2LE9B

Ragec2-s100a13 tetrameric complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
b'AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Interaction of S100A13 with Receptor for Advanced Glycation End products (RAGE) C2 domain
rcsb
source organism Homo sapiens
molecule tags Membrane protein/metal binding protein
total genus 26
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2le9B00
1BR1B 2MLEC 4MEWA 3FIAA 2M1KB 2K7OA 5F6TA 4PHMA 1WY9A 1DT7B 2K7DA 2BL0C 5AANA 3TUYB 1PVAA 1CFCA 5B8IB 2KSPA 2L4IA 1Y0VH 3BUXB 1C7VA 1QXPA 1JF0A 2BBMA 1DTLA 3CR5X 3EK7A 1A2XA 1N2DA 1J7OA 1R6PA 3HCMA 4C0KA 1NP8A 1S6IA 2KQ6A 5ER5A 4ETOA 3CZTX 1SK6D 2LLTA 2KAXA 2M9GA 2BKHB 4I5JA 4GUKA 1SPYA 4A4CA 2LMTA 4I5NB 1DJZA 1CDPA 2SASA 1QATA 2EC6C 4CLNA 1MHOA 5CPVA 3DF0B 4QJ4B 5GQQC 2BCBA 5CSFA 4XYNA 4BY4A 1IG5A 2KFGA 2LUCA 2OTGB 1J1EA 1SCMB 2LVJA 4Q04A 5I8NA 2OS8C 1B47A 1B8CA 2ZRTA 1TCFA 4MSPA 3TS5C 1RECA 2B1UA 2LANA 1KQMC 1LXFC 4YRUA 2M0RA 5I2QA 2I2RE 4IL1A 1NX1A 2NCOA 1KK7Z 4PDZA 3SG7A 1ALWA 4M2OA 2KNEA 2BL0B 1G4YR 2LLUA 4C0JA 1PRWA 2R2IA 3IQOA 3OB1B 1A03A 2LLSA 4OCIA 1EH2A 2CXJA 1K9UA 1IKUA 1FW4A 3EKJA 3FWBA 1CLBA 3LK1A 1SL9A 3O2PA 1PVBA 1NX2A 1UWOA 1UHHA 1X02A 2JULA 3I5GC 3VGOA 1PK0D 4YGCB 3OHMB 2JXCA 2KQYA 2LVVA 1KK7Y 3I5FB 4XJKA 2KI4B 3CWGA 1QX7A 1IRJA 3VRPA 1KFUL 1S26D 3EVUA 3K21A 1J7PA 1TCOB 1YX8A 2ISDA 3BUWB 3E3RA 1BOCA 1TOPA 1WRLA 1KSMA 3NSLA 2H61A 4YGAA 2M3WA 2M8UA 2I94A 1SYMA 4WQ2A 4MZJA 2CT9A 2IS9A 1SW8A 4YGEB 1KFUS 2LUXA 3FS7A 1EL4A 1S6JA 1NUBA 1DJGA 2A4JA 1QTXA 5HKYA 1MR8A 1W7JB 2HPSA 1DJHA 1YUSA 2LCPA 2NLNA 3WHTB 2I7AA 1QS7A 4YGDB 1QLKA 1N0YA 1K93D 3SG3A 1G8IA 2L2EA 1UP5A 4PHJA 1BG1A 2MHHA 3BOWB 3PATA 1FF1A 1MQ1A 1XFXO 2WORA 4PHKA 1A75B 1JSAA 1TNXA 1OE9B 2M29A 1YUTA 3SJSA 1PALA 1CFDA 2LC5A 1AK8A 1IWQA 2PVBA 3AKAA 5CSJA 1F8HA 1NIWA 3BYAA 2M49B 1WDCB 1AP4A 1XK4A 4PHNA 2KHNA 1AVSA 1LA0A 5I2OA 3GK4X 1MUXA 1DGVA 2JXLA 1AJ5A 1Y6WA 1NX0A 2LHIA 1DJIA 2G9BA 1YR5A 2K0JA 4OVNF 2K8MB 2BKIB 3AAKA 1RJVA 2JU0A 2MAZA 1MF8B 3PALA 1J7RA 1NCYA 2JOJA 1KFXS 2HETA 1OMRA 3BUNB 3WXAA 1S36A 4NDDA 4HRGA 5FYXA 4U8DA 2KBIA 2L98A 2F33A 2L0PA 1S5GZ 2JT8A 1CDLA 3CR2A 1UHKA 2E6WA 3HX4A 2QPTA 1FPWA 1JC2A 1Y1XA 1K2HA 1U5IB 1GGWA 1OSAA 3BXKA 4FTGA 1ZACA 1SR6B 2GGMA 1ZOTB 5AFPA 1CFFA 2ZNEA 3NSOA 1K95A 4WQ3A 1CNPA 1UUSA 2M7NA 1IJ5A 1IQ5A 4HREE 4NDBA 1KK8B 2K61A 1MXEA 3CR4X 1UHJA 2ZFDA 1F4QA 5D69A 5I2LA 3BQ3A 1QX2A 2ZN9A 4PALA 1JBAA 3KHEA 1TN4A 1PSBA 1GJYA 2BE6A 2KYCA 4MLWA 2JC2A 2NZ0A 4N5XA 1C7WA 1J7QA 1BT6A 3M0WA 1DJXA 1OOJA 2HQWA 2WCBA 3I5HC 1TRFA 1HT9A 4AOMA 5IBWA 1RK9A 3BUOB 1BF5A 2LP2A 2WNDA 3GK1A 1F70A 2HF5A 2CNPA 2LNKA 1GQMA 3H4SE 1R2UA 3WHUB 1TNQA 2FJUB 2KI6D 3EK8A 3GOFA 2ZRSA 4BY5A 4YI9A 3PSRA 1BJFA 2JWWA 2COLB 2MBXA 4JQ0D 4NDCA 1KQVA 5HYDA 3I5IB 2H61C 2JZIA 3DF0A 3VRQA 1K9PA 1QV1A 2LVIA 3O6BA 3TDZA 1LVCD 3QRXA 5CSIA 1K90D 2KYFA 1OQPA 5JJGA 1TNWA 2EGDA 3BUMB 4GPLB 1UHIA 2JQ6A 4R1EA 2JT0A 2KFHA 4NQGA 3F45A 4ORAB 3LL8B 4CPVA 1K96A 1KWOC 1RWYA 5HKWA 1NSHA 1B7TZ 2PALA 2KOTA 1SL8A 1LA3A 3MSEB 1L2OC 1MXLC 1GGZA 1BMOA 4USLA 1OMDA 2CTNA 3FWCA 4WRIA 2AUCA 2EC6B 4MZKA 3CS1A 1EG4A 2WOSA 4XJKB 1V1GA 3TDUA 2F2PA 2NCPA 2BCAA 2Y5IA 2F3YA 1DF0B 3RM1A 3D0YB 5ER4X 1FI6A 1SY9A 2AAOA 2M97A 2OS8B 1XFWO 3TS5B 4GBAA 4JPZB 1SMGA 1YUUA 2I18A 1KQMB 1EXRA 3EVVA 1LKJA 1ODBA 1A29A 2JNXA 1V1FA 4PCWA 4ICBA 1M63B 3OP0A 1XYDA 4DRWA 4YI8A 1A4PA 4PE0A 4ZCVA 3VROA 1JFKA 4PE7A 2BE4A 3KF9A 2NXQA 1NCXA 2LAPA 1DMOA 2KDHA 2LMUA 1CKKA 1B4CA 3I5GB 2LE9B 4CFRA 1JUOA 2PRUA 3OB2B 1HQVA 1YRUB 1Q80A 1KFXL 3IF7A 1BU3A 5DKNA 1NPQA 2PSRA 1Y1UA 3BOWA 1M31A 1YVLA 1SRAA 1A75A 3GK2A 4AQJA 1NWDA 2L4HA 1TIZA 3DVMA 1K94A 2G2BA 3ZNIA 3SIAA 3EK4A 3TUYC 3PN7C 5D7FA 2FCEA 4N1FA 1TNPA 2LHLA 3O4YA 3JTDC 2M7LA 1G33A 2BCXA 1FBVA 4CIDA 1EG3A 1DJYA 2E30A 3LLEA 4QJ3B 4GGFA 4FQOA 5AEQA 5CSNA 1JF2A 2PMYA 4I5KA 1L7ZA 3ZWHA 3PM8A 2O5GA 4OR9B 4GNKB 4I5LB 2AMIA 4DUQA 1BR4B 1H4BA 2K2AA 4N1GA 5AERA 2OPOA 1CM4A 1ZMZA 5HKZA 1YTZC 1DVIA 1XFVO 1XFZO 3CTNA 3PLFB 2OTGC 1F4OA 1SL7A 2TN4A 1CTRA 2KAVA 1S5GY 1F71A 2WC8A 4MZLA 2JPTA 1WLMA 4ZCUA 1QASA 2WCFA 3OX5A 1CMFA 3CLNA 4MBEA 4PE1A 4P5OE 1YX7A 2K7CA 4JWQA 4OV2A 3RLZA 3A8RA 4DS7A 4GFTA 4M2QA 1SKTA 3PN7B 2KFFA 1D1OA 1AUIB 1AHRA 1M46A 1YVHA 2DOQA 4HRHA 1PULA 1IJ6A 3JTDB 2MJWB 1NX3A 2CCMA 3KEVA 1QVIZ 2LM5A 1EJ3A 1J1DA 1M39A 4MN0A 1QV0A 1K9KA 1JWDA 3I5FC 2MLFC 2KI4C 4ORBB 2KI6C 2MA2A 3OX6A 5HLOA 2GV5A 1F54A 2LVKA 2LP3A 3JVTC 2F8PA 3TZ1A 3SG2A 3DVJA 1PSRA 4GGNA 4D1EA 4F0ZB 4TNCA 1QVIY 1QIVA 2ZNDA 2V53A 4UPGA 2KGBC 1OZSA 3SG6A 1S6CA 2VRGA 4HSZA 5KTYA 1OZOA 1B9AA 1QLSA 2P6BB 1XO5A 3KO0A 5G08A 1CMGA 5PALA 5KU1A 4M2PA 3I5HB 1OMVA 4MVFA 1H8BA 1IQ3A 1QIWA 2LV7A 2ZKMX 1XK4C 2F3ZA 4MRXA 1B7TY 1RROA 5HLVA 2LMVA 3SG4A 2H2KA 1YURA 4MRYA 5DKQA 1RFJA 3DVEA 2K2FA 1CDMA 1CLMA 3CGAA 1XA5A 3WNXB 1BODA 4P2YB 1WLZA 1XFUO 4A4BA 2O60A 2M1UA 3AKBA 1WDCC 5AXIA 2JT3A 2L5XB 1B8LA 1KCYA 2BBNA 1CM1A 1WRZA 2F2OA 2FCDA 2CBLA 3C1VA 1NYAA 1DF0A 3JVTB 5DKRA 2JNFA 3D0YA 1KWOB 3EKHA 3VRRA 2Q4UA 1BLQA 1IH0A 4GGFC 1XVJA 1S3PA 1VRKA 2Y1NA 1FI5A 1MWNA 1W7IB 1B1GA 3KPXA 1JFJA 1IGVA 2KBMA 4QJ5B 1C07A 1SCVA 1L2OB 1SNLA 4GAOA 2KAYA 4E68A 1Y1AA 4ORCB 2WCEA 3D10A 3DD4A 3NSKA 5J3XA 1YRTB 3A4UB 3AAJA 1QJTA 2K7BA 2EHBA 2ZN8A 1M45A 1J55A 5BPJA 3NXAA 2RGIA 2MRDA 1E8AA 2PASA 1NCZA 4YGBB 4C0LA 1TTXA 2Y4QA 1SR6C 2KGRA 3VRNA 4CFQA 1DGUA 3LCPC 1XFYO 1CFPA 1N65A 2JTTA 3LK0A 1KK8C 2JTZA 1KSOA 2BECA 3ICBA 5K89A 3NSIA 2Q91A 3IQQA 1AJ4A 4OKHA 1CB1A 4DCKA 1RTP1 3O78A 2D8NA 2HQ8A 4PE4A 1B8RA 5KSZA 3SG5A 2FOTA 1S1EA 1CDNA 1UHNA 1CLLA 1QX5B 5JOLA 1ZFSA 3PFVA 3DVKA 2JRFA 3SIBA 1SBJA 2L51A 3EVRA 1WRKA 2L50A 1SCMC 4YBHB 2SCPA 4L9MA 1U5IA 2QACA 4DIRA 1F55A 5TNCA 1LINA 1ZUZA 2Y1MA 3I5IC 2GGZA 4AQIA 1DJWA 3TDIA 1UURA 1K8UA 1ALVA
