2LE9B

Ragec2-s100a13 tetrameric complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Interaction of S100A13 with Receptor for Advanced Glycation End products (RAGE) C2 domain
rcsb
source organism Homo sapiens
molecule tags Membrane protein/metal binding protein
total genus 26
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2le9B00
1J7RA 1DF0A 5FYXA 1YRUB 1BG1A 1GQMA 1SL7A 3IQQA 2M3WA 1B1GA 3DF0B 3O78A 1G8IA 3EK4A 2JC2A 1M46A 2L51A 3BXKA 3CR5X 1TNXA 1A2XA 2I2RE 1QATA 2JQ6A 2MRDA 4OKHA 4BY4A 1N2DA 2ZKMX 4MSPA 1TNPA 1J7PA 1SW8A 1QX2A 1TCFA 4MN0A 2GGZA 1BR1B 1PVBA 2KQ6A 2JPTA 2BL0C 4E68A 5J3XA 1Y0VH 3C1VA 1BODA 4DCKA 2K2AA 2PMYA 1KFUL 3LL8B 4L9MA 1CDNA 1NX1A 4CFRA 3ICBA 5CSNA 4GGFC 1TTXA 1DF0B 4GBAA 2LAPA 1IWQA 2JWWA 2LMUA 2OTGB 1CFCA 1DJXA 1DJHA 3I5FB 1B47A 2KDHA 5AXIA 1RFJA 2FJUB 1XVJA 5KSZA 1YUUA 3A8RA 4C0KA 1SPYA 2BCAA 2JULA 1EG4A 1SCVA 2FOTA 2H2KA 2LUCA 2G9BA 3TDZA 2BECA 1C7WA 3CWGA 1YVHA 2D8NA 3AAKA 4BY5A 2LE9B 3MSEB 5HLVA 4AOMA 4MZJA 2E6WA 1F71A 4U8DA 4JPZB 2PALA 2WOSA 2M49B 2CXJA 4FQOA 1CMGA 4YGCB 2KAYA 4TNCA 2LC5A 2P6BB 4CFQA 1PSRA 4GFTA 1NIWA 4OR9B 3BUXB 1YR5A 1CDLA 2AUCA 3VROA 1QIVA 1G33A 3I5HB 2JT3A 2LNKA 1AUIB 4GPLB 3CR2A 2EGDA 1CDPA 1SCMB 2E30A 4F0ZB 3DVMA 3HCMA 2OTGC 2WCFA 1JF2A 3PSRA 3TUYB 1RECA 1YUTA 2MLEC 3I5FC 2NLNA 1SKTA 1LXFC 3I5IB 2L50A 4I5NB 3D0YB 4WRIA 1TOPA 3IQOA 3NSKA 4ICBA 3O2PA 5KU1A 3VRNA 1RROA 2LLSA 3DD4A 3FWCA 2O5GA 1N65A 2FCEA 1AP4A 5I2QA 3VRQA 5HKYA 1CDMA 1MWNA 1VRKA 1E8AA 1YURA 1F70A 1UWOA 2SASA 1J1DA 1H8BA 1EXRA 1SMGA 1WRLA 4GGFA 2LMVA 4OV2A 2FCDA 2F2PA 5BPJA 2F3YA 1CB1A 3NSIA 2PASA 2JZIA 3JVTB 1MF8B 2ZNEA 5PALA 3TS5B 2HQ8A 3TZ1A 1R6PA 1S5GY 1YVLA 1ZMZA 2LMTA 2KYFA 2LM5A 1YX7A 2AMIA 1MHOA 2ZN9A 4PALA 2COLB 1BF5A 2KOTA 5GQQC 4C0JA 1D1OA 1MUXA 3I5HC 1ALWA 2K7DA 5HYDA 2BCBA 2KI4B 2BKIB 1SCMC 1N0YA 4OVNF 1CM1A 1NYAA 3TUYC 1UHKA 1JUOA 1CLMA 2M1UA 2BKHB 2V53A 3I5IC 2KHNA 4NDDA 1BT6A 2EC6B 1QJTA 2F8PA 1WRKA 2L2EA 2LP3A 2JXLA 1L7ZA 3KO0A 2KI6C 2M7NA 4QJ4B 5AFPA 1PULA 1QTXA 2LV7A 1JFKA 3PN7B 2H61A 4JQ0D 1J1EA 1NSHA 1TNWA 1Y1AA 2LLUA 5ER5A 3VGOA 1GJYA 4CPVA 4FTGA 3JVTC 1LA0A 1B9AA 5HKWA 1KSMA 3TS5C 4DIRA 2JRFA 2ZRSA 1IKUA 1CFFA 1CFPA 5HKZA 4I5JA 4MRYA 3SIAA 1FF1A 5AANA 3WHUB 3CLNA 1WDCB 1OQPA 3SG4A 1QS7A 1MR8A 1J7OA 2NZ0A 1GGZA 4M2QA 5DKRA 1IGVA 1RJVA 2JTZA 1SBJA 1NCYA 2HETA 1CNPA 1A29A 1NX2A 1SL9A 3KF9A 2KI4C 2K7CA 3O6BA 1XA5A 1S26D 5HLOA 1TIZA 1KCYA 4YGBB 3OP0A 4PE4A 3BUOB 2EC6C 2KBIA 2MLFC 1B8LA 4GUKA 1YTZC 1FI6A 4MZLA 2I7AA 3RM1A 1DVIA 2M29A 3BUMB 4N1FA 1ZOTB 3OB1B 3RLZA 1R2UA 1DJYA 4MLWA 1UHIA 3HX4A 4I5KA 4A4CA 2I94A 1K9UA 3AAJA 3PN7C 3VRPA 2BCXA 1CM4A 1CTRA 4USLA 4DUQA 1Y1XA 1KFXL 3PALA 4ORAB 5F6TA 2Y4QA 1KQVA 4CLNA 4DS7A 1KWOB 1SNLA 1RWYA 1CLBA 3D0YA 4JWQA 1CLLA 3BYAA 2K61A 1BMOA 2KFFA 1WDCC 2QPTA 2JT8A 4I5LB 1SR6B 4OCIA 1JFJA 4MRXA 2MAZA 1MXEA 3WNXB 1EJ3A 2M8UA 1IH0A 2F33A 2OS8B 1XFVO 1DGUA 1XYDA 5JJGA 4XJKA 2BE4A 2LUXA 3FS7A 2IS9A 3OX6A 4HSZA 4PE7A 1S6CA 4PCWA 3EK8A 1B8CA 1BU3A 1UURA 2O60A 2H61C 4YBHB 4ZCVA 2MBXA 5AEQA 2Y1MA 2WCEA 2LLTA 1IRJA 1YUSA 2G2BA 2QACA 2OPOA 4AQJA 1LVCD 1Y6WA 1OOJA 1AJ4A 1S5GZ 3LK0A 2K0JA 1WLMA 1SY9A 4ETOA 3DVEA 4HRHA 1LINA 3LCPC 4ORCB 1M31A 1ZACA 1UHNA 1KWOC 1JC2A 2JNFA 4YI9A 1WLZA 4MZKA 2B1UA 1DT7B 3EVVA 1SR6C 1B8RA 1A03A 1KSOA 1F4QA 4XJKB 1F54A 4D1EA 1RTP1 3OHMB 3CS1A 4GGNA 3SIBA 2NCPA 2OS8C 2MJWB 4NDBA 1DGVA 2Q91A 3ZNIA 2KGBC 1OZOA 1QLKA 2F2OA 1PK0D 1M45A 1V1FA 2MA2A 1NWDA 1S1EA 2L4IA 3SG6A 2HPSA 3GK2A 5CSIA 4A4BA 2WCBA 4C0LA 2K8MB 2RGIA 3CGAA 1UHJA 1OMRA 1DTLA 3KEVA 1WY9A 3EVRA 3FIAA 1XFWO 1K95A 1B7TY 2R2IA 2JTTA 4P5OE 3PFVA 5JOLA 1WRZA 4PDZA 1ZUZA 2ZFDA 1TNQA 2HQWA 1X02A 3I5GB 1KK8B 2LVJA 1SYMA 2JU0A 5DKNA 1HQVA 1IJ5A 2CNPA 3GOFA 3DVKA 2LVIA 4NDCA 2AAOA 1KFXS 1NCXA 2LANA 3D10A 4N1GA 3O4YA 3NSLA 5G08A 1UHHA 1LKJA 1M39A 3GK1A 3BUNB 1K90D 4YGEB 1G4YR 1MQ1A 1NUBA 3SG2A 2LVKA 3DVJA 3EKHA 2GV5A 3NXAA 2KGRA 3WHTB 1U5IA 1IG5A 1UUSA 1KK7Y 1FI5A 1QX7A 1S6JA 1ALVA 1QXPA 2ZRTA 3KHEA 2L4HA 1IQ3A 1V1GA 4Q04A 2F3ZA 1K9PA 2TN4A 3SG7A 1NX0A 2Q4UA 2SCPA 1SL8A 1DJWA 1QVIY 1M63B 2M0RA 3OB2B 1W7IB 2GGMA 2BBMA 5B8IB 3H4SE 2BBNA 1K8UA 1AVSA 1K93D 1RK9A 2KYCA 4GNKB 5AERA 2KSPA 3IF7A 3EVUA 4HRGA 4XYNA 1DJIA 5ER4X 4PHNA 4DRWA 3BOWB 1OSAA 2MHHA 1NCZA 3KPXA 1DMOA 1IJ6A 5CSJA 1BJFA 3I5GC 1KK8C 3NSOA 3WXAA 1EL4A 4M2OA 1AJ5A 1PALA 1YX8A 3JTDB 1OE9B 1QV1A 2M1KB 1HT9A 1OZSA 5K89A 4CIDA 1C7VA 2CBLA 2WC8A 1MXLC 4P2YB 1U5IB 1Y1UA 1QIWA 2KAVA 4MBEA 1K2HA 2LVVA 4QJ5B 3PATA 1XFYO 4N5XA 3LLEA 1NPQA 2ZN8A 2HF5A 4R1EA 3QRXA 1K94A 3SG3A 1YRTB 2KBMA 1J55A 4AQIA 3M0WA 1FBVA 1JBAA 1S3PA 2JOJA 1CFDA 2CCMA 3GK4X 2L5XB 2K7OA 1DJGA 2Y1NA 1IQ5A 1S36A 1KQMB 3PLFB 2JXCA 1QLSA 4WQ2A 1L2OB 3EKJA 1Q80A 5DKQA 3SG5A 3F45A 3BUWB 5KTYA 1NP8A 1FW4A 1S6IA 1K9KA 1CMFA 3CTNA 3JTDC 4M2PA 4IL1A 4NQGA 3K21A 4GAOA 1BLQA 4PHKA 1XK4C 1TN4A 1JSAA 1A75A 1PVAA 3FWBA 2I18A 1NX3A 2JT0A 1C07A 1OMVA 1F4OA 2M9GA 3CR4X 4MEWA 3AKAA 3CZTX 1W7JB 2KI6D 2PVBA 2M7LA 1B7TZ 3EK7A 5D69A 3TDIA 2NCOA 4MVFA 2A4JA 1ZFSA 1OMDA 2KFHA 2KNEA 1EG3A 2KAXA 4WQ3A 2Y5IA 3OX5A 1KQMC 2NXQA 4ORBB 2LCPA 1GGWA 2DOQA 1L2OC 2K2FA 4QJ3B 2M97A 5I8NA 1PSBA 5CSFA 2JNXA 2KQYA 2VRGA 2CT9A 1LA3A 3LK1A 1BOCA 1XFZO 4PE0A 4PE1A 2ZNDA 2ISDA 1EH2A 1FPWA 4YGAA 4UPGA 1BR4B 5I2LA 3VRRA 1A75B 5D7FA 1H4BA 2EHBA 1KK7Z 1JF0A 2LHLA 1DJZA 4YGDB 1TCOB 3BQ3A 3DF0A 2L0PA 4YRUA 5CPVA 1QV0A 4HREE 3SJSA 4ZCUA 2WNDA 1AHRA 4PHJA 1QVIZ 3BOWA 1XFUO 2L98A 2WORA 2PSRA 2CTNA 5IBWA 1TRFA 1B4CA 1K96A 1XFXO 5TNCA 1F8HA 2BL0B 2PRUA 3AKBA 4YI8A 1SRAA 4PHMA 1CKKA 3E3RA 3ZWHA 1QX5B 1KFUS 1SK6D 1A4PA 1UP5A 1J7QA 5I2OA 2KFGA 3A4UB 1XK4A 3TDUA 2BE6A 1ODBA 1QASA 3PM8A 2K7BA 2LP2A 1AK8A 1F55A 2LHIA 1PRWA 1JWDA 1XO5A
