1IG5A

Bovine calbindin d9k binding mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN, INTESTINAL
publication title Structural basis for the negative allostery between Ca(2+)- and Mg(2+)-binding in the intracellular Ca(2+)-receptor calbindin D9k.
pubmed rcsb
source organism Bos taurus
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ig5A00
3PFVA 1F54A 4GNKB 1E8AA 2LUXA 4OR9B 1J7QA 4MZJA 1KK7Y 3ZNIA 2BKHB 2L2EA 4YI8A 2ZN9A 1ZACA 2OTGB 4P2YB 1EXRA 1NCXA 1C7WA 3SG3A 1ZOTB 1MR8A 3SIBA 2OTGC 4C0KA 1PSBA 1XK4A 4YBHB 1F8HA 4L9MA 1QXPA 1MF8B 2M8UA 3ZWHA 2H61A 3OX5A 3LK1A 5KU1A 1GGWA 2BCBA 2JC2A 1OZOA 2JTTA 1CM1A 2K7DA 1XYDA 2F33A 1K96A 3MSEB 1XFVO 2BBMA 4QJ5B 1XA5A 1QIVA 1B1GA 2M49B 3BOWB 2Y1MA 1EG4A 1L2OB 4TNCA 3H4SE 1CFFA 3IQQA 1R2UA 2L0PA 1UHHA 3QRXA 4IL1A 4MEWA 2EHBA 2G2BA 2KI4C 4I5LB 1S6IA 1WDCC 1JF0A 2E6WA 1M45A 3BUXB 2LLSA 3CR2A 4PE0A 2BL0C 2M1UA 1DJXA 1XO5A 1S26D 3OHMB 1BOCA 3EK8A 1F71A 5J3XA 1QX5B 2G9BA 4BY4A 3TS5B 1RWYA 1N2DA 1FI5A 2L51A 1YX8A 2AMIA 2LMUA 1SCMC 2Q91A 3DVMA 1KCYA 1OMRA 1NSHA 1DJYA 1YUSA 2I7AA 2R2IA 2BBNA 3TS5C 1YRTB 4YGEB 5ER5A 1UHNA 4QJ3B 4ORCB 1KFXL 1PVBA 1K93D 2BECA 4MVFA 4OVNF 1IRJA 4GGFA 1BLQA 2GGZA 1SMGA 2LMVA 3O2PA 4ZCVA 1SR6B 2OPOA 2LV7A 3KF9A 1YURA 2HF5A 3DD4A 1FI6A 3EKJA 1H8BA 3CWGA 1VRKA 2JT8A 2WORA 1SL9A 2GGMA 2PVBA 2ZRSA 4GUKA 4WQ2A 2HQ8A 4YGDB 4E68A 1R6PA 1B8LA 2KAXA 4WQ3A 5HYDA 2WNDA 1DF0B 1CMGA 1NIWA 1XK4C 3KO0A 1CFCA 3AAJA 5F6TA 4GBAA 4PHMA 1A03A 2KAYA 1NX2A 2ZFDA 1LXFC 3KHEA 2JNFA 2H61C 1BG1A 1CDMA 1QX2A 3LL8B 4NQGA 3WHTB 1KWOC 4JPZB 3M0WA 1B7TZ 1K95A 3IF7A 1B4CA 2KBMA 3BOWA 2JWWA 2M0RA 1JSAA 5G08A 1WRLA 1N65A 1G33A 2KFGA 1BMOA 1RFJA 1DTLA 1JUOA 1K9KA 1S36A 1JBAA 4MSPA 3HX4A 1LA3A 1TNQA 3NSLA 5AANA 5I8NA 4N5XA 1UWOA 2NZ0A 1C7VA 1B9AA 1KQMC 1QS7A 2HPSA 4CIDA 1V1FA 2I18A 1KQVA 1S6CA 1YVHA 1YUTA 3VRNA 2M97A 4A4BA 1BU3A 2V53A 2LCPA 1RTP1 1S1EA 2M9GA 3A4UB 4OKHA 1ZFSA 5FYXA 1KSMA 2I2RE 2PSRA 1OE9B 1QVIZ 1J55A 2M3WA 1HT9A 4PE1A 3SG4A 3BUWB 2EC6C 2WOSA 2L98A 1TCOB 1NPQA 1YRUB 4GFTA 1J7PA 2LC5A 1IH0A 5I2LA 4I5NB 3JTDB 5DKQA 1AUIB 4GGFC 2F3ZA 1RJVA 1L7ZA 2KI6D 3SJSA 1KK8C 2K2AA 2KFHA 3EVUA 5CPVA 4AOMA 1XFWO 2LM5A 1UHJA 2LLUA 1F4OA 1LINA 2IS9A 2M1KB 4PALA 4YGAA 5KSZA 5HKZA 3FS7A 1SY9A 2FOTA 2NLNA 1K9PA 3WHUB 1KFUL 2F2PA 5AEQA 1AP4A 4M2QA 5CSFA 1M46A 1LVCD 2JQ6A 1DF0A 1XVJA 1OMVA 2JT0A 1NX3A 3I5GB 4NDDA 1H4BA 1XFZO 2JTZA 1MXEA 2LAPA 2BE4A 3GOFA 4JQ0D 4MZKA 2JT3A 1CFDA 2NCOA 2LP3A 2MBXA 2Y4QA 5CSJA 3I5HB 1YUUA 2KYCA 2JXCA 3BUNB 4C0LA 2I94A 3PM8A 1EJ3A 3WXAA 3I5HC 2ISDA 2D8NA 1DVIA 2FJUB 3FIAA 1AHRA 1IQ3A 4Q04A 4ETOA 2SASA 1CM4A 3OP0A 4OV2A 2L4HA 1L2OC 2KGBC 1KFXS 1DT7B 1MXLC 4PE4A 5KTYA 2L4IA 2EGDA 3DVJA 1M63B 3CR5X 1UUSA 1XFXO 2KSPA 1DGUA 1NP8A 1N0YA 1OMDA 3TDZA 1X02A 3PLFB 3OB2B 1QATA 1TTXA 3CS1A 1DMOA 1ZUZA 1JWDA 4HSZA 2LVJA 3FWBA 4YRUA 2Q4UA 2PALA 4HREE 2WCEA 4FTGA 5TNCA 3TDIA 4A4CA 4UPGA 2BCXA 3NSKA 2NXQA 1WRKA 3NXAA 1CKKA 1A75B 4CPVA 1NYAA 3VROA 2CBLA 2MLFC 3CLNA 2JRFA 1K90D 2WCBA 1Y0VH 2BE6A 2AUCA 2L5XB 2LNKA 1SR6C 4PHNA 4DIRA 2MAZA 1J1EA 1C07A 3LCPC 2FCEA 1W7JB 2LE9B 2KHNA 2K2FA 1QTXA 2MLEC 4N1FA 2KAVA 2K7BA 1SL8A 4DRWA 2Y1NA 4I5KA 4OCIA 2KQ6A 2DOQA 2ZNDA 5JJGA 2LHIA 3EK4A 2K7OA 3NSIA 2LP2A 1MWNA 2TN4A 2JZIA 1F55A 1FPWA 2K8MB 5CSNA 1M39A 2JU0A 2H2KA 3CZTX 3CR4X 1PULA 1S5GZ 1KSOA 1NUBA 1JFKA 1WLZA 1Y1UA 1TIZA 2LVKA 4YI9A 2KBIA 1Q80A 1SRAA 3DF0B 1D1OA 5DKRA 1SW8A 4XYNA 2P6BB 3OX6A 5GQQC 3SG2A 1WLMA 1DJIA 5HLVA 1PSRA 3K21A 1K9UA 1DJWA 3A8RA 1B47A 3NSOA 1BR1B 1SL7A 4AQJA 4MRYA 1SK6D 4ORBB 2AAOA 2QPTA 1GQMA 4YGBB 4PE7A 1EL4A 1YTZC 1KK7Z 3KPXA 1BODA 1IQ5A 4PHKA 1TRFA 2KI6C 3VRPA 1EG3A 2JOJA 1TNWA 1OOJA 1A75A 3PN7B 4I5JA 1F4QA 5HLOA 1CNPA 2KFFA 1IWQA 1B7TY 2RGIA 2K7CA 2LVVA 4F0ZB 1FW4A 1B8CA 1NX1A 3JTDC 1CDPA 3BUOB 3SG5A 1SPYA 2LLTA 2JNXA 3I5FB 5D7FA 3VRRA 1BR4B 1S6JA 4HRHA 3VGOA 4R1EA 1QV1A 3I5FC 1CB1A 3BXKA 4NDCA 1F70A 2O60A 1MHOA 1V1GA 2CNPA 2KDHA 4JWQA 5AFPA 3D0YB 1DJGA 1ALWA 4HRGA 1ODBA 3DVKA 3EVRA 4PCWA 1TNPA 1EH2A 3BUMB 3PATA 3I5GC 4USLA 2JPTA 1RK9A 3PALA 1U5IB 1QVIY 3FWCA 2KGRA 1SNLA 2LMTA 3CGAA 4ICBA 1SKTA 3RM1A 3AAKA 3F45A 2HETA 5AXIA 2F8PA 1J7RA 1OSAA 2CT9A 1A29A 1J1DA 2VRGA 2COLB 2Y5IA 1DJHA 3AKBA 4QJ4B 1J7OA 2NCPA 2PRUA 5I2OA 3PSRA 1XFYO 1CLMA 4CFRA 4ZCUA 4MZLA 3E3RA 3DF0A 4YGCB 1PRWA 1S3PA 4XJKB 3BYAA 3IQOA 1Y1AA 1CMFA 1G4YR 2M7NA 1K2HA 1LKJA 3GK1A 5CSIA 1IG5A 2LUCA 1WY9A 1IKUA 3CTNA 1YVLA 1PALA 1TN4A 1MQ1A 3RLZA 1JFJA 1QLSA 2KI4B 2MA2A 1QV0A 1Y6WA 1IJ5A 1WDCB 2E30A 3O6BA 1HQVA 1YR5A 5B8IB 2CXJA 4ORAB 4GAOA 4BY5A 1SYMA 2QACA 2LVIA 2BL0B 3I5IB 3EVVA 5DKNA 3GK2A 1G8IA 1Y1XA 5D69A 3I5IC 2M7LA 2F2OA 1GJYA 3WNXB 1SCMB 1AJ4A 1LA0A 2L50A 4FQOA 3OB1B 3VRQA 5AERA 1CFPA 3AKAA 1BT6A 1GGZA 1CDNA 1QASA 2KNEA 4AQIA 1QLKA 1QIWA 2MJWB 1DJZA 1QJTA 4DCKA 3D0YA 1K8UA 4CLNA 1UHIA 4CFQA 2KQYA 5BPJA 1AJ5A 1CLLA 1WRZA 1QX7A 2O5GA 3O4YA 4NDBA 1CTRA 4P5OE 3SIAA 3ICBA 4N1GA 1IJ6A 1U5IA 1PVAA 1NCZA 2HQWA 2OS8B 3TDUA 2GV5A 1FF1A 2K0JA 4GPLB 5HKYA 1BJFA 4PHJA 5IBWA 3C1VA 1PK0D 4MLWA 1W7IB 1RROA 2OS8C 3HCMA 2ZN8A 1MUXA 4DS7A 1AVSA 2ZRTA 1UHKA 2ZKMX 5ER4X 2WC8A 5HKWA 3DVEA 2K61A 1JF2A 4MRXA 1FBVA 5I2QA 5K89A 2JULA 3BQ3A 1KWOB 4XJKA 1A2XA 2M29A 5JOLA 2F3YA 3D10A 4M2PA 3LLEA 1CDLA 1DGVA 1ZMZA 1UP5A 1TNXA 4PDZA 3SG6A 1B8RA 3SG7A 1IGVA 1NX0A 1A4PA 1SCVA 4C0JA 1KFUS 2LANA 3TUYB 1CLBA 2LHLA 2KOTA 1YX7A 3GK4X 4D1EA 1XFUO 2MRDA 1KQMB 1NCYA 4MBEA 3TUYC 4DUQA 2PMYA 3JVTB 3O78A 3PN7C 3EK7A 1M31A 3JVTC 1OZSA 1NWDA 3LK0A 1S5GY 1TCFA 2CCMA 2BKIB 1JC2A 3TZ1A 2PASA 2MHHA 2EC6B 2B1UA 4MN0A 1BF5A 1SBJA 1TOPA 4U8DA 1ALVA 5PALA 2JXLA 3KEVA 4WRIA 1OQPA 2KYFA 2CTNA 3EKHA 2WCFA 1UURA 4M2OA 1K94A 2SCPA 4GGNA 2A4JA 1KK8B 1AK8A 1RECA 2FCDA 2ZNEA 2BCAA
