y1XA 1DGVA 2JULA 1XA5A 2FJUB 3CR5X 1CLBA 1YTZC 1SR6B 3BUNB 2L98A 3D0YA 1KFUL 1NX0A 3LK0A 3VRPA 3PN7B 5JOLA 2LUXA 4MN0A 2K0JA 1XVJA 2KGRA 5PALA 3I5IB 1NYAA 2EC6B 5ER5A 1KK7Z 2JWWA 3GK4X 1QX5B 2LCPA 1Y0VH 1SCMC 1E8AA 1SRAA 4DCKA 2BL0B 2L5XB 2L0PA 4NDCA 1A03A 3BYAA 1MHOA 4CLNA 4MLWA 1CMFA 1A2XA 4QJ5B 1H8BA 1MR8A 3FIAA 5F6TA 1SR6C 1YUSA 1K96A 5CSJA 1KSOA 2JTTA 2COLB 1TNQA 3PN7C 5CPVA 4DUQA 4QJ4B 1NCXA 1AVSA 1M63B 4C0JA 2CNPA 1N2DA 1QIWA 2EC6C 3I5IC 3O6BA 4TNCA 4ZCUA 1LVCD 3E3RA 1DGUA 1TCOB 2F8PA 3LL8B 4DIRA 2JT3A 4GNKB 4WRIA 2BL0C 2M0RA 2KAVA 1F71A 4MZLA 2KSPA 1C07A 2HQWA 3KPXA 2JU0A 1UP5A 2KOTA 1L2OB 1QX7A 2BE4A 4FTGA 4C0LA 1J7PA 1XK4A 4JQ0D 1DJHA 3O78A 1AHRA 1UWOA 3AAJA 1TTXA 2KYCA 4D1EA 5I8NA 2Y1NA 4PHJA 2OPOA 2M7LA 3KEVA 2NZ0A 1QIVA 1DJWA 1B4CA 1N65A 1UURA 4ZCVA 1JFKA 4GGFA 3TS5B 3BUMB 2M1KB 1QATA 1K95A 4GAOA 1QASA 1QXPA 1RK9A 3VRQA 2K8MB 3VRRA 1L2OC 2M1UA 2JOJA 2QPTA 5J3XA 1SCVA 1M39A 3NSOA 4MZKA 2BKIB 4BY5A 1WRKA 2ZKMX 2WNDA 3F45A 1NCZA 2LUCA 1XFUO 3EK8A 2M9GA 3EVRA 2JNFA 3BOWA 3TS5C 5HKWA 2E30A 4M2OA 3OX5A 3GOFA 4NDDA 3BUWB 2AMIA 2JT8A 3WNXB 4C0KA 2KGBC 2KHNA 1N0YA 3OHMB 1W7JB 4DS7A 2JNXA 2L50A 1IJ6A 2AAOA 2LVIA 2EHBA 2LVVA 1XFYO 2M7NA 4WQ2A 3IQOA 4ETOA 1NX1A 1BJFA 1UUSA 1K94A 3OX6A 5ER4X 1A4PA 1B8CA 4P2YB 1JC2A 2GGMA 4PHNA 2QACA 4ORBB 2MJWB 1NWDA 3WHTB 3FWBA 1LKJA 1L7ZA 3CGAA 3CR2A 1SKTA 2K7BA 2KQYA 2K2FA 5B8IB 1BOCA 1S5GZ 3PLFB 1C7VA 3DD4A 3BUXB 4MRYA 5KU1A 4XJKA 3SIBA 1WLMA 3IF7A 5DKQA 3OB2B 1CFDA 3NXAA 1B8LA 3RM1A 2LVKA 1SW8A 1JF0A 1YVLA 1H4BA 1OMDA 2RGIA 4CFRA 4HREE 2KNEA 1QX2A 1NCYA 2K61A 1J7QA 1OQPA 3SIAA 1B1GA 2CTNA 2IS9A 3IQQA 4PDZA 1MUXA 4GGNA 1C7WA 1ZMZA 3I5GB 1QLSA 2M29A 1CDPA 1FF1A 1DJGA 1EXRA 1JFJA 2MHHA 1IJ5A 2CXJA 4AOMA 2FOTA 2ZN8A 2KYFA 2BBMA 1XFVO 1S6JA 1TN4A 1V1GA 4QJ3B 2PRUA 1OMVA 4PHMA 1OZOA 5KSZA 1A75B 3LCPC 5I2OA 1CNPA 1SBJA 4GUKA 3EK7A 3I5GC 1FW4A 1JSAA 1CM4A 1TNPA 1X02A 1CFFA 5K89A 1M45A 2KBMA 1KK7Y 4DRWA 4P5OE 1NPQA 4USLA 2I2RE 4PE1A 1PVBA 2K2AA 4ORAB 5CSFA 1KQVA 1XYDA 4I5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5I B;  4N5X A;  1DJI A;  3PAT A;  4ORC B;  5HYD A;  1KSM A;  4YGD B;  1RWY A;  1WDC B;  3EKH A;  4YBH B;  4CFQ A;  4I5N B;  2WOR A;  1DT7 B;  1K9K A;  1LA3 A;  1PSR A;  2LP3 A;  2F2P A;  3AAK A;  2L4H A;  5CSI A;  2HQ8 A;  1JBA A;  2NXQ A;  1SY9 A;  1DJY A;  4MRX A;  5AAN A;  3K21 A;  3OB1 B;  3QRX A;  2Y1M A;  4I5K A;  1UHJ A;  3DVE A;  1CDL A;  4CID A;  1YUT A;  1KFX S;  1JF2 A;  2R2I A;  5GQQ C;  1NP8 A;  5FYX A;  1Y6W A;  4F0Z B;  1M46 A;  2OTG B;  3ZNI A;  1WDC C;  4NQG A;  2AUC A;  2CT9 A;  2LHI A;  1XFX O;  1TIZ A;  5KTY A;  1YR5 A;  2H2K A;  1WRZ A;  3D0Y B;  1F4O A;  1LIN A;  1PUL A;  2KFF A;  4MEW A;  1CFC A;  1DVI A;  1S1E A;  1WY9 A;  3PM8 A;  2FCD A;  1S36 A;  2BKH B;  2LMT A;  3KO0 A;  1EL4 A;  2JT0 A;  3WXA A;  1CDN A;  1QS7 A;  2Y5I A;  2LVJ A;  2ZND A;  2I7A A;  2MLF C;  2OTG C;  2K7O A;  1A29 A;  1KFU S;  1OOJ A;  2FCE A;  1ALV A;  1PRW A;  2KAY A;  4MZJ A;  1NIW A;  1D1O A;  2JZI A;  5HKY A;  3CLN A;  2PAS A;  4AQI A;  5IBW A;  1DF0 A;  1TNW A;  1YVH A;  3CS1 A;  1B47 A;  3NSL A;  1S6C A;  1XO5 A;  3CR4 X;  3A4U B;  3EK4 A;  4OCI A;  2KI6 C;  2LLT A;  2LP2 A;  3EKJ A;  2F3Z A;  4I5L B;  3AKB A;  1ZOT B;  4Q04 A;  1Y1U A;  2KI6 D;  1KK8 B;  2ISD A;  2TN4 A;  1G33 A;  2O60 A;  1AUI B;  1LXF C;  3SG6 A;  2JXC A;  1F8H A;  1SL9 A;  1ALW A;  2D8N A;  5G08 A;  4MSP