chains in the Genus database with same CATH superfamily
1Z2CB 1J7RA 1DF0A 5FYXA 1YRUB 1BG1A 1GQMA 1SL7A 3IQQA 2M3WA 1B1GA 3DF0B 3RZSA 3O78A 1G8IA 3EK4A 2JC2A 1M46A 2L51A 3BXKA 3CR5X 1TNXA 1A2XA 2I2RE 1W9ZA 1QATA 2JQ6A 2MRDA 1SSEB 4OKHA 4BY4A 1N2DA 2ZKMX 4MSPA 1TNPA 1J7PA 1SW8A 1QX2A 1TCFA 4MN0A 2GGZA 1BR1B 1PVBA 2KQ6A 2JPTA 2BL0C 2FJYA 4E68A 5J3XA 1Y0VH 3OGNA 3C1VA 1BODA 4DCKA 2K2AA 2PMYA 4JKTA 1KFUL 3LL8B 4L9MA 1CDNA 1NX1A 4CFRA 1DQEA 2QEHA 3ICBA 5CSNA 4GGFC 1TTXA 1DF0B 3B86A 4INXA 4GBAA 2LAPA 1IWQA 2JWWA 2LMUA 2OTGB 1CFCA 1DJXA 1DJHA 3I5FB 1B47A 2KDHA 5AXIA 1RFJA 2FJUB 1XVJA 5KSZA 3R1OA 1YUUA 3A8RA 3O4XA 4C0KA 1SPYA 2H8VA 2BCAA 2JULA 1EG4A 1SCVA 2FOTA 2H2KA 2LUCA 2G9BA 3TDZA 2BECA 3D73A 1C7WA 3UO9A 3CWGA 1YVHA 2D8NA 3AAKA 4BY5A 3DY9A 2LE9B 3MSEB 5HLVA 4AOMA 3D74A 4MZJA 2E6WA 1F71A 4U8DA 4JPZB 2PALA 2WOSA 2M49B 2CXJA 4FQOA 1CMGA 4YGCB 2KAYA 4TNCA 2LC5A 3CZ2A 2P6BB 4CFQA 1PSRA 4GFTA 1NIWA 3Q8IA 4OR9B 3BUXB 1YR5A 1CDLA 2AUCA 3VROA 1QIVA 3B6XA 1G33A 3I5HB 2JT3A 2LNKA 2YGUA 1AUIB 4GPLB 3CR2A 2EGDA 1CDPA 1SCMB 2E30A 4F0ZB 3DVMA 3HCMA 2OTGC 2WCFA 1JF2A 3PSRA 3TUYB 1RECA 1YUTA 2MLEC 3I5FC 2NLNA 1SKTA 1LXFC 3I5IB 2WC6A 2L50A 4I5NB 3D0YB 4WRIA 1TOPA 3IQOA 3NSKA 4ICBA 3O2PA 5KU1A 2QEBA 3VRNA 1RROA 2LLSA 3DD4A 3S0GA 3FWCA 2O5GA 1N65A 2FCEA 3UNWA 1AP4A 5I2QA 3VRQA 5HKYA 1CDMA 1MWNA 1VRKA 1E8AA 1YURA 3BFBA 1F70A 1UWOA 2SASA 1J1DA 1H8BA 1EXRA 1SMGA 1WRLA 4GGFA 2LMVA 4OV2A 2FCDA 2F2PA 5BPJA 2F3YA 1CB1A 3NSIA 1DC1A 2PASA 2JZIA 3JVTB 1MF8B 2ZNEA 5PALA 3TS5B 2HQ8A 3TZ1A 1R6PA 1S5GY 1YVLA 1ZMZA 3SS4A 2LMTA 2KYFA 2LM5A 1YX7A 4F7FA 2AMIA 1MHOA 2ZN9A 4PALA 2COLB 1BF5A 2KOTA 5GQQC 4C0JA 1D1OA 1MUXA 3I5HC 1ALWA 2K7DA 5HYDA 1OOIX 2BCBA 2KI4B 2BKIB 3D76A 1SCMC 1N0YA 4OVNF 1CM1A 1NYAA 3TUYC 1UHKA 1JUOA 1CLMA 2M1UA 2BKHB 2V53A 3I5IC 2KHNA 4NDDA 1BT6A 2EC6B 1QJTA 1XFRA 4PT1A 2F8PA 1WRKA 2L2EA 2LP3A 2JXLA 1L7ZA 3KO0A 2KI6C 2M7NA 4QJ4B 5AFPA 1C3YA 1PULA 1QTXA 2LV7A 1JFKA 5EL2A 3BJHA 3PN7B 3B88A 2H61A 4JQ0D 1T14A 1J1EA 1NSHA 1TNWA 1Y1AA 3S0BA 2LLUA 5ER5A 3VGOA 1GJYA 4CPVA 4FTGA 3JVTC 5FI7A 1LA0A 1B9AA 5HKWA 1KSMA 3TS5C 4DIRA 2JRFA 2ZRSA 1IKUA 1CFFA 1CFPA 5HKZA 4I5JA 4MRYA 3SIAA 1FF1A 5AANA 3R1VA 3WHUB 3CLNA 1WDCB 1OQPA 5FI2A 3FE6A 3SG4A 3NGVA 2PQLA 1QS7A 1MR8A 1J7OA 2NZ0A 1GGZA 2ERBA 3D78A 4M2QA 5DKRA 1IGVA 1RJVA 2JTZA 1SBJA 1NCYA 2HETA 1CNPA 1A29A 1NX2A 1SL9A 3KF9A 3PJIA 2KI4C 2K7CA 3O6BA 1XA5A 1S26D 2PYQA 5HLOA 2QEOA 1TIZA 1KCYA 4YGBB 2QDIA 3OP0A 4PE4A 3BUOB 4KYNA 1DEKA 2EC6C 2KBIA 2MLFC 1B8LA 3NHIA 4GUKA 3VB1A 1YTZC 1FI6A 4MZLA 3IVTA 2I7AA 3RM1A 1DVIA 2M29A 3BUMB 4N1FA 1ZOTB 3OB1B 3RLZA 1R2UA 1DJYA 3L47A 4MLWA 1UHIA 3HX4A 4I5KA 4A4CA 2I94A 1K9UA 3AAJA 3FE9A 3PN7C 3VRPA 1TUJA 2BCXA 1CM4A 1CTRA 4USLA 4DUQA 1Y1XA 1KFXL 3PALA 4ORAB 5F6TA 2Y4QA 1KQVA 4CLNA 4DS7A 1KWOB 1SNLA 3R1PA 1RWYA 1CLBA 3D0YA 4JWQA 1CLLA 3BYAA 2K61A 1BMOA 2KFFA 1WDCC 2QPTA 2JT8A 4I5LB 1SR6B 3CDNA 4OCIA 1JFJA 4MRXA 2MAZA 3CYZA 1MXEA 3WNXB 1EJ3A 2M8UA 1IH0A 2F33A 2OS8B 1XFVO 1DGUA 1XYDA 5JJGA 4XJKA 2BE4A 3D77A 1DELA 2LUXA 3FS7A 2IS9A 3OX6A 4HSZA 4PE7A 1S6CA 4PCWA 3EK8A 1B8CA 1BU3A 1UURA 2BAPA 2H61C 2O60A 4YBHB 4ZCVA 5AEQA 2MBXA 2Y1MA 2JPOA 2WCEA 2LLTA 1IRJA 1YUSA 2G2BA 2QACA 2WCJA 2OPOA 1IIOA 4AQJA 1LVCD 1Y6WA 1OOJA 1AJ4A 1S5GZ 3LK0A 2K0JA 1WLMA 1SY9A 4ETOA 3DVEA 4HRHA 1LINA 3LCPC 4ORCB 1M31A 1ZACA 1UHNA 2KLEA 1KWOC 1JC2A 2JNFA 4YI9A 1WLZA 4MZKA 2B1UA 1DT7B 3EVVA 1SR6C 3S0DA 1B8RA 2WCMA 1A03A 1KSOA 1F4QA 4XJKB 1F54A 4D1EA 1RTP1 3OHMB 3CS1A 4GGNA 3SIBA 2NCPA 2OS8C 2MJWB 4NDBA 1DGVA 2Q91A 3ZNIA 2KGBC 1OZOA 1QLKA 2F2OA 1TUZA 1PK0D 1M45A 1V1FA 2BNXA 2MA2A 1NWDA 1S1EA 2L4IA 3SG6A 2HPSA 3GK2A 5CSIA 2P71A 4A4BA 2WCBA 4C0LA 3EG5B 2WCLA 2K8MB 2QEVA 2RGIA 2GTEA 3CGAA 1UHJA 1GM0A 1OMRA 1DTLA 3KEVA 3BFHA 1WY9A 3EVRA 3V2LA 4INWA 3FIAA 1XFWO 1K95A 1B7TY 2R2IA 2JTTA 4P5OE 3PFVA 5JOLA 3SS3A 3SS5A 1WRZA 4PDZA 1ZUZA 2ZFDA 5HL1A 1TNQA 2HQWA 1OOHA 1X02A 3L4LA 3I5GB 1KK8B 2LVJA 1SYMA 2JU0A 5DKNA 1HQVA 1IJ5A 3B7AA 3OBVA 2CNPA 2P70A 3DVKA 3GOFA 2LVIA 4NDCA 2AAOA 1KFXS 1NCXA 2LANA 3B87A 3D10A 4N1GA 3O4YA 3QMEA 3NSLA 5G08A 1UHHA 1LKJA 1M39A 3GK1A 3BUNB 1K90D 1QWVA 1G4YR 4YGEB 5DICA 1MQ1A 1NUBA 3SG2A 2LVKA 3DVJA 3EKHA 2GV5A 3NXAA 2KGRA 3WHTB 1U5IA 1IG5A 1UUSA 1KK7Y 3R72A 1FI5A 1QX7A 1S6JA 1ALVA 1QXPA 1TWOA 2ZRTA 3KHEA 2L4HA 1IQ3A 1V1GA 4Q04A 2F3ZA 1K9PA 2TN4A 3SG7A 3DYEA 1NX0A 2Q4UA 2SCPA 1SL8A 1DJWA 1QVIY 1M63B 2M0RA 3OB2B 1W7IB 2GGMA 2BBMA 5B8IB 3H4SE 2BBNA 1K8UA 1AVSA 1K93D 1OW4A 1RK9A 2KYCA 4GNKB 5AERA 2KSPA 3IF7A 3EVUA 4HRGA 4XYNA 1DJIA 5ER4X 4PHNA 4DRWA 3BOWB 1OSAA 2MHHA 1NCZA 3KPXA 1DMOA 1IJ6A 5CSJA 1BJFA 3S0EA 3I5GC 1KK8C 3NSOA 3WXAA 1EL4A 4M2OA 1AJ5A 1PALA 1YX8A 3JTDB 1OE9B 1QV1A 2M1KB 1HT9A 1OZSA 5K89A 4CIDA 1C7VA 2CBLA 2WC8A 1MXLC 4P2YB 1U5IB 1Y1UA 1QIWA 2KAVA 2L2CA 4MBEA 1K2HA 2LVVA 4QJ5B 3PATA 3K1EA 4JD9A 1XFYO 4N5XA 3LLEA 1NPQA 2ZN8A 2HF5A 4R1EA 3QRXA 1K94A 3SG3A 1YRTB 2KBMA 5I94A 1J55A 4AQIA 3M0WA 2WCKA 2KPHA 1FBVA 1JBAA 1S3PA 2JOJA 1CFDA 2CCMA 2KLDA 3GK4X 2L5XB 2K7OA 1DJGA 