chains in the Genus database with same CATH superfamily
2QEVA 3PFVA 1F54A 4GNKB 1E8AA 2LUXA 4OR9B 1J7QA 4MZJA 1KK7Y 5DICA 3ZNIA 2KLEA 2BKHB 2L2EA 5I94A 4YI8A 2YGUA 2ZN9A 5FI7A 1ZACA 3UNWA 2OTGB 4P2YB 1EXRA 1NCXA 3RZSA 5HL1A 1C7WA 1QWVA 5EL2A 3SG3A 1DELA 1ZOTB 1MR8A 3SIBA 2OTGC 4C0KA 1PSBA 1XK4A 4YBHB 1F8HA 4L9MA 1QXPA 1MF8B 2M8UA 3ZWHA 2P70A 2H61A 3OX5A 3LK1A 5KU1A 1GGWA 2BCBA 2JC2A 1OZOA 1DC1A 2JTTA 1CM1A 2K7DA 1XYDA 2F33A 1K96A 3MSEB 1XFVO 2BBMA 4QJ5B 1XA5A 1QIVA 1B1GA 2M49B 3BOWB 3S0AA 2Y1MA 1EG4A 3R1OA 2H8VA 1L2OB 4TNCA 3H4SE 1CFFA 1DEKA 1R2UA 3IQQA 3V2LA 2L0PA 1UHHA 3QRXA 4IL1A 4MEWA 2EHBA 2G2BA 2KI4C 4I5LB 3SS3A 1S6IA 1WDCC 1JF0A 2E6WA 2PQLA 1M45A 3BUXB 2LLSA 3CR2A 4PE0A 2BL0C 2M1UA 1DJXA 1XO5A 1S26D 3OHMB 1BOCA 3CDNA 3EK8A 1F71A 5J3XA 1QX5B 2G9BA 4BY4A 3TS5B 1RWYA 1N2DA 1FI5A 1TWOA 1YX8A 2AMIA 2L51A 1SCMC 2LMUA 2Q91A 3DVMA 1OMRA 1NSHA 1DJYA 1YUSA 2I7AA 1KCYA 2R2IA 2BBNA 3TS5C 3L4LA 1OW4A 1YRTB 4YGEB 3DYEA 1UHNA 3PJIA 4QJ3B 5ER5A 2GTEA 4ORCB 1KFXL 1PVBA 1K93D 2BECA 4MVFA 4OVNF 1IRJA 4GGFA 1BLQA 2GGZA 1SMGA 2LMVA 3O2PA 4ZCVA 1SR6B 2OPOA 2LV7A 3KF9A 1YURA 2FJYA 2HF5A 3DD4A 3EKJA 1FI6A 1H8BA 3CWGA 1VRKA 2JT8A 2WORA 1SL9A 2GGMA 2PVBA 2ZRSA 4GUKA 4WQ2A 2HQ8A 4YGDB 3B6XA 4E68A 1R6PA 1B8LA 2KAXA 1TUJA 4WQ3A 5HYDA 2WNDA 1OOIX 2L2CA 1DF0B 1CMGA 1NIWA 2KPHA 1W9ZA 1XK4C 3KO0A 1CFCA 3K1EA 3AAJA 5F6TA 5FI2A 4GBAA 4PHMA 1A03A 2KAYA 1NX2A 2QEOA 2ZFDA 1LXFC 3B88A 3KHEA 2JNFA 2H61C 1BG1A 1CDMA 1QX2A 3LL8B 4NQGA 3WHTB 1KWOC 4JPZB 3M0WA 1B7TZ 3S0FA 1K95A 3IF7A 1B4CA 2KBMA 3BOWA 2JWWA 2M0RA 1JSAA 5G08A 1WRLA 1N65A 1G33A 2KFGA 1BMOA 1RFJA 1DTLA 1JUOA 5FI6A 1K9KA 1S36A 1JBAA 4MSPA 3UO9A 3HX4A 1LA3A 1TNQA 3NSLA 5AANA 2JPOA 4N5XA 1UWOA 2NZ0A 5I8NA 1B9AA 1KQMC 1QS7A 1C7VA 2HPSA 1OOFA 4CIDA 1V1FA 2I18A 1KQVA 1S6CA 3D73A 1YVHA 1YUTA 3VRNA 2M97A 4A4BA 4OZDA 1BU3A 2L5YA 2LCPA 1RTP1 2V53A 1S1EA 2M9GA 3A4UB 4OKHA 1ZFSA 2QEBA 4INWA 5FYXA 1KSMA 2I2RE 2PSRA 1OE9B 1QVIZ 1J55A 2M3WA 1C3YA 1HT9A 4PE1A 3SG4A 3BUWB 2EC6C 2WOSA 2L98A 1TCOB 1NPQA 1YRUB 4GFTA 1J7PA 2LC5A 1IH0A 5I2LA 4I5NB 3JTDB 5DKQA 1LS8A 1AUIB 4GGFC 2F3ZA 5D3OA 1RJVA 1L7ZA 2KI6D 3SJSA 1KK8C 2K2AA 2KFHA 3EVUA 1OOGA 5CPVA 4AOMA 1XFWO 2LM5A 1UHJA 2LLUA 1F4OA 1LINA 2IS9A 2M1KB 4PALA 4YGAA 5KSZA 5HKZA 3FS7A 1SY9A 2FOTA 2NLNA 1K9PA 2QDIA 3WHUB 1KFUL 2F2PA 5AEQA 1AP4A 4M2QA 5CSFA 1M46A 1LVCD 2JQ6A 1DF0A 1XVJA 1OMVA 2JT0A 1NX3A 3I5GB 4NDDA 1H4BA 1XFZO 2JTZA 1MXEA 2LAPA 2BAPA 2BE4A 3GOFA 4JQ0D 3S0DA 4MZKA 2JT3A 1CFDA 2NCOA 2LP3A 2MBXA 2Y4QA 5CSJA 3I5HB 1YUUA 2KYCA 2JXCA 3BUNB 4C0LA 2I94A 3PM8A 1EJ3A 3WXAA 3I5HC 3B7AA 2ISDA 2D8NA 1DVIA 2FJUB 3FIAA 1AHRA 1IQ3A 4Q04A 4JD9A 2SASA 1CM4A 4ETOA 3OP0A 4OV2A 2L4HA 1L2OC 2KGBC 1KFXS 1DT7B 1MXLC 4PE4A 5KTYA 3S0EA 2L4IA 2EGDA 3DVJA 1M63B 3CR5X 1UUSA 1XFXO 2KSPA 1DGUA 1NP8A 1N0YA 1OMDA 3BJHA 3TDZA 1X02A 3PLFB 3OB2B 1QATA 1TTXA 3CS1A 1DMOA 1ZUZA 1JWDA 3R72A 4HSZA 2LVJA 3FWBA 4YRUA 1TUZA 3BFHA 2Q4UA 2PALA 1OOHA 2K60A 4HREE 4KYNA 2WCEA 4FTGA 5TNCA 3TDIA 4A4CA 4UPGA 2BCXA 3NSKA 2NXQA 1WRKA 3NXAA 1CKKA 1A75B 4CPVA 1NYAA 3VROA 2CBLA 2MLFC 3CLNA 3D74A 2JRFA 4PT1A 1IIOA 1K90D 2WCBA 1Y0VH 2BE6A 2AUCA 2L5XB 2LNKA 1SR6C 4PHNA 4DIRA 2MAZA 1J1EA 3SS5A 1C07A 3NHIA 3LCPC 2FCEA 1T14A 1W7JB 2LE9B 2KHNA 2K2FA 1QTXA 2MLEC 4N1FA 2KAVA 2K7BA 1SL8A 4DRWA 2Y1NA 4I5KA 4OCIA 3CZ1A 2KQ6A 2DOQA 2ZNDA 5JJGA 2LHIA 3EK4A 2K7OA 3NSIA 2LP2A 1MWNA 2PYQA 2TN4A 2JZIA 1F55A 1FPWA 1GM0A 2K8MB 5CSNA 1M39A 2JU0A 2H2KA 3CZTX 3CR4X 1PULA 1S5GZ 1KSOA 1NUBA 1JFKA 1WLZA 1Y1UA 1TIZA 2LVKA 3FE9A 2KBIA 1Q80A 4YI9A 1SRAA 3D75A 3DF0B 1D1OA 1C3ZA 3D77A 5DKRA 1SW8A 4XYNA 2P6BB 3OX6A 5GQQC 3SG2A 1WLMA 1DJIA 5HLVA 1PSRA 3K21A 1K9UA 1DJWA 3A8RA 1B47A 3NSOA 1BR1B 1SL7A 4FQTA 4AQJA 4MRYA 1SK6D 4ORBB 2AAOA 2QPTA 1GQMA 4YGBB 1Z2CB 4PE7A 1EL4A 1YTZC 1KK7Z 3B87A 3QMEA 3KPXA 1BODA 1IQ5A 4PHKA 1TRFA 4F7FA 2KI6C 3CZ2A 3VRPA 1EG3A 2JOJA 1TNWA 1OOJA 1A75A 3PN7B 4I5JA 1F4QA 5HLOA 1CNPA 2KFFA 3L47A 1IWQA 1B7TY 1ORGA 2RGIA 2K7CA 2LVVA 4F0ZB 1FW4A 1B8CA 1NX1A 3JTDC 1CDPA 3BUOB 3EG5B 3SG5A 1SPYA 2LLTA 3BFAA 2JNXA 3I5FB 5D7FA 3VRRA 1BR4B 1S6JA 4HRHA 3VB1A 2KLDA 3VGOA 4R1EA 1QV1A 1XFRA 3CZ0A 3I5FC 1CB1A 3BXKA 3IVTA 4NDCA 3S0BA 1F70A 2O60A 1MHOA 1V1GA 2CNPA 1DQEA 2KDHA 4JWQA 5AFPA 3D0YB 1DJGA 1ALWA 4HRGA 1ODBA 3DVKA 3PM2A 3EVRA 4PCWA 1TNPA 1EH2A 3BUMB 3PATA 3I5GC 4USLA 2JPTA 1RK9A 3PALA 1U5IB 1QVIY 3NHTA 3FWCA 2KGRA 1SNLA 2LMTA 3Q8IA 3CGAA 4ICBA 1SKTA 3RM1A 3AAKA 3F45A 2HETA 5AXIA 2F8PA 1J7RA 1OSAA 1A29A 1J1DA 2CT9A 2VRGA 2COLB 2WCMA 1DJHA 2Y5IA 3AKBA 3DZTA 2NCPA 4QJ4B 1J7OA 2PRUA 5I2OA 3PSRA 1XFYO 1CLMA 4CFRA 4ZCUA 4MZLA 3E3RA 3DF0A 3L4AA 4YGCB 1PRWA 1S3PA 4XJKB 3BYAA 2WC6A 3DXLA 2BNXA 3D76A 3IQOA 1Y1AA 1CMFA 3FE6A 1G4YR 2M7NA 3OGNA 1K2HA 1LKJA 3GK1A 5CSIA 1IG5A 2LUCA 1WY9A 1IKUA 3CTNA 3R1PA 4IJ7A 1YVLA 1PALA 2QEHA 1TN4A 4JKTA 1MQ1A 3RLZA 1JFJA 1QLSA 2KI4B 2MA2A 1QV0A 1Y6WA 1IJ5A 1P28A 1WDCB 2E30A 2P71A 3D78A 1HQVA 1YR5A 3O6BA 5B8IB 2CXJA 4ORAB 4GAOA 4BY5A 1SYMA 2QACA 2LVIA 2BL0B 3I5IB 3EVVA 5DKNA 3GK2A 