A;  3DF0 A;  2JRF A;  1SK6 D;  4YI9 A;  1CB1 A;  1BT6 A;  2WOS A;  5HLV A;  2KFH A;  2GGZ A;  1JWD A;  1GJY A;  4YGA A;  1J1D A;  1KK8 C;  1KWO B;  1M31 A;  1MXE A;  1W7I B;  1XK4 C;  2VRG A;  1S5G Y;  1F70 A;  2LE9 B;  5AEQ A;  1FI6 A;  3DVK A;  1S6I A;  1XFZ O;  1QV1 A;  1BOD A;  3ICB A;  4XYN A;  2KAX A;  1A75 A;  2KBI A;  2KI4 B;  1IRJ A;  5HKZ A;  3KHE A;  4GBA A;  1TOP A;  4GGF C;  1BR4 B;  1J55 A;  3BOW B;  3D10 A;  4U8D A;  4JPZ B;  4CPV A;  1YUU A;  1KWO C;  1EH2 A;  1OE9 B;  2Q4U A;  1CKK A;  2I94 A;  4M2Q A;  4MBE A;  3NSI A;  2LMU A;  4PE7 A;  3PFV A;  2LC5 A;  1MXL C;  1YX7 A;  1CFP A;  3EVU A;  4PE4 A;  1Q80 A;  1F54 A;  3PAL A;  2KI4 C;  1QLK A;  1KCY A;  5D7F A;  4NDB A;  1QVI Z;  1K8U A;  3VGO A;  1F55 A;  1YUR A;  2JQ6 A;  3BXK A;  2B1U A;  4E68 A;  3CTN A;  3JVT B;  1RJV A;  3I5F B;  1CMG A;  1CDM A;  2K7C A;  1MQ1 A;  2A4J A;  5DKN A;  4PE0 A;  2F2O A;  1WLZ A;  1HQV A;  4UPG A;  2H61 C;  1IGV A;  2V53 A;  1AP4 A;  2E6W A;  2BCX A;  4PAL A;  1F4Q A;  2ZRT A;  3SG3 A;  1DMO A;  1RRO A;  2JPT A;  1G8I A;  1SL7 A;  1BMO A;  3JVT C;  3DVJ A;  3I5F C;  4BY4 A;  1GGW A;  1UHH A;  1HT9 A;  1NSH A;  1PAL A;  4YGC B;  2I18 A;  2O5G A;  2L2E A;  1SNL A;  1AK8 A;  2MA2 A;  1GQM A;  2MBX A;  1ZAC A;  1TCF A;  2K7D A;  3CWG A;  2ZN9 A;  4GPL B;  2PVB A;  1TRF A;  1KQM B;  1RTP 1;  2KDH A;  3HCM A;  1BF5 A;  1OZS A;  2MRD A;  1K9P A;  1REC A;  1K9U A;  2BBN A;  5D69 A;  1YRT B;  5I2L A;  5BPJ A;  1YX8 A;  2LLS A;  4M2P A;  4PHK A;  1FPW A;  1Y1A A;  1IWQ A;  1IQ3 A;  1SL8 A;  2BCA A;  1BG1 A;  3SG5 A;  3WHU B;  4OR9 B;  2NCP A;  1EG4 A;  1R2U A;  1VRK A;  1V1F A;  1DJZ A;  1OMR A;  2G2B A;  1KQM C;  2M8U A;  1XFW O;  2LM5 A;  1UHN A;  2OS8 B;  3OP0 A;  2CCM A;  2LHL A;  4GFT A;  2MLE C;  1K90 D;  2BE6 A;  3SJS A;  1BR1 B;  2NLN A;  1PVA A;  2NCO A;  1NUB A;  4YGB B;  2PMY A;  3H4S E;  1ZFS A;  3NSK A;  3TZ1 A;  4PCW A;  5DKR A;  2LV7 A;  2EGD A;  3TDI A;  1EJ3 A;  1ODB A;  1G4Y R;  2BCB A;  3FS7 A;  3PSR A;  2LLU A;  2OS8 C;  1YRU B;  2WCE A;  4N1F A;  1JUO A;  5CSN A;  2ZFD A;  2M3W A;  2KQ6 A;  2L51 A;  1BLQ A;  2M49 B;  1K93 D;  3A8R A;  1IKU A;  1SMG A;  1FBV A;  2JTZ A;  3VRN A;  3VRO A;  1EG3 A;  1QTX A;  2LAN A;  4L9M A;  4YRU A;  1SYM A;  3JTD B;  3C1V A;  1S26 D;  2HPS A;  1K2H A;  1PSB A;  1DJX A;  1S3P A;  4OKH A;  4OV2 A;  1J1E A;  4HRH A;  2DOQ A;  2PSR A;  4HSZ A;  2JC2 A;  5AXI A;  4WQ3 A;  4IL1 A;  3GK1 A;  1ZUZ A;  2HET A;  3SG7 A;  3TDU A;  2Q91 A;  3M0W A;  3SG4 A;  4R1E A;  1GGZ A;  2WCB A;  3FWC A;  3SG2 A;  4FQO A;  1MWN A;  2H61 A;  1OSA A;  4A4B A;  5JJG A;  5I2Q A;  4MVF A;  4ICB A;  1FI5 A;  1CTR A;  1R6P A;  3JTD C;  2HF5 A;  2L4I A;  3KF9 A;  5AER A;  1B9A A;  1B7T Z;  2ZNE A;  2KFG A;  1DTL A;  1DF0 B;  1CLL A;  1RFJ A;  2M97 A;  2F3Y A;  4YGE B;  1MF8 B;  1TNX A;  3I5H B;  3TUY B;  1B7T Y;  1UHK A;  4AQJ A;  3DVM A;  2CBL A;  3HX4 A;  1AJ5 A;  5TNC A;  1B8R A;  4HRG A;  4OVN F;  2P6B B;  2MAZ A;  3O2P A;  1SPY A;  2WC8 A;  2Y4Q A;  4JWQ A;  1IH0 A;  1IQ5 A;  2BEC A;  1UHI A;  3TDZ A;  3EVV A;  1U5I A;  3MSE B;  1QJT A;  3CZT X;  1AJ4 A;  1CLM A;  1CM1 A;  2PAL A;  1KFX L;  2JXL A;  2LMV A;  1J7R A;  4N1G A;  2G9B A;  3BQ3 A;  5HLO A;  1WRL A;  2ZRS A;  3DF0 B;  3RLZ A;  3BUO B;  3I5H C;  2F33 A;  3ZWH A;  3TUY C;  1NX3 A;  3LLE A;  1QVI Y;  3LK1 A;  2LNK A;  1BU3 A;  3O4Y A;  1NX2 A;  4A4C A;  