1P28A 2Y1NA 4IJ7A 1IQ5A 4OZDA 1S36A 1KQMB 3PLFB 2JXCA 3BFAA 1QLSA 4WQ2A 1L2OB 3EKJA 1Q80A 5D3OA 5DKQA 3SG5A 3F45A 3BUWB 5KTYA 1NP8A 1FW4A 1S6IA 1K9KA 3CZ1A 1CMFA 3CTNA 2K60A 3JTDC 4M2PA 1C3ZA 4IL1A 4NQGA 3K21A 4GAOA 1BLQA 3D75A 4PHKA 1XK4C 1TN4A 1JSAA 3DXLA 1A75A 1PVAA 3FWBA 2I18A 1NX3A 2JT0A 1C07A 1OOFA 1OMVA 1F4OA 2M9GA 3CR4X 4MEWA 3AKAA 3CZTX 1W7JB 2KI6D 2PVBA 2M7LA 1B7TZ 3EK7A 3PM2A 5D69A 3TDIA 2NCOA 4MVFA 2A4JA 1ZFSA 1OMDA 3CABA 4FQTA 3S0FA 3DZTA 2KFHA 2KNEA 1EG3A 2KAXA 4WQ3A 2Y5IA 3OX5A 1KQMC 3CZ0A 2NXQA 4ORBB 3S0AA 2LCPA 1GGWA 2DOQA 1L2OC 1LS8A 2K2FA 4QJ3B 2M97A 5I8NA 1PSBA 5CSFA 2JNXA 2KQYA 2VRGA 2CT9A 1LA3A 3LK1A 1BOCA 1XFZO 4PE0A 4PE1A 2ZNDA 2ISDA 1EH2A 1FPWA 4YGAA 4UPGA 1BR4B 5I2LA 3VRRA 1A75B 5D7FA 1H4BA 2EHBA 1KK7Z 3L4AA 1JF0A 2LHLA 1DJZA 3N7HA 4YGDB 1TCOB 3BQ3A 3DF0A 2L0PA 5FI6A 5CPVA 1QV0A 4YRUA 4HREE 3SJSA 4ZCUA 2WNDA 1AHRA 4PHJA 1QVIZ 1ORGA 3BOWA 1XFUO 2L98A 2WORA 2PSRA 2CTNA 3FE8A 1TRFA 5IBWA 1B4CA 2WC5A 3NHTA 1K96A 1XFXO 5TNCA 1F8HA 2BL0B 2PRUA 3AKBA 4YI8A 1SRAA 4PHMA 1CKKA 3E3RA 3ZWHA 1QX5B 1KFUS 1SK6D 1A4PA 1UP5A 1J7QA 5I2OA 2KFGA 1OOGA 3A4UB 1XK4A 2L5YA 3TDUA 2BE6A 1Z4HA 1ODBA 1QASA 3PM8A 2WCHA 2K7BA 2LP2A 1AK8A 1F55A 2LHIA 1PRWA 1JWDA 1XO5A
chains in the Genus database with same CATH topology
1J7RA 1DF0A 5FYXA 1YRUB 1BG1A 1GQMA 1SL7A 3IQQA 2M3WA 1B1GA 3DF0B 3O78A 1G8IA 3EK4A 2JC2A 1M46A 2L51A 3BXKA 3CR5X 1TNXA 1A2XA 2I2RE 1QATA 2JQ6A 2MRDA 4OKHA 4BY4A 1N2DA 2ZKMX 4MSPA 1TNPA 1J7PA 1SW8A 1QX2A 1TCFA 4MN0A 2GGZA 1BR1B 1PVBA 2KQ6A 2JPTA 2BL0C 4E68A 5J3XA 1Y0VH 3C1VA 1BODA 4DCKA 2K2AA 2PMYA 1KFUL 3LL8B 4L9MA 1CDNA 1NX1A 4CFRA 3ICBA 5CSNA 4GGFC 1TTXA 1DF0B 4GBAA 2LAPA 1IWQA 2JWWA 2LMUA 2OTGB 1CFCA 1DJXA 1DJHA 3I5FB 1B47A 2KDHA 5AXIA 1RFJA 2FJUB 1XVJA 5KSZA 1YUUA 3A8RA 4C0KA 1SPYA 2BCAA 2JULA 1EG4A 1SCVA 2FOTA 2H2KA 2LUCA 2G9BA 3TDZA 2BECA 1C7WA 3CWGA 1YVHA 2D8NA 3AAKA 4BY5A 2LE9B 3MSEB 5HLVA 4AOMA 4MZJA 2E6WA 1F71A 4U8DA 4JPZB 2PALA 2WOSA 2M49B 2CXJA 4FQOA 1CMGA 4YGCB 2KAYA 4TNCA 2LC5A 2P6BB 4CFQA 1PSRA 4GFTA 1NIWA 4OR9B 3BUXB 1YR5A 1CDLA 2AUCA 3VROA 1QIVA 1G33A 3I5HB 2JT3A 2LNKA 1AUIB 4GPLB 3CR2A 2EGDA 1CDPA 1SCMB 2E30A 4F0ZB 3DVMA 3HCMA 2OTGC 2WCFA 1JF2A 3PSRA 3TUYB 1RECA 1YUTA 2MLEC 3I5FC 2NLNA 1SKTA 1LXFC 3I5IB 2L50A 4I5NB 3D0YB 4WRIA 1TOPA 3IQOA 3NSKA 4ICBA 3O2PA 5KU1A 3VRNA 1RROA 2LLSA 3DD4A 3FWCA 2O5GA 1N65A 2FCEA 1AP4A 5I2QA 3VRQA 5HKYA 1CDMA 1MWNA 1VRKA 1E8AA 1YURA 1F70A 1UWOA 2SASA 1J1DA 1H8BA 1EXRA 1SMGA 1WRLA 4GGFA 2LMVA 4OV2A 2FCDA 2F2PA 5BPJA 2F3YA 1CB1A 3NSIA 2PASA 2JZIA 3JVTB 1MF8B 2ZNEA 5PALA 3TS5B 2HQ8A 3TZ1A 1R6PA 1S5GY 1YVLA 1ZMZA 2LMTA 2KYFA 2LM5A 1YX7A 2AMIA 1MHOA 2ZN9A 4PALA 2COLB 1BF5A 2KOTA 5GQQC 4C0JA 1D1OA 1MUXA 3I5HC 1ALWA 2K7DA 5HYDA 2BCBA 2KI4B 2BKIB 1SCMC 1N0YA 4OVNF 1CM1A 1NYAA 3TUYC 1UHKA 1JUOA 1CLMA 2M1UA 2BKHB 2V53A 3I5IC 2KHNA 4NDDA 1BT6A 2EC6B 1QJTA 2F8PA 1WRKA 2L2EA 2LP3A 2JXLA 1L7ZA 3KO0A 2KI6C 2M7NA 4QJ4B 5AFPA 1PULA 1QTXA 2LV7A 1JFKA 3PN7B 2H61A 4JQ0D 1J1EA 1NSHA 1TNWA 1Y1AA 2LLUA 5ER5A 3VGOA 1GJYA 4CPVA 4FTGA 3JVTC 1LA0A 1B9AA 5HKWA 1KSMA 3TS5C 4DIRA 2JRFA 2ZRSA 1IKUA 1CFFA 1CFPA 5HKZA 4I5JA 4MRYA 3SIAA 1FF1A 5AANA 3WHUB 3CLNA 1WDCB 1OQPA 3SG4A 1QS7A 1MR8A 1J7OA 2NZ0A 1GGZA 4M2QA 5DKRA 1IGVA 1RJVA 2JTZA 1SBJA 1NCYA 2HETA 1CNPA 1A29A 1NX2A 1SL9A 3KF9A 2KI4C 2K7CA 3O6BA 1XA5A 1S26D 5HLOA 1TIZA 1KCYA 4YGBB 3OP0A 4PE4A 3BUOB 2EC6C 2KBIA 2MLFC 1B8LA 4GUKA 1YTZC 1FI6A 4MZLA 2I7AA 3RM1A 1DVIA 2M29A 3BUMB 4N1FA 1ZOTB 3OB1B 3RLZA 1R2UA 1DJYA 4MLWA 1UHIA 3HX4A 4I5KA 4A4CA 2I94A 1K9UA 3AAJA 3PN7C 3VRPA 2BCXA 1CM4A 1CTRA 4USLA 4DUQA 1Y1XA 1KFXL 3PALA 4ORAB 5F6TA 2Y4QA 1KQVA 4CLNA 4DS7A 1KWOB 1SNLA 1RWYA 1CLBA 3D0YA 4JWQA 1CLLA 3BYAA 2K61A 1BMOA 2KFFA 1WDCC 2QPTA 2JT8A 4I5LB 1SR6B 4OCIA 1JFJA 4MRXA 2MAZA 1MXEA 3WNXB 1EJ3A 2M8UA 1IH0A 2F33A 2OS8B 1XFVO 1DGUA 1XYDA 5JJGA 4XJKA 2BE4A 2LUXA 3FS7A 2IS9A 3OX6A 4HSZA 4PE7A 1S6CA 4PCWA 3EK8A 1B8CA 1BU3A 1UURA 2O60A 2H61C 4YBHB 4ZCVA 2MBXA 5AEQA 2Y1MA 2WCEA 2LLTA 1IRJA 1YUSA 2G2BA 2QACA 2OPOA 4AQJA 1LVCD 1Y6WA 1OOJA 1AJ4A 1S5GZ 3LK0A 2K0JA 1WLMA 1SY9A 4ETOA 3DVEA 4HRHA 1LINA 3LCPC 4ORCB 1M31A 1ZACA 1UHNA 1KWOC 1JC2A 2JNFA 4YI9A 1WLZA 4MZKA 2B1UA 1DT7B 3EVVA 1SR6C 1B8RA 1A03A 1KSOA 1F4QA 4XJKB 1F54A 4D1EA 1RTP1 3OHMB 3CS1A 4GGNA 3SIBA 2NCPA 2OS8C 2MJWB 4NDBA 1DGVA 2Q91A 3ZNIA 2KGBC 1OZOA 1QLKA 2F2OA 1PK0D 1M45A 1V1FA 2MA2A 1NWDA 1S1EA 2L4IA 3SG6A 2HPSA 3GK2A 5CSIA 4A4BA 2WCBA 4C0LA 2K8MB 2RGIA 3CGAA 1UHJA 1OMRA 1DTLA 3KEVA 1WY9A 3EVRA 3FIAA 1XFWO 1K95A 1B7TY 2R2IA 2JTTA 4P5OE 3PFVA 5JOLA 1WRZA 4PDZA 1ZUZA 2ZFDA 1TNQA 2HQWA 1X02A 3I5GB 1KK8B 2LVJA 1SYMA 2JU0A 5DKNA 1HQVA 1IJ5A 2CNPA 3GOFA 3DVKA 2LVIA 4NDCA 2AAOA 1KFXS 1NCXA 2LANA 3D10A 4N1GA 3O4YA 3NSLA 5G08A 1UHHA 1LKJA 1M39A 3GK1A 3BUNB 1K90D 4YGEB 1G4YR 1MQ1A 1NUBA 3SG2A 2LVKA 3DVJA 3EKHA 2GV5A 3NXAA 2KGRA 3WHTB 1U5IA 1IG5A 1UUSA 1KK7Y 1FI5A 1QX7A 1S6JA 1ALVA 1QXPA 2ZRTA 3KHEA 2L4HA 1IQ3A 1V1GA 4Q04A 2F3ZA 1K9PA 2TN4A 3SG7A 1NX0A 2Q4UA 2SCPA 1SL8A 1DJWA 1QVIY 1M63B 2M0RA 3OB2B 1W7IB 2GGMA 2BBMA 5B8IB 3H4SE 2BBNA 1K8UA 1AVSA 1K93D 1RK9A 2KYCA 4GNKB 5AERA 2KSPA 3IF7A 3EVUA 4HRGA 4XYNA 1DJIA 5ER4X 4PHNA 4DRWA 3BOWB 1OSAA 2MHHA 1NCZA 3KPXA 1DMOA 1IJ6A 5CSJA 1BJFA 3I5GC 1KK8C 3NSOA 3WXAA 1EL4A 4M2OA 1AJ5A 1PALA 1YX8A 3JTDB 1OE9B 1QV1A 2M1KB 1HT9A 1OZSA 5K89A 4CIDA 1C7VA 2CBLA 2WC8A 1MXLC 