1IG5A

Bovine calbindin d9k binding mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN, INTESTINAL
publication title Structural basis for the negative allostery between Ca(2+)- and Mg(2+)-binding in the intracellular Ca(2+)-receptor calbindin D9k.
pubmed rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ig5A00
1S26D 1EG3A 1RECA 3OX6A 2KBMA 2MHHA 2JTTA 1SRAA 4NDCA 2K7BA 2P6BB 2BL0C 1IKUA 2QPTA 3PALA 1F70A 1YUSA 1IWQA 1PK0D 1K95A 1QTXA 1NCYA 1LVCD 3LCPC 5ER4X 2KHNA 5GQQC 4CLNA 1QJTA 1OMRA 2HF5A 2LMUA 3EKJA 4TNCA 1XFYO 1N65A 1JF0A 2KNEA 3GK4X 3BUOB 2SASA 1QXPA 1IJ5A 3OB2B 4I5JA 2Y1NA 5G08A 3KEVA 3E3RA 2K7DA 1PULA 1YVLA 3LK1A 1X02A 3DF0B 4Q04A 4WQ2A 1JUOA 3I5GB 3VRQA 1U5IB 1A03A 2CXJA 1CFDA 1EG4A 1ZOTB 4MZJA 3I5HC 4YGCB 5KU1A 3HCMA 4C0LA 1LKJA 3BOWA 3WNXB 3CR2A 2JNFA 1R6PA 5HLOA 3BQ3A 5CSFA 5D7FA 5ER5A 3EVVA 2AAOA 1QASA 3TS5C 4M2PA 4ORAB 4C0JA 2K2AA 2KI6D 3A4UB 2IS9A 3PSRA 1DGVA 4PALA 4QJ3B 1BLQA 3FWCA 1FI5A 1ALVA 1BU3A 3KHEA 4YGAA 5HKYA 4GGFC 2KAVA 2CCMA 3CGAA 2K7OA 1UP5A 1CFCA 1J1DA 3BUNB 1NCZA 2PMYA 2JRFA 3OHMB 4R1EA 3VROA 1DT7B 2LNKA 1Y1XA 2BL0B 5DKQA 2K2FA 2CTNA 2L4IA 2KFGA 1AJ5A 2MBXA 4PE4A 5CSIA 1WY9A 1CDMA 4OR9B 1BR1B 1SR6C 1M31A 2MJWB 4XJKB 1AUIB 2AMIA 2K61A 1L2OC 2M7NA 5K89A 3PM8A 1CM4A 1GGZA 1PSBA 2LUXA 1S6IA 3VRPA 4MN0A 2RGIA 5I2LA 1M46A 1PSRA 1F4OA 3I5HB 2LLSA 4C0KA 3OP0A 2E6WA 3DD4A 3SG5A 1DF0A 1Q80A 2M1UA 4P2YB 1SNLA 1DJWA 1TNPA 3F45A 1WRLA 3TS5B 1S5GY 2LHLA 3KF9A 2I18A 2M9GA 1KWOC 1XO5A 3SG3A 5FYXA 1TNWA 2LP3A 2NCPA 1CDNA 2QACA 2LC5A 3D10A 3TZ1A 1S6JA 2KBIA 4YGDB 3FS7A 2Y4QA 1IJ6A 1MWNA 1R2UA 5CSNA 2ZN8A 1K9UA 1BG1A 1PVBA 1TOPA 2JT8A 2JXLA 2ZRTA 1UUSA 1NYAA 2NLNA 2HQWA 5AXIA 1AHRA 1CLLA 4MVFA 5JJGA 1N0YA 3PATA 2PRUA 2WCFA 1M63B 4AQJA 3FWBA 1WLMA 1SR6B 3DVKA 1QS7A 1WRKA 3DVJA 1L2OB 3KO0A 3CZTX 1A75B 3D0YB 2JXCA 1H4BA 1DJYA 3PN7B 2JT0A 1NIWA 1AK8A 2LVKA 1KK7Y 1LXFC 5D69A 3CWGA 1DJIA 2JOJA 2ZKMX 2LUCA 2R2IA 3AKBA 1ZFSA 1KCYA 4I5KA 1KSMA 1FBVA 1LA3A 1CMGA 