1G8IA 1Y1XA 5D69A 3I5IC 2M7LA 2F2OA 1GJYA 3WNXB 1SCMB 1AJ4A 1LA0A 2L50A 2WCHA 3OB1B 4FQOA 3SS4A 3VRQA 5AERA 1CFPA 3AKAA 1BT6A 1GGZA 1CDNA 1QASA 3CYZA 2KNEA 3O4XA 4AQIA 1QLKA 1QIWA 2MJWB 1DJZA 1QJTA 4DCKA 3D0YA 1K8UA 4CLNA 1UHIA 4CFQA 2ERBA 2KQYA 5BPJA 1AJ5A 1CLLA 1WRZA 3B86A 1QX7A 2O5GA 3O4YA 4NDBA 1Z4HA 1CTRA 4P5OE 3SIAA 3ICBA 3NGVA 1IJ6A 4N1GA 1U5IA 1PVAA 1NCZA 2HQWA 2OS8B 3TDUA 2GV5A 1FF1A 2K0JA 4GPLB 5HKYA 1BJFA 4PHJA 5IBWA 3C1VA 1PK0D 4MLWA 1W7IB 1RROA 2OS8C 3HCMA 2WCLA 2ZN8A 1MUXA 4DS7A 1AVSA 2ZRTA 1UHKA 2ZKMX 5ER4X 2WC8A 5HKWA 3DVEA 3N7HA 2K61A 1JF2A 4MRXA 1FBVA 5I2QA 5K89A 2JULA 3BQ3A 3S0GA 1KWOB 4XJKA 1A2XA 2M29A 3BFBA 1SSEB 5JOLA 2F3YA 3D10A 4M2PA 3LLEA 1CDLA 2WCKA 1DGVA 1ZMZA 3FE8A 1UP5A 1TNXA 4PDZA 3SG6A 1B8RA 3SG7A 1IGVA 1NX0A 1A4PA 1SCVA 4C0JA 1KFUS 3DY9A 2LANA 3TUYB 1CLBA 2LHLA 2KOTA 1YX7A 3GK4X 4D1EA 1XFUO 2MRDA 1KQMB 1NCYA 3R1VA 4MBEA 3TUYC 4DUQA 2PMYA 3JVTB 3O78A 3PN7C 3EK7A 1M31A 3JVTC 2WC5A 1OZSA 1NWDA 3CABA 3LK0A 1S5GY 1TCFA 2CCMA 2BKIB 1JC2A 3TZ1A 2PASA 2MHHA 2EC6B 2WCJA 2B1UA 4MN0A 1BF5A 1SBJA 1TOPA 4U8DA 1ALVA 5PALA 4INXA 2JXLA 3KEVA 4WRIA 1OQPA 2KYFA 2CTNA 3EKHA 2WCFA 1UURA 3OBVA 1K94A 4M2OA 2SCPA 4GGNA 2A4JA 1KK8B 1AK8A 1RECA 2FCDA 2ZNEA 2BCAA
chains in the Genus database with same CATH topology
3PFVA 1F54A 4GNKB 1E8AA 2LUXA 4OR9B 1J7QA 4MZJA 1KK7Y 3ZNIA 2BKHB 2L2EA 4YI8A 2ZN9A 1ZACA 2OTGB 4P2YB 1EXRA 1NCXA 1C7WA 3SG3A 1ZOTB 1MR8A 3SIBA 2OTGC 4C0KA 1PSBA 1XK4A 4YBHB 1F8HA 4L9MA 1QXPA 1MF8B 2M8UA 3ZWHA 2H61A 3OX5A 3LK1A 5KU1A 1GGWA 2BCBA 2JC2A 1OZOA 2JTTA 1CM1A 2K7DA 1XYDA 2F33A 1K96A 3MSEB 1XFVO 2BBMA 4QJ5B 1XA5A 1QIVA 1B1GA 2M49B 3BOWB 2Y1MA 1EG4A 1L2OB 4TNCA 3H4SE 1CFFA 3IQQA 1R2UA 2L0PA 1UHHA 3QRXA 4IL1A 4MEWA 2EHBA 2G2BA 2KI4C 4I5LB 1S6IA 1WDCC 1JF0A 2E6WA 1M45A 3BUXB 2LLSA 3CR2A 4PE0A 2BL0C 2M1UA 1DJXA 1XO5A 1S26D 3OHMB 1BOCA 3EK8A 1F71A 5J3XA 1QX5B 2G9BA 4BY4A 3TS5B 1RWYA 1N2DA 1FI5A 2L51A 1YX8A 2AMIA 2LMUA 1SCMC 2Q91A 3DVMA 1KCYA 1OMRA 1NSHA 1DJYA 1YUSA 2I7AA 2R2IA 2BBNA 3TS5C 1YRTB 4YGEB 5ER5A 1UHNA 4QJ3B 4ORCB 1KFXL 1PVBA 1K93D 2BECA 4MVFA 4OVNF 1IRJA 4GGFA 1BLQA 2GGZA 1SMGA 2LMVA 3O2PA 4ZCVA 1SR6B 2OPOA 2LV7A 3KF9A 1YURA 2HF5A 3DD4A 1FI6A 3EKJA 1H8BA 3CWGA 1VRKA 2JT8A 2WORA 1SL9A 2GGMA 2PVBA 2ZRSA 4GUKA 4WQ2A 2HQ8A 4YGDB 4E68A 1R6PA 1B8LA 2KAXA 4WQ3A 5HYDA 2WNDA 1DF0B 1CMGA 1NIWA 1XK4C 3KO0A 1CFCA 3AAJA 5F6TA 4GBAA 4PHMA 1A03A 2KAYA 1NX2A 2ZFDA 1LXFC 3KHEA 2JNFA 2H61C 1BG1A 1CDMA 1QX2A 3LL8B 4NQGA 3WHTB 1KWOC 4JPZB 3M0WA 1B7TZ 1K95A 3IF7A 1B4CA 2KBMA 3BOWA 2JWWA 2M0RA 1JSAA 5G08A 1WRLA 1N65A 1G33A 2KFGA 1BMOA 1RFJA 1DTLA 1JUOA 1K9KA 1S36A 1JBAA 4MSPA 3HX4A 1LA3A 1TNQA 3NSLA 5AANA 5I8NA 4N5XA 1UWOA 2NZ0A 1C7VA 1B9AA 1KQMC 1QS7A 2HPSA 4CIDA 1V1FA 2I18A 1KQVA 1S6CA 1YVHA 1YUTA 3VRNA 2M97A 4A4BA 1BU3A 2V53A 2LCPA 1RTP1 1S1EA 2M9GA 3A4UB 4OKHA 1ZFSA 5FYXA 1KSMA 2I2RE 2PSRA 1OE9B 1QVIZ 1J55A 2M3WA 1HT9A 4PE1A 3SG4A 3BUWB 2EC6C 2WOSA 2L98A 1TCOB 1NPQA 1YRUB 4GFTA 1J7PA 2LC5A 1IH0A 5I2LA 4I5NB 3JTDB 5DKQA 1AUIB 4GGFC 2F3ZA 1RJVA 1L7ZA 2KI6D 3SJSA 1KK8C 2K2AA 2KFHA 3EVUA 5CPVA 4AOMA 1XFWO 2LM5A 1UHJA 2LLUA 1F4OA 1LINA 2IS9A 2M1KB 4PALA 4YGAA 5KSZA 5HKZA 3FS7A 1SY9A 2FOTA 2NLNA 1K9PA 3WHUB 1KFUL 2F2PA 5AEQA 1AP4A 4M2QA 5CSFA 1M46A 1LVCD 2JQ6A 1DF0A 1XVJA 1OMVA 2JT0A 1NX3A 3I5GB 4NDDA 1H4BA 1XFZO 2JTZA 1MXEA 2LAPA 2BE4A 3GOFA 4JQ0D 4MZKA 2JT3A 1CFDA 2NCOA 2LP3A 2MBXA 2Y4QA 5CSJA 3I5HB 1YUUA 2KYCA 2JXCA 3BUNB 4C0LA 2I94A 3PM8A 1EJ3A 3WXAA 3I5HC 2ISDA 2D8NA 1DVIA 2FJUB 3FIAA 1AHRA 1IQ3A 4Q04A 4ETOA 2SASA 1CM4A 3OP0A 4OV2A 2L4HA 1L2OC 2KGBC 1KFXS 1DT7B 1MXLC 4PE4A 5KTYA 2L4IA 2EGDA 3DVJA 1M63B 3CR5X 1UUSA 1XFXO 2KSPA 1DGUA 1NP8A 1N0YA 1OMDA 3TDZA 1X02A 3PLFB 3OB2B 1QATA 1TTXA 3CS1A 1DMOA 1ZUZA 1JWDA 4HSZA 2LVJA 3FWBA 4YRUA 2Q4UA 2PALA 4HREE 2WCEA 4FTGA 5TNCA 3TDIA 4A4CA 4UPGA 2BCXA 3NSKA 2NXQA 1WRKA 3NXAA 1CKKA 1A75B 4CPVA 1NYAA 3VROA 2CBLA 2MLFC 3CLNA 2JRFA 1K90D 2WCBA 1Y0VH 2BE6A 2AUCA 2L5XB 2LNKA 1SR6C 4PHNA 4DIRA 2MAZA 1J1EA 1C07A 3LCPC 2FCEA 1W7JB 2LE9B 2KHNA 2K2FA 1QTXA 2MLEC 4N1FA 2KAVA 2K7BA 1SL8A 4DRWA 2Y1NA 4I5KA 4OCIA 2KQ6A 2DOQA 2ZNDA 5JJGA 2LHIA 3EK4A 2K7OA 3NSIA 2LP2A 1MWNA 2TN4A 2JZIA 1F55A 1FPWA 2K8MB 5CSNA 1M39A 2JU0A 2H2KA 3CZTX 3CR4X 1PULA 1S5GZ 1KSOA 1NUBA 1JFKA 1WLZA 1Y1UA 1TIZA 2LVKA 4YI9A 2KBIA 1Q80A 1SRAA 3DF0B 1D1OA 5DKRA 1SW8A 4XYNA 2P6BB 3OX6A 5GQQC 3SG2A 1WLMA 1DJIA 5HLVA 1PSRA 3K21A 1K9UA 1DJWA 3A8RA 1B47A 3NSOA 1BR1B 1SL7A 4AQJA 4MRYA 1SK6D 4ORBB 2AAOA 2QPTA 1GQMA 4YGBB 4PE7A 1EL4A 1YTZC 1KK7Z 3KPXA 1BODA 1IQ5A 4PHKA 1TRFA 2KI6C 3VRPA 1EG3A 2JOJA 1TNWA 1OOJA 1A75A 3PN7B 4I5JA 1F4QA 5HLOA 1CNPA 2KFFA 1IWQA 1B7TY 2RGIA 2K7CA 2LVVA 4F0ZB 1FW4A 1B8CA 1NX1A 3JTDC 1CDPA 3BUOB 3SG5A 1SPYA 2LLTA 2JNXA 3I5FB 5D7FA 3VRRA 1BR4B 1S6JA 4HRHA 3VGOA 4R1EA 1QV1A 3I5FC 1CB1A 3BXKA 4NDCA 1F70A 2O60A 1MHOA 1V1GA 2CNPA 2KDHA 4JWQA 5AFPA 3D0YB 1DJGA 1ALWA 4HRGA 1ODBA 3DVKA 3EVRA 4PCWA 1TNPA 1EH2A 3BUMB 3PATA 3I5GC 4USLA 2JPTA 1RK9A 3PALA 1U5IB 1QVIY 3FWCA 2KGRA 1SNLA 2LMTA 3CGAA 4ICBA 1SKTA 3RM1A 3AAKA 3F45A 2HETA 5AXIA 2F8PA 1J7RA 1OSAA 2CT9A 1A29A 1J1DA 2VRGA 2COLB 2Y5IA 1DJHA 3AKBA 4QJ4B 1J7OA 2NCPA 2PRUA 5I2OA 3PSRA 1XFYO 1CLMA 4CFRA 4ZCUA 4MZLA 3E3RA 3DF0A 4YGCB 1PRWA 1S3PA 4XJKB 3BYAA 3IQOA 1Y1AA 1CMFA 1G4YR 2M7NA 1K2HA 1LKJA 3GK1A 5CSIA 1IG5A 2LUCA 1WY9A 1IKUA 3CTNA 1YVLA 1PALA 1TN4A 