chains in the Genus database with same CATH superfamily
1BR1B 2MLEC 4MEWA 3FIAA 2M1KB 2K7OA 2H8VA 3CZ2A 1WY9A 4PHMA 5F6TA 2K7DA 2KPHA 1DT7B 2BL0C 5AANA 3TUYB 5FI7A 1PVAA 1CFCA 3Q8IA 2KSPA 1Z4HA 5B8IB 2L4IA 1Y0VH 3BUXB 1C7VA 1QXPA 3DZTA 1JF0A 2BBMA 1DTLA 3CR5X 3EK7A 1A2XA 1N2DA 1J7OA 1R6PA 3HCMA 4C0KA 1NP8A 1S6IA 2KQ6A 3NHIA 5ER5A 4ETOA 3CZTX 1SK6D 2LLTA 2KAXA 2M9GA 2BKHB 4I5JA 4GUKA 1SPYA 4A4CA 2LMTA 4I5NB 1DJZA 1CDPA 2SASA 1QATA 2EC6C 4CLNA 1MHOA 5CPVA 3DF0B 1OW4A 4QJ4B 3NGVA 5GQQC 2BCBA 5CSFA 4XYNA 4BY4A 1IG5A 2KFGA 3D76A 2LUCA 3OBVA 2OTGB 2BAPA 1J1EA 3NHTA 1SCMB 2LVJA 4Q04A 5I8NA 2OS8C 1B47A 4INXA 1B8CA 2ZRTA 1TCFA 4MSPA 3TS5C 1SSEB 1RECA 2B1UA 2LANA 1KQMC 1LXFC 2QDIA 4YRUA 2M0RA 5I2QA 2I2RE 4IL1A 3OGNA 1NX1A 2NCOA 1KK7Z 4PDZA 3SG7A 1ALWA 4M2OA 2KNEA 4KYNA 2BL0B 1G4YR 2LLUA 4C0JA 1PRWA 2R2IA 3IQOA 3OB1B 1A03A 2LLSA 4OCIA 1EH2A 2CXJA 1K9UA 1IKUA 2KLDA 1FW4A 3EKJA 3FWBA 1CLBA 3LK1A 1SL9A 3O2PA 1PVBA 2JPOA 1NX2A 1UWOA 1OOHA 1UHHA 1X02A 2JULA 3D74A 3I5GC 1C3ZA 3VGOA 1PK0D 4YGCB 3OHMB 2JXCA 2KQYA 3FE9A 3FE6A 2LVVA 1KK7Y 3I5FB 4XJKA 2KI4B 3CWGA 1QX7A 1IRJA 3VRPA 1KFUL 1S26D 3EVUA 3K21A 1J7PA 2L5YA 1TCOB 1YX8A 2ISDA 3BUWB 3E3RA 2BNXA 1TOPA 1BOCA 3UO9A 1WRLA 1KSMA 3NSLA 2H61A 4YGAA 2M3WA 3O4XA 2M8UA 2I94A 1SYMA 4WQ2A 4MZJA 2CT9A 2IS9A 1SW8A 4YGEB 1KFUS 2LUXA 3FS7A 1EL4A 1S6JA 1NUBA 1DJGA 2A4JA 1QTXA 5HKYA 1MR8A 1W7JB 2HPSA 1DJHA 1YUSA 2LCPA 2NLNA 3WHTB 2I7AA 1QS7A 4YGDB 1QLKA 1N0YA 1OOIX 1K93D 3SG3A 1G8IA 2L2EA 1UP5A 4PHJA 1BG1A 2MHHA 3BOWB 3PATA 1FF1A 1MQ1A 1XFXO 2WORA 2PQLA 1A75B 3DYEA 4PHKA 3D73A 1TNXA 1JSAA 1OE9B 2M29A 3PM2A 1YUTA 3SJSA 1PALA 1CFDA 2LC5A 1AK8A 1IWQA 2PVBA 3AKAA 5CSJA 1F8HA 1NIWA 3BYAA 2M49B 1WDCB 1AP4A 1GM0A 1XK4A 4OZDA 2KHNA 1AVSA 1LA0A 4PHNA 5I2OA 3GK4X 1MUXA 1DGVA 3R1OA 2JXLA 1AJ5A 1Y6WA 1NX0A 2LHIA 1DJIA 3S0AA 1C3YA 2G9BA 1YR5A 2K0JA 4OVNF 2K8MB 2BKIB 3AAKA 3S0GA 1RJVA 2JU0A 2MAZA 1MF8B 3PALA 1J7RA 1NCYA 2JOJA 1KFXS 2HETA 1OMRA 3BUNB 3WXAA 1S36A 2WC6A 5HL1A 4NDDA 3CABA 4HRGA 5FYXA 3S0EA 4U8DA 2KBIA 2L98A 2F33A 3PJIA 2L0PA 1S5GZ 2JT8A 1CDLA 3CR2A 1UHKA 2E6WA 3HX4A 2QPTA 1FPWA 3B88A 3BFBA 1Y1XA 1JC2A 1K2HA 1U5IB 1GGWA 1OSAA 3DY9A 3BXKA 4FTGA 1ZACA 1SR6B 2GGMA 1ZOTB 5AFPA 1CFFA 2ZNEA 3NSOA 1K95A 4WQ3A 1CNPA 1UUSA 2M7NA 1IJ5A 1IQ5A 4HREE 4NDBA 1KK8B 1TUZA 1MXEA 2K61A 1UHJA 2ZFDA 3CR4X 1F4QA 5D69A 5I2LA 3BQ3A 4JD9A 1QX2A 2ZN9A 4PALA 1JBAA 3KHEA 3BJHA 1TN4A 1PSBA 1GJYA 2BE6A 5FI6A 2WCLA 2KYCA 4MLWA 2JC2A 2NZ0A 4N5XA 1C7WA 1J7QA 1BT6A 3M0WA 3R72A 1DJXA 1OOJA 2HQWA 1ORGA 2WCBA 1TRFA 3I5HC 1HT9A 3D78A 4AOMA 5IBWA 1RK9A 2YGUA 2FJYA 3BUOB 3D75A 1BF5A 2LP2A 2WNDA 3GK1A 1F70A 2HF5A 2CNPA 2LNKA 1GQMA 3H4SE 1R2UA 3WHUB 1TNQA 2FJUB 2KI6D 3EK8A 3GOFA 1DQEA 2ZRSA 4BY5A 4YI9A 3PSRA 1BJFA 5EL2A 2JWWA 2COLB 2MBXA 4JQ0D 4NDCA 1KQVA 3SS5A 5HYDA 3I5IB 2H61C 2JZIA 3DF0A 3S0FA 3VRQA 1K9PA 1QV1A 2LVIA 3O6BA 3TDZA 1LVCD 3QRXA 5CSIA 1K90D 2KYFA 1OQPA 2QEOA 1TNWA 5JJGA 2EGDA 3BUMB 4GPLB 1UHIA 2JQ6A 4R1EA 2JT0A 2KFHA 4NQGA 3F45A 4ORAB 3LL8B 4CPVA 1K96A 1KWOC 1RWYA 5HKWA 1NSHA 1B7TZ 2PALA 2KOTA 1SL8A 1LA3A 3MSEB 1L2OC 2PYQA 1MXLC 1GGZA 1BMOA 1DC1A 2QEHA 1OOGA 4USLA 3BFAA 1OMDA 2CTNA 3FWCA 4WRIA 2AUCA 2EC6B 4MZKA 3CS1A 1EG4A 2WOSA 3VB1A 4XJKB 1V1GA 3TDUA 2F2PA 2NCPA 2BCAA 2Y5IA 2F3YA 3B6XA 1DF0B 3RM1A 3D0YB 5ER4X 1FI6A 1SY9A 2AAOA 2M97A 2OS8B 4JKTA 1XFWO 3TS5B 4GBAA 4JPZB 1SMGA 1YUUA 1TWOA 2I18A 1KQMB 1EXRA 3EVVA 1LKJA 1ODBA 1A29A 2JNXA 1V1FA 4INWA 4PCWA 4ICBA 1M63B 2KLEA 3S0BA 3OP0A 2QEVA 1XYDA 4DRWA 4YI8A 1A4PA 4PE0A 4ZCVA 3VROA 1JFKA 4PE7A 2BE4A 3KF9A 2NXQA 1NCXA 2LAPA 1DMOA 2KDHA 2LMUA 3SS4A 1CKKA 1B4CA 3I5GB 2LE9B 3UNWA 3CYZA 4CFRA 1JUOA 2PRUA 3OB2B 1HQVA 1YRUB 1Q80A 3K1EA 1KFXL 3IF7A 1BU3A 5DKNA 1NPQA 2PSRA 1Y1UA 3BOWA 1M31A 1YVLA 3SS3A 1SRAA 1A75A 3GK2A 3L4AA 4AQJA 3B86A 1NWDA 2L4HA 1TIZA 3DVMA 3B7AA 1K94A 2G2BA 2K60A 3ZNIA 3SIAA 3EK4A 3TUYC 3PN7C 5D7FA 2FCEA 4N1FA 1TNPA 2LHLA 1DELA 3CZ0A 3O4YA 1QWVA 3JTDC 2M7LA 1G33A 2BCXA 1FBVA 2WCHA 3L4LA 4CIDA 1EG3A 1DJYA 2E30A 2WC5A 3LLEA 4QJ3B 3EG5B 2QEBA 2P70A 3IVTA 4GGFA 4FQOA 5AEQA 5CSNA 1JF2A 2PMYA 4I5KA 1L7ZA 3B87A 3ZWHA 3PM8A 2O5GA 4OR9B 4GNKB 4I5LB 2AMIA 4DUQA 1BR4B 1H4BA 2K2AA 4N1GA 5AERA 2OPOA 1CM4A 1ZMZA 5HKZA 1YTZC 1DVIA 1XFVO 1XFZO 1XFRA 3CTNA 2OTGC 3PLFB 1F4OA 1SL7A 2TN4A 1CTRA 2KAVA 1S5GY 1F71A 2WC8A 3CDNA 4MZLA 2JPTA 1WLMA 4ZCUA 1QASA 2WCFA 3OX5A 1CMFA 3CLNA 4MBEA 4PE1A 4P5OE 1YX7A 2K7CA 4JWQA 4OV2A 3RLZA 3A8RA 3V2LA 4DS7A 4GFTA 4M2QA 1SKTA 3PN7B 2KFFA 1D1OA 3RZSA 1AUIB 1OOFA 1AHRA 1M46A 1YVHA 2DOQA 4HRHA 3S0DA 4IJ7A 1PULA 1IJ6A 3JTDB 2MJWB 1NX3A 2CCMA 3KEVA 1QVIZ 2LM5A 1EJ3A 1J1DA 1M39A 3D77A 4MN0A 1QV0A 1W9ZA 1K9KA 2WCMA 1Z2CB 1JWDA 3I5FC 2MLFC 2KI4C 4ORBB 2KI6C 2MA2A 3OX6A 5HLOA 2GV5A 1F54A 2LVKA 2LP3A 3JVTC 2F8PA 3TZ1A 3SG2A 5D3OA 3DVJA 1PSRA 4GGNA 4D1EA 4F0ZB 1T14A 4TNCA 1QVIY 1QIVA 2ZNDA 2V53A 4UPGA 2KGBC 1OZSA 3SG6A 1S6CA 2VRGA 4HSZA 5KTYA 1OZOA 4F7FA 1B9AA 1QLSA 2P6BB 1XO5A 3KO0A 5G08A 1CMGA 5PALA 5KU1A 