2SAS A;  1LA0 A;  5AFP A;  2GV5 A;  1IG5 A;  1SCM B;  3GK2 A;  2LAP A;  3AKA A;  1PK0 D;  4YI8 A;  1J7O A;  2SCP A;  1QV0 A;  2WCF A;  4XJK B;  1Y1X A;  1DGV A;  2JUL A;  1XA5 A;  2FJU B;  3CR5 X;  1CLB A;  1YTZ C;  1SR6 B;  3BUN B;  2L98 A;  3D0Y A;  1KFU L;  1NX0 A;  3LK0 A;  3VRP A;  3PN7 B;  5JOL A;  2LUX A;  4MN0 A;  2K0J A;  1XVJ A;  2KGR A;  5PAL A;  3I5I B;  1NYA A;  2EC6 B;  5ER5 A;  1KK7 Z;  2JWW A;  3GK4 X;  1QX5 B;  2LCP A;  1Y0V H;  1SCM C;  1E8A A;  1SRA A;  4DCK A;  2BL0 B;  2L5X B;  2L0P A;  4NDC A;  1A03 A;  3BYA A;  1MHO A;  4CLN A;  4MLW A;  1CMF A;  1A2X A;  4QJ5 B;  1H8B A;  1MR8 A;  3FIA A;  5F6T A;  1SR6 C;  1YUS A;  1K96 A;  5CSJ A;  1KSO A;  2JTT A;  2COL B;  1TNQ A;  3PN7 C;  5CPV A;  4DUQ A;  4QJ4 B;  1NCX A;  1AVS A;  1M63 B;  4C0J A;  2CNP A;  1N2D A;  1QIW A;  2EC6 C;  3I5I C;  3O6B A;  4TNC A;  4ZCU A;  1LVC D;  3E3R A;  1DGU A;  1TCO B;  2F8P A;  3LL8 B;  4DIR A;  2JT3 A;  4GNK B;  4WRI A;  2BL0 C;  2M0R A;  2KAV A;  1F71 A;  4MZL A;  2KSP A;  1C07 A;  2HQW A;  3KPX A;  2JU0 A;  1UP5 A;  2KOT A;  1L2O B;  1QX7 A;  2BE4 A;  4FTG A;  4C0L A;  1J7P A;  1XK4 A;  4JQ0 D;  1DJH A;  3O78 A;  1AHR A;  1UWO A;  3AAJ A;  1TTX A;  2KYC A;  4D1E A;  5I8N A;  2Y1N A;  4PHJ A;  2OPO A;  2M7L A;  3KEV A;  2NZ0 A;  1QIV A;  1DJW A;  1B4C A;  1N65 A;  1UUR A;  4ZCV A;  1JFK A;  4GGF A;  3TS5 B;  3BUM B;  2M1K B;  1QAT A;  1K95 A;  4GAO A;  1QAS A;  1QXP A;  1RK9 A;  3VRQ A;  2K8M B;  3VRR A;  1L2O C;  2M1U A;  2JOJ A;  2QPT A;  5J3X A;  1SCV A;  1M39 A;  3NSO A;  4MZK A;  2BKI B;  4BY5 A;  1WRK A;  2ZKM X;  2WND A;  3F45 A;  1NCZ A;  2LUC A;  1XFU O;  3EK8 A;  2M9G A;  3EVR A;  2JNF A;  3BOW A;  3TS5 C;  5HKW A;  2E30 A;  4M2O A;  3OX5 A;  3GOF A;  4NDD A;  3BUW B;  2AMI A;  2JT8 A;  3WNX B;  4C0K A;  2KGB C;  2KHN A;  1N0Y A;  3OHM B;  1W7J B;  4DS7 A;  2JNX A;  2L50 A;  1IJ6 A;  2AAO A;  2LVI A;  2EHB A;  2LVV A;  1XFY O;  2M7N A;  4WQ2 A;  3IQO A;  4ETO A;  1NX1 A;  1BJF A;  1UUS A;  1K94 A;  3OX6 A;  5ER4 X;  1A4P A;  1B8C A;  4P2Y B;  1JC2 A;  2GGM A;  4PHN A;  2QAC A;  4ORB B;  2MJW B;  1NWD A;  3WHT B;  3FWB A;  1LKJ A;  1L7Z A;  3CGA A;  3CR2 A;  1SKT A;  2K7B A;  2KQY A;  2K2F A;  5B8I B;  1BOC A;  1S5G Z;  3PLF B;  1C7V A;  3DD4 A;  3BUX B;  4MRY A;  5KU1 A;  4XJK A;  3SIB A;  1WLM A;  3IF7 A;  5DKQ A;  3OB2 B;  1CFD A;  3NXA A;  1B8L A;  3RM1 A;  2LVK A;  1SW8 A;  1JF0 A;  1YVL A;  1H4B A;  1OMD A;  2RGI A;  4CFR A;  4HRE E;  2KNE A;  1QX2 A;  1NCY A;  2K61 A;  1J7Q A;  1OQP A;  3SIA A;  1B1G A;  2CTN A;  2IS9 A;  3IQQ A;  4PDZ A;  1MUX A;  4GGN A;  1C7W A;  1ZMZ A;  3I5G B;  1QLS A;  2M29 A;  1CDP A;  1FF1 A;  1DJG A;  1EXR A;  1JFJ A;  2MHH A;  1IJ5 A;  2CXJ A;  4AOM A;  2FOT A;  2ZN8 A;  2KYF A;  2BBM A;  1XFV O;  1S6J A;  1TN4 A;  1V1G A;  4QJ3 B;  2PRU A;  1OMV A;  4PHM A;  1OZO A;  5KSZ A;  1A75 B;  3LCP C;  5I2O A;  1CNP A;  1SBJ A;  4GUK A;  3EK7 A;  3I5G C;  1FW4 A;  1JSA A;  1CM4 A;  1TNP A;  1X02 A;  1CFF A;  5K89 A;  1M45 A;  2KBM A;  1KK7 Y;  4DRW A;  4P5O E;  1NPQ A;  4USL A;  2I2R E;  4PE1 A;  1PVB A;  2K2A A;  4ORA B;  5CSF A;  1KQV A;  1XYD A;  4I5J A; 
#chains in the Genus database with same CATH topology