4P2YB 1U5IB 1Y1UA 1QIWA 2KAVA 4MBEA 1K2HA 2LVVA 4QJ5B 3PATA 1XFYO 4N5XA 3LLEA 1NPQA 2ZN8A 2HF5A 4R1EA 3QRXA 1K94A 3SG3A 1YRTB 2KBMA 1J55A 4AQIA 3M0WA 1FBVA 1JBAA 1S3PA 2JOJA 1CFDA 2CCMA 3GK4X 2L5XB 2K7OA 1DJGA 2Y1NA 1IQ5A 1S36A 1KQMB 3PLFB 2JXCA 1QLSA 4WQ2A 1L2OB 3EKJA 1Q80A 5DKQA 3SG5A 3F45A 3BUWB 5KTYA 1NP8A 1FW4A 1S6IA 1K9KA 1CMFA 3CTNA 3JTDC 4M2PA 4IL1A 4NQGA 3K21A 4GAOA 1BLQA 4PHKA 1XK4C 1TN4A 1JSAA 1A75A 1PVAA 3FWBA 2I18A 1NX3A 2JT0A 1C07A 1OMVA 1F4OA 2M9GA 3CR4X 4MEWA 3AKAA 3CZTX 1W7JB 2KI6D 2PVBA 2M7LA 1B7TZ 3EK7A 5D69A 3TDIA 2NCOA 4MVFA 2A4JA 1ZFSA 1OMDA 2KFHA 2KNEA 1EG3A 2KAXA 4WQ3A 2Y5IA 3OX5A 1KQMC 2NXQA 4ORBB 2LCPA 1GGWA 2DOQA 1L2OC 2K2FA 4QJ3B 2M97A 5I8NA 1PSBA 5CSFA 2JNXA 2KQYA 2VRGA 2CT9A 1LA3A 3LK1A 1BOCA 1XFZO 4PE0A 4PE1A 2ZNDA 2ISDA 1EH2A 1FPWA 4YGAA 4UPGA 1BR4B 5I2LA 3VRRA 1A75B 5D7FA 1H4BA 2EHBA 1KK7Z 1JF0A 2LHLA 1DJZA 4YGDB 1TCOB 3BQ3A 3DF0A 2L0PA 4YRUA 5CPVA 1QV0A 4HREE 3SJSA 4ZCUA 2WNDA 1AHRA 4PHJA 1QVIZ 3BOWA 1XFUO 2L98A 2WORA 2PSRA 2CTNA 5IBWA 1TRFA 1B4CA 1K96A 1XFXO 5TNCA 1F8HA 2BL0B 2PRUA 3AKBA 4YI8A 1SRAA 4PHMA 1CKKA 3E3RA 3ZWHA 1QX5B 1KFUS 1SK6D 1A4PA 1UP5A 1J7QA 5I2OA 2KFGA 3A4UB 1XK4A 3TDUA 2BE6A 1ODBA 1QASA 3PM8A 2K7BA 2LP2A 1AK8A 1F55A 2LHIA 1PRWA 1JWDA 1XO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7R A;  1DF0 A;  5FYX A;  1YRU B;  1BG1 A;  1GQM A;  1SL7 A;  3IQQ A;  2M3W A;  1B1G A;  3DF0 B;  3O78 A;  1G8I A;  3EK4 A;  2JC2 A;  1M46 A;  2L51 A;  3BXK A;  3CR5 X;  1TNX A;  1A2X A;  2I2R E;  1QAT A;  2JQ6 A;  2MRD A;  4OKH A;  4BY4 A;  1N2D A;  2ZKM X;  4MSP A;  1TNP A;  1J7P A;  1SW8 A;  1QX2 A;  1TCF A;  4MN0 A;  2GGZ A;  1BR1 B;  1PVB A;  2KQ6 A;  2JPT A;  2BL0 C;  4E68 A;  5J3X A;  1Y0V H;  3C1V A;  1BOD A;  4DCK A;  2K2A A;  2PMY A;  1KFU L;  3LL8 B;  4L9M A;  1CDN A;  1NX1 A;  4CFR A;  3ICB A;  5CSN A;  4GGF C;  1TTX A;  1DF0 B;  4GBA A;  2LAP A;  1IWQ A;  2JWW A;  2LMU A;  2OTG B;  1CFC A;  1DJX A;  1DJH A;  3I5F B;  1B47 A;  2KDH A;  5AXI A;  1RFJ A;  2FJU B;  1XVJ A;  5KSZ A;  1YUU A;  3A8R A;  4C0K A;  1SPY A;  2BCA A;  2JUL A;  1EG4 A;  1SCV A;  2FOT A;  2H2K A;  2LUC A;  2G9B A;  3TDZ A;  2BEC A;  1C7W A;  3CWG A;  1YVH A;  2D8N A;  3AAK A;  4BY5 A;  2LE9 B;  3MSE B;  5HLV A;  4AOM A;  4MZJ A;  2E6W A;  1F71 A;  4U8D A;  4JPZ B;  2PAL A;  2WOS A;  2M49 B;  2CXJ A;  4FQO A;  1CMG A;  4YGC B;  2KAY A;  4TNC A;  2LC5 A;  2P6B B;  4CFQ A;  1PSR A;  4GFT A;  1NIW A;  4OR9 B;  3BUX B;  1YR5 A;  1CDL A;  2AUC A;  3VRO A;  1QIV A;  1G33 A;  3I5H B;  2JT3 A;  2LNK A;  1AUI B;  4GPL B;  3CR2 A;  2EGD A;  1CDP A;  1SCM B;  2E30 A;  4F0Z B;  3DVM A;  3HCM A;  2OTG C;  2WCF A;  1JF2 A;  3PSR A;  3TUY B;  1REC A;  1YUT A;  2MLE C;  3I5F C;  2NLN A;  1SKT A;  1LXF C;  3I5I B;  2L50 A;  4I5N B;  3D0Y B;  4WRI A;  1TOP A;  3IQO A;  3NSK A;  4ICB A;  3O2P A;  5KU1 A;  3VRN A;  1RRO A;  2LLS A;  3DD4 A;  3FWC A;  2O5G A;  1N65 A;  2FCE A;  1AP4 A;  5I2Q A;  3VRQ A;  5HKY A;  1CDM A;  1MWN A;  1VRK A;  1E8A A;  1YUR A;  1F70 A;  1UWO A;  2SAS A;  1J1D A;  1H8B A;  1EXR A;  1SMG A;  1WRL A;  4GGF A;  2LMV A;  4OV2 A;  2FCD A;  2F2P A;  5BPJ A;  2F3Y A;  1CB1 A;  3NSI A;  2PAS A;  2JZI A;  3JVT B;  1MF8 B;  2ZNE A;  5PAL A;  3TS5 B;  2HQ8 A;  3TZ1 A;  1R6P A;  1S5G Y;  1YVL A;  1ZMZ A;  2LMT A;  2KYF A;  2LM5 A;  1YX7 A;  2AMI A;  1MHO A;  2ZN9 A;  4PAL A;  2COL B;  1BF5 A;  2KOT A;  5GQQ C;  4C0J A;  1D1O A;  1MUX A;  3I5H C;  1ALW A;  2K7D A;  5HYD A;  2BCB A;  2KI4 B;  2BKI B;  1SCM C;  1N0Y A;  4OVN F;  1CM1 A;  1NYA A;  3TUY C;  1UHK A;  1JUO A;  1CLM A;  2M1U A;  2BKH B;  2V53 A;  3I5I C;  2KHN A;  4NDD A;  1BT6 A;  2EC6 B;  1QJT A;  2F8P A;  1WRK A;  2L2E A;  2LP3 A;  2JXL A;  1L7Z A;  3KO0 A;  2KI6 C;  2M7N A;  4QJ4 B;  5AFP A;  1PUL A;  1QTX A;  2LV7 A;  1JFK A;  3PN7 B;  2H61 A;  4JQ0 D;  1J1E A;  1NSH A;  1TNW A;  1Y1A A;  2LLU A;  5ER5 A;  3VGO A;  1GJY A;  4CPV A;  4FTG A;  3JVT C;  1LA0 A;  1B9A A;  5HKW A;  1KSM A;  3TS5 C;  4DIR A;  2JRF A;  2ZRS A;  1IKU A;  1CFF A;  1CFP A;  5HKZ A;  4I5J A;  4MRY A;  3SIA A;  1FF1 A;  5AAN A;  3WHU B;  3CLN A;  1WDC B;  1OQP A;  3SG4 A;  1QS7 A;  1MR8 A;  1J7O A;  2NZ0 A;  1GGZ A;  4M2Q A;  5DKR A;  1IGV A;  1RJV A;  2JTZ A;  1SBJ A;  1NCY A;  2HET A;  1CNP A;  1A29 A;  1NX2 A;  1SL9 A;  3KF9 A;  2KI4 C;  2K7C A;  3O6B A;  1XA5 A;  1S26 D;  5HLO A;  1TIZ A;  1KCY A;  4YGB B;  3OP0 A;  4PE4 A;  3BUO B;  2EC6 C;  2KBI A;  2MLF C;  1B8L A;  4GUK A;  1YTZ C;  1FI6 A;  4MZL A;  2I7A A;  3RM1 A;  1DVI A;  2M29 A;  3BUM B;  4N1F A;  1ZOT B;  3OB1 B;  3RLZ A;  1R2U A;  1DJY A;  4MLW A;  1UHI A;  3HX4 A;  4I5K A;  4A4C A;  2I94 A;  1K9U A;  3AAJ A;  3PN7 C;  3VRP A;  2BCX A;  1CM4 A;  1CTR A;  4USL A;  4DUQ A;  1Y1X A;  1KFX L;  3PAL A;  4ORA B;  5F6T A;  2Y4Q A;  1KQV A;  4CLN A;  4DS7 A;  1KWO B;  1SNL A;  1RWY A;  1CLB A;  3D0Y A;  4JWQ A;  1CLL A;  3BYA A;  2K61 A;  1BMO A;  2KFF A;  1WDC C;  2QPT A;  2JT8 A;  4I5L B;  1SR6 B;  4OCI A;  1JFJ A;  4MRX A;  2MAZ A;  1MXE A;  3WNX B;  1EJ3 A;  2M8U A;  1IH0 A;  2F33 A;  2OS8 B;  1XFV O;  1DGU A;  1XYD A;  5JJG A;  4XJK A;  2BE4 A;  2LUX A;  3FS7 A;  2IS9 A;  3OX6 A;  4HSZ A;  4PE7 A;  1S6C A;  4PCW A;  3EK8 A;  1B8C A;  1BU3 A;  1UUR A;  2O60 A;  2H61 C;  4YBH B;  4ZCV A;  2MBX A;  5AEQ A;  2Y1M