4M2PA 3I5HB 1OMVA 4MVFA 1H8BA 1IQ3A 3QMEA 1QIWA 3DXLA 2LV7A 2ZKMX 1XK4C 2F3ZA 4MRXA 3L47A 1DEKA 1B7TY 1RROA 5HLVA 2LMVA 3SG4A 2H2KA 1YURA 4MRYA 3FE8A 1RFJA 3DVEA 5DKQA 2K2FA 1CDMA 5I94A 1CLMA 3CGAA 1XA5A 3WNXB 2GTEA 1BODA 4P2YB 1WLZA 1XFUO 4A4BA 2O60A 2M1UA 3AKBA 1WDCC 5AXIA 2JT3A 2L5XB 4FQTA 2WCKA 1B8LA 1KCYA 2BBNA 1CM1A 1WRZA 2F2OA 2FCDA 2CBLA 3C1VA 1NYAA 1DF0A 3CZ1A 3JVTB 2JNFA 3D0YA 1KWOB 3EKHA 5DKRA 2Q4UA 3VRRA 1BLQA 1IH0A 4GGFC 1XVJA 1S3PA 1VRKA 2Y1NA 1FI5A 1MWNA 1W7IB 3N7HA 3KPXA 5FI2A 1B1GA 1JFJA 2L2CA 1IGVA 2ERBA 2KBMA 4QJ5B 1C07A 1SCVA 1L2OB 3R1VA 1SNLA 4GAOA 2KAYA 4E68A 1Y1AA 3BFHA 4ORCB 1P28A 2WCEA 3D10A 3DD4A 3NSKA 5J3XA 1YRTB 3A4UB 3AAJA 2WCJA 1QJTA 2K7BA 2EHBA 2ZN8A 1M45A 1J55A 5BPJA 3NXAA 2RGIA 2MRDA 1E8AA 2PASA 1NCZA 4YGBB 4C0LA 1TTXA 2Y4QA 1SR6C 2KGRA 3VRNA 4CFQA 1DGUA 3LCPC 1XFYO 1CFPA 1N65A 2JTTA 1TUJA 3LK0A 1KK8C 2JTZA 1KSOA 2BECA 3ICBA 5K89A 3NSIA 3R1PA 2Q91A 3IQQA 1AJ4A 4OKHA 2P71A 1CB1A 4DCKA 1RTP1 3O78A 2D8NA 2HQ8A 5DICA 4PE4A 1B8RA 5KSZA 3SG5A 2FOTA 1S1EA 1CDNA 1UHNA 1IIOA 1CLLA 1QX5B 5JOLA 1ZFSA 3PFVA 3DVKA 4PT1A 2JRFA 3SIBA 1SBJA 2L51A 3EVRA 1LS8A 1WRKA 1SCMC 2L50A 2SCPA 4L9MA 1U5IA 2QACA 4YBHB 4DIRA 1F55A 5TNCA 1LINA 1ZUZA 2Y1MA 3I5IC 2GGZA 4AQIA 1DJWA 3TDIA 1UURA 1K8UA 1ALVA
chains in the Genus database with same CATH topology
1BR1B 2MLEC 4MEWA 3FIAA 2M1KB 2K7OA 5F6TA 4PHMA 1WY9A 1DT7B 2K7DA 2BL0C 5AANA 3TUYB 1PVAA 1CFCA 5B8IB 2KSPA 2L4IA 1Y0VH 3BUXB 1C7VA 1QXPA 1JF0A 2BBMA 1DTLA 3CR5X 3EK7A 1A2XA 1N2DA 1J7OA 1R6PA 3HCMA 4C0KA 1NP8A 1S6IA 2KQ6A 5ER5A 4ETOA 3CZTX 1SK6D 2LLTA 2KAXA 2M9GA 2BKHB 4I5JA 4GUKA 1SPYA 4A4CA 2LMTA 4I5NB 1DJZA 1CDPA 2SASA 1QATA 2EC6C 4CLNA 1MHOA 5CPVA 3DF0B 4QJ4B 5GQQC 2BCBA 5CSFA 4XYNA 4BY4A 1IG5A 2KFGA 2LUCA 2OTGB 1J1EA 1SCMB 2LVJA 4Q04A 5I8NA 2OS8C 1B47A 1B8CA 2ZRTA 1TCFA 4MSPA 3TS5C 1RECA 2B1UA 2LANA 1KQMC 1LXFC 4YRUA 2M0RA 5I2QA 2I2RE 4IL1A 1NX1A 2NCOA 1KK7Z 4PDZA 3SG7A 1ALWA 4M2OA 2KNEA 2BL0B 1G4YR 2LLUA 4C0JA 1PRWA 2R2IA 3IQOA 3OB1B 1A03A 2LLSA 4OCIA 1EH2A 2CXJA 1K9UA 1IKUA 1FW4A 3EKJA 3FWBA 1CLBA 3LK1A 1SL9A 3O2PA 1PVBA 1NX2A 1UWOA 1UHHA 1X02A 2JULA 3I5GC 3VGOA 1PK0D 4YGCB 3OHMB 2JXCA 2KQYA 2LVVA 1KK7Y 3I5FB 4XJKA 2KI4B 3CWGA 1QX7A 1IRJA 3VRPA 1KFUL 1S26D 3EVUA 3K21A 1J7PA 1TCOB 1YX8A 2ISDA 3BUWB 3E3RA 1BOCA 1TOPA 1WRLA 1KSMA 3NSLA 2H61A 4YGAA 2M3WA 2M8UA 2I94A 1SYMA 4WQ2A 4MZJA 2CT9A 2IS9A 1SW8A 4YGEB 1KFUS 2LUXA 3FS7A 1EL4A 1S6JA 1NUBA 1DJGA 2A4JA 1QTXA 5HKYA 1MR8A 1W7JB 2HPSA 1DJHA 1YUSA 2LCPA 2NLNA 3WHTB 2I7AA 1QS7A 4YGDB 1QLKA 1N0YA 1K93D 3SG3A 1G8IA 2L2EA 1UP5A 4PHJA 1BG1A 2MHHA 3BOWB 3PATA 1FF1A 1MQ1A 1XFXO 2WORA 4PHKA 1A75B 1JSAA 1TNXA 1OE9B 2M29A 1YUTA 3SJSA 1PALA 1CFDA 2LC5A 1AK8A 1IWQA 2PVBA 3AKAA 5CSJA 1F8HA 1NIWA 3BYAA 2M49B 1WDCB 1AP4A 1XK4A 4PHNA 2KHNA 1AVSA 1LA0A 5I2OA 3GK4X 1MUXA 1DGVA 2JXLA 1AJ5A 1Y6WA 1NX0A 2LHIA 1DJIA 2G9BA 1YR5A 2K0JA 4OVNF 2K8MB 2BKIB 3AAKA 1RJVA 2JU0A 2MAZA 1MF8B 3PALA 1J7RA 1NCYA 2JOJA 1KFXS 2HETA 1OMRA 3BUNB 3WXAA 1S36A 4NDDA 4HRGA 5FYXA 4U8DA 2KBIA 2L98A 2F33A 2L0PA 1S5GZ 2JT8A 1CDLA 3CR2A 1UHKA 2E6WA 3HX4A 2QPTA 1FPWA 1JC2A 1Y1XA 1K2HA 1U5IB 1GGWA 1OSAA 3BXKA 4FTGA 1ZACA 1SR6B 2GGMA 1ZOTB 5AFPA 1CFFA 2ZNEA 3NSOA 1K95A 4WQ3A 1CNPA 1UUSA 2M7NA 1IJ5A 1IQ5A 4HREE 4NDBA 1KK8B 2K61A 1MXEA 3CR4X 1UHJA 2ZFDA 1F4QA 5D69A 5I2LA 3BQ3A 1QX2A 2ZN9A 4PALA 1JBAA 3KHEA 1TN4A 1PSBA 1GJYA 2BE6A 2KYCA 4MLWA 2JC2A 2NZ0A 4N5XA 1C7WA 1J7QA 1BT6A 3M0WA 1DJXA 1OOJA 2HQWA 2WCBA 3I5HC 1TRFA 1HT9A 4AOMA 5IBWA 1RK9A 3BUOB 1BF5A 2LP2A 2WNDA 3GK1A 1F70A 2HF5A 2CNPA 2LNKA 1GQMA 3H4SE 1R2UA 3WHUB 1TNQA 2FJUB 2KI6D 3EK8A 3GOFA 2ZRSA 4BY5A 4YI9A 3PSRA 1BJFA 2JWWA 2COLB 2MBXA 4JQ0D 4NDCA 1KQVA 5HYDA 3I5IB 2H61C 2JZIA 3DF0A 3VRQA 1K9PA 1QV1A 2LVIA 3O6BA 3TDZA 1LVCD 3QRXA 5CSIA 1K90D 2KYFA 1OQPA 5JJGA 1TNWA 2EGDA 3BUMB 4GPLB 1UHIA 2JQ6A 4R1EA 2JT0A 2KFHA 4NQGA 3F45A 4ORAB 3LL8B 4CPVA 1K96A 1KWOC 1RWYA 5HKWA 1NSHA 1B7TZ 2PALA 2KOTA 1SL8A 1LA3A 3MSEB 1L2OC 1MXLC 1GGZA 1BMOA 4USLA 1OMDA 2CTNA 3FWCA 4WRIA 2AUCA 2EC6B 4MZKA 3CS1A 1EG4A 2WOSA 4XJKB 1V1GA 3TDUA 2F2PA 2NCPA 2BCAA 2Y5IA 2F3YA 1DF0B 3RM1A 3D0YB 5ER4X 1FI6A 1SY9A 2AAOA 2M97A 2OS8B 1XFWO 3TS5B 4GBAA 4JPZB 1SMGA 1YUUA 2I18A 1KQMB 1EXRA 3EVVA 1LKJA 1ODBA 1A29A 2JNXA 1V1FA 4PCWA 4ICBA 1M63B 3OP0A 1XYDA 4DRWA 4YI8A 1A4PA 4PE0A 4ZCVA 3VROA 1JFKA 4PE7A 2BE4A 3KF9A 2NXQA 1NCXA 2LAPA 1DMOA 2KDHA 2LMUA 1CKKA 1B4CA 3I5GB 2LE9B 4CFRA 1JUOA 2PRUA 3OB2B 1HQVA 1YRUB 1Q80A 1KFXL 3IF7A 1BU3A 5DKNA 1NPQA 2PSRA 1Y1UA 3BOWA 1M31A 1YVLA 1SRAA 1A75A 3GK2A 4AQJA 1NWDA 2L4HA 1TIZA 3DVMA 1K94A 2G2BA 3ZNIA 3SIAA 3EK4A 3TUYC 3PN7C 5D7FA 2FCEA 4N1FA 1TNPA 2LHLA 3O4YA 3JTDC 2M7LA 1G33A 2BCXA 1FBVA 4CIDA 1EG3A 1DJYA 2E30A 3LLEA 4QJ3B 4GGFA 4FQOA 5AEQA 5CSNA 1JF2A 2PMYA 4I5KA 1L7ZA 3ZWHA 3PM8A 2O5GA 4OR9B 4GNKB 4I5LB 2AMIA 4DUQA 1BR4B 1H4BA 2K2AA 4N1GA 5AERA 2OPOA 1CM4A 1ZMZA 5HKZA 1YTZC 1DVIA 1XFVO 1XFZO 3CTNA 3PLFB 2OTGC 1F4OA 1SL7A 2TN4A 1CTRA 2KAVA 1S5GY 1F71A 2WC8A 4MZLA 2JPTA 1WLMA 4ZCUA 1QASA 2WCFA 3OX5A 1CMFA 3CLNA 4MBEA 4PE1A 4P5OE 1YX7A 2K7CA 4JWQA 4OV2A 3RLZA 3A8RA 4DS7A 4GFTA 4M2QA 1SKTA 3PN7B 2KFFA 1D1OA 1AUIB 1AHRA 1M46A 1YVHA 2DOQA 4HRHA 1PULA 1IJ6A 3JTDB 2MJWB 1NX3A 2CCMA 3KEVA 1QVIZ 2LM5A 1EJ3A 1J1DA 1M39A 4MN0A 1QV0A 1K9KA 1JWDA 3I5FC 2MLFC 2KI4C 4ORBB 2KI6C 2MA2A 3OX6A 5HLOA 2GV5A 1F54A 2LVKA 2LP3A 3JVTC 2F8PA 3TZ1A 