1MQ1A 3RLZA 1JFJA 1QLSA 2KI4B 2MA2A 1QV0A 1Y6WA 1IJ5A 1WDCB 2E30A 3O6BA 1HQVA 1YR5A 5B8IB 2CXJA 4ORAB 4GAOA 4BY5A 1SYMA 2QACA 2LVIA 2BL0B 3I5IB 3EVVA 5DKNA 3GK2A 1G8IA 1Y1XA 5D69A 3I5IC 2M7LA 2F2OA 1GJYA 3WNXB 1SCMB 1AJ4A 1LA0A 2L50A 4FQOA 3OB1B 3VRQA 5AERA 1CFPA 3AKAA 1BT6A 1GGZA 1CDNA 1QASA 2KNEA 4AQIA 1QLKA 1QIWA 2MJWB 1DJZA 1QJTA 4DCKA 3D0YA 1K8UA 4CLNA 1UHIA 4CFQA 2KQYA 5BPJA 1AJ5A 1CLLA 1WRZA 1QX7A 2O5GA 3O4YA 4NDBA 1CTRA 4P5OE 3SIAA 3ICBA 4N1GA 1IJ6A 1U5IA 1PVAA 1NCZA 2HQWA 2OS8B 3TDUA 2GV5A 1FF1A 2K0JA 4GPLB 5HKYA 1BJFA 4PHJA 5IBWA 3C1VA 1PK0D 4MLWA 1W7IB 1RROA 2OS8C 3HCMA 2ZN8A 1MUXA 4DS7A 1AVSA 2ZRTA 1UHKA 2ZKMX 5ER4X 2WC8A 5HKWA 3DVEA 2K61A 1JF2A 4MRXA 1FBVA 5I2QA 5K89A 2JULA 3BQ3A 1KWOB 4XJKA 1A2XA 2M29A 5JOLA 2F3YA 3D10A 4M2PA 3LLEA 1CDLA 1DGVA 1ZMZA 1UP5A 1TNXA 4PDZA 3SG6A 1B8RA 3SG7A 1IGVA 1NX0A 1A4PA 1SCVA 4C0JA 1KFUS 2LANA 3TUYB 1CLBA 2LHLA 2KOTA 1YX7A 3GK4X 4D1EA 1XFUO 2MRDA 1KQMB 1NCYA 4MBEA 3TUYC 4DUQA 2PMYA 3JVTB 3O78A 3PN7C 3EK7A 1M31A 3JVTC 1OZSA 1NWDA 3LK0A 1S5GY 1TCFA 2CCMA 2BKIB 1JC2A 3TZ1A 2PASA 2MHHA 2EC6B 2B1UA 4MN0A 1BF5A 1SBJA 1TOPA 4U8DA 1ALVA 5PALA 2JXLA 3KEVA 4WRIA 1OQPA 2KYFA 2CTNA 3EKHA 2WCFA 1UURA 4M2OA 1K94A 2SCPA 4GGNA 2A4JA 1KK8B 1AK8A 1RECA 2FCDA 2ZNEA 2BCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFV A;  1F54 A;  4GNK B;  1E8A A;  2LUX A;  4OR9 B;  1J7Q A;  4MZJ A;  1KK7 Y;  3ZNI A;  2BKH B;  2L2E A;  4YI8 A;  2ZN9 A;  1ZAC A;  2OTG B;  4P2Y B;  1EXR A;  1NCX A;  1C7W A;  3SG3 A;  1ZOT B;  1MR8 A;  3SIB A;  2OTG C;  4C0K A;  1PSB A;  1XK4 A;  4YBH B;  1F8H A;  4L9M A;  1QXP A;  1MF8 B;  2M8U A;  3ZWH A;  2H61 A;  3OX5 A;  3LK1 A;  5KU1 A;  1GGW A;  2BCB A;  2JC2 A;  1OZO A;  2JTT A;  1CM1 A;  2K7D A;  1XYD A;  2F33 A;  1K96 A;  3MSE B;  1XFV O;  2BBM A;  4QJ5 B;  1XA5 A;  1QIV A;  1B1G A;  2M49 B;  3BOW B;  2Y1M A;  1EG4 A;  1L2O B;  4TNC A;  3H4S E;  1CFF A;  3IQQ A;  1R2U A;  2L0P A;  1UHH A;  3QRX A;  4IL1 A;  4MEW A;  2EHB A;  2G2B A;  2KI4 C;  4I5L B;  1S6I A;  1WDC C;  1JF0 A;  2E6W A;  1M45 A;  3BUX B;  2LLS A;  3CR2 A;  4PE0 A;  2BL0 C;  2M1U A;  1DJX A;  1XO5 A;  1S26 D;  3OHM B;  1BOC A;  3EK8 A;  1F71 A;  5J3X A;  1QX5 B;  2G9B A;  4BY4 A;  3TS5 B;  1RWY A;  1N2D A;  1FI5 A;  2L51 A;  1YX8 A;  2AMI A;  2LMU A;  1SCM C;  2Q91 A;  3DVM A;  1KCY A;  1OMR A;  1NSH A;  1DJY A;  1YUS A;  2I7A A;  2R2I A;  2BBN A;  3TS5 C;  1YRT B;  4YGE B;  5ER5 A;  1UHN A;  4QJ3 B;  4ORC B;  1KFX L;  1PVB A;  1K93 D;  2BEC A;  4MVF A;  4OVN F;  1IRJ A;  4GGF A;  1BLQ A;  2GGZ A;  1SMG A;  2LMV A;  3O2P A;  4ZCV A;  1SR6 B;  2OPO A;  2LV7 A;  3KF9 A;  1YUR A;  2HF5 A;  3DD4 A;  1FI6 A;  3EKJ A;  1H8B A;  3CWG A;  1VRK A;  2JT8 A;  2WOR A;  1SL9 A;  2GGM A;  2PVB A;  2ZRS A;  4GUK A;  4WQ2 A;  2HQ8 A;  4YGD B;  4E68 A;  1R6P A;  1B8L A;  2KAX A;  4WQ3 A;  5HYD A;  2WND A;  1DF0 B;  1CMG A;  1NIW A;  1XK4 C;  3KO0 A;  1CFC A;  3AAJ A;  5F6T A;  4GBA A;  4PHM A;  1A03 A;  2KAY A;  1NX2 A;  2ZFD A;  1LXF C;  3KHE A;  2JNF A;  2H61 C;  1BG1 A;  1CDM A;  1QX2 A;  3LL8 B;  4NQG A;  3WHT B;  1KWO C;  4JPZ B;  3M0W A;  1B7T Z;  1K95 A;  3IF7 A;  1B4C A;  2KBM A;  3BOW A;  2JWW A;  2M0R A;  1JSA A;  5G08 A;  1WRL A;  1N65 A;  1G33 A;  2KFG A;  1BMO A;  1RFJ A;  1DTL A;  1JUO A;  1K9K A;  1S36 A;  1JBA A;  4MSP A;  3HX4 A;  1LA3 A;  1TNQ A;  3NSL A;  5AAN A;  5I8N A;  4N5X A;  1UWO A;  2NZ0 A;  1C7V A;  1B9A A;  1KQM C;  1QS7 A;  2HPS A;  4CID A;  1V1F A;  2I18 A;  1KQV A;  1S6C A;  1YVH A;  1YUT A;  3VRN A;  2M97 A;  4A4B A;  1BU3 A;  2V53 A;  2LCP A;  1RTP 1;  1S1E A;  2M9G A;  3A4U B;  4OKH A;  1ZFS A;  5FYX A;  1KSM A;  2I2R E;  2PSR A;  1OE9 B;  1QVI Z;  1J55 A;  2M3W A;  1HT9 A;  4PE1 A;  3SG4 A;  3BUW B;  2EC6 C;  2WOS A;  2L98 A;  1TCO B;  1NPQ A;  1YRU B;  4GFT A;  1J7P A;  2LC5 A;  1IH0 A;  5I2L A;  4I5N B;  3JTD B;  5DKQ A;  1AUI B;  4GGF C;  2F3Z A;  1RJV A;  1L7Z A;  2KI6 D;  3SJS A;  1KK8 C;  2K2A A;  2KFH A;  3EVU A;  5CPV A;  4AOM A;  1XFW O;  2LM5 A;  1UHJ A;  2LLU A;  1F4O A;  1LIN A;  2IS9 A;  2M1K B;  4PAL A;  4YGA A;  5KSZ A;  5HKZ A;  3FS7 A;  1SY9 A;  2FOT A;  2NLN A;  1K9P A;  3WHU B;  1KFU L;  2F2P A;  5AEQ A;  1AP4 A;  4M2Q A;  5CSF A;  1M46 A;  1LVC D;  2JQ6 A;  1DF0 A;  1XVJ A;  1OMV A;  2JT0 A;  1NX3 A;  3I5G B;  4NDD A;  1H4B A;  1XFZ O;  2JTZ A;  1MXE A;  2LAP A;  2BE4 A;  3GOF A;  4JQ0 D;  4MZK A;  2JT3 A;  1CFD A;  2NCO A;  2LP3 A;  2MBX A;  2Y4Q A;  5CSJ A;  3I5H B;  1YUU A;  2KYC A;  2JXC A;  3BUN B;  4C0L A;  2I94 A;  3PM8 A;  1EJ3 A;  3WXA A;  3I5H C;  2ISD A;  2D8N A;  1DVI A;  2FJU B;  3FIA A;  1AHR A;  1IQ3 A;  4Q04 A;  4ETO A;  2SAS A;  1CM4 A;  3OP0 A;  4OV2 A;  2L4H A;  1L2O C;  2KGB C;  1KFX S;  1DT7 B;  1MXL C;  4PE4 A;  5KTY A;  2L4I A;  2EGD A;  3DVJ A;  1M63 B;  3CR5 X;  1UUS A;  1XFX O;  2KSP A;  1DGU A;  1NP8 A;  1N0Y A;  1OMD A;  3TDZ A;  1X02 A;  3PLF B;  3OB2 B;  1QAT A;  1TTX A;  3CS1 A;  1DMO A;  1ZUZ A;  1JWD A;  4HSZ A;  2LVJ A;  3FWB A;  4YRU A;  2Q4U A;  2PAL A;  4HRE E;  2WCE A;  4FTG A;  5TNC A;  3TDI A;  4A4C A;  4UPG A;  2BCX A;  3NSK A;  2NXQ A;  1WRK A;  3NXA A;  1CKK A;  1A75 B;  4CPV A;  1NYA A;  3VRO A;  2CBL A;  2MLF C;  3CLN A;  2JRF A;  1K90 D;  2WCB A;  1Y0V H;  2BE6 A;  2AUC A;  2L5X B;  2LNK A;  1SR6 C;  4PHN A;  4DIR A;  