A;  2WCE A;  2LLT A;  1IRJ A;  1YUS A;  2G2B A;  2QAC A;  2OPO A;  4AQJ A;  1LVC D;  1Y6W A;  1OOJ A;  1AJ4 A;  1S5G Z;  3LK0 A;  2K0J A;  1WLM A;  1SY9 A;  4ETO A;  3DVE A;  4HRH A;  1LIN A;  3LCP C;  4ORC B;  1M31 A;  1ZAC A;  1UHN A;  1KWO C;  1JC2 A;  2JNF A;  4YI9 A;  1WLZ A;  4MZK A;  2B1U A;  1DT7 B;  3EVV A;  1SR6 C;  1B8R A;  1A03 A;  1KSO A;  1F4Q A;  4XJK B;  1F54 A;  4D1E A;  1RTP 1;  3OHM B;  3CS1 A;  4GGN A;  3SIB A;  2NCP A;  2OS8 C;  2MJW B;  4NDB A;  1DGV A;  2Q91 A;  3ZNI A;  2KGB C;  1OZO A;  1QLK A;  2F2O A;  1PK0 D;  1M45 A;  1V1F A;  2MA2 A;  1NWD A;  1S1E A;  2L4I A;  3SG6 A;  2HPS A;  3GK2 A;  5CSI A;  4A4B A;  2WCB A;  4C0L A;  2K8M B;  2RGI A;  3CGA A;  1UHJ A;  1OMR A;  1DTL A;  3KEV A;  1WY9 A;  3EVR A;  3FIA A;  1XFW O;  1K95 A;  1B7T Y;  2R2I A;  2JTT A;  4P5O E;  3PFV A;  5JOL A;  1WRZ A;  4PDZ A;  1ZUZ A;  2ZFD A;  1TNQ A;  2HQW A;  1X02 A;  3I5G B;  1KK8 B;  2LVJ A;  1SYM A;  2JU0 A;  5DKN A;  1HQV A;  1IJ5 A;  2CNP A;  3GOF A;  3DVK A;  2LVI A;  4NDC A;  2AAO A;  1KFX S;  1NCX A;  2LAN A;  3D10 A;  4N1G A;  3O4Y A;  3NSL A;  5G08 A;  1UHH A;  1LKJ A;  1M39 A;  3GK1 A;  3BUN B;  1K90 D;  4YGE B;  1G4Y R;  1MQ1 A;  1NUB A;  3SG2 A;  2LVK A;  3DVJ A;  3EKH A;  2GV5 A;  3NXA A;  2KGR A;  3WHT B;  1U5I A;  1IG5 A;  1UUS A;  1KK7 Y;  1FI5 A;  1QX7 A;  1S6J A;  1ALV A;  1QXP A;  2ZRT A;  3KHE A;  2L4H A;  1IQ3 A;  1V1G A;  4Q04 A;  2F3Z A;  1K9P A;  2TN4 A;  3SG7 A;  1NX0 A;  2Q4U A;  2SCP A;  1SL8 A;  1DJW A;  1QVI Y;  1M63 B;  2M0R A;  3OB2 B;  1W7I B;  2GGM A;  2BBM A;  5B8I B;  3H4S E;  2BBN A;  1K8U A;  1AVS A;  1K93 D;  1RK9 A;  2KYC A;  4GNK B;  5AER A;  2KSP A;  3IF7 A;  3EVU A;  4HRG A;  4XYN A;  1DJI A;  5ER4 X;  4PHN A;  4DRW A;  3BOW B;  1OSA A;  2MHH A;  1NCZ A;  3KPX A;  1DMO A;  1IJ6 A;  5CSJ A;  1BJF A;  3I5G C;  1KK8 C;  3NSO A;  3WXA A;  1EL4 A;  4M2O A;  1AJ5 A;  1PAL A;  1YX8 A;  3JTD B;  1OE9 B;  1QV1 A;  2M1K B;  1HT9 A;  1OZS A;  5K89 A;  4CID A;  1C7V A;  2CBL A;  2WC8 A;  1MXL C;  4P2Y B;  1U5I B;  1Y1U A;  1QIW A;  2KAV A;  4MBE A;  1K2H A;  2LVV A;  4QJ5 B;  3PAT A;  1XFY O;  4N5X A;  3LLE A;  1NPQ A;  2ZN8 A;  2HF5 A;  4R1E A;  3QRX A;  1K94 A;  3SG3 A;  1YRT B;  2KBM A;  1J55 A;  4AQI A;  3M0W A;  1FBV A;  1JBA A;  1S3P A;  2JOJ A;  1CFD A;  2CCM A;  3GK4 X;  2L5X B;  2K7O A;  1DJG A;  2Y1N A;  1IQ5 A;  1S36 A;  1KQM B;  3PLF B;  2JXC A;  1QLS A;  4WQ2 A;  1L2O B;  3EKJ A;  1Q80 A;  5DKQ A;  3SG5 A;  3F45 A;  3BUW B;  5KTY A;  1NP8 A;  1FW4 A;  1S6I A;  1K9K A;  1CMF A;  3CTN A;  3JTD C;  4M2P A;  4IL1 A;  4NQG A;  3K21 A;  4GAO A;  1BLQ A;  4PHK A;  1XK4 C;  1TN4 A;  1JSA A;  1A75 A;  1PVA A;  3FWB A;  2I18 A;  1NX3 A;  2JT0 A;  1C07 A;  1OMV A;  1F4O A;  2M9G A;  3CR4 X;  4MEW A;  3AKA A;  3CZT X;  1W7J B;  2KI6 D;  2PVB A;  2M7L A;  1B7T Z;  3EK7 A;  5D69 A;  3TDI A;  2NCO A;  4MVF A;  2A4J A;  1ZFS A;  1OMD A;  2KFH A;  2KNE A;  1EG3 A;  2KAX A;  4WQ3 A;  2Y5I A;  3OX5 A;  1KQM C;  2NXQ A;  4ORB B;  2LCP A;  1GGW A;  2DOQ A;  1L2O C;  2K2F A;  4QJ3 B;  2M97 A;  5I8N A;  1PSB A;  5CSF A;  2JNX A;  2KQY A;  2VRG A;  2CT9 A;  1LA3 A;  3LK1 A;  1BOC A;  1XFZ O;  4PE0 A;  4PE1 A;  2ZND A;  2ISD A;  1EH2 A;  1FPW A;  4YGA A;  4UPG A;  1BR4 B;  5I2L A;  3VRR A;  1A75 B;  5D7F A;  1H4B A;  2EHB A;  1KK7 Z;  1JF0 A;  2LHL A;  1DJZ A;  4YGD B;  1TCO B;  3BQ3 A;  3DF0 A;  2L0P A;  4YRU A;  5CPV A;  1QV0 A;  4HRE E;  3SJS A;  4ZCU A;  2WND A;  1AHR A;  4PHJ A;  1QVI Z;  3BOW A;  1XFU O;  2L98 A;  2WOR A;  2PSR A;  2CTN A;  5IBW A;  1TRF A;  1B4C A;  1K96 A;  1XFX O;  5TNC A;  1F8H A;  2BL0 B;  2PRU A;  3AKB A;  4YI8 A;  1SRA A;  4PHM A;  1CKK A;  3E3R A;  3ZWH A;  1QX5 B;  1KFU S;  1SK6 D;  1A4P A;  1UP5 A;  1J7Q A;  5I2O A;  2KFG A;  3A4U B;  1XK4 A;  3TDU A;  2BE6 A;  1ODB A;  1QAS A;  3PM8 A;  2K7B A;  2LP2 A;  1AK8 A;  1F55 A;  2LHI A;  1PRW A;  1JWD A;  1XO5 A; 
#chains in the Genus database with same CATH topology
 1Z2C B;  1J7R A;  1DF0 A;  5FYX A;  1YRU B;  1BG1 A;  1GQM A;  1SL7 A;  3IQQ A;  2M3W A;  1B1G A;  3DF0 B;  3RZS A;  3O78 A;  1G8I A;  3EK4 A;  2JC2 A;  1M46 A;  2L51 A;  3BXK A;  3CR5 X;  1TNX A;  1A2X A;  2I2R E;  1W9Z A;  1QAT A;  2JQ6 A;  2MRD A;  1SSE B;  4OKH A;  4BY4 A;  1N2D A;  2ZKM X;  4MSP A;  1TNP A;  1J7P A;  1SW8 A;  1QX2 A;  1TCF A;  4MN0 A;  2GGZ A;  1BR1 B;  1PVB A;  2KQ6 A;  2JPT A;  2BL0 C;  2FJY A;  4E68 A;  5J3X A;  1Y0V H;  3OGN A;  3C1V A;  1BOD A;  4DCK A;  2K2A A;  2PMY A;  4JKT A;  1KFU L;  3LL8 B;  4L9M A;  1CDN A;  1NX1 A;  4CFR A;  1DQE A;  2QEH A;  3ICB A;  5CSN A;  4GGF C;  1TTX A;  1DF0 B;  3B86 A;  4INX A;  4GBA A;  2LAP A;  1IWQ A;  2JWW A;  2LMU A;  2OTG B;  1CFC A;  1DJX A;  1DJH A;  3I5F B;  1B47 A;  2KDH A;  5AXI A;  1RFJ A;  2FJU B;  1XVJ A;  5KSZ A;  3R1O A;  1YUU A;  3A8R A;  3O4X A;  4C0K A;  1SPY A;  2H8V A;  2BCA A;  2JUL A;  1EG4 A;  1SCV A;  2FOT A;  2H2K A;  2LUC A;  2G9B A;  3TDZ A;  2BEC A;  3D73 A;  1C7W A;  3UO9 A;  3CWG A;  1YVH A;  2D8N A;  3AAK A;  4BY5 A;  3DY9 A;  2LE9 B;  3MSE B;  5HLV A;  4AOM A;  3D74 A;  4MZJ A;  2E6W A;  1F71 A;  4U8D A;  4JPZ B;  2PAL A;  2WOS A;  2M49 B;  2CXJ A;  4FQO A;  1CMG A;  4YGC B;  2KAY A;  4TNC A;  2LC5 A;  3CZ2 A;  2P6B B;  4CFQ A;  1PSR A;  4GFT A;  1NIW A;  3Q8I