3SG2A 3DVJA 1PSRA 4GGNA 4D1EA 4F0ZB 4TNCA 1QVIY 1QIVA 2ZNDA 2V53A 4UPGA 2KGBC 1OZSA 3SG6A 1S6CA 2VRGA 4HSZA 5KTYA 1OZOA 1B9AA 1QLSA 2P6BB 1XO5A 3KO0A 5G08A 1CMGA 5PALA 5KU1A 4M2PA 3I5HB 1OMVA 4MVFA 1H8BA 1IQ3A 1QIWA 2LV7A 2ZKMX 1XK4C 2F3ZA 4MRXA 1B7TY 1RROA 5HLVA 2LMVA 3SG4A 2H2KA 1YURA 4MRYA 5DKQA 1RFJA 3DVEA 2K2FA 1CDMA 1CLMA 3CGAA 1XA5A 3WNXB 1BODA 4P2YB 1WLZA 1XFUO 4A4BA 2O60A 2M1UA 3AKBA 1WDCC 5AXIA 2JT3A 2L5XB 1B8LA 1KCYA 2BBNA 1CM1A 1WRZA 2F2OA 2FCDA 2CBLA 3C1VA 1NYAA 1DF0A 3JVTB 5DKRA 2JNFA 3D0YA 1KWOB 3EKHA 3VRRA 2Q4UA 1BLQA 1IH0A 4GGFC 1XVJA 1S3PA 1VRKA 2Y1NA 1FI5A 1MWNA 1W7IB 1B1GA 3KPXA 1JFJA 1IGVA 2KBMA 4QJ5B 1C07A 1SCVA 1L2OB 1SNLA 4GAOA 2KAYA 4E68A 1Y1AA 4ORCB 2WCEA 3D10A 3DD4A 3NSKA 5J3XA 1YRTB 3A4UB 3AAJA 1QJTA 2K7BA 2EHBA 2ZN8A 1M45A 1J55A 5BPJA 3NXAA 2RGIA 2MRDA 1E8AA 2PASA 1NCZA 4YGBB 4C0LA 1TTXA 2Y4QA 1SR6C 2KGRA 3VRNA 4CFQA 1DGUA 3LCPC 1XFYO 1CFPA 1N65A 2JTTA 3LK0A 1KK8C 2JTZA 1KSOA 2BECA 3ICBA 5K89A 3NSIA 2Q91A 3IQQA 1AJ4A 4OKHA 1CB1A 4DCKA 1RTP1 3O78A 2D8NA 2HQ8A 4PE4A 1B8RA 5KSZA 3SG5A 2FOTA 1S1EA 1CDNA 1UHNA 1CLLA 1QX5B 5JOLA 1ZFSA 3PFVA 3DVKA 2JRFA 3SIBA 1SBJA 2L51A 3EVRA 1WRKA 2L50A 1SCMC 4YBHB 2SCPA 4L9MA 1U5IA 2QACA 4DIRA 1F55A 5TNCA 1LINA 1ZUZA 2Y1MA 3I5IC 2GGZA 4AQIA 1DJWA 3TDIA 1UURA 1K8UA 1ALVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR1 B;  2MLE C;  4MEW A;  3FIA A;  2M1K B;  2K7O A;  5F6T A;  4PHM A;  1WY9 A;  1DT7 B;  2K7D A;  2BL0 C;  5AAN A;  3TUY B;  1PVA A;  1CFC A;  5B8I B;  2KSP A;  2L4I A;  1Y0V H;  3BUX B;  1C7V A;  1QXP A;  1JF0 A;  2BBM A;  1DTL A;  3CR5 X;  3EK7 A;  1A2X A;  1N2D A;  1J7O A;  1R6P A;  3HCM A;  4C0K A;  1NP8 A;  1S6I A;  2KQ6 A;  5ER5 A;  4ETO A;  3CZT X;  1SK6 D;  2LLT A;  2KAX A;  2M9G A;  2BKH B;  4I5J A;  4GUK A;  1SPY A;  4A4C A;  2LMT A;  4I5N B;  1DJZ A;  1CDP A;  2SAS A;  1QAT A;  2EC6 C;  4CLN A;  1MHO A;  5CPV A;  3DF0 B;  4QJ4 B;  5GQQ C;  2BCB A;  5CSF A;  4XYN A;  4BY4 A;  1IG5 A;  2KFG A;  2LUC A;  2OTG B;  1J1E A;  1SCM B;  2LVJ A;  4Q04 A;  5I8N A;  2OS8 C;  1B47 A;  1B8C A;  2ZRT A;  1TCF A;  4MSP A;  3TS5 C;  1REC A;  2B1U A;  2LAN A;  1KQM C;  1LXF C;  4YRU A;  2M0R A;  5I2Q A;  2I2R E;  4IL1 A;  1NX1 A;  2NCO A;  1KK7 Z;  4PDZ A;  3SG7 A;  1ALW A;  4M2O A;  2KNE A;  2BL0 B;  1G4Y R;  2LLU A;  4C0J A;  1PRW A;  2R2I A;  3IQO A;  3OB1 B;  1A03 A;  2LLS A;  4OCI A;  1EH2 A;  2CXJ A;  1K9U A;  1IKU A;  1FW4 A;  3EKJ A;  3FWB A;  1CLB A;  3LK1 A;  1SL9 A;  3O2P A;  1PVB A;  1NX2 A;  1UWO A;  1UHH A;  1X02 A;  2JUL A;  3I5G C;  3VGO A;  1PK0 D;  4YGC B;  3OHM B;  2JXC A;  2KQY A;  2LVV A;  1KK7 Y;  3I5F B;  4XJK A;  2KI4 B;  3CWG A;  1QX7 A;  1IRJ A;  3VRP A;  1KFU L;  1S26 D;  3EVU A;  3K21 A;  1J7P A;  1TCO B;  1YX8 A;  2ISD A;  3BUW B;  3E3R A;  1BOC A;  1TOP A;  1WRL A;  1KSM A;  3NSL A;  2H61 A;  4YGA A;  2M3W A;  2M8U A;  2I94 A;  1SYM A;  4WQ2 A;  4MZJ A;  2CT9 A;  2IS9 A;  1SW8 A;  4YGE B;  1KFU S;  2LUX A;  3FS7 A;  1EL4 A;  1S6J A;  1NUB A;  1DJG A;  2A4J A;  1QTX A;  5HKY A;  1MR8 A;  1W7J B;  2HPS A;  1DJH A;  1YUS A;  2LCP A;  2NLN A;  3WHT B;  2I7A A;  1QS7 A;  4YGD B;  1QLK A;  1N0Y A;  1K93 D;  3SG3 A;  1G8I A;  2L2E A;  1UP5 A;  4PHJ A;  1BG1 A;  2MHH A;  3BOW B;  3PAT A;  1FF1 A;  1MQ1 A;  1XFX O;  2WOR A;  4PHK A;  1A75 B;  1JSA A;  1TNX A;  1OE9 B;  2M29 A;  1YUT A;  3SJS A;  1PAL A;  1CFD A;  2LC5 A;  1AK8 A;  1IWQ A;  2PVB A;  3AKA A;  5CSJ A;  1F8H A;  1NIW A;  3BYA A;  2M49 B;  1WDC B;  1AP4 A;  1XK4 A;  4PHN A;  2KHN A;  1AVS A;  1LA0 A;  5I2O A;  3GK4 X;  1MUX A;  1DGV A;  2JXL A;  1AJ5 A;  1Y6W A;  1NX0 A;  2LHI A;  1DJI A;  2G9B A;  1YR5 A;  2K0J A;  4OVN F;  2K8M B;  2BKI B;  3AAK A;  1RJV A;  2JU0 A;  2MAZ A;  1MF8 B;  3PAL A;  1J7R A;  1NCY A;  2JOJ A;  1KFX S;  2HET A;  1OMR A;  3BUN B;  3WXA A;  1S36 A;  4NDD A;  4HRG A;  5FYX A;  4U8D A;  2KBI A;  2L98 A;  2F33 A;  2L0P A;  1S5G Z;  2JT8 A;  1CDL A;  3CR2 A;  1UHK A;  2E6W A;  3HX4 A;  2QPT A;  1FPW A;  1JC2 A;  1Y1X A;  1K2H A;  1U5I B;  1GGW A;  1OSA A;  3BXK A;  4FTG A;  1ZAC A;  1SR6 B;  2GGM A;  1ZOT B;  5AFP A;  1CFF A;  2ZNE A;  3NSO A;  1K95 A;  4WQ3 A;  1CNP A;  1UUS A;  2M7N A;  1IJ5 A;  1IQ5 A;  4HRE E;  4NDB A;  1KK8 B;  2K61 A;  1MXE A;  3CR4 X;  1UHJ A;  2ZFD A;  1F4Q A;  5D69 A;  5I2L A;  3BQ3 A;  1QX2 A;  2ZN9 A;  4PAL A;  1JBA A;  3KHE A;  1TN4 A;  1PSB A;  1GJY A;  2BE6 A;  2KYC A;  4MLW A;  2JC2 A;  2NZ0 A;  4N5X A;  1C7W A;  1J7Q A;  1BT6 A;  3M0W A;  1DJX A;  1OOJ A;  2HQW A;  2WCB A;  3I5H C;  1TRF A;  1HT9 A;  4AOM A;  5IBW A;  1RK9 A;  3BUO B;  1BF5 A;  2LP2 A;  2WND A;  3GK1 A;  1F70 A;  2HF5 A;  2CNP A;  2LNK A;  1GQM A;  3H4S E;  1R2U A;  3WHU B;  1TNQ A;  2FJU B;  2KI6 D;  3EK8 A;  3GOF A;  2ZRS A;  4BY5 A;  4YI9 A;  3PSR A;  1BJF A;  2JWW A;  2COL B;  2MBX A;  4JQ0 D;  4NDC A;  1KQV A;  5HYD A;  3I5I B;  2H61 C;  2JZI A;  3DF0 A;  3VRQ A;  1K9P A;  1QV1 A;  2LVI A;  3O6B A;  3TDZ A;  1LVC D;  3QRX A;  5CSI A;  1K90 D;  2KYF A;  1OQP A;  5JJG A;  1TNW A;  2EGD A;  3BUM B;  4GPL B;  1UHI A;  2JQ6 A;  4R1E A;  2JT0 A;  2KFH A;  4NQG A;  3F45 A;  4ORA B;  3LL8 B;  4CPV A;  1K96 A;  1KWO C;  1RWY A;  5HKW A;  1NSH A;  1B7T Z;  2PAL A;  2KOT A;  1SL8 A;  1LA3 A;  3MSE B;  1L2O C;  1MXL C;  1GGZ A;  1BMO A;  4USL A;  1OMD A;  2CTN A;  