 1U5I B;  4N5X A;  1DJI A;  3PAT A;  4ORC B;  5HYD A;  1KSM A;  4YGD B;  1RWY A;  1WDC B;  3EKH A;  4YBH B;  1T14 A;  4I5N B;  2WOR A;  4CFQ A;  1DT7 B;  1K9K A;  1LA3 A;  1PSR A;  2WCM A;  2LP3 A;  2F2P A;  3AAK A;  2L4H A;  5CSI A;  2HQ8 A;  1JBA A;  2NXQ A;  1SY9 A;  1DJY A;  4MRX A;  5AAN A;  3K21 A;  3OB1 B;  3QRX A;  2WC6 A;  2Y1M A;  4I5K A;  1UHJ A;  3DVE A;  1CDL A;  4CID A;  3NHT A;  1YUT A;  1KFX S;  1JF2 A;  2R2I A;  2YGU A;  5GQQ C;  1NP8 A;  5FYX A;  3L4A A;  3R72 A;  1Y6W A;  4F0Z B;  1M46 A;  2OTG B;  3ZNI A;  1WDC C;  4NQG A;  2AUC A;  2CT9 A;  2LHI A;  1XFX O;  1TIZ A;  5KTY A;  1YR5 A;  2H2K A;  1WRZ A;  3D0Y B;  1F4O A;  1LIN A;  1PUL A;  2KFF A;  4KYN A;  4MEW A;  1DVI A;  1CFC A;  1S1E A;  1WY9 A;  3PM8 A;  1OOI X;  3DZT A;  2FCD A;  1S36 A;  2BKH B;  2LMT A;  3KO0 A;  1EL4 A;  2JT0 A;  3WXA A;  1OOF A;  1DC1 A;  1CDN A;  1GM0 A;  1QS7 A;  2Y5I A;  2LVJ A;  2ZND A;  2I7A A;  2MLF C;  2OTG C;  2K7O A;  1A29 A;  1KFU S;  1OOJ A;  2FCE A;  1ALV A;  1PRW A;  2KAY A;  4MZJ A;  1NIW A;  1D1O A;  2JZI A;  5HKY A;  3CLN A;  2PAS A;  3R1O A;  4AQI A;  5IBW A;  1DF0 A;  1TNW A;  1YVH A;  3CS1 A;  1B47 A;  3NSL A;  1S6C A;  1XO5 A;  3CR4 X;  3A4U B;  3EK4 A;  4OCI A;  2KI6 C;  2LLT A;  2LP2 A;  3EKJ A;  2F3Z A;  4I5L B;  3AKB A;  1ZOT B;  4Q04 A;  1Y1U A;  2KI6 D;  3CZ0 A;  3O4X A;  1KK8 B;  2L2C A;  2ISD A;  2TN4 A;  1G33 A;  2O60 A;  1LS8 A;  1AUI B;  1LXF C;  3SG6 A;  2JXC A;  3OGN A;  1F8H A;  1SL9 A;  1ALW A;  2D8N A;  5G08 A;  4MSP A;  3DF0 A;  2JRF A;  1SK6 D;  4YI9 A;  1CB1 A;  1BT6 A;  2WOS A;  5HLV A;  2KFH A;  2GGZ A;  1JWD A;  1GJY A;  4YGA A;  1J1D A;  1KK8 C;  1KWO B;  1M31 A;  1MXE A;  1W7I B;  1XK4 C;  2VRG A;  1S5G Y;  2PYQ A;  1F70 A;  3D78 A;  1DEK A;  2LE9 B;  5AEQ A;  1FI6 A;  3DVK A;  1S6I A;  1XFZ O;  1QV1 A;  1BOD A;  3ICB A;  3SS3 A;  4XYN A;  2KAX A;  1A75 A;  2KBI A;  2KI4 B;  1IRJ A;  5HKZ A;  3KHE A;  5I94 A;  4ZCU A;  3S0A A;  4GBA A;  1TOP A;  4GGF C;  1BR4 B;  1J55 A;  3BOW B;  3D10 A;  3B87 A;  4JPZ B;  4U8D A;  4CPV A;  3UO9 A;  1YUU A;  1KWO C;  2QDI A;  3BFH A;  1EH2 A;  1OE9 B;  2Q4U A;  1CKK A;  2I94 A;  4M2Q A;  4MBE A;  3NSI A;  2LMU A;  4PE7 A;  3PFV A;  1QWV A;  2LC5 A;  1MXL C;  1YX7 A;  1CFP A;  3EVU A;  4PE4 A;  1Q80 A;  3DXL A;  1F54 A;  3PAL A;  2KI4 C;  1QLK A;  3FE6 A;  5D7F A;  1KCY A;  4NDB A;  1QVI Z;  1K8U A;  3VGO A;  1F55 A;  1YUR A;  2JQ6 A;  3BXK A;  2B1U A;  4E68 A;  3CTN A;  3JVT B;  1RJV A;  1TUJ A;  3I5F B;  1CMG A;  2GTE A;  3D77 A;  2K60 A;  3NHI A;  3R1P A;  1CDM A;  2K7C A;  1MQ1 A;  2A4J A;  5DKN A;  4PE0 A;  2F2O A;  1WLZ A;  1HQV A;  3L4L A;  4UPG A;  2H61 C;  5FI6 A;  1IGV A;  2V53 A;  1AP4 A;  2E6W A;  2BCX A;  4PAL A;  1F4Q A;  2ZRT A;  3SG3 A;  1DMO A;  1RRO A;  2JPT A;  3NGV A;  1G8I A;  1SL7 A;  1BMO A;  2WC5 A;  3JVT C;  3DVJ A;  3I5F C;  3DYE A;  4BY4 A;  1GGW A;  1UHH A;  1HT9 A;  1NSH A;  1PAL A;  4YGC B;  2I18 A;  2O5G A;  2L2E A;  1SNL A;  1AK8 A;  2MA2 A;  1GQM A;  2MBX A;  1ZAC A;  1TCF A;  2K7D A;  3CWG A;  3R1V A;  2ZN9 A;  4GPL B;  2PVB A;  1TRF A;  1KQM B;  1RTP 1;  2KDH A;  3HCM A;  1BF5 A;  1OZS A;  3FE9 A;  2MRD A;  1K9P A;  1REC A;  1K9U A;  1Z2C B;  4F7F A;  2BBN A;  5D69 A;  1YRT B;  5I2L A;  5BPJ A;  1OOG A;  1YX8 A;  2LLS A;  4M2P A;  4PHK A;  1FPW A;  1Y1A A;  1IWQ A;  1C3Z A;  1IQ3 A;  1SL8 A;  2BCA A;  1BG1 A;  3SG5 A;  3WHU B;  4OR9 B;  2NCP A;  1EG4 A;  1R2U A;  1VRK A;  1V1F A;  3D75 A;  1DJZ A;  2P71 A;  1OMR A;  2G2B A;  1KQM C;  2M8U A;  1XFW O;  2LM5 A;  1UHN A;  2OS8 B;  3OP0 A;  2CCM A;  2LHL