2MAZ A;  1J1E A;  1C07 A;  3LCP C;  2FCE A;  1W7J B;  2LE9 B;  2KHN A;  2K2F A;  1QTX A;  2MLE C;  4N1F A;  2KAV A;  2K7B A;  1SL8 A;  4DRW A;  2Y1N A;  4I5K A;  4OCI A;  2KQ6 A;  2DOQ A;  2ZND A;  5JJG A;  2LHI A;  3EK4 A;  2K7O A;  3NSI A;  2LP2 A;  1MWN A;  2TN4 A;  2JZI A;  1F55 A;  1FPW A;  2K8M B;  5CSN A;  1M39 A;  2JU0 A;  2H2K A;  3CZT X;  3CR4 X;  1PUL A;  1S5G Z;  1KSO A;  1NUB A;  1JFK A;  1WLZ A;  1Y1U A;  1TIZ A;  2LVK A;  4YI9 A;  2KBI A;  1Q80 A;  1SRA A;  3DF0 B;  1D1O A;  5DKR A;  1SW8 A;  4XYN A;  2P6B B;  3OX6 A;  5GQQ C;  3SG2 A;  1WLM A;  1DJI A;  5HLV A;  1PSR A;  3K21 A;  1K9U A;  1DJW A;  3A8R A;  1B47 A;  3NSO A;  1BR1 B;  1SL7 A;  4AQJ A;  4MRY A;  1SK6 D;  4ORB B;  2AAO A;  2QPT A;  1GQM A;  4YGB B;  4PE7 A;  1EL4 A;  1YTZ C;  1KK7 Z;  3KPX A;  1BOD A;  1IQ5 A;  4PHK A;  1TRF A;  2KI6 C;  3VRP A;  1EG3 A;  2JOJ A;  1TNW A;  1OOJ A;  1A75 A;  3PN7 B;  4I5J A;  1F4Q A;  5HLO A;  1CNP A;  2KFF A;  1IWQ A;  1B7T Y;  2RGI A;  2K7C A;  2LVV A;  4F0Z B;  1FW4 A;  1B8C A;  1NX1 A;  3JTD C;  1CDP A;  3BUO B;  3SG5 A;  1SPY A;  2LLT A;  2JNX A;  3I5F B;  5D7F A;  3VRR A;  1BR4 B;  1S6J A;  4HRH A;  3VGO A;  4R1E A;  1QV1 A;  3I5F C;  1CB1 A;  3BXK A;  4NDC A;  1F70 A;  2O60 A;  1MHO A;  1V1G A;  2CNP A;  2KDH A;  4JWQ A;  5AFP A;  3D0Y B;  1DJG A;  1ALW A;  4HRG A;  1ODB A;  3DVK A;  3EVR A;  4PCW A;  1TNP A;  1EH2 A;  3BUM B;  3PAT A;  3I5G C;  4USL A;  2JPT A;  1RK9 A;  3PAL A;  1U5I B;  1QVI Y;  3FWC A;  2KGR A;  1SNL A;  2LMT A;  3CGA A;  4ICB A;  1SKT A;  3RM1 A;  3AAK A;  3F45 A;  2HET A;  5AXI A;  2F8P A;  1J7R A;  1OSA A;  2CT9 A;  1A29 A;  1J1D A;  2VRG A;  2COL B;  2Y5I A;  1DJH A;  3AKB A;  4QJ4 B;  1J7O A;  2NCP A;  2PRU A;  5I2O A;  3PSR A;  1XFY O;  1CLM A;  4CFR A;  4ZCU A;  4MZL A;  3E3R A;  3DF0 A;  4YGC B;  1PRW A;  1S3P A;  4XJK B;  3BYA A;  3IQO A;  1Y1A A;  1CMF A;  1G4Y R;  2M7N A;  1K2H A;  1LKJ A;  3GK1 A;  5CSI A;  1IG5 A;  2LUC A;  1WY9 A;  1IKU A;  3CTN A;  1YVL A;  1PAL A;  1TN4 A;  1MQ1 A;  3RLZ A;  1JFJ A;  1QLS A;  2KI4 B;  2MA2 A;  1QV0 A;  1Y6W A;  1IJ5 A;  1WDC B;  2E30 A;  3O6B A;  1HQV A;  1YR5 A;  5B8I B;  2CXJ A;  4ORA B;  4GAO A;  4BY5 A;  1SYM A;  2QAC A;  2LVI A;  2BL0 B;  3I5I B;  3EVV A;  5DKN A;  3GK2 A;  1G8I A;  1Y1X A;  5D69 A;  3I5I C;  2M7L A;  2F2O A;  1GJY A;  3WNX B;  1SCM B;  1AJ4 A;  1LA0 A;  2L50 A;  4FQO A;  3OB1 B;  3VRQ A;  5AER A;  1CFP A;  3AKA A;  1BT6 A;  1GGZ A;  1CDN A;  1QAS A;  2KNE A;  4AQI A;  1QLK A;  1QIW A;  2MJW B;  1DJZ A;  1QJT A;  4DCK A;  3D0Y A;  1K8U A;  4CLN A;  1UHI A;  4CFQ A;  2KQY A;  5BPJ A;  1AJ5 A;  1CLL A;  1WRZ A;  1QX7 A;  2O5G A;  3O4Y A;  4NDB A;  1CTR A;  4P5O E;  3SIA A;  3ICB A;  4N1G A;  1IJ6 A;  1U5I A;  1PVA A;  1NCZ A;  2HQW A;  2OS8 B;  3TDU A;  2GV5 A;  1FF1 A;  2K0J A;  4GPL B;  5HKY A;  1BJF A;  4PHJ A;  5IBW A;  3C1V A;  1PK0 D;  4MLW A;  1W7I B;  1RRO A;  2OS8 C;  3HCM A;  2ZN8 A;  1MUX A;  4DS7 A;  1AVS A;  2ZRT A;  1UHK A;  2ZKM X;  5ER4 X;  2WC8 A;  5HKW A;  3DVE A;  2K61 A;  1JF2 A;  4MRX A;  1FBV A;  5I2Q A;  5K89 A;  2JUL A;  3BQ3 A;  1KWO B;  4XJK A;  1A2X A;  2M29 A;  5JOL A;  2F3Y A;  3D10 A;  4M2P A;  3LLE A;  1CDL A;  1DGV A;  1ZMZ A;  1UP5 A;  1TNX A;  4PDZ A;  3SG6 A;  1B8R A;  3SG7 A;  1IGV A;  1NX0 A;  1A4P A;  1SCV A;  4C0J A;  1KFU S;  2LAN A;  3TUY B;  1CLB A;  2LHL A;  2KOT A;  1YX7 A;  3GK4 X;  4D1E A;  1XFU O;  2MRD A;  1KQM B;  1NCY A;  4MBE A;  3TUY C;  4DUQ A;  2PMY A;  3JVT B;  3O78 A;  3PN7 C;  3EK7 A;  1M31 A;  3JVT C;  1OZS A;  1NWD A;  3LK0 A;  1S5G Y;  1TCF A;  2CCM A;  2BKI B;  1JC2 A;  3TZ1 A;  2PAS A;  2MHH A;  2EC6 B;  2B1U A;  4MN0 A;  1BF5 A;  1SBJ A;  1TOP A;  4U8D A;  1ALV A;  5PAL A;  2JXL A;  3KEV A;  4WRI A;  1OQP A;  2KYF A;  2CTN A;  3EKH A;  2WCF A;  1UUR A;  4M2O A;  1K94 A;  2SCP A;  4GGN A;  2A4J A;  1KK8 B;  1AK8 A;  1REC A;  2FCD A;  2ZNE A;  2BCA A; 
#chains in the Genus database with same CATH topology
 2QEV A;  3PFV A;  1F54 A;  4GNK B;  1E8A A;  2LUX A;  4OR9 B;  1J7Q A;  4MZJ A;  1KK7 Y;  5DIC A;  3ZNI A;  2KLE A;  2BKH B;  2L2E A;  5I94 A;  4YI8 A;  2YGU A;  2ZN9 A;  5FI7 A;  1ZAC A;  3UNW A;  2OTG B;  4P2Y B;  1EXR A;  1NCX A;  3RZS A;  5HL1 A;  1C7W A;  1QWV A;  5EL2 A;  3SG3 A;  1DEL A;  1ZOT B;  1MR8 A;  3SIB A;  2OTG C;  4C0K A;  1PSB A;  1XK4 A;  4YBH B;  1F8H A;  4L9M A;  1QXP A;  1MF8 B;  2M8U A;  3ZWH A;  2P70 A;  2H61 A;  3OX5 A;  3LK1 A;  5KU1 A;  1GGW A;  2BCB A;  2JC2 A;  1OZO A;  1DC1 A;  2JTT A;  1CM1 A;  2K7D A;  1XYD A;  2F33 A;  1K96 A;  3MSE B;  1XFV O;  2BBM A;  4QJ5 B;  1XA5 A;  1QIV A;  1B1G A;  2M49 B;  3BOW B;  3S0A A;  2Y1M A;  1EG4 A;  3R1O A;  2H8V A;  1L2O B;  4TNC A;  3H4S E;  1CFF A;  1DEK A;  1R2U A;  3IQQ A;  3V2L A;  2L0P A;  1UHH A;  3QRX A;  4IL1 A;  4MEW A;  2EHB A;  2G2B A;  2KI4 C;  4I5L B;  3SS3 A;  1S6I A;  1WDC C;  1JF0 A;  2E6W A;  2PQL A;  1M45 A;  3BUX B;  2LLS A;  3CR2 A;  4PE0 A;  2BL0 C;  2M1U A;  1DJX A;  1XO5 A;  1S26 D;  3OHM B;  1BOC A;  3CDN A;  3EK8 A;  1F71 A;  5J3X A;  1QX5 B;  2G9B A;  4BY4 A;  3TS5 B;  1RWY A;  1N2D A;  1FI5 A;  1TWO A;  1YX8 A;  2AMI A;  2L51 A;  1SCM C;  2LMU A;  2Q91 A;  3DVM A;  1OMR A;  1NSH A;  1DJY A;  1YUS A;  2I7A A;  1KCY A;  2R2I A;  2BBN A;  3TS5 C;  3L4L A;  1OW4 