3FWC A;  4WRI A;  2AUC A;  2EC6 B;  4MZK A;  3CS1 A;  1EG4 A;  2WOS A;  4XJK B;  1V1G A;  3TDU A;  2F2P A;  2NCP A;  2BCA A;  2Y5I A;  2F3Y A;  1DF0 B;  3RM1 A;  3D0Y B;  5ER4 X;  1FI6 A;  1SY9 A;  2AAO A;  2M97 A;  2OS8 B;  1XFW O;  3TS5 B;  4GBA A;  4JPZ B;  1SMG A;  1YUU A;  2I18 A;  1KQM B;  1EXR A;  3EVV A;  1LKJ A;  1ODB A;  1A29 A;  2JNX A;  1V1F A;  4PCW A;  4ICB A;  1M63 B;  3OP0 A;  1XYD A;  4DRW A;  4YI8 A;  1A4P A;  4PE0 A;  4ZCV A;  3VRO A;  1JFK A;  4PE7 A;  2BE4 A;  3KF9 A;  2NXQ A;  1NCX A;  2LAP A;  1DMO A;  2KDH A;  2LMU A;  1CKK A;  1B4C A;  3I5G B;  2LE9 B;  4CFR A;  1JUO A;  2PRU A;  3OB2 B;  1HQV A;  1YRU B;  1Q80 A;  1KFX L;  3IF7 A;  1BU3 A;  5DKN A;  1NPQ A;  2PSR A;  1Y1U A;  3BOW A;  1M31 A;  1YVL A;  1SRA A;  1A75 A;  3GK2 A;  4AQJ A;  1NWD A;  2L4H A;  1TIZ A;  3DVM A;  1K94 A;  2G2B A;  3ZNI A;  3SIA A;  3EK4 A;  3TUY C;  3PN7 C;  5D7F A;  2FCE A;  4N1F A;  1TNP A;  2LHL A;  3O4Y A;  3JTD C;  2M7L A;  1G33 A;  2BCX A;  1FBV A;  4CID A;  1EG3 A;  1DJY A;  2E30 A;  3LLE A;  4QJ3 B;  4GGF A;  4FQO A;  5AEQ A;  5CSN A;  1JF2 A;  2PMY A;  4I5K A;  1L7Z A;  3ZWH A;  3PM8 A;  2O5G A;  4OR9 B;  4GNK B;  4I5L B;  2AMI A;  4DUQ A;  1BR4 B;  1H4B A;  2K2A A;  4N1G A;  5AER A;  2OPO A;  1CM4 A;  1ZMZ A;  5HKZ A;  1YTZ C;  1DVI A;  1XFV O;  1XFZ O;  3CTN A;  3PLF B;  2OTG C;  1F4O A;  1SL7 A;  2TN4 A;  1CTR A;  2KAV A;  1S5G Y;  1F71 A;  2WC8 A;  4MZL A;  2JPT A;  1WLM A;  4ZCU A;  1QAS A;  2WCF A;  3OX5 A;  1CMF A;  3CLN A;  4MBE A;  4PE1 A;  4P5O E;  1YX7 A;  2K7C A;  4JWQ A;  4OV2 A;  3RLZ A;  3A8R A;  4DS7 A;  4GFT A;  4M2Q A;  1SKT A;  3PN7 B;  2KFF A;  1D1O A;  1AUI B;  1AHR A;  1M46 A;  1YVH A;  2DOQ A;  4HRH A;  1PUL A;  1IJ6 A;  3JTD B;  2MJW B;  1NX3 A;  2CCM A;  3KEV A;  1QVI Z;  2LM5 A;  1EJ3 A;  1J1D A;  1M39 A;  4MN0 A;  1QV0 A;  1K9K A;  1JWD A;  3I5F C;  2MLF C;  2KI4 C;  4ORB B;  2KI6 C;  2MA2 A;  3OX6 A;  5HLO A;  2GV5 A;  1F54 A;  2LVK A;  2LP3 A;  3JVT C;  2F8P A;  3TZ1 A;  3SG2 A;  3DVJ A;  1PSR A;  4GGN A;  4D1E A;  4F0Z B;  4TNC A;  1QVI Y;  1QIV A;  2ZND A;  2V53 A;  4UPG A;  2KGB C;  1OZS A;  3SG6 A;  1S6C A;  2VRG A;  4HSZ A;  5KTY A;  1OZO A;  1B9A A;  1QLS A;  2P6B B;  1XO5 A;  3KO0 A;  5G08 A;  1CMG A;  5PAL A;  5KU1 A;  4M2P A;  3I5H B;  1OMV A;  4MVF A;  1H8B A;  1IQ3 A;  1QIW A;  2LV7 A;  2ZKM X;  1XK4 C;  2F3Z A;  4MRX A;  1B7T Y;  1RRO A;  5HLV A;  2LMV A;  3SG4 A;  2H2K A;  1YUR A;  4MRY A;  5DKQ A;  1RFJ A;  3DVE A;  2K2F A;  1CDM A;  1CLM A;  3CGA A;  1XA5 A;  3WNX B;  1BOD A;  4P2Y B;  1WLZ A;  1XFU O;  4A4B A;  2O60 A;  2M1U A;  3AKB A;  1WDC C;  5AXI A;  2JT3 A;  2L5X B;  1B8L A;  1KCY A;  2BBN A;  1CM1 A;  1WRZ A;  2F2O A;  2FCD A;  2CBL A;  3C1V A;  1NYA A;  1DF0 A;  3JVT B;  5DKR A;  2JNF A;  3D0Y A;  1KWO B;  3EKH A;  3VRR A;  2Q4U A;  1BLQ A;  1IH0 A;  4GGF C;  1XVJ A;  1S3P A;  1VRK A;  2Y1N A;  1FI5 A;  1MWN A;  1W7I B;  1B1G A;  3KPX A;  1JFJ A;  1IGV A;  2KBM A;  4QJ5 B;  1C07 A;  1SCV A;  1L2O B;  1SNL A;  4GAO A;  2KAY A;  4E68 A;  1Y1A A;  4ORC B;  2WCE A;  3D10 A;  3DD4 A;  3NSK A;  5J3X A;  1YRT B;  3A4U B;  3AAJ A;  1QJT A;  2K7B A;  2EHB A;  2ZN8 A;  1M45 A;  1J55 A;  5BPJ A;  3NXA A;  2RGI A;  2MRD A;  1E8A A;  2PAS A;  1NCZ A;  4YGB B;  4C0L A;  1TTX A;  2Y4Q A;  1SR6 C;  2KGR A;  3VRN A;  4CFQ A;  1DGU A;  3LCP C;  1XFY O;  1CFP A;  1N65 A;  2JTT A;  3LK0 A;  1KK8 C;  2JTZ A;  1KSO A;  2BEC A;  3ICB A;  5K89 A;  3NSI A;  2Q91 A;  3IQQ A;  1AJ4 A;  4OKH A;  1CB1 A;  4DCK A;  1RTP 1;  3O78 A;  2D8N A;  2HQ8 A;  4PE4 A;  1B8R A;  5KSZ A;  3SG5 A;  2FOT A;  1S1E A;  1CDN A;  1UHN A;  1CLL A;  1QX5 B;  5JOL A;  1ZFS A;  3PFV A;  3DVK A;  2JRF A;  3SIB A;  1SBJ A;  2L51 A;  3EVR A;  1WRK A;  2L50 A;  1SCM C;  4YBH B;  2SCP A;  4L9M A;  1U5I A;  2QAC A;  4DIR A;  1F55 A;  5TNC A;  1LIN A;  1ZUZ A;  2Y1M A;  3I5I C;  2GGZ A;  4AQI A;  1DJW A;  3TDI A;  1UUR A;  1K8U A;  1ALV A; 
#chains in the Genus database with same CATH topology
 1BR1 B;  2MLE C;  4MEW A;  3FIA A;  2M1K B;  2K7O A;  2H8V A;  3CZ2 A;  1WY9 A;  4PHM A;  5F6T A;  2K7D A;  2KPH A;  1DT7 B;  2BL0 C;  5AAN A;  3TUY B;  5FI7 A;  1PVA A;  1CFC A;  3Q8I A;  2KSP A;  1Z4H A;  5B8I B;  2L4I A;  1Y0V H;  3BUX B;  1C7V A;  1QXP A;  3DZT A;  1JF0 A;  2BBM A;  1DTL A;  3CR5 X;  3EK7 A;  1A2X A;  1N2D A;  1J7O A;  1R6P A;  3HCM A;  4C0K A;  1NP8 A;  1S6I A;  2KQ6 A;  3NHI A;  5ER5 A;  4ETO A;  3CZT X;  1SK6 D;  2LLT A;  2KAX A;  2M9G A;  2BKH B;  4I5J A;  4GUK A;  1SPY A;  4A4C A;  2LMT A;  4I5N B;  1DJZ A;  1CDP A;  2SAS A;  1QAT A;  2EC6 C;  4CLN A;  1MHO A;  5CPV A;  3DF0 B;  1OW4 A;  4QJ4 B;  3NGV A;  5GQQ C;  2BCB A;  5CSF A;  4XYN A;  4BY4 A;  1IG5 A;  2KFG A;  3D76 A;  2LUC A;  3OBV A;  2OTG B;  2BAP A;  1J1E A;  3NHT A;  1SCM B;  2LVJ A;  4Q04 A;  5I8N A;  2OS8 C;  1B47 A;  4INX A;  1B8C A;  2ZRT A;  1TCF A;  4MSP A;  3TS5 C;  1SSE B;  1REC A;  2B1U A;  2LAN A;  1KQM C;  1LXF C;  2QDI A;  4YRU A;  2M0R A;  5I2Q A;  2I2R E;  4IL1 A;  3OGN A;  1NX1 A;  2NCO A;  1KK7 Z;  4PDZ A;  3SG7 A;  1ALW A;  4M2O A;  2KNE A;  4KYN A;  2BL0 B;  1G4Y R;  2LLU A;  4C0J A;  1PRW A;  2R2I A;  3IQO A;  3OB1 B;  1A03 A;  2LLS A;  4OCI A;  1EH2 A;  2CXJ A;  1K9U A;  1IKU A;  2KLD A;  1FW4 A;  3EKJ A;  3FWB A;  1CLB A;  