A;  4GFT A;  2MLE C;  1K90 D;  2BE6 A;  3SJS A;  1BR1 B;  3BFA A;  2NLN A;  1PVA A;  2NCO A;  1NUB A;  2ERB A;  2PMY A;  4YGB B;  3H4S E;  1ZFS A;  3NSK A;  2KPH A;  3TZ1 A;  4PCW A;  5DKR A;  2LV7 A;  3B6X A;  2EGD A;  3TDI A;  1EJ3 A;  1ODB A;  1G4Y R;  2BCB A;  3FS7 A;  3PSR A;  2LLU A;  2OS8 C;  1YRU B;  1C3Y A;  2WCE A;  4N1F A;  1JUO A;  3N7H A;  5CSN A;  2ZFD A;  2M3W A;  2KQ6 A;  2L51 A;  3SS4 A;  1BLQ A;  2M49 B;  1K93 D;  3A8R A;  1IKU A;  1SMG A;  1FBV A;  2JTZ A;  3VRN A;  3VRO A;  1EG3 A;  1QTX A;  2LAN A;  4L9M A;  3OBV A;  4YRU A;  1XFR A;  3CZ2 A;  1SYM A;  4FQT A;  3JTD B;  3C1V A;  1S26 D;  2HPS A;  1K2H A;  1PSB A;  4INW A;  1DJX A;  1S3P A;  4OKH A;  4OV2 A;  1J1E A;  4HRH A;  2DOQ A;  2PSR A;  4HSZ A;  2JC2 A;  5AXI A;  4WQ3 A;  3S0G A;  4IL1 A;  3GK1 A;  1ZUZ A;  2HET A;  3DY9 A;  5EL2 A;  3SG7 A;  2Q91 A;  3TDU A;  3M0W A;  3PJI A;  3SG4 A;  2PQL A;  4OZD A;  1GGZ A;  4R1E A;  2WCB A;  3FWC A;  3SG2 A;  4FQO A;  1MWN A;  2H61 A;  1OSA A;  4A4B A;  5JJG A;  5I2Q A;  4JKT A;  4MVF A;  4ICB A;  1FI5 A;  2JPO A;  1CTR A;  1R6P A;  3JTD C;  2HF5 A;  2L4I A;  3KF9 A;  1SSE B;  3FE8 A;  5AER A;  2WCK A;  1B9A A;  1B7T Z;  2ZNE A;  2KFG A;  1DTL A;  1DF0 B;  1CLL A;  1RFJ A;  2M97 A;  3B7A A;  2F3Y A;  3D74 A;  1MF8 B;  4YGE B;  1TNX A;  3I5H B;  3TUY B;  1B7T Y;  1UHK A;  4AQJ A;  3DVM A;  2CBL A;  3Q8I A;  3HX4 A;  1AJ5 A;  5TNC A;  1B8R A;  3D76 A;  4HRG A;  4OVN F;  2P6B B;  2MAZ A;  3O2P A;  1SPY A;  2WC8 A;  2Y4Q A;  4JWQ A;  1IH0 A;  1IQ5 A;  2BEC A;  1UHI A;  3EG5 B;  3EVV A;  3TDZ A;  1U5I A;  3MSE B;  1QJT A;  3CZT X;  1AJ4 A;  1CLM A;  1CM1 A;  2PAL A;  1KFX L;  2JXL A;  2LMV A;  1J7R A;  4N1G A;  2G9B A;  3BQ3 A;  3CZ1 A;  5HLO A;  3B88 A;  1WRL A;  2ZRS A;  3DF0 B;  3RLZ A;  3BUO B;  3I5H C;  2F33 A;  3ZWH A;  3TUY C;  1NX3 A;  3LLE A;  1QVI Y;  3LK1 A;  2LNK A;  1BU3 A;  3O4Y A;  1NX2 A;  4A4C A;  2SAS A;  1LA0 A;  5AFP A;  2GV5 A;  3BJH A;  1IG5 A;  1DEL A;  1SCM B;  3GK2 A;  2LAP A;  3AKA A;  1PK0 D;  4YI8 A;  1J7O A;  2SCP A;  1QV0 A;  2WCF A;  4XJK B;  1Y1X A;  1DGV A;  1ORG A;  2JUL A;  3S0E A;  3VB1 A;  1XA5 A;  2FJU B;  3CR5 X;  1CLB A;  1YTZ C;  1SR6 B;  3BUN B;  2L98 A;  3D0Y A;  1TWO A;  1KFU L;  1NX0 A;  3LK0 A;  3SS5 A;  3VRP A;  3PN7 B;  5JOL A;  2LUX A;  4MN0 A;  2K0J A;  1XVJ A;  2KGR A;  5PAL A;  3I5I B;  1NYA A;  2EC6 B;  2P70 A;  5ER5 A;  3UNW A;  1KK7 Z;  2JWW A;  3CYZ A;  1QX5 B;  2LCP A;  3GK4 X;  1Y0V H;  2QEH A;  1SCM C;  1E8A A;  1SRA A;  4DCK A;  2BL0 B;  2L5X B;  2L0P A;  4NDC A;  3V2L A;  1A03 A;  3BYA A;  1MHO A;  3K1E A;  4CLN A;  4MLW A;  5HL1 A;  1CMF A;  1A2X A;  4QJ5 B;  1H8B A;  1MR8 A;  3FIA A;  5F6T A;  1SR6 C;  1YUS A;  3QME A;  1K96 A;  5CSJ A;  3RZS A;  1KSO A;  2JTT A;  2COL B;  1TNQ A;  3PN7 C;  5CPV A;  4DUQ A;  4QJ4 B;  1NCX A;  1AVS A;  1M63 B;  1P28 A;  2CNP A;  1N2D A;  1QIW A;  2EC6 C;  2WCJ A;  3I5I C;  3O6B A;  4TNC A;  2BAP A;  1LVC D;  3E3R A;  1DGU A;  1TCO B;  2F8P A;  2H8V A;  3LL8 B;  4DIR A;  2JT3 A;  4GNK B;  4WRI A;  2BL0 C;  2M0R A;  5D3O A;  2KAV A;  1F71 A;  3CDN A;  4MZL A;  2KSP A;  2QEV A;  1C07 A;  2HQW A;  3KPX A;  2JU0 A;  1UP5 A;  2KOT A;  1L2O B;  1QX7 A;  2BE4 A;  4FTG A;  4C0L A;  1J7P A;  1XK4 A;  4JQ0 D;  1DJH A;  3O78 A;  1AHR A;  1UWO A;  1Z4H A;  1TTX A;  2KYC A;  3AAJ A;  4D1E A;  5I8N A;  2Y1N A;  4PHJ A;  2OPO A;  2M7L A;  