A;  1YRT B;  4YGE B;  3DYE A;  1UHN A;  3PJI A;  4QJ3 B;  5ER5 A;  2GTE A;  4ORC B;  1KFX L;  1PVB A;  1K93 D;  2BEC A;  4MVF A;  4OVN F;  1IRJ A;  4GGF A;  1BLQ A;  2GGZ A;  1SMG A;  2LMV A;  3O2P A;  4ZCV A;  1SR6 B;  2OPO A;  2LV7 A;  3KF9 A;  1YUR A;  2FJY A;  2HF5 A;  3DD4 A;  3EKJ A;  1FI6 A;  1H8B A;  3CWG A;  1VRK A;  2JT8 A;  2WOR A;  1SL9 A;  2GGM A;  2PVB A;  2ZRS A;  4GUK A;  4WQ2 A;  2HQ8 A;  4YGD B;  3B6X A;  4E68 A;  1R6P A;  1B8L A;  2KAX A;  1TUJ A;  4WQ3 A;  5HYD A;  2WND A;  1OOI X;  2L2C A;  1DF0 B;  1CMG A;  1NIW A;  2KPH A;  1W9Z A;  1XK4 C;  3KO0 A;  1CFC A;  3K1E A;  3AAJ A;  5F6T A;  5FI2 A;  4GBA A;  4PHM A;  1A03 A;  2KAY A;  1NX2 A;  2QEO A;  2ZFD A;  1LXF C;  3B88 A;  3KHE A;  2JNF A;  2H61 C;  1BG1 A;  1CDM A;  1QX2 A;  3LL8 B;  4NQG A;  3WHT B;  1KWO C;  4JPZ B;  3M0W A;  1B7T Z;  3S0F A;  1K95 A;  3IF7 A;  1B4C A;  2KBM A;  3BOW A;  2JWW A;  2M0R A;  1JSA A;  5G08 A;  1WRL A;  1N65 A;  1G33 A;  2KFG A;  1BMO A;  1RFJ A;  1DTL A;  1JUO A;  5FI6 A;  1K9K A;  1S36 A;  1JBA A;  4MSP A;  3UO9 A;  3HX4 A;  1LA3 A;  1TNQ A;  3NSL A;  5AAN A;  2JPO A;  4N5X A;  1UWO A;  2NZ0 A;  5I8N A;  1B9A A;  1KQM C;  1QS7 A;  1C7V A;  2HPS A;  1OOF A;  4CID A;  1V1F A;  2I18 A;  1KQV A;  1S6C A;  3D73 A;  1YVH A;  1YUT A;  3VRN A;  2M97 A;  4A4B A;  4OZD A;  1BU3 A;  2L5Y A;  2LCP A;  1RTP 1;  2V53 A;  1S1E A;  2M9G A;  3A4U B;  4OKH A;  1ZFS A;  2QEB A;  4INW A;  5FYX A;  1KSM A;  2I2R E;  2PSR A;  1OE9 B;  1QVI Z;  1J55 A;  2M3W A;  1C3Y A;  1HT9 A;  4PE1 A;  3SG4 A;  3BUW B;  2EC6 C;  2WOS A;  2L98 A;  1TCO B;  1NPQ A;  1YRU B;  4GFT A;  1J7P A;  2LC5 A;  1IH0 A;  5I2L A;  4I5N B;  3JTD B;  5DKQ A;  1LS8 A;  1AUI B;  4GGF C;  2F3Z A;  5D3O A;  1RJV A;  1L7Z A;  2KI6 D;  3SJS A;  1KK8 C;  2K2A A;  2KFH A;  3EVU A;  1OOG A;  5CPV A;  4AOM A;  1XFW O;  2LM5 A;  1UHJ A;  2LLU A;  1F4O A;  1LIN A;  2IS9 A;  2M1K B;  4PAL A;  4YGA A;  5KSZ A;  5HKZ A;  3FS7 A;  1SY9 A;  2FOT A;  2NLN A;  1K9P A;  2QDI A;  3WHU B;  1KFU L;  2F2P A;  5AEQ A;  1AP4 A;  4M2Q A;  5CSF A;  1M46 A;  1LVC D;  2JQ6 A;  1DF0 A;  1XVJ A;  1OMV A;  2JT0 A;  1NX3 A;  3I5G B;  4NDD A;  1H4B A;  1XFZ O;  2JTZ A;  1MXE A;  2LAP A;  2BAP A;  2BE4 A;  3GOF A;  4JQ0 D;  3S0D A;  4MZK A;  2JT3 A;  1CFD A;  2NCO A;  2LP3 A;  2MBX A;  2Y4Q A;  5CSJ A;  3I5H B;  1YUU A;  2KYC A;  2JXC A;  3BUN B;  4C0L A;  2I94 A;  3PM8 A;  1EJ3 A;  3WXA A;  3I5H C;  3B7A A;  2ISD A;  2D8N A;  1DVI A;  2FJU B;  3FIA A;  1AHR A;  1IQ3 A;  4Q04 A;  4JD9 A;  2SAS A;  1CM4 A;  4ETO A;  3OP0 A;  4OV2 A;  2L4H A;  1L2O C;  2KGB C;  1KFX S;  1DT7 B;  1MXL C;  4PE4 A;  5KTY A;  3S0E A;  2L4I A;  2EGD A;  3DVJ A;  1M63 B;  3CR5 X;  1UUS A;  1XFX O;  2KSP A;  1DGU A;  1NP8 A;  1N0Y A;  1OMD A;  3BJH A;  3TDZ A;  1X02 A;  3PLF B;  3OB2 B;  1QAT A;  1TTX A;  3CS1 A;  1DMO A;  1ZUZ A;  1JWD A;  3R72 A;  4HSZ A;  2LVJ A;  3FWB A;  4YRU A;  1TUZ A;  3BFH A;  2Q4U A;  2PAL A;  1OOH A;  2K60 A;  4HRE E;  4KYN A;  2WCE A;  4FTG A;  5TNC A;  3TDI A;  4A4C A;  4UPG A;  2BCX A;  3NSK A;  2NXQ A;  1WRK A;  3NXA A;  1CKK A;  1A75 B;  4CPV A;  1NYA A;  3VRO A;  2CBL A;  2MLF C;  3CLN A;  3D74 A;  2JRF A;  4PT1 A;  1IIO A;  1K90 D;  2WCB A;  1Y0V H;  2BE6 A;  2AUC A;  2L5X B;  2LNK A;  1SR6 C;  4PHN A;  4DIR A;  2MAZ A;  1J1E A;  3SS5 A;  1C07 A;  3NHI A;  3LCP C;  2FCE A;  1T14 A;  1W7J B;  2LE9 B;  2KHN A;  2K2F A;  1QTX A;  2MLE C;  4N1F A;  2KAV A;  2K7B A;  1SL8 A;  4DRW A;  2Y1N A;  4I5K A;  4OCI A;  3CZ1 A;  2KQ6 A;  2DOQ A;  2ZND A;  5JJG A;  2LHI A;  3EK4 A;  2K7O A;  3NSI A;  2LP2 A;  1MWN A;  2PYQ A;  2TN4 A;  2JZI A;  1F55 A;  1FPW A;  1GM0 A;  2K8M B;  5CSN A;  1M39 A;  2JU0 A;  2H2K A;  3CZT X;  3CR4 X;  1PUL A;  1S5G Z;  1KSO A;  1NUB A;  1JFK A;  1WLZ A;  1Y1U A;  1TIZ A;  2LVK A;  3FE9 A;  2KBI A;  1Q80 A;  4YI9 A;  1SRA A;  3D75 A;  3DF0 B;  1D1O A;  1C3Z A;  3D77 A;  5DKR A;  1SW8 A;  4XYN A;  2P6B B;  3OX6 A;  5GQQ C;  3SG2 A;  1WLM A;  1DJI A;  5HLV A;  1PSR A;  3K21 A;  1K9U A;  1DJW A;  3A8R A;  1B47 A;  3NSO A;  1BR1 B;  1SL7 A;  4FQT A;  4AQJ A;  4MRY A;  1SK6 D;  4ORB B;  2AAO A;  2QPT A;  1GQM A;  4YGB B;  1Z2C B;  4PE7 A;  1EL4 A;  1YTZ C;  1KK7 Z;  3B87 A;  3QME A;  3KPX A;  1BOD A;  1IQ5 A;  4PHK A;  1TRF A;  4F7F A;  2KI6 C;  3CZ2 A;  3VRP A;  1EG3 A;  2JOJ A;  1TNW A;  1OOJ A;  1A75 A;  3PN7 B;  4I5J A;  1F4Q A;  5HLO A;  1CNP A;  2KFF A;  3L47 A;  1IWQ A;  1B7T Y;  1ORG A;  2RGI A;  2K7C A;  2LVV A;  4F0Z B;  1FW4 A;  1B8C A;  1NX1 A;  3JTD C;  1CDP A;  3BUO B;  3EG5 B;  3SG5 A;  1SPY A;  2LLT A;  3BFA A;  2JNX A;  3I5F B;  5D7F A;  3VRR A;  1BR4 B;  1S6J A;  4HRH A;  3VB1 A;  2KLD A;  3VGO A;  4R1E A;  1QV1 A;  1XFR A;  3CZ0 A;  3I5F C;  1CB1 A;  3BXK A;  3IVT A;  4NDC A;  3S0B A;  1F70 A;  2O60 A;  1MHO A;  1V1G A;  2CNP A;  1DQE A;  2KDH A;  4JWQ A;  5AFP A;  3D0Y B;  1DJG A;  1ALW A;  4HRG A;  1ODB A;  3DVK A;  3PM2 A;  3EVR A;  4PCW A;  1TNP A;  1EH2 A;  3BUM B;  3PAT A;  3I5G C;  4USL A;  2JPT A;  1RK9 A;  3PAL A;  1U5I B;  1QVI Y;  3NHT A;  3FWC A;  2KGR A;  1SNL A;  2LMT A;  3Q8I A;  3CGA A;  4ICB A;  1SKT A;  3RM1 A;  3AAK A;  3F45 A;  2HET A;  5AXI A;  2F8P A;  1J7R A;  1OSA A;  1A29 A;  1J1D A;  2CT9 A;  2VRG A;  2COL B;  2WCM A;  1DJH A;  2Y5I