3LK1 A;  1SL9 A;  3O2P A;  1PVB A;  2JPO A;  1NX2 A;  1UWO A;  1OOH A;  1UHH A;  1X02 A;  2JUL A;  3D74 A;  3I5G C;  1C3Z A;  3VGO A;  1PK0 D;  4YGC B;  3OHM B;  2JXC A;  2KQY A;  3FE9 A;  3FE6 A;  2LVV A;  1KK7 Y;  3I5F B;  4XJK A;  2KI4 B;  3CWG A;  1QX7 A;  1IRJ A;  3VRP A;  1KFU L;  1S26 D;  3EVU A;  3K21 A;  1J7P A;  2L5Y A;  1TCO B;  1YX8 A;  2ISD A;  3BUW B;  3E3R A;  2BNX A;  1TOP A;  1BOC A;  3UO9 A;  1WRL A;  1KSM A;  3NSL A;  2H61 A;  4YGA A;  2M3W A;  3O4X A;  2M8U A;  2I94 A;  1SYM A;  4WQ2 A;  4MZJ A;  2CT9 A;  2IS9 A;  1SW8 A;  4YGE B;  1KFU S;  2LUX A;  3FS7 A;  1EL4 A;  1S6J A;  1NUB A;  1DJG A;  2A4J A;  1QTX A;  5HKY A;  1MR8 A;  1W7J B;  2HPS A;  1DJH A;  1YUS A;  2LCP A;  2NLN A;  3WHT B;  2I7A A;  1QS7 A;  4YGD B;  1QLK A;  1N0Y A;  1OOI X;  1K93 D;  3SG3 A;  1G8I A;  2L2E A;  1UP5 A;  4PHJ A;  1BG1 A;  2MHH A;  3BOW B;  3PAT A;  1FF1 A;  1MQ1 A;  1XFX O;  2WOR A;  2PQL A;  1A75 B;  3DYE A;  4PHK A;  3D73 A;  1TNX A;  1JSA A;  1OE9 B;  2M29 A;  3PM2 A;  1YUT A;  3SJS A;  1PAL A;  1CFD A;  2LC5 A;  1AK8 A;  1IWQ A;  2PVB A;  3AKA A;  5CSJ A;  1F8H A;  1NIW A;  3BYA A;  2M49 B;  1WDC B;  1AP4 A;  1GM0 A;  1XK4 A;  4OZD A;  2KHN A;  1AVS A;  1LA0 A;  4PHN A;  5I2O A;  3GK4 X;  1MUX A;  1DGV A;  3R1O A;  2JXL A;  1AJ5 A;  1Y6W A;  1NX0 A;  2LHI A;  1DJI A;  3S0A A;  1C3Y A;  2G9B A;  1YR5 A;  2K0J A;  4OVN F;  2K8M B;  2BKI B;  3AAK A;  3S0G A;  1RJV A;  2JU0 A;  2MAZ A;  1MF8 B;  3PAL A;  1J7R A;  1NCY A;  2JOJ A;  1KFX S;  2HET A;  1OMR A;  3BUN B;  3WXA A;  1S36 A;  2WC6 A;  5HL1 A;  4NDD A;  3CAB A;  4HRG A;  5FYX A;  3S0E A;  4U8D A;  2KBI A;  2L98 A;  2F33 A;  3PJI A;  2L0P A;  1S5G Z;  2JT8 A;  1CDL A;  3CR2 A;  1UHK A;  2E6W A;  3HX4 A;  2QPT A;  1FPW A;  3B88 A;  3BFB A;  1Y1X A;  1JC2 A;  1K2H A;  1U5I B;  1GGW A;  1OSA A;  3DY9 A;  3BXK A;  4FTG A;  1ZAC A;  1SR6 B;  2GGM A;  1ZOT B;  5AFP A;  1CFF A;  2ZNE A;  3NSO A;  1K95 A;  4WQ3 A;  1CNP A;  1UUS A;  2M7N A;  1IJ5 A;  1IQ5 A;  4HRE E;  4NDB A;  1KK8 B;  1TUZ A;  1MXE A;  2K61 A;  1UHJ A;  2ZFD A;  3CR4 X;  1F4Q A;  5D69 A;  5I2L A;  3BQ3 A;  4JD9 A;  1QX2 A;  2ZN9 A;  4PAL A;  1JBA A;  3KHE A;  3BJH A;  1TN4 A;  1PSB A;  1GJY A;  2BE6 A;  5FI6 A;  2WCL A;  2KYC A;  4MLW A;  2JC2 A;  2NZ0 A;  4N5X A;  1C7W A;  1J7Q A;  1BT6 A;  3M0W A;  3R72 A;  1DJX A;  1OOJ A;  2HQW A;  1ORG A;  2WCB A;  1TRF A;  3I5H C;  1HT9 A;  3D78 A;  4AOM A;  5IBW A;  1RK9 A;  2YGU A;  2FJY A;  3BUO B;  3D75 A;  1BF5 A;  2LP2 A;  2WND A;  3GK1 A;  1F70 A;  2HF5 A;  2CNP A;  2LNK A;  1GQM A;  3H4S E;  1R2U A;  3WHU B;  1TNQ A;  2FJU B;  2KI6 D;  3EK8 A;  3GOF A;  1DQE A;  2ZRS A;  4BY5 A;  4YI9 A;  3PSR A;  1BJF A;  5EL2 A;  2JWW A;  2COL B;  2MBX A;  4JQ0 D;  4NDC A;  1KQV A;  3SS5 A;  5HYD A;  3I5I B;  2H61 C;  2JZI A;  3DF0 A;  3S0F A;  3VRQ A;  1K9P A;  1QV1 A;  2LVI A;  3O6B A;  3TDZ A;  1LVC D;  3QRX A;  5CSI A;  1K90 D;  2KYF A;  1OQP A;  2QEO A;  1TNW A;  5JJG A;  2EGD A;  3BUM B;  4GPL B;  1UHI A;  2JQ6 A;  4R1E A;  2JT0 A;  2KFH A;  4NQG A;  3F45 A;  4ORA B;  3LL8 B;  4CPV A;  1K96 A;  1KWO C;  1RWY A;  5HKW A;  1NSH A;  1B7T Z;  2PAL A;  2KOT A;  1SL8 A;  1LA3 A;  3MSE B;  1L2O C;  2PYQ A;  1MXL C;  1GGZ A;  1BMO A;  1DC1 A;  2QEH A;  1OOG A;  4USL A;  3BFA A;  1OMD A;  2CTN A;  3FWC A;  4WRI A;  2AUC A;  2EC6 B;  4MZK A;  3CS1 A;  1EG4 A;  2WOS A;  3VB1 A;  4XJK B;  1V1G A;  3TDU A;  2F2P A;  2NCP A;  2BCA A;  2Y5I A;  2F3Y A;  3B6X A;  1DF0 B;  3RM1 A;  3D0Y B;  5ER4 X;  1FI6 A;  1SY9 A;  2AAO A;  2M97 A;  2OS8 B;  4JKT A;  1XFW O;  3TS5 B;  4GBA A;  4JPZ B;  1SMG A;  1YUU A;  1TWO A;  2I18 A;  1KQM B;  1EXR A;  3EVV A;  1LKJ A;  1ODB A;  1A29 A;  2JNX A;  1V1F A;  4INW A;  4PCW A;  4ICB A;  1M63 B;  2KLE A;  3S0B A;  3OP0 A;  2QEV A;  1XYD A;  4DRW A;  4YI8 A;  1A4P A;  4PE0 A;  4ZCV A;  3VRO A;  1JFK A;  4PE7 A;  2BE4 A;  3KF9 A;  2NXQ A;  1NCX A;  2LAP A;  1DMO A;  2KDH A;  2LMU A;  3SS4 A;  1CKK A;  1B4C A;  3I5G B;  2LE9 B;  3UNW A;  3CYZ A;  4CFR A;  1JUO A;  2PRU A;  3OB2 B;  1HQV A;  1YRU B;  1Q80 A;  3K1E A;  1KFX L;  3IF7 A;  1BU3 A;  5DKN A;  1NPQ A;  2PSR A;  1Y1U A;  3BOW A;  1M31 A;  1YVL A;  3SS3 A;  1SRA A;  1A75 A;  3GK2 A;  3L4A A;  4AQJ A;  3B86 A;  1NWD A;  2L4H A;  1TIZ A;  3DVM A;  3B7A A;  1K94 A;  2G2B A;  2K60 A;  3ZNI A;  3SIA A;  3EK4 A;  3TUY C;  3PN7 C;  5D7F A;  2FCE A;  4N1F A;  1TNP A;  2LHL A;  1DEL A;  3CZ0 A;  3O4Y A;  1QWV A;  3JTD C;  2M7L A;  1G33 A;  2BCX A;  1FBV A;  2WCH A;  3L4L A;  4CID A;  1EG3 A;  1DJY A;  2E30 A;  2WC5 A;  3LLE A;  4QJ3 B;  3EG5 B;  2QEB A;  2P70 A;  3IVT A;  4GGF A;  4FQO A;  5AEQ A;  5CSN A;  1JF2 A;  2PMY A;  4I5K A;  1L7Z A;  3B87 A;  3ZWH A;  3PM8 A;  2O5G A;  4OR9 B;  4GNK B;  4I5L B;  2AMI A;  4DUQ A;  1BR4 B;  1H4B A;  2K2A A;  4N1G A;  5AER A;  2OPO A;  1CM4 A;  1ZMZ A;  5HKZ A;  1YTZ C;  1DVI A;  1XFV O;  1XFZ O;  1XFR A;  3CTN A;  2OTG C;  3PLF B;  1F4O A;  1SL7 A;  2TN4 A;  1CTR A;  2KAV A;  1S5G Y;  1F71 A;  2WC8 A;  3CDN A;  4MZL A;  2JPT A;  1WLM A;  4ZCU A;  1QAS A;  2WCF A;  3OX5 A;  1CMF A;  3CLN A;  4MBE A;  4PE1 A;  4P5O E;  1YX7 A;  2K7C A;  4JWQ A;  4OV2 A;  3RLZ A;  3A8R A;  3V2L A;  4DS7 A;  4GFT A;  4M2Q A;  1SKT A;  3PN7 B;  2KFF A;  1D1O A;  3RZS A;  1AUI B;  1OOF A;  1AHR