3KEV A;  2NZ0 A;  1QIV A;  1DJW A;  1B4C A;  1N65 A;  1UUR A;  1W9Z A;  2KLE A;  1JFK A;  4GGF A;  4ZCV A;  3TS5 B;  3BUM B;  2KLD A;  2M1K B;  1QAT A;  1K95 A;  4GAO A;  1QAS A;  1QXP A;  1RK9 A;  3VRQ A;  2K8M B;  3VRR A;  1L2O C;  2M1U A;  2JOJ A;  2QPT A;  5J3X A;  1SCV A;  1TUZ A;  1M39 A;  3NSO A;  4MZK A;  2BKI B;  4BY5 A;  1WRK A;  2ZKM X;  2WND A;  3F45 A;  1NCZ A;  2LUC A;  1XFU O;  4JD9 A;  3EK8 A;  2M9G A;  3EVR A;  5FI2 A;  2JNF A;  3BOW A;  3TS5 C;  5HKW A;  3IVT A;  4C0J A;  2E30 A;  4M2O A;  3OX5 A;  3GOF A;  5FI7 A;  4NDD A;  2L5Y A;  3BUW B;  3BFB A;  1OOH A;  2AMI A;  2JT8 A;  3WNX B;  4C0K A;  2KGB C;  2KHN A;  1N0Y A;  3OHM B;  1W7J B;  3S0D A;  2JNX A;  4DS7 A;  2L50 A;  1IJ6 A;  2AAO A;  2LVI A;  2EHB A;  2LVV A;  1XFY O;  2M7N A;  4WQ2 A;  3IQO A;  4ETO A;  1NX1 A;  1BJF A;  1UUS A;  1K94 A;  3OX6 A;  1IIO A;  5ER4 X;  1A4P A;  1B8C A;  2WCH A;  4P2Y B;  1JC2 A;  2GGM A;  4PHN A;  2QAC A;  4ORB B;  2MJW B;  3S0F A;  1NWD A;  3WHT B;  3FWB A;  1LKJ A;  1L7Z A;  3CGA A;  3CR2 A;  1SKT A;  2K7B A;  2KQY A;  2QEB A;  2QEO A;  2K2F A;  5B8I B;  1BOC A;  1S5G Z;  3PLF B;  3B86 A;  1C7V A;  3DD4 A;  3BUX B;  3D73 A;  3L47 A;  4MRY A;  5KU1 A;  4XJK A;  3SIB A;  1WLM A;  3IF7 A;  5DKQ A;  3OB2 B;  1CFD A;  3NXA A;  1B8L A;  3RM1 A;  2LVK A;  3S0B A;  1SW8 A;  1JF0 A;  4PT1 A;  1YVL A;  1H4B A;  1OMD A;  2RGI A;  4CFR A;  2FJY A;  4HRE E;  2KNE A;  1QX2 A;  1NCY A;  2K61 A;  1J7Q A;  1OQP A;  3SIA A;  1B1G A;  2CTN A;  2IS9 A;  2BNX A;  3IQQ A;  4IJ7 A;  4PDZ A;  1MUX A;  4GGN A;  1DQE A;  1C7W A;  1ZMZ A;  3I5G B;  1QLS A;  2M29 A;  1CDP A;  1FF1 A;  1DJG A;  1EXR A;  1JFJ A;  2MHH A;  4INX A;  1IJ5 A;  2CXJ A;  4AOM A;  2FOT A;  2ZN8 A;  2KYF A;  2BBM A;  1XFV O;  1S6J A;  1TN4 A;  1V1G A;  4QJ3 B;  2PRU A;  1OMV A;  1OW4 A;  4PHM A;  1OZO A;  5KSZ A;  1A75 B;  3LCP C;  5I2O A;  1CNP A;  1SBJ A;  4GUK A;  3EK7 A;  3I5G C;  1FW4 A;  1JSA A;  1CM4 A;  3PM2 A;  5DIC A;  1TNP A;  1X02 A;  1CFF A;  5K89 A;  1M45 A;  2KBM A;  3CAB A;  1KK7 Y;  4DRW A;  4P5O E;  1NPQ A;  4USL A;  2I2R E;  4PE1 A;  1PVB A;  2K2A A;  4ORA B;  2WCL A;  5CSF A;  1KQV A;  1XYD A;  4I5J A; 
#chains in the Genus database with same CATH homology
 1U5I B;  4N5X A;  1DJI A;  3PAT A;  4ORC B;  5HYD A;  1KSM A;  4YGD B;  1RWY A;  1WDC B;  3EKH A;  4YBH B;  4CFQ A;  4I5N B;  2WOR A;  1DT7 B;  1K9K A;  1LA3 A;  1PSR A;  2LP3 A;  2F2P A;  3AAK A;  2L4H A;  5CSI A;  2HQ8 A;  1JBA A;  2NXQ A;  1SY9 A;  1DJY A;  4MRX A;  5AAN A;  3K21 A;  3OB1 B;  3QRX A;  2Y1M A;  4I5K A;  1UHJ A;  3DVE A;  1CDL A;  4CID A;  1YUT A;  1KFX S;  1JF2 A;  2R2I A;  5GQQ C;  1NP8 A;  5FYX A;  1Y6W A;  4F0Z B;  1M46 A;  2OTG B;  3ZNI A;  1WDC C;  4NQG A;  2AUC A;  2CT9 A;  2LHI A;  1XFX O;  1TIZ A;  5KTY A;  1YR5 A;  2H2K A;  1WRZ A;  3D0Y B;  1F4O A;  1LIN A;  1PUL A;  2KFF A;  4MEW A;  1CFC A;  1DVI A;  1S1E A;  1WY9 A;  3PM8 A;  2FCD A;  1S36 A;  2BKH B;  2LMT A;  3KO0 A;  1EL4 A;  2JT0 A;  3WXA A;  1CDN A;  1QS7 A;  2Y5I A;  2LVJ A;  2ZND A;  2I7A A;  2MLF C;  2OTG C;  2K7O A;  1A29 A;  1KFU S;  1OOJ A;  2FCE A;  1ALV A;  1PRW A;  2KAY A;  4MZJ A;  1NIW A;  1D1O A;  2JZI A;  5HKY A;  3CLN A;  2PAS A;  4AQI A;  5IBW A;  1DF0 A;  1TNW A;  1YVH A;  3CS1 A;  1B47 A;  3NSL A;  1S6C A;  1XO5 A;  3CR4 X;  3A4U B;  3EK4 A;  4OCI A;  2KI6 C;  2LLT A;  2LP2 A;  3EKJ A;  2F3Z A;  