A;  3AKB A;  3DZT A;  2NCP A;  4QJ4 B;  1J7O A;  2PRU A;  5I2O A;  3PSR A;  1XFY O;  1CLM A;  4CFR A;  4ZCU A;  4MZL A;  3E3R A;  3DF0 A;  3L4A A;  4YGC B;  1PRW A;  1S3P A;  4XJK B;  3BYA A;  2WC6 A;  3DXL A;  2BNX A;  3D76 A;  3IQO A;  1Y1A A;  1CMF A;  3FE6 A;  1G4Y R;  2M7N A;  3OGN A;  1K2H A;  1LKJ A;  3GK1 A;  5CSI A;  1IG5 A;  2LUC A;  1WY9 A;  1IKU A;  3CTN A;  3R1P A;  4IJ7 A;  1YVL A;  1PAL A;  2QEH A;  1TN4 A;  4JKT A;  1MQ1 A;  3RLZ A;  1JFJ A;  1QLS A;  2KI4 B;  2MA2 A;  1QV0 A;  1Y6W A;  1IJ5 A;  1P28 A;  1WDC B;  2E30 A;  2P71 A;  3D78 A;  1HQV A;  1YR5 A;  3O6B A;  5B8I B;  2CXJ A;  4ORA B;  4GAO A;  4BY5 A;  1SYM A;  2QAC A;  2LVI A;  2BL0 B;  3I5I B;  3EVV A;  5DKN A;  3GK2 A;  1G8I A;  1Y1X A;  5D69 A;  3I5I C;  2M7L A;  2F2O A;  1GJY A;  3WNX B;  1SCM B;  1AJ4 A;  1LA0 A;  2L50 A;  2WCH A;  3OB1 B;  4FQO A;  3SS4 A;  3VRQ A;  5AER A;  1CFP A;  3AKA A;  1BT6 A;  1GGZ A;  1CDN A;  1QAS A;  3CYZ A;  2KNE A;  3O4X A;  4AQI A;  1QLK A;  1QIW A;  2MJW B;  1DJZ A;  1QJT A;  4DCK A;  3D0Y A;  1K8U A;  4CLN A;  1UHI A;  4CFQ A;  2ERB A;  2KQY A;  5BPJ A;  1AJ5 A;  1CLL A;  1WRZ A;  3B86 A;  1QX7 A;  2O5G A;  3O4Y A;  4NDB A;  1Z4H A;  1CTR A;  4P5O E;  3SIA A;  3ICB A;  3NGV A;  1IJ6 A;  4N1G A;  1U5I A;  1PVA A;  1NCZ A;  2HQW A;  2OS8 B;  3TDU A;  2GV5 A;  1FF1 A;  2K0J A;  4GPL B;  5HKY A;  1BJF A;  4PHJ A;  5IBW A;  3C1V A;  1PK0 D;  4MLW A;  1W7I B;  1RRO A;  2OS8 C;  3HCM A;  2WCL A;  2ZN8 A;  1MUX A;  4DS7 A;  1AVS A;  2ZRT A;  1UHK A;  2ZKM X;  5ER4 X;  2WC8 A;  5HKW A;  3DVE A;  3N7H A;  2K61 A;  1JF2 A;  4MRX A;  1FBV A;  5I2Q A;  5K89 A;  2JUL A;  3BQ3 A;  3S0G A;  1KWO B;  4XJK A;  1A2X A;  2M29 A;  3BFB A;  1SSE B;  5JOL A;  2F3Y A;  3D10 A;  4M2P A;  3LLE A;  1CDL A;  2WCK A;  1DGV A;  1ZMZ A;  3FE8 A;  1UP5 A;  1TNX A;  4PDZ A;  3SG6 A;  1B8R A;  3SG7 A;  1IGV A;  1NX0 A;  1A4P A;  1SCV A;  4C0J A;  1KFU S;  3DY9 A;  2LAN A;  3TUY B;  1CLB A;  2LHL A;  2KOT A;  1YX7 A;  3GK4 X;  4D1E A;  1XFU O;  2MRD A;  1KQM B;  1NCY A;  3R1V A;  4MBE A;  3TUY C;  4DUQ A;  2PMY A;  3JVT B;  3O78 A;  3PN7 C;  3EK7 A;  1M31 A;  3JVT C;  2WC5 A;  1OZS A;  1NWD A;  3CAB A;  3LK0 A;  1S5G Y;  1TCF A;  2CCM A;  2BKI B;  1JC2 A;  3TZ1 A;  2PAS A;  2MHH A;  2EC6 B;  2WCJ A;  2B1U A;  4MN0 A;  1BF5 A;  1SBJ A;  1TOP A;  4U8D A;  1ALV A;  5PAL A;  4INX A;  2JXL A;  3KEV A;  4WRI A;  1OQP A;  2KYF A;  2CTN A;  3EKH A;  2WCF A;  1UUR A;  3OBV A;  1K94 A;  4M2O A;  2SCP A;  4GGN A;  2A4J A;  1KK8 B;  1AK8 A;  1REC A;  2FCD A;  2ZNE A;  2BCA A; 
#chains in the Genus database with same CATH homology
 3PFV A;  1F54 A;  4GNK B;  1E8A A;  2LUX A;  4OR9 B;  1J7Q A;  4MZJ A;  1KK7 Y;  3ZNI A;  2BKH B;  2L2E A;  4YI8 A;  2ZN9 A;  1ZAC A;  2OTG B;  4P2Y B;  1EXR A;  1NCX A;  1C7W A;  3SG3 A;  1ZOT B;  1MR8 A;  3SIB A;  2OTG C;  4C0K A;  1PSB A;  1XK4 A;  4YBH B;  1F8H A;  4L9M A;  1QXP A;  1MF8 B;  2M8U A;  3ZWH A;  2H61 A;  3OX5 A;  3LK1 A;  5KU1 A;  1GGW A;  2BCB A;  2JC2 A;  1OZO A;  2JTT A;  1CM1 A;  2K7D A;  1XYD A;  2F33 A;  1K96 A;  3MSE B;  1XFV O;  2BBM A;  4QJ5 B;  1XA5 A;  1QIV A;  1B1G A;  2M49 B;  3BOW B;  2Y1M A;  1EG4 A;  1L2O B;  4TNC A;  3H4S E;  1CFF A;  3IQQ A;  1R2U A;  2L0P A;  1UHH A;  3QRX A;  4IL1 A;  4MEW A;  2EHB A;  2G2B A;  2KI4 C;  4I5L B;  1S6I A;  1WDC C;  1JF0 A;  2E6W A;  1M45 A;  3BUX B;  2LLS A;  3CR2 A;  4PE0 A;  2BL0 C;  2M1U A;  1DJX A;  1XO5 A;  1S26 D;  3OHM B;  1BOC A;  3EK8 A;  1F71 A;  5J3X A;  1QX5 B;  2G9B A;  4BY4 A;  3TS5 B;  1RWY A;  1N2D A;  1FI5 A;  2L51 A;  1YX8 A;  2AMI A;  2LMU A;  1SCM C;  2Q91 A;  3DVM A;  1KCY A;  1OMR A;  1NSH A;  1DJY A;  1YUS A;  2I7A A;  2R2I A;  2BBN A;  3TS5 C;  1YRT B;  4YGE B;  5ER5 A;  1UHN A;  4QJ3 B;  4ORC B;  1KFX L;  1PVB A;  1K93 D;  2BEC A;  4MVF A;  4OVN F;  1IRJ A;  4GGF A;  1BLQ A;  2GGZ A;  1SMG A;  2LMV A;  3O2P A;  4ZCV A;  1SR6 B;  2OPO A;  2LV7 A;  3KF9 A;  1YUR A;  2HF5 A;  3DD4 A;  1FI6 A;  3EKJ A;  1H8B A;  3CWG A;  1VRK A;  2JT8 A;  2WOR A;  1SL9 A;  2GGM A;  2PVB A;  2ZRS A;  4GUK A;  4WQ2 A;  2HQ8 A;  4YGD B;  4E68 A;  1R6P A;  1B8L A;  2KAX A;  4WQ3 A;  5HYD A;  2WND A;  1DF0 B;  1CMG A;  1NIW A;  1XK4 C;  3KO0 A;  1CFC A;  3AAJ A;  5F6T A;  4GBA A;  4PHM A;  1A03 A;  2KAY A;  1NX2 A;  2ZFD A;  1LXF C;  3KHE A;  2JNF A;  2H61 C;  1BG1 A;  1CDM A;  1QX2 A;  3LL8 B;  4NQG A;  3WHT B;  1KWO C;  4JPZ B;  3M0W A;  1B7T Z;  1K95 A;  3IF7 A;  1B4C A;  2KBM A;  3BOW A;  2JWW A;  2M0R A;  1JSA A;  5G08 A;  1WRL A;  1N65 A;  1G33 A;  2KFG A;  1BMO A;  1RFJ A;  1DTL A;  1JUO A;  1K9K A;  1S36 A;  1JBA A;  4MSP A;  3HX4 A;  1LA3 A;  1TNQ A;  3NSL A;  5AAN A;  5I8N A;  4N5X A;  1UWO A;  2NZ0 A;  1C7V A;  1B9A A;  1KQM C;  1QS7 A;  2HPS A;  4CID A;  1V1F A;  2I18 A;  1KQV A;  1S6C A;  1YVH A;  1YUT A;  3VRN A;  2M97 A;  4A4B A;  1BU3 A;  2V53 A;  2LCP A;  1RTP 1;  1S1E A;  2M9G A;  3A4U B;  4OKH A;  1ZFS A;  5FYX A;  1KSM A;  2I2R E;  2PSR A;  1OE9 B;  1QVI Z;  1J55 A;  2M3W A;  1HT9 A;  4PE1 A;  3SG4 A;  3BUW B;  2EC6 C;  2WOS A;  2L98 A;  1TCO B;  1NPQ A;  1YRU B;  4GFT A;  1J7P A;  2LC5 A;  1IH0 A;  5I2L A;  4I5N B;  3JTD B;  5DKQ A;  1AUI B;  4GGF C;  2F3Z A;  1RJV A;  1L7Z A;  2KI6 D;  3SJS A;  1KK8 C;  2K2A A;  2KFH A;  3EVU A;  5CPV A;  