A;  1M46 A;  1YVH A;  2DOQ A;  4HRH A;  3S0D A;  4IJ7 A;  1PUL A;  1IJ6 A;  3JTD B;  2MJW B;  1NX3 A;  2CCM A;  3KEV A;  1QVI Z;  2LM5 A;  1EJ3 A;  1J1D A;  1M39 A;  3D77 A;  4MN0 A;  1QV0 A;  1W9Z A;  1K9K A;  2WCM A;  1Z2C B;  1JWD A;  3I5F C;  2MLF C;  2KI4 C;  4ORB B;  2KI6 C;  2MA2 A;  3OX6 A;  5HLO A;  2GV5 A;  1F54 A;  2LVK A;  2LP3 A;  3JVT C;  2F8P A;  3TZ1 A;  3SG2 A;  5D3O A;  3DVJ A;  1PSR A;  4GGN A;  4D1E A;  4F0Z B;  1T14 A;  4TNC A;  1QVI Y;  1QIV A;  2ZND A;  2V53 A;  4UPG A;  2KGB C;  1OZS A;  3SG6 A;  1S6C A;  2VRG A;  4HSZ A;  5KTY A;  1OZO A;  4F7F A;  1B9A A;  1QLS A;  2P6B B;  1XO5 A;  3KO0 A;  5G08 A;  1CMG A;  5PAL A;  5KU1 A;  4M2P A;  3I5H B;  1OMV A;  4MVF A;  1H8B A;  1IQ3 A;  3QME A;  1QIW A;  3DXL A;  2LV7 A;  2ZKM X;  1XK4 C;  2F3Z A;  4MRX A;  3L47 A;  1DEK A;  1B7T Y;  1RRO A;  5HLV A;  2LMV A;  3SG4 A;  2H2K A;  1YUR A;  4MRY A;  3FE8 A;  1RFJ A;  3DVE A;  5DKQ A;  2K2F A;  1CDM A;  5I94 A;  1CLM A;  3CGA A;  1XA5 A;  3WNX B;  2GTE A;  1BOD A;  4P2Y B;  1WLZ A;  1XFU O;  4A4B A;  2O60 A;  2M1U A;  3AKB A;  1WDC C;  5AXI A;  2JT3 A;  2L5X B;  4FQT A;  2WCK A;  1B8L A;  1KCY A;  2BBN A;  1CM1 A;  1WRZ A;  2F2O A;  2FCD A;  2CBL A;  3C1V A;  1NYA A;  1DF0 A;  3CZ1 A;  3JVT B;  2JNF A;  3D0Y A;  1KWO B;  3EKH A;  5DKR A;  2Q4U A;  3VRR A;  1BLQ A;  1IH0 A;  4GGF C;  1XVJ A;  1S3P A;  1VRK A;  2Y1N A;  1FI5 A;  1MWN A;  1W7I B;  3N7H A;  3KPX A;  5FI2 A;  1B1G A;  1JFJ A;  2L2C A;  1IGV A;  2ERB A;  2KBM A;  4QJ5 B;  1C07 A;  1SCV A;  1L2O B;  3R1V A;  1SNL A;  4GAO A;  2KAY A;  4E68 A;  1Y1A A;  3BFH A;  4ORC B;  1P28 A;  2WCE A;  3D10 A;  3DD4 A;  3NSK A;  5J3X A;  1YRT B;  3A4U B;  3AAJ A;  2WCJ A;  1QJT A;  2K7B A;  2EHB A;  2ZN8 A;  1M45 A;  1J55 A;  5BPJ A;  3NXA A;  2RGI A;  2MRD A;  1E8A A;  2PAS A;  1NCZ A;  4YGB B;  4C0L A;  1TTX A;  2Y4Q A;  1SR6 C;  2KGR A;  3VRN A;  4CFQ A;  1DGU A;  3LCP C;  1XFY O;  1CFP A;  1N65 A;  2JTT A;  1TUJ A;  3LK0 A;  1KK8 C;  2JTZ A;  1KSO A;  2BEC A;  3ICB A;  5K89 A;  3NSI A;  3R1P A;  2Q91 A;  3IQQ A;  1AJ4 A;  4OKH A;  2P71 A;  1CB1 A;  4DCK A;  1RTP 1;  3O78 A;  2D8N A;  2HQ8 A;  5DIC A;  4PE4 A;  1B8R A;  5KSZ A;  3SG5 A;  2FOT A;  1S1E A;  1CDN A;  1UHN A;  1IIO A;  1CLL A;  1QX5 B;  5JOL A;  1ZFS A;  3PFV A;  3DVK A;  4PT1 A;  2JRF A;  3SIB A;  1SBJ A;  2L51 A;  3EVR A;  1LS8 A;  1WRK A;  1SCM C;  2L50 A;  2SCP A;  4L9M A;  1U5I A;  2QAC A;  4YBH B;  4DIR A;  1F55 A;  5TNC A;  1LIN A;  1ZUZ A;  2Y1M A;  3I5I C;  2GGZ A;  4AQI A;  1DJW A;  3TDI A;  1UUR A;  1K8U A;  1ALV A; 
#chains in the Genus database with same CATH homology
 1BR1 B;  2MLE C;  4MEW A;  3FIA A;  2M1K B;  2K7O A;  5F6T A;  4PHM A;  1WY9 A;  1DT7 B;  2K7D A;  2BL0 C;  5AAN A;  3TUY B;  1PVA A;  1CFC A;  5B8I B;  2KSP A;  2L4I A;  1Y0V H;  3BUX B;  1C7V A;  1QXP A;  1JF0 A;  2BBM A;  1DTL A;  3CR5 X;  3EK7 A;  1A2X A;  1N2D A;  1J7O A;  1R6P A;  3HCM A;  4C0K A;  1NP8 A;  1S6I A;  2KQ6 A;  5ER5 A;  4ETO A;  3CZT X;  1SK6 D;  2LLT A;  2KAX A;  2M9G A;  2BKH B;  4I5J A;  4GUK A;  1SPY A;  4A4C A;  2LMT A;  4I5N B;  1DJZ A;  1CDP A;  2SAS A;  1QAT A;  2EC6 C;  4CLN A;  1MHO A;  5CPV A;  3DF0 B;  4QJ4 B;  5GQQ C;  2BCB A;  5CSF A;  4XYN A;  4BY4 A;  1IG5 A;  2KFG A;  2LUC A;  2OTG B;  1J1E A;  1SCM B;  2LVJ A;  4Q04 A;  5I8N A;  2OS8 C;  1B47 A;  1B8C A;  2ZRT A;  1TCF A;  4MSP A;  3TS5 C;  1REC A;  2B1U A;  2LAN A;  1KQM C;  1LXF C;  4YRU A;  2M0R A;  5I2Q A;  2I2R E;  4IL1 A;  1NX1 A;  2NCO A;  1KK7 Z;  4PDZ A;  3SG7 A;  1ALW A;  4M2O A;  2KNE A;  2BL0 B;  1G4Y R;  2LLU A;  4C0J A;  1PRW A;  2R2I A;  3IQO A;  3OB1 B;  1A03 A;  2LLS A;  4OCI A;  1EH2 A;  2CXJ A;  1K9U A;  1IKU A;  1FW4 A;  3EKJ A;  3FWB A;  1CLB A;  3LK1 A;  1SL9 A;  3O2P A;  1PVB A;  1NX2 A;  1UWO A;  1UHH A;  1X02 A;  2JUL A;  3I5G C;  3VGO A;  1PK0 D;  4YGC B;  3OHM B;  2JXC A;  2KQY A;  2LVV A;  1KK7 Y;  3I5F B;  4XJK A;  2KI4 B;  3CWG A;  1QX7 A;  1IRJ A;  3VRP A;  1KFU L;  1S26 D;  3EVU A;  3K21 A;  1J7P A;  1TCO B;  1YX8 A;  2ISD A;  3BUW B;  3E3R A;  1BOC A;  1TOP A;  1WRL A;  1KSM A;  3NSL A;  2H61 A;  4YGA A;  2M3W A;  2M8U A;  2I94 A;  1SYM A;  4WQ2 A;  4MZJ A;  2CT9 A;  2IS9 A;  1SW8 A;  4YGE B;  1KFU S;  2LUX A;  3FS7 A;  1EL4 A;  1S6J A;  1NUB A;  1DJG A;  2A4J A;  1QTX A;  5HKY A;  1MR8 A;  1W7J B;  2HPS A;  1DJH A;  1YUS A;  2LCP A;  2NLN A;  3WHT B;  2I7A A;  1QS7 A;  4YGD B;  1QLK A;  1N0Y A;  1K93 D;  3SG3 A;  1G8I A;  2L2E A;  1UP5 A;  4PHJ A;  1BG1 A;  2MHH A;  3BOW B;  3PAT A;  1FF1 A;  1MQ1 A;  1XFX O;  2WOR A;  4PHK A;  1A75 B;  1JSA A;  1TNX A;  1OE9 B;  2M29 A;  1YUT A;  3SJS A;  1PAL A;  1CFD A;  2LC5 A;  1AK8 A;  1IWQ A;  2PVB A;  3AKA A;  5CSJ A;  1F8H A;  1NIW A;  3BYA A;  2M49 B;  1WDC B;  1AP4 A;  1XK4 A;  4PHN A;  2KHN A;  1AVS A;  1LA0 A;  5I2O A;  3GK4 X;  1MUX A;  1DGV A;  2JXL A;  1AJ5 A;  1Y6W A;  1NX0 A;  2LHI A;  1DJI A;  2G9B A;  1YR5 A;  2K0J A;  4OVN F;  2K8M B;  2BKI B;  3AAK A;  1RJV A;  2JU0 A;  2MAZ A;  1MF8 B;  3PAL A;  1J7R A;  1NCY A;  2JOJ A;  1KFX S;  2HET A;  1OMR A;  3BUN B;  3WXA A;  1S36 A;  4NDD A;  4HRG A;  5FYX A;  4U8D A;  2KBI A;  2L98 A;  2F33 A;  2L0P A;  1S5G Z;  2JT8 A;  1CDL A;  3CR2 A;  1UHK A;  2E6W A;  3HX4 A;  2QPT A;  1FPW A;  1JC2 A;  1Y1X A;  1K2H