4I5L B;  3AKB A;  1ZOT B;  4Q04 A;  1Y1U A;  2KI6 D;  1KK8 B;  2ISD A;  2TN4 A;  1G33 A;  2O60 A;  1AUI B;  1LXF C;  3SG6 A;  2JXC A;  1F8H A;  1SL9 A;  1ALW A;  2D8N A;  5G08 A;  4MSP A;  3DF0 A;  2JRF A;  1SK6 D;  4YI9 A;  1CB1 A;  1BT6 A;  2WOS A;  5HLV A;  2KFH A;  2GGZ A;  1JWD A;  1GJY A;  4YGA A;  1J1D A;  1KK8 C;  1KWO B;  1M31 A;  1MXE A;  1W7I B;  1XK4 C;  2VRG A;  1S5G Y;  1F70 A;  2LE9 B;  5AEQ A;  1FI6 A;  3DVK A;  1S6I A;  1XFZ O;  1QV1 A;  1BOD A;  3ICB A;  4XYN A;  2KAX A;  1A75 A;  2KBI A;  2KI4 B;  1IRJ A;  5HKZ A;  3KHE A;  4GBA A;  1TOP A;  4GGF C;  1BR4 B;  1J55 A;  3BOW B;  3D10 A;  4U8D A;  4JPZ B;  4CPV A;  1YUU A;  1KWO C;  1EH2 A;  1OE9 B;  2Q4U A;  1CKK A;  2I94 A;  4M2Q A;  4MBE A;  3NSI A;  2LMU A;  4PE7 A;  3PFV A;  2LC5 A;  1MXL C;  1YX7 A;  1CFP A;  3EVU A;  4PE4 A;  1Q80 A;  1F54 A;  3PAL A;  2KI4 C;  1QLK A;  1KCY A;  5D7F A;  4NDB A;  1QVI Z;  1K8U A;  3VGO A;  1F55 A;  1YUR A;  2JQ6 A;  3BXK A;  2B1U A;  4E68 A;  3CTN A;  3JVT B;  1RJV A;  3I5F B;  1CMG A;  1CDM A;  2K7C A;  1MQ1 A;  2A4J A;  5DKN A;  4PE0 A;  2F2O A;  1WLZ A;  1HQV A;  4UPG A;  2H61 C;  1IGV A;  2V53 A;  1AP4 A;  2E6W A;  2BCX A;  4PAL A;  1F4Q A;  2ZRT A;  3SG3 A;  1DMO A;  1RRO A;  2JPT A;  1G8I A;  1SL7 A;  1BMO A;  3JVT C;  3DVJ A;  3I5F C;  4BY4 A;  1GGW A;  1UHH A;  1HT9 A;  1NSH A;  1PAL A;  4YGC B;  2I18 A;  2O5G A;  2L2E A;  1SNL A;  1AK8 A;  2MA2 A;  1GQM A;  2MBX A;  1ZAC A;  1TCF A;  2K7D A;  3CWG A;  2ZN9 A;  4GPL B;  2PVB A;  1TRF A;  1KQM B;  1RTP 1;  2KDH A;  3HCM A;  1BF5 A;  1OZS A;  2MRD A;  1K9P A;  1REC A;  1K9U A;  2BBN A;  5D69 A;  1YRT B;  5I2L A;  5BPJ A;  1YX8 A;  2LLS A;  4M2P A;  4PHK A;  1FPW A;  1Y1A A;  1IWQ A;  1IQ3 A;  1SL8 A;  2BCA A;  1BG1 A;  3SG5 A;  3WHU B;  4OR9 B;  2NCP A;  1EG4 A;  1R2U A;  1VRK A;  1V1F A;  1DJZ A;  1OMR A;  2G2B A;  1KQM C;  2M8U A;  1XFW O;  2LM5 A;  1UHN A;  2OS8 B;  3OP0 A;  2CCM A;  2LHL A;  4GFT A;  2MLE C;  1K90 D;  2BE6 A;  3SJS A;  1BR1 B;  2NLN A;  1PVA A;  2NCO A;  1NUB A;  4YGB B;  2PMY A;  3H4S E;  1ZFS A;  3NSK A;  3TZ1 A;  4PCW A;  5DKR A;  2LV7 A;  2EGD A;  3TDI A;  1EJ3 A;  1ODB A;  1G4Y R;  2BCB A;  3FS7 A;  3PSR A;  2LLU A;  2OS8 C;  1YRU B;  2WCE A;  4N1F A;  1JUO A;  5CSN A;  2ZFD A;  2M3W A;  2KQ6 A;  2L51 A;  1BLQ A;  2M49 B;  1K93 D;  3A8R A;  1IKU A;  1SMG A;  1FBV A;  2JTZ A;  3VRN A;  3VRO A;  1EG3 A;  1QTX A;  2LAN A;  4L9M A;  4YRU A;  1SYM A;  3JTD B;  3C1V A;  1S26 D;  2HPS A;  1K2H A;  1PSB A;  1DJX A;  1S3P A;  4OKH A;  4OV2 A;  1J1E A;  4HRH A;  2DOQ A;  2PSR A;  4HSZ A;  2JC2 A;  5AXI A;  4WQ3 A;  4IL1 A;  3GK1 A;  1ZUZ A;  2HET A;  3SG7 A;  3TDU A;  2Q91 A;  3M0W A;  3SG4 A;  4R1E A;  1GGZ A;  2WCB A;  3FWC A;  3SG2 A;  4FQO A;  1MWN A;  2H61 A;  1OSA A;  4A4B A;  5JJG A;  5I2Q A;  4MVF A;  4ICB A;  1FI5 A;  1CTR A;  1R6P A;  3JTD C;  2HF5 A;  2L4I A;  3KF9 A;  5AER A;  1B9A A;  1B7T Z;  2ZNE A;  2KFG A;  1DTL A;  1DF0 B;  1CLL A;  1RFJ A;  2M97 A;  2F3Y A;  4YGE B;  1MF8 B;  1TNX A;  3I5H B;  3TUY B;  1B7T Y;  1UHK A;  4AQJ A;  3DVM A;  2CBL A;  3HX4 A;  1AJ5 A;  5TNC A;  1B8R A;  4HRG A;  4OVN F;  2P6B B;  2MAZ A;  3O2P A;  1SPY A;  2WC8 A;  2Y4Q A;  4JWQ A;  1IH0 A;  1IQ5 A;  2BEC A;  1UHI A;  3TDZ A;  3EVV A;  1U5I A;  3MSE B;  1QJT A;  3CZT X;  1AJ4 A;  1CLM A;  1CM1 A;  2PAL A;  1KFX L;  2JXL A;  2LMV A;  1J7R A;  4N1G A;  