A;  4OR9 B;  3BUX B;  1YR5 A;  1CDL A;  2AUC A;  3VRO A;  1QIV A;  3B6X A;  1G33 A;  3I5H B;  2JT3 A;  2LNK A;  2YGU A;  1AUI B;  4GPL B;  3CR2 A;  2EGD A;  1CDP A;  1SCM B;  2E30 A;  4F0Z B;  3DVM A;  3HCM A;  2OTG C;  2WCF A;  1JF2 A;  3PSR A;  3TUY B;  1REC A;  1YUT A;  2MLE C;  3I5F C;  2NLN A;  1SKT A;  1LXF C;  3I5I B;  2WC6 A;  2L50 A;  4I5N B;  3D0Y B;  4WRI A;  1TOP A;  3IQO A;  3NSK A;  4ICB A;  3O2P A;  5KU1 A;  2QEB A;  3VRN A;  1RRO A;  2LLS A;  3DD4 A;  3S0G A;  3FWC A;  2O5G A;  1N65 A;  2FCE A;  3UNW A;  1AP4 A;  5I2Q A;  3VRQ A;  5HKY A;  1CDM A;  1MWN A;  1VRK A;  1E8A A;  1YUR A;  3BFB A;  1F70 A;  1UWO A;  2SAS A;  1J1D A;  1H8B A;  1EXR A;  1SMG A;  1WRL A;  4GGF A;  2LMV A;  4OV2 A;  2FCD A;  2F2P A;  5BPJ A;  2F3Y A;  1CB1 A;  3NSI A;  1DC1 A;  2PAS A;  2JZI A;  3JVT B;  1MF8 B;  2ZNE A;  5PAL A;  3TS5 B;  2HQ8 A;  3TZ1 A;  1R6P A;  1S5G Y;  1YVL A;  1ZMZ A;  3SS4 A;  2LMT A;  2KYF A;  2LM5 A;  1YX7 A;  4F7F A;  2AMI A;  1MHO A;  2ZN9 A;  4PAL A;  2COL B;  1BF5 A;  2KOT A;  5GQQ C;  4C0J A;  1D1O A;  1MUX A;  3I5H C;  1ALW A;  2K7D A;  5HYD A;  1OOI X;  2BCB A;  2KI4 B;  2BKI B;  3D76 A;  1SCM C;  1N0Y A;  4OVN F;  1CM1 A;  1NYA A;  3TUY C;  1UHK A;  1JUO A;  1CLM A;  2M1U A;  2BKH B;  2V53 A;  3I5I C;  2KHN A;  4NDD A;  1BT6 A;  2EC6 B;  1QJT A;  1XFR A;  4PT1 A;  2F8P A;  1WRK A;  2L2E A;  2LP3 A;  2JXL A;  1L7Z A;  3KO0 A;  2KI6 C;  2M7N A;  4QJ4 B;  5AFP A;  1C3Y A;  1PUL A;  1QTX A;  2LV7 A;  1JFK A;  5EL2 A;  3BJH A;  3PN7 B;  3B88 A;  2H61 A;  4JQ0 D;  1T14 A;  1J1E A;  1NSH A;  1TNW A;  1Y1A A;  3S0B A;  2LLU A;  5ER5 A;  3VGO A;  1GJY A;  4CPV A;  4FTG A;  3JVT C;  5FI7 A;  1LA0 A;  1B9A A;  5HKW A;  1KSM A;  3TS5 C;  4DIR A;  2JRF A;  2ZRS A;  1IKU A;  1CFF A;  1CFP A;  5HKZ A;  4I5J A;  4MRY A;  3SIA A;  1FF1 A;  5AAN A;  3R1V A;  3WHU B;  3CLN A;  1WDC B;  1OQP A;  5FI2 A;  3FE6 A;  3SG4 A;  3NGV A;  2PQL A;  1QS7 A;  1MR8 A;  1J7O A;  2NZ0 A;  1GGZ A;  2ERB A;  3D78 A;  4M2Q A;  5DKR A;  1IGV A;  1RJV A;  2JTZ A;  1SBJ A;  1NCY A;  2HET A;  1CNP A;  1A29 A;  1NX2 A;  1SL9 A;  3KF9 A;  3PJI A;  2KI4 C;  2K7C A;  3O6B A;  1XA5 A;  1S26 D;  2PYQ A;  5HLO A;  2QEO A;  1TIZ A;  1KCY A;  4YGB B;  2QDI A;  3OP0 A;  4PE4 A;  3BUO B;  4KYN A;  1DEK A;  2EC6 C;  2KBI A;  2MLF C;  1B8L A;  3NHI A;  4GUK A;  3VB1 A;  1YTZ C;  1FI6 A;  4MZL A;  3IVT A;  2I7A A;  3RM1 A;  1DVI A;  2M29 A;  3BUM B;  4N1F A;  1ZOT B;  3OB1 B;  3RLZ A;  1R2U A;  1DJY A;  3L47 A;  4MLW A;  1UHI A;  3HX4 A;  4I5K A;  4A4C A;  2I94 A;  1K9U A;  3AAJ A;  3FE9 A;  3PN7 C;  3VRP A;  1TUJ A;  2BCX A;  1CM4 A;  1CTR A;  4USL A;  4DUQ A;  1Y1X A;  1KFX L;  3PAL A;  4ORA B;  5F6T A;  2Y4Q A;  1KQV A;  4CLN A;  4DS7 A;  1KWO B;  1SNL A;  3R1P A;  1RWY A;  1CLB A;  3D0Y A;  4JWQ A;  1CLL A;  3BYA A;  2K61 A;  1BMO A;  2KFF A;  1WDC C;  2QPT A;  2JT8 A;  4I5L B;  1SR6 B;  3CDN A;  4OCI A;  1JFJ A;  4MRX A;  2MAZ A;  3CYZ A;  1MXE A;  3WNX B;  1EJ3 A;  2M8U A;  1IH0 A;  2F33 A;  2OS8 B;  1XFV O;  1DGU A;  1XYD A;  5JJG A;  4XJK A;  2BE4 A;  3D77 A;  1DEL A;  2LUX A;  3FS7 A;  2IS9 A;  3OX6 A;  4HSZ A;  4PE7 A;  1S6C A;  4PCW A;  3EK8 A;  1B8C A;  1BU3 A;  1UUR A;  2BAP A;  2H61 C;  2O60 A;  4YBH B;  4ZCV A;  5AEQ A;  2MBX A;  2Y1M A;  2JPO A;  2WCE A;  2LLT A;  1IRJ A;  1YUS A;  2G2B A;  2QAC A;  2WCJ A;  2OPO A;  1IIO A;  4AQJ A;  1LVC D;  1Y6W A;  1OOJ A;  1AJ4 A;  1S5G Z;  3LK0 A;  2K0J A;  1WLM A;  1SY9 A;  4ETO A;  3DVE A;  4HRH A;  1LIN A;  3LCP C;  4ORC B;  1M31 A;  1ZAC A;  1UHN A;  2KLE A;  1KWO C;  1JC2 A;  2JNF A;  4YI9 A;  1WLZ A;  4MZK A;  2B1U A;  1DT7 B;  3EVV A;  1SR6 C;  3S0D A;  1B8R A;  2WCM A;  1A03 A;  1KSO A;  1F4Q A;  4XJK B;  1F54 A;  4D1E A;  1RTP 1;  3OHM B;  3CS1 A;  4GGN A;  3SIB A;  2NCP A;  2OS8 C;  2MJW B;  4NDB A;  1DGV A;  2Q91 A;  3ZNI A;  2KGB C;  1OZO A;  1QLK A;  2F2O A;  1TUZ A;  1PK0 D;  1M45 A;  1V1F A;  2BNX A;  2MA2 A;  1NWD A;  1S1E A;  2L4I A;  3SG6 A;  2HPS A;  3GK2 A;  5CSI A;  2P71 A;  4A4B A;  2WCB A;  4C0L A;  3EG5 B;  2WCL A;  2K8M B;  2QEV A;  2RGI A;  2GTE A;  3CGA A;  1UHJ A;  1GM0 A;  1OMR A;  1DTL A;  3KEV A;  3BFH A;  1WY9 A;  3EVR A;  3V2L A;  4INW A;  3FIA A;  1XFW O;  1K95 A;  1B7T Y;  2R2I A;  2JTT A;  4P5O E;  3PFV A;  5JOL A;  3SS3 A;  3SS5 A;  1WRZ A;  4PDZ A;  1ZUZ A;  2ZFD A;  5HL1 A;  1TNQ A;  2HQW A;  1OOH A;  1X02 A;  3L4L A;  3I5G B;  1KK8 B;  2LVJ A;  1SYM A;  2JU0 A;  5DKN A;  1HQV A;  1IJ5 A;  3B7A A;  3OBV A;  2CNP A;  2P70 A;  3DVK A;  3GOF A;  2LVI A;  4NDC A;  2AAO A;  1KFX S;  1NCX A;  2LAN A;  3B87 A;  3D10 A;  4N1G A;  3O4Y A;  3QME A;  3NSL A;  5G08 A;  1UHH A;  1LKJ A;  1M39 A;  3GK1 A;  3BUN B;  1K90 D;  1QWV A;  1G4Y R;  4YGE B;  5DIC A;  1MQ1 A;  1NUB A;  3SG2 A;  2LVK A;  3DVJ A;  3EKH A;  2GV5 A;  3NXA A;  2KGR A;  3WHT B;  1U5I A;  1IG5 A;  1UUS A;  1KK7 Y;  3R72 A;  1FI5 A;  1QX7 A;  1S6J A;  1ALV A;  1QXP A;  1TWO A;  2ZRT A;  3KHE A;  2L4H A;  1IQ3 A;  1V1G A;  4Q04 A;  2F3Z A;  1K9P A;  2TN4 A;  3SG7 A;  3DYE A;  1NX0 A;  2Q4U A;  2SCP A;  1SL8 A;  1DJW A;  1QVI Y;  1M63 B;  2M0R A;  3OB2 B;  1W7I B;  2GGM A;  2BBM A;  5B8I B;  3H4S E;  2BBN A;  1K8U A;  1AVS A;  1K93 D;  1OW4 A;  1RK9 A;  2KYC A;  4GNK B;  5AER A;  2KSP A;  3IF7 A;  3EVU A;  