A;  1U5I B;  1GGW A;  1OSA A;  3BXK A;  4FTG A;  1ZAC A;  1SR6 B;  2GGM A;  1ZOT B;  5AFP A;  1CFF A;  2ZNE A;  3NSO A;  1K95 A;  4WQ3 A;  1CNP A;  1UUS A;  2M7N A;  1IJ5 A;  1IQ5 A;  4HRE E;  4NDB A;  1KK8 B;  2K61 A;  1MXE A;  3CR4 X;  1UHJ A;  2ZFD A;  1F4Q A;  5D69 A;  5I2L A;  3BQ3 A;  1QX2 A;  2ZN9 A;  4PAL A;  1JBA A;  3KHE A;  1TN4 A;  1PSB A;  1GJY A;  2BE6 A;  2KYC A;  4MLW A;  2JC2 A;  2NZ0 A;  4N5X A;  1C7W A;  1J7Q A;  1BT6 A;  3M0W A;  1DJX A;  1OOJ A;  2HQW A;  2WCB A;  3I5H C;  1TRF A;  1HT9 A;  4AOM A;  5IBW A;  1RK9 A;  3BUO B;  1BF5 A;  2LP2 A;  2WND A;  3GK1 A;  1F70 A;  2HF5 A;  2CNP A;  2LNK A;  1GQM A;  3H4S E;  1R2U A;  3WHU B;  1TNQ A;  2FJU B;  2KI6 D;  3EK8 A;  3GOF A;  2ZRS A;  4BY5 A;  4YI9 A;  3PSR A;  1BJF A;  2JWW A;  2COL B;  2MBX A;  4JQ0 D;  4NDC A;  1KQV A;  5HYD A;  3I5I B;  2H61 C;  2JZI A;  3DF0 A;  3VRQ A;  1K9P A;  1QV1 A;  2LVI A;  3O6B A;  3TDZ A;  1LVC D;  3QRX A;  5CSI A;  1K90 D;  2KYF A;  1OQP A;  5JJG A;  1TNW A;  2EGD A;  3BUM B;  4GPL B;  1UHI A;  2JQ6 A;  4R1E A;  2JT0 A;  2KFH A;  4NQG A;  3F45 A;  4ORA B;  3LL8 B;  4CPV A;  1K96 A;  1KWO C;  1RWY A;  5HKW A;  1NSH A;  1B7T Z;  2PAL A;  2KOT A;  1SL8 A;  1LA3 A;  3MSE B;  1L2O C;  1MXL C;  1GGZ A;  1BMO A;  4USL A;  1OMD A;  2CTN A;  3FWC A;  4WRI A;  2AUC A;  2EC6 B;  4MZK A;  3CS1 A;  1EG4 A;  2WOS A;  4XJK B;  1V1G A;  3TDU A;  2F2P A;  2NCP A;  2BCA A;  2Y5I A;  2F3Y A;  1DF0 B;  3RM1 A;  3D0Y B;  5ER4 X;  1FI6 A;  1SY9 A;  2AAO A;  2M97 A;  2OS8 B;  1XFW O;  3TS5 B;  4GBA A;  4JPZ B;  1SMG A;  1YUU A;  2I18 A;  1KQM B;  1EXR A;  3EVV A;  1LKJ A;  1ODB A;  1A29 A;  2JNX A;  1V1F A;  4PCW A;  4ICB A;  1M63 B;  3OP0 A;  1XYD A;  4DRW A;  4YI8 A;  1A4P A;  4PE0 A;  4ZCV A;  3VRO A;  1JFK A;  4PE7 A;  2BE4 A;  3KF9 A;  2NXQ A;  1NCX A;  2LAP A;  1DMO A;  2KDH A;  2LMU A;  1CKK A;  1B4C A;  3I5G B;  2LE9 B;  4CFR A;  1JUO A;  2PRU A;  3OB2 B;  1HQV A;  1YRU B;  1Q80 A;  1KFX L;  3IF7 A;  1BU3 A;  5DKN A;  1NPQ A;  2PSR A;  1Y1U A;  3BOW A;  1M31 A;  1YVL A;  1SRA A;  1A75 A;  3GK2 A;  4AQJ A;  1NWD A;  2L4H A;  1TIZ A;  3DVM A;  1K94 A;  2G2B A;  3ZNI A;  3SIA A;  3EK4 A;  3TUY C;  3PN7 C;  5D7F A;  2FCE A;  4N1F A;  1TNP A;  2LHL A;  3O4Y A;  3JTD C;  2M7L A;  1G33 A;  2BCX A;  1FBV A;  4CID A;  1EG3 A;  1DJY A;  2E30 A;  3LLE A;  4QJ3 B;  4GGF A;  4FQO A;  5AEQ A;  5CSN A;  1JF2 A;  2PMY A;  4I5K A;  1L7Z A;  3ZWH A;  3PM8 A;  2O5G A;  4OR9 B;  4GNK B;  4I5L B;  2AMI A;  4DUQ A;  1BR4 B;  1H4B A;  2K2A A;  4N1G A;  5AER A;  2OPO A;  1CM4 A;  1ZMZ A;  5HKZ A;  1YTZ C;  1DVI A;  1XFV O;  1XFZ O;  3CTN A;  3PLF B;  2OTG C;  1F4O A;  1SL7 A;  2TN4 A;  1CTR A;  2KAV A;  1S5G Y;  1F71 A;  2WC8 A;  4MZL A;  2JPT A;  1WLM A;  4ZCU A;  1QAS A;  2WCF A;  3OX5 A;  1CMF A;  3CLN A;  4MBE A;  4PE1 A;  4P5O E;  1YX7 A;  2K7C A;  4JWQ A;  4OV2 A;  3RLZ A;  3A8R A;  4DS7 A;  4GFT A;  4M2Q A;  1SKT A;  3PN7 B;  2KFF A;  1D1O A;  1AUI B;  1AHR A;  1M46 A;  1YVH A;  2DOQ A;  4HRH A;  1PUL A;  1IJ6 A;  3JTD B;  2MJW B;  1NX3 A;  2CCM A;  3KEV A;  1QVI Z;  2LM5 A;  1EJ3 A;  1J1D A;  1M39 A;  4MN0 A;  1QV0 A;  1K9K A;  1JWD A;  3I5F C;  2MLF C;  2KI4 C;  4ORB B;  2KI6 C;  2MA2 A;  3OX6 A;  5HLO A;  2GV5 A;  1F54 A;  2LVK A;  2LP3 A;  3JVT C;  2F8P A;  3TZ1 A;  3SG2 A;  3DVJ A;  1PSR A;  4GGN A;  4D1E A;  4F0Z B;  4TNC A;  1QVI Y;  1QIV A;  2ZND A;  2V53 A;  4UPG A;  2KGB C;  1OZS A;  3SG6 A;  1S6C A;  2VRG A;  4HSZ A;  5KTY A;  1OZO A;  1B9A A;  1QLS A;  2P6B B;  1XO5 A;  3KO0 A;  5G08 A;  1CMG A;  5PAL A;  5KU1 A;  4M2P A;  3I5H B;  1OMV A;  4MVF A;  1H8B A;  1IQ3 A;  1QIW A;  2LV7 A;  2ZKM X;  1XK4 C;  2F3Z A;  4MRX A;  1B7T Y;  1RRO A;  5HLV A;  2LMV A;  3SG4 A;  2H2K A;  1YUR A;  4MRY A;  5DKQ A;  1RFJ A;  3DVE A;  2K2F A;  1CDM A;  1CLM A;  3CGA A;  1XA5 A;  3WNX B;  1BOD A;  4P2Y B;  1WLZ A;  1XFU O;  4A4B A;  2O60 A;  2M1U A;  3AKB A;  1WDC C;  5AXI A;  2JT3 A;  2L5X B;  1B8L A;  1KCY A;  2BBN A;  1CM1 A;  1WRZ A;  2F2O A;  2FCD A;  2CBL A;  3C1V A;  1NYA A;  1DF0 A;  3JVT B;  5DKR A;  2JNF A;  3D0Y A;  1KWO B;  3EKH A;  3VRR A;  2Q4U A;  1BLQ A;  1IH0 A;  4GGF C;  1XVJ A;  1S3P A;  1VRK A;  2Y1N A;  1FI5 A;  1MWN A;  1W7I B;  1B1G A;  3KPX A;  1JFJ A;  1IGV A;  2KBM A;  4QJ5 B;  1C07 A;  1SCV A;  1L2O B;  1SNL A;  4GAO A;  2KAY A;  4E68 A;  1Y1A A;  4ORC B;  2WCE A;  3D10 A;  3DD4 A;  3NSK A;  5J3X A;  1YRT B;  3A4U B;  3AAJ A;  1QJT A;  2K7B A;  2EHB A;  2ZN8 A;  1M45 A;  1J55 A;  5BPJ A;  3NXA A;  2RGI A;  2MRD A;  1E8A A;  2PAS A;  1NCZ A;  4YGB B;  4C0L A;  1TTX A;  2Y4Q A;  1SR6 C;  2KGR A;  3VRN A;  4CFQ A;  1DGU A;  3LCP C;  1XFY O;  1CFP A;  1N65 A;  2JTT A;  3LK0 A;  1KK8 C;  2JTZ A;  1KSO A;  2BEC A;  3ICB A;  5K89 A;  3NSI A;  2Q91 A;  3IQQ A;  1AJ4 A;  4OKH A;  1CB1 A;  4DCK A;  1RTP 1;  3O78 A;  2D8N A;  2HQ8 A;  4PE4 A;  1B8R A;  5KSZ A;  3SG5 A;  2FOT A;  1S1E A;  1CDN A;  1UHN A;  1CLL A;  1QX5 B;  5JOL A;  1ZFS A;  3PFV A;  3DVK A;  2JRF A;  3SIB A;  1SBJ A;  2L51 A;  3EVR A;  1WRK A;  2L50 A;  1SCM C;  4YBH B;  2SCP A;  4L9M A;  1U5I A;  2QAC A;  4DIR A;  1F55 A;  5TNC A;  1LIN A;  1ZUZ A;  2Y1M A;  3I5I C;  2GGZ A;  4AQI A;  1DJW A;  3TDI A;  1UUR A;  1K8U A;  1ALV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...