2G9B A;  3BQ3 A;  5HLO A;  1WRL A;  2ZRS A;  3DF0 B;  3RLZ A;  3BUO B;  3I5H C;  2F33 A;  3ZWH A;  3TUY C;  1NX3 A;  3LLE A;  1QVI Y;  3LK1 A;  2LNK A;  1BU3 A;  3O4Y A;  1NX2 A;  4A4C A;  2SAS A;  1LA0 A;  5AFP A;  2GV5 A;  1IG5 A;  1SCM B;  3GK2 A;  2LAP A;  3AKA A;  1PK0 D;  4YI8 A;  1J7O A;  2SCP A;  1QV0 A;  2WCF A;  4XJK B;  1Y1X A;  1DGV A;  2JUL A;  1XA5 A;  2FJU B;  3CR5 X;  1CLB A;  1YTZ C;  1SR6 B;  3BUN B;  2L98 A;  3D0Y A;  1KFU L;  1NX0 A;  3LK0 A;  3VRP A;  3PN7 B;  5JOL A;  2LUX A;  4MN0 A;  2K0J A;  1XVJ A;  2KGR A;  5PAL A;  3I5I B;  1NYA A;  2EC6 B;  5ER5 A;  1KK7 Z;  2JWW A;  3GK4 X;  1QX5 B;  2LCP A;  1Y0V H;  1SCM C;  1E8A A;  1SRA A;  4DCK A;  2BL0 B;  2L5X B;  2L0P A;  4NDC A;  1A03 A;  3BYA A;  1MHO A;  4CLN A;  4MLW A;  1CMF A;  1A2X A;  4QJ5 B;  1H8B A;  1MR8 A;  3FIA A;  5F6T A;  1SR6 C;  1YUS A;  1K96 A;  5CSJ A;  1KSO A;  2JTT A;  2COL B;  1TNQ A;  3PN7 C;  5CPV A;  4DUQ A;  4QJ4 B;  1NCX A;  1AVS A;  1M63 B;  4C0J A;  2CNP A;  1N2D A;  1QIW A;  2EC6 C;  3I5I C;  3O6B A;  4TNC A;  4ZCU A;  1LVC D;  3E3R A;  1DGU A;  1TCO B;  2F8P A;  3LL8 B;  4DIR A;  2JT3 A;  4GNK B;  4WRI A;  2BL0 C;  2M0R A;  2KAV A;  1F71 A;  4MZL A;  2KSP A;  1C07 A;  2HQW A;  3KPX A;  2JU0 A;  1UP5 A;  2KOT A;  1L2O B;  1QX7 A;  2BE4 A;  4FTG A;  4C0L A;  1J7P A;  1XK4 A;  4JQ0 D;  1DJH A;  3O78 A;  1AHR A;  1UWO A;  3AAJ A;  1TTX A;  2KYC A;  4D1E A;  5I8N A;  2Y1N A;  4PHJ A;  2OPO A;  2M7L A;  3KEV A;  2NZ0 A;  1QIV A;  1DJW A;  1B4C A;  1N65 A;  1UUR A;  4ZCV A;  1JFK A;  4GGF A;  3TS5 B;  3BUM B;  2M1K B;  1QAT A;  1K95 A;  4GAO A;  1QAS A;  1QXP A;  1RK9 A;  3VRQ A;  2K8M B;  3VRR A;  1L2O C;  2M1U A;  2JOJ A;  2QPT A;  5J3X A;  1SCV A;  1M39 A;  3NSO A;  4MZK A;  2BKI B;  4BY5 A;  1WRK A;  2ZKM X;  2WND A;  3F45 A;  1NCZ A;  2LUC A;  1XFU O;  3EK8 A;  2M9G A;  3EVR A;  2JNF A;  3BOW A;  3TS5 C;  5HKW A;  2E30 A;  4M2O A;  3OX5 A;  3GOF A;  4NDD A;  3BUW B;  2AMI A;  2JT8 A;  3WNX B;  4C0K A;  2KGB C;  2KHN A;  1N0Y A;  3OHM B;  1W7J B;  4DS7 A;  2JNX A;  2L50 A;  1IJ6 A;  2AAO A;  2LVI A;  2EHB A;  2LVV A;  1XFY O;  2M7N A;  4WQ2 A;  3IQO A;  4ETO A;  1NX1 A;  1BJF A;  1UUS A;  1K94 A;  3OX6 A;  5ER4 X;  1A4P A;  1B8C A;  4P2Y B;  1JC2 A;  2GGM A;  4PHN A;  2QAC A;  4ORB B;  2MJW B;  1NWD A;  3WHT B;  3FWB A;  1LKJ A;  1L7Z A;  3CGA A;  3CR2 A;  1SKT A;  2K7B A;  2KQY A;  2K2F A;  5B8I B;  1BOC A;  1S5G Z;  3PLF B;  1C7V A;  3DD4 A;  3BUX B;  4MRY A;  5KU1 A;  4XJK A;  3SIB A;  1WLM A;  3IF7 A;  5DKQ A;  3OB2 B;  1CFD A;  3NXA A;  1B8L A;  3RM1 A;  2LVK A;  1SW8 A;  1JF0 A;  1YVL A;  1H4B A;  1OMD A;  2RGI A;  4CFR A;  4HRE E;  2KNE A;  1QX2 A;  1NCY A;  2K61 A;  1J7Q A;  1OQP A;  3SIA A;  1B1G A;  2CTN A;  2IS9 A;  3IQQ A;  4PDZ A;  1MUX A;  4GGN A;  1C7W A;  1ZMZ A;  3I5G B;  1QLS A;  2M29 A;  1CDP A;  1FF1 A;  1DJG A;  1EXR A;  1JFJ A;  2MHH A;  1IJ5 A;  2CXJ A;  4AOM A;  2FOT A;  2ZN8 A;  2KYF A;  2BBM A;  1XFV O;  1S6J A;  1TN4 A;  1V1G A;  4QJ3 B;  2PRU A;  1OMV A;  4PHM A;  1OZO A;  5KSZ A;  1A75 B;  3LCP C;  5I2O A;  1CNP A;  1SBJ A;  4GUK A;  3EK7 A;  3I5G C;  1FW4 A;  1JSA A;  1CM4 A;  1TNP A;  1X02 A;  1CFF A;  5K89 A;  1M45 A;  2KBM A;  1KK7 Y;  4DRW A;  4P5O E;  1NPQ A;  4USL A;  2I2R E;  4PE1 A;  1PVB A;  2K2A A;  4ORA B;  5CSF A;  1KQV A;  1XYD A;  4I5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...