4AOM A;  1XFW O;  2LM5 A;  1UHJ A;  2LLU A;  1F4O A;  1LIN A;  2IS9 A;  2M1K B;  4PAL A;  4YGA A;  5KSZ A;  5HKZ A;  3FS7 A;  1SY9 A;  2FOT A;  2NLN A;  1K9P A;  3WHU B;  1KFU L;  2F2P A;  5AEQ A;  1AP4 A;  4M2Q A;  5CSF A;  1M46 A;  1LVC D;  2JQ6 A;  1DF0 A;  1XVJ A;  1OMV A;  2JT0 A;  1NX3 A;  3I5G B;  4NDD A;  1H4B A;  1XFZ O;  2JTZ A;  1MXE A;  2LAP A;  2BE4 A;  3GOF A;  4JQ0 D;  4MZK A;  2JT3 A;  1CFD A;  2NCO A;  2LP3 A;  2MBX A;  2Y4Q A;  5CSJ A;  3I5H B;  1YUU A;  2KYC A;  2JXC A;  3BUN B;  4C0L A;  2I94 A;  3PM8 A;  1EJ3 A;  3WXA A;  3I5H C;  2ISD A;  2D8N A;  1DVI A;  2FJU B;  3FIA A;  1AHR A;  1IQ3 A;  4Q04 A;  4ETO A;  2SAS A;  1CM4 A;  3OP0 A;  4OV2 A;  2L4H A;  1L2O C;  2KGB C;  1KFX S;  1DT7 B;  1MXL C;  4PE4 A;  5KTY A;  2L4I A;  2EGD A;  3DVJ A;  1M63 B;  3CR5 X;  1UUS A;  1XFX O;  2KSP A;  1DGU A;  1NP8 A;  1N0Y A;  1OMD A;  3TDZ A;  1X02 A;  3PLF B;  3OB2 B;  1QAT A;  1TTX A;  3CS1 A;  1DMO A;  1ZUZ A;  1JWD A;  4HSZ A;  2LVJ A;  3FWB A;  4YRU A;  2Q4U A;  2PAL A;  4HRE E;  2WCE A;  4FTG A;  5TNC A;  3TDI A;  4A4C A;  4UPG A;  2BCX A;  3NSK A;  2NXQ A;  1WRK A;  3NXA A;  1CKK A;  1A75 B;  4CPV A;  1NYA A;  3VRO A;  2CBL A;  2MLF C;  3CLN A;  2JRF A;  1K90 D;  2WCB A;  1Y0V H;  2BE6 A;  2AUC A;  2L5X B;  2LNK A;  1SR6 C;  4PHN A;  4DIR A;  2MAZ A;  1J1E A;  1C07 A;  3LCP C;  2FCE A;  1W7J B;  2LE9 B;  2KHN A;  2K2F A;  1QTX A;  2MLE C;  4N1F A;  2KAV A;  2K7B A;  1SL8 A;  4DRW A;  2Y1N A;  4I5K A;  4OCI A;  2KQ6 A;  2DOQ A;  2ZND A;  5JJG A;  2LHI A;  3EK4 A;  2K7O A;  3NSI A;  2LP2 A;  1MWN A;  2TN4 A;  2JZI A;  1F55 A;  1FPW A;  2K8M B;  5CSN A;  1M39 A;  2JU0 A;  2H2K A;  3CZT X;  3CR4 X;  1PUL A;  1S5G Z;  1KSO A;  1NUB A;  1JFK A;  1WLZ A;  1Y1U A;  1TIZ A;  2LVK A;  4YI9 A;  2KBI A;  1Q80 A;  1SRA A;  3DF0 B;  1D1O A;  5DKR A;  1SW8 A;  4XYN A;  2P6B B;  3OX6 A;  5GQQ C;  3SG2 A;  1WLM A;  1DJI A;  5HLV A;  1PSR A;  3K21 A;  1K9U A;  1DJW A;  3A8R A;  1B47 A;  3NSO A;  1BR1 B;  1SL7 A;  4AQJ A;  4MRY A;  1SK6 D;  4ORB B;  2AAO A;  2QPT A;  1GQM A;  4YGB B;  4PE7 A;  1EL4 A;  1YTZ C;  1KK7 Z;  3KPX A;  1BOD A;  1IQ5 A;  4PHK A;  1TRF A;  2KI6 C;  3VRP A;  1EG3 A;  2JOJ A;  1TNW A;  1OOJ A;  1A75 A;  3PN7 B;  4I5J A;  1F4Q A;  5HLO A;  1CNP A;  2KFF A;  1IWQ A;  1B7T Y;  2RGI A;  2K7C A;  2LVV A;  4F0Z B;  1FW4 A;  1B8C A;  1NX1 A;  3JTD C;  1CDP A;  3BUO B;  3SG5 A;  1SPY A;  2LLT A;  2JNX A;  3I5F B;  5D7F A;  3VRR A;  1BR4 B;  1S6J A;  4HRH A;  3VGO A;  4R1E A;  1QV1 A;  3I5F C;  1CB1 A;  3BXK A;  4NDC A;  1F70 A;  2O60 A;  1MHO A;  1V1G A;  2CNP A;  2KDH A;  4JWQ A;  5AFP A;  3D0Y B;  1DJG A;  1ALW A;  4HRG A;  1ODB A;  3DVK A;  3EVR A;  4PCW A;  1TNP A;  1EH2 A;  3BUM B;  3PAT A;  3I5G C;  4USL A;  2JPT A;  1RK9 A;  3PAL A;  1U5I B;  1QVI Y;  3FWC A;  2KGR A;  1SNL A;  2LMT A;  3CGA A;  4ICB A;  1SKT A;  3RM1 A;  3AAK A;  3F45 A;  2HET A;  5AXI A;  2F8P A;  1J7R A;  1OSA A;  2CT9 A;  1A29 A;  1J1D A;  2VRG A;  2COL B;  2Y5I A;  1DJH A;  3AKB A;  4QJ4 B;  1J7O A;  2NCP A;  2PRU A;  5I2O A;  3PSR A;  1XFY O;  1CLM A;  4CFR A;  4ZCU A;  4MZL A;  3E3R A;  3DF0 A;  4YGC B;  1PRW A;  1S3P A;  4XJK B;  3BYA A;  3IQO A;  1Y1A A;  1CMF A;  1G4Y R;  2M7N A;  1K2H A;  1LKJ A;  3GK1 A;  5CSI A;  1IG5 A;  2LUC A;  1WY9 A;  1IKU A;  3CTN A;  1YVL A;  1PAL A;  1TN4 A;  1MQ1 A;  3RLZ A;  1JFJ A;  1QLS A;  2KI4 B;  2MA2 A;  1QV0 A;  1Y6W A;  1IJ5 A;  1WDC B;  2E30 A;  3O6B A;  1HQV A;  1YR5 A;  5B8I B;  2CXJ A;  4ORA B;  4GAO A;  4BY5 A;  1SYM A;  2QAC A;  2LVI A;  2BL0 B;  3I5I B;  3EVV A;  5DKN A;  3GK2 A;  1G8I A;  1Y1X A;  5D69 A;  3I5I C;  2M7L A;  2F2O A;  1GJY A;  3WNX B;  1SCM B;  1AJ4 A;  1LA0 A;  2L50 A;  4FQO A;  3OB1 B;  3VRQ A;  5AER A;  1CFP A;  3AKA A;  1BT6 A;  1GGZ A;  1CDN A;  1QAS A;  2KNE A;  4AQI A;  1QLK A;  1QIW A;  2MJW B;  1DJZ A;  1QJT A;  4DCK A;  3D0Y A;  1K8U A;  4CLN A;  1UHI A;  4CFQ A;  2KQY A;  5BPJ A;  1AJ5 A;  1CLL A;  1WRZ A;  1QX7 A;  2O5G A;  3O4Y A;  4NDB A;  1CTR A;  4P5O E;  3SIA A;  3ICB A;  4N1G A;  1IJ6 A;  1U5I A;  1PVA A;  1NCZ A;  2HQW A;  2OS8 B;  3TDU A;  2GV5 A;  1FF1 A;  2K0J A;  4GPL B;  5HKY A;  1BJF A;  4PHJ A;  5IBW A;  3C1V A;  1PK0 D;  4MLW A;  1W7I B;  1RRO A;  2OS8 C;  3HCM A;  2ZN8 A;  1MUX A;  4DS7 A;  1AVS A;  2ZRT A;  1UHK A;  2ZKM X;  5ER4 X;  2WC8 A;  5HKW A;  3DVE A;  2K61 A;  1JF2 A;  4MRX A;  1FBV A;  5I2Q A;  5K89 A;  2JUL A;  3BQ3 A;  1KWO B;  4XJK A;  1A2X A;  2M29 A;  5JOL A;  2F3Y A;  3D10 A;  4M2P A;  3LLE A;  1CDL A;  1DGV A;  1ZMZ A;  1UP5 A;  1TNX A;  4PDZ A;  3SG6 A;  1B8R A;  3SG7 A;  1IGV A;  1NX0 A;  1A4P A;  1SCV A;  4C0J A;  1KFU S;  2LAN A;  3TUY B;  1CLB A;  2LHL A;  2KOT A;  1YX7 A;  3GK4 X;  4D1E A;  1XFU O;  2MRD A;  1KQM B;  1NCY A;  4MBE A;  3TUY C;  4DUQ A;  2PMY A;  3JVT B;  3O78 A;  3PN7 C;  3EK7 A;  1M31 A;  3JVT C;  1OZS A;  1NWD A;  3LK0 A;  1S5G Y;  1TCF A;  2CCM A;  2BKI B;  1JC2 A;  3TZ1 A;  2PAS A;  2MHH A;  2EC6 B;  2B1U A;  4MN0 A;  1BF5 A;  1SBJ A;  1TOP A;  4U8D A;  1ALV A;  5PAL A;  2JXL A;  3KEV A;  4WRI A;  1OQP A;  2KYF A;  2CTN A;  3EKH A;  2WCF A;  1UUR A;  4M2O A;  1K94 A;  2SCP A;  4GGN A;  2A4J A;  1KK8 B;  1AK8 A;  1REC A;  2FCD A;  2ZNE A;  2BCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...