4HRG A;  4XYN A;  1DJI A;  5ER4 X;  4PHN A;  4DRW A;  3BOW B;  1OSA A;  2MHH A;  1NCZ A;  3KPX A;  1DMO A;  1IJ6 A;  5CSJ A;  1BJF A;  3S0E A;  3I5G C;  1KK8 C;  3NSO A;  3WXA A;  1EL4 A;  4M2O A;  1AJ5 A;  1PAL A;  1YX8 A;  3JTD B;  1OE9 B;  1QV1 A;  2M1K B;  1HT9 A;  1OZS A;  5K89 A;  4CID A;  1C7V A;  2CBL A;  2WC8 A;  1MXL C;  4P2Y B;  1U5I B;  1Y1U A;  1QIW A;  2KAV A;  2L2C A;  4MBE A;  1K2H A;  2LVV A;  4QJ5 B;  3PAT A;  3K1E A;  4JD9 A;  1XFY O;  4N5X A;  3LLE A;  1NPQ A;  2ZN8 A;  2HF5 A;  4R1E A;  3QRX A;  1K94 A;  3SG3 A;  1YRT B;  2KBM A;  5I94 A;  1J55 A;  4AQI A;  3M0W A;  2WCK A;  2KPH A;  1FBV A;  1JBA A;  1S3P A;  2JOJ A;  1CFD A;  2CCM A;  2KLD A;  3GK4 X;  2L5X B;  2K7O A;  1DJG A;  1P28 A;  2Y1N A;  4IJ7 A;  1IQ5 A;  4OZD A;  1S36 A;  1KQM B;  3PLF B;  2JXC A;  3BFA A;  1QLS A;  4WQ2 A;  1L2O B;  3EKJ A;  1Q80 A;  5D3O A;  5DKQ A;  3SG5 A;  3F45 A;  3BUW B;  5KTY A;  1NP8 A;  1FW4 A;  1S6I A;  1K9K A;  3CZ1 A;  1CMF A;  3CTN A;  2K60 A;  3JTD C;  4M2P A;  1C3Z A;  4IL1 A;  4NQG A;  3K21 A;  4GAO A;  1BLQ A;  3D75 A;  4PHK A;  1XK4 C;  1TN4 A;  1JSA A;  3DXL A;  1A75 A;  1PVA A;  3FWB A;  2I18 A;  1NX3 A;  2JT0 A;  1C07 A;  1OOF A;  1OMV A;  1F4O A;  2M9G A;  3CR4 X;  4MEW A;  3AKA A;  3CZT X;  1W7J B;  2KI6 D;  2PVB A;  2M7L A;  1B7T Z;  3EK7 A;  3PM2 A;  5D69 A;  3TDI A;  2NCO A;  4MVF A;  2A4J A;  1ZFS A;  1OMD A;  3CAB A;  4FQT A;  3S0F A;  3DZT A;  2KFH A;  2KNE A;  1EG3 A;  2KAX A;  4WQ3 A;  2Y5I A;  3OX5 A;  1KQM C;  3CZ0 A;  2NXQ A;  4ORB B;  3S0A A;  2LCP A;  1GGW A;  2DOQ A;  1L2O C;  1LS8 A;  2K2F A;  4QJ3 B;  2M97 A;  5I8N A;  1PSB A;  5CSF A;  2JNX A;  2KQY A;  2VRG A;  2CT9 A;  1LA3 A;  3LK1 A;  1BOC A;  1XFZ O;  4PE0 A;  4PE1 A;  2ZND A;  2ISD A;  1EH2 A;  1FPW A;  4YGA A;  4UPG A;  1BR4 B;  5I2L A;  3VRR A;  1A75 B;  5D7F A;  1H4B A;  2EHB A;  1KK7 Z;  3L4A A;  1JF0 A;  2LHL A;  1DJZ A;  3N7H A;  4YGD B;  1TCO B;  3BQ3 A;  3DF0 A;  2L0P A;  5FI6 A;  5CPV A;  1QV0 A;  4YRU A;  4HRE E;  3SJS A;  4ZCU A;  2WND A;  1AHR A;  4PHJ A;  1QVI Z;  1ORG A;  3BOW A;  1XFU O;  2L98 A;  2WOR A;  2PSR A;  2CTN A;  3FE8 A;  1TRF A;  5IBW A;  1B4C A;  2WC5 A;  3NHT A;  1K96 A;  1XFX O;  5TNC A;  1F8H A;  2BL0 B;  2PRU A;  3AKB A;  4YI8 A;  1SRA A;  4PHM A;  1CKK A;  3E3R A;  3ZWH A;  1QX5 B;  1KFU S;  1SK6 D;  1A4P A;  1UP5 A;  1J7Q A;  5I2O A;  2KFG A;  1OOG A;  3A4U B;  1XK4 A;  2L5Y A;  3TDU A;  2BE6 A;  1Z4H A;  1ODB A;  1QAS A;  3PM8 A;  2WCH A;  2K7B A;  2LP2 A;  1AK8 A;  1F55 A;  2LHI A;  1PRW A;  1JWD A;  1XO5 A; 
#chains in the Genus database with same CATH homology
 1J7R A;  1DF0 A;  5FYX A;  1YRU B;  1BG1 A;  1GQM A;  1SL7 A;  3IQQ A;  2M3W A;  1B1G A;  3DF0 B;  3O78 A;  1G8I A;  3EK4 A;  2JC2 A;  1M46 A;  2L51 A;  3BXK A;  3CR5 X;  1TNX A;  1A2X A;  2I2R E;  1QAT A;  2JQ6 A;  2MRD A;  4OKH A;  4BY4 A;  1N2D A;  2ZKM X;  4MSP A;  1TNP A;  1J7P A;  1SW8 A;  1QX2 A;  1TCF A;  4MN0 A;  2GGZ A;  1BR1 B;  1PVB A;  2KQ6 A;  2JPT A;  2BL0 C;  4E68 A;  5J3X A;  1Y0V H;  3C1V A;  1BOD A;  4DCK A;  2K2A A;  2PMY A;  1KFU L;  3LL8 B;  4L9M A;  1CDN A;  1NX1 A;  4CFR A;  3ICB A;  5CSN A;  4GGF C;  1TTX A;  1DF0 B;  4GBA A;  2LAP A;  1IWQ A;  2JWW A;  2LMU A;  2OTG B;  1CFC A;  1DJX A;  1DJH A;  3I5F B;  1B47 A;  2KDH A;  5AXI A;  1RFJ A;  2FJU B;  1XVJ A;  5KSZ A;  1YUU A;  3A8R A;  4C0K A;  1SPY A;  2BCA A;  2JUL A;  1EG4 A;  1SCV A;  2FOT A;  2H2K A;  2LUC A;  2G9B A;  3TDZ A;  2BEC A;  1C7W A;  3CWG A;  1YVH A;  2D8N A;  3AAK A;  4BY5 A;  2LE9 B;  3MSE B;  5HLV A;  4AOM A;  4MZJ A;  2E6W A;  1F71 A;  4U8D A;  4JPZ B;  2PAL A;  2WOS A;  2M49 B;  2CXJ A;  4FQO A;  1CMG A;  4YGC B;  2KAY A;  4TNC A;  2LC5 A;  2P6B B;  4CFQ A;  1PSR A;  4GFT A;  1NIW A;  4OR9 B;  3BUX B;  1YR5 A;  1CDL A;  2AUC A;  3VRO A;  1QIV A;  1G33 A;  3I5H B;  2JT3 A;  2LNK A;  1AUI B;  4GPL B;  3CR2 A;  2EGD A;  1CDP A;  1SCM B;  2E30 A;  4F0Z B;  3DVM A;  3HCM A;  2OTG C;  2WCF A;  1JF2 A;  3PSR A;  3TUY B;  1REC A;  1YUT A;  2MLE C;  3I5F C;  2NLN A;  1SKT A;  1LXF C;  3I5I B;  2L50 A;  4I5N B;  3D0Y B;  4WRI A;  1TOP A;  3IQO A;  3NSK A;  4ICB A;  3O2P A;  5KU1 A;  3VRN A;  1RRO A;  2LLS A;  3DD4 A;  3FWC A;  2O5G A;  1N65 A;  2FCE A;  1AP4 A;  5I2Q A;  3VRQ A;  5HKY A;  1CDM A;  1MWN A;  1VRK A;  1E8A A;  1YUR A;  1F70 A;  1UWO A;  2SAS A;  1J1D A;  1H8B A;  1EXR A;  1SMG A;  1WRL A;  4GGF A;  2LMV A;  4OV2 A;  2FCD A;  2F2P A;  5BPJ A;  2F3Y A;  1CB1 A;  3NSI A;  2PAS A;  2JZI A;  3JVT B;  1MF8 B;  2ZNE A;  5PAL A;  3TS5 B;  2HQ8 A;  3TZ1 A;  1R6P A;  1S5G Y;  1YVL A;  1ZMZ A;  2LMT A;  2KYF A;  2LM5 A;  1YX7 A;  2AMI A;  1MHO A;  2ZN9 A;  4PAL A;  2COL B;  1BF5 A;  2KOT A;  5GQQ C;  4C0J A;  1D1O A;  1MUX A;  3I5H C;  1ALW A;  2K7D A;  5HYD A;  2BCB A;  2KI4 B;  2BKI B;  1SCM C;  1N0Y A;  4OVN F;  1CM1 A;  1NYA A;  3TUY C;  1UHK A;  1JUO A;  1CLM A;  2M1U A;  2BKH B;  2V53 A;  3I5I C;  2KHN A;  4NDD A;  1BT6 A;  2EC6 B;  1QJT A;  2F8P A;  1WRK A;  2L2E A;  2LP3 A;  2JXL A;  1L7Z A;  3KO0 A;  2KI6 C;  2M7N A;  4QJ4 B;  5AFP A;  1PUL A;  1QTX A;  2LV7 A;  1JFK A;  3PN7 B;  2H61 A;  4JQ0 D;  1J1E A;  1NSH A;  1TNW A;  1Y1A A;  2LLU A;  5ER5 A;  3VGO A;  1GJY A;  4CPV A;  4FTG A;  3JVT C;  1LA0 A;  1B9A A;  5HKW A;  1KSM A;  3TS5 C;  4DIR A;  2JRF A;  2ZRS A;  1IKU A;  1CFF A;  1CFP A;  5HKZ A;  4I5J A;  4MRY A;  3SIA A;  1FF1 A;  5AAN A;  3WHU B;  3CLN A;  1WDC B;  1OQP A;  3SG4 A;  1QS7 A;  1MR8 A;  1J7O A;  2NZ0 A;  1GGZ A;  4M2Q A;  5DKR A;  1IGV A;  1RJV A;  2JTZ A;  1SBJ A;  1NCY A;  2HET A;  1CNP A;  1A29 A;  1NX2 A;  1SL9 A;  3KF9 A;  2KI4 C;  2K7C A;  3O6B A;  1XA5 A;  1S26 D;  5HLO A;  1TIZ A;  1KCY A;  4YGB B;  3OP0 A;  4PE4 A;  3BUO B;  2EC6 C;  2KBI A;  2MLF C;  1B8L A;  4GUK A;  1YTZ C;  1FI6 A;  4MZL A;  2I7A A;  3RM1 A;  1DVI A;  2M29 A;  3BUM B;  4N1F A;  1ZOT B;  3OB1 B;  3RLZ A;  1R2U A;  1DJY A;  4MLW A;  1UHI A;  3HX4 A;  4I5K A;  4A4C A;  2I94 A;  1K9U A;  3AAJ A;  3PN7 C;  3VRP A;  2BCX A;  1CM4 A;  1CTR A;  4USL A;  4DUQ A;  1Y1X A;  1KFX L;  3PAL A;  4ORA B;  5F6T A;  2Y4Q A;  1KQV A;  4CLN A;  4DS7 A;  1KWO B;  1SNL A;  1RWY A;  1CLB A;  3D0Y A;  4JWQ A;  1CLL A;  3BYA A;  2K61 A;  1BMO A;  2KFF A;  1WDC C;  2QPT A;  2JT8 A;  4I5L B;  1SR6 B;  4OCI A;  1JFJ A;  4MRX A;  2MAZ A;  1MXE A;  3WNX B;  1EJ3 A;  2M8U A;  1IH0 A;  2F33 A;  2OS8 B;  1XFV O;  1DGU A;  1XYD A;  5JJG A;  4XJK A;  2BE4 A;  2LUX A;  3FS7 A;  2IS9 A;  3OX6 A;  4HSZ A;  4PE7 A;  1S6C A;  4PCW A;  3EK8 A;  1B8C A;  1BU3 A;  1UUR A;  2O60 A;  2H61 C;  4YBH B;  4ZCV A;  2MBX A;  5AEQ A;  2Y1M A;  2WCE A;  2LLT A;  1IRJ A;  1YUS A;  2G2B A;  2QAC A;  2OPO A;  4AQJ A;  1LVC D;  1Y6W A;  1OOJ A;  1AJ4 A;  1S5G Z;  3LK0 A;  2K0J A;  1WLM A;  1SY9 A;  4ETO A;  3DVE A;  4HRH A;  1LIN A;  3LCP C;  4ORC B;  1M31 A;  1ZAC A;  1UHN A;  1KWO C;  1JC2 A;  2JNF A;  4YI9 A;  1WLZ A;  4MZK A;  2B1U A;  1DT7 B;  3EVV A;  1SR6 C;  1B8R A;  1A03 A;  1KSO A;  1F4Q A;  4XJK B;  1F54 A;  4D1E A;  1RTP 1;  3OHM B;  3CS1 A;  4GGN A;  3SIB A;  2NCP A;  2OS8 C;  2MJW B;  4NDB A;  1DGV A;  2Q91 A;  3ZNI A;  2KGB C;  1OZO A;  1QLK A;  2F2O A;  1PK0 D;  1M45 A;  1V1F A;  2MA2 A;  1NWD A;  1S1E A;  2L4I A;  3SG6 A;  2HPS A;  3GK2 A;  5CSI A;  4A4B A;  2WCB A;  4C0L A;  2K8M B;  2RGI A;  3CGA A;  1UHJ A;  1OMR A;  1DTL A;  3KEV A;  1WY9 A;  3EVR A;  3FIA A;  1XFW O;  1K95 A;  1B7T Y;  2R2I A;  2JTT A;  4P5O E;  3PFV A;  5JOL A;  1WRZ A;  4PDZ A;  1ZUZ A;  2ZFD A;  1TNQ A;  2HQW A;  1X02 A;  3I5G B;  1KK8 B;  2LVJ A;  1SYM A;  2JU0 A;  5DKN A;  1HQV A;  1IJ5 A;  2CNP A;  3GOF A;  3DVK A;  2LVI A;  4NDC A;  2AAO A;  1KFX S;  1NCX A;  2LAN A;  3D10 A;  4N1G A;  3O4Y A;  3NSL A;  5G08 A;  1UHH A;  1LKJ A;  1M39 A;  3GK1 A;  3BUN B;  1K90 D;  4YGE B;  1G4Y R;  1MQ1 A;  1NUB A;  3SG2 A;  2LVK A;  3DVJ A;  3EKH A;  2GV5 A;  3NXA A;  2KGR A;  3WHT B;  1U5I A;  1IG5 A;  1UUS A;  1KK7 Y;  1FI5 A;  1QX7 A;  1S6J A;  1ALV A;  1QXP A;  2ZRT A;  3KHE A;  2L4H A;  1IQ3 A;  1V1G A;  4Q04 A;  2F3Z A;  1K9P A;  2TN4 A;  3SG7 A;  1NX0 A;  2Q4U A;  2SCP A;  1SL8 A;  1DJW A;  1QVI Y;  1M63 B;  2M0R A;  3OB2 B;  1W7I B;  2GGM A;  2BBM A;  5B8I B;  3H4S E;  2BBN A;  1K8U A;  1AVS A;  1K93 D;  1RK9 A;  2KYC A;  4GNK B;  5AER A;  2KSP A;  3IF7 A;  3EVU A;  4HRG A;  4XYN A;  1DJI A;  5ER4 X;  4PHN A;  4DRW A;  3BOW B;  1OSA A;  2MHH A;  1NCZ A;  3KPX A;  1DMO A;  1IJ6 A;  5CSJ A;  1BJF A;  3I5G C;  1KK8 C;  3NSO A;  3WXA A;  1EL4 A;  4M2O A;  1AJ5 A;  1PAL A;  1YX8 A;  3JTD B;  1OE9 B;  1QV1 A;  2M1K B;  1HT9 A;  1OZS A;  5K89 A;  4CID A;  1C7V A;  2CBL A;  2WC8 A;  1MXL C;  4P2Y B;  1U5I B;  1Y1U A;  1QIW A;  2KAV A;  4MBE A;  1K2H A;  2LVV A;  4QJ5 B;  3PAT A;  1XFY O;  4N5X A;  3LLE A;  1NPQ A;  2ZN8 A;  2HF5 A;  4R1E A;  3QRX A;  1K94 A;  3SG3 A;  1YRT B;  2KBM A;  1J55 A;  4AQI A;  3M0W A;  1FBV A;  1JBA A;  1S3P A;  2JOJ A;  1CFD A;  2CCM A;  3GK4 X;  2L5X B;  2K7O A;  1DJG A;  2Y1N A;  1IQ5 A;  1S36 A;  1KQM B;  3PLF B;  2JXC A;  1QLS A;  4WQ2 A;  1L2O B;  3EKJ A;  1Q80 A;  5DKQ A;  3SG5 A;  3F45 A;  3BUW B;  5KTY A;  1NP8 A;  1FW4 A;  1S6I A;  1K9K A;  1CMF A;  3CTN A;  3JTD C;  4M2P A;  4IL1 A;  4NQG A;  3K21 A;  4GAO A;  1BLQ A;  4PHK A;  1XK4 C;  1TN4 A;  1JSA A;  1A75 A;  1PVA A;  3FWB A;  2I18 A;  1NX3 A;  2JT0 A;  1C07 A;  1OMV A;  1F4O A;  2M9G A;  3CR4 X;  4MEW A;  3AKA A;  3CZT X;  1W7J B;  2KI6 D;  2PVB A;  2M7L A;  1B7T Z;  3EK7 A;  5D69 A;  3TDI A;  2NCO A;  4MVF A;  2A4J A;  1ZFS A;  1OMD A;  2KFH A;  2KNE A;  1EG3 A;  2KAX A;  4WQ3 A;  2Y5I A;  3OX5 A;  1KQM C;  2NXQ A;  4ORB B;  2LCP A;  1GGW A;  2DOQ A;  1L2O C;  2K2F A;  4QJ3 B;  2M97 A;  5I8N A;  1PSB A;  5CSF A;  2JNX A;  2KQY A;  2VRG A;  2CT9 A;  1LA3 A;  3LK1 A;  1BOC A;  1XFZ O;  4PE0 A;  4PE1 A;  2ZND A;  2ISD A;  1EH2 A;  1FPW A;  4YGA A;  4UPG A;  1BR4 B;  5I2L A;  3VRR A;  1A75 B;  5D7F A;  1H4B A;  2EHB A;  1KK7 Z;  1JF0 A;  2LHL A;  1DJZ A;  4YGD B;  1TCO B;  3BQ3 A;  3DF0 A;  2L0P A;  4YRU A;  5CPV A;  1QV0 A;  4HRE E;  3SJS A;  4ZCU A;  2WND A;  1AHR A;  4PHJ A;  1QVI Z;  3BOW A;  1XFU O;  2L98 A;  2WOR A;  2PSR A;  2CTN A;  5IBW A;  1TRF A;  1B4C A;  1K96 A;  1XFX O;  5TNC A;  1F8H A;  2BL0 B;  2PRU A;  3AKB A;  4YI8 A;  1SRA A;  4PHM A;  1CKK A;  3E3R A;  3ZWH A;  1QX5 B;  1KFU S;  1SK6 D;  1A4P A;  1UP5 A;  1J7Q A;  5I2O A;  2KFG A;  3A4U B;  1XK4 A;  3TDU A;  2BE6 A;  1ODB A;  1QAS A;  3PM8 A;  2K7B A;  2LP2 A;  1AK8 A;  1F55 A;  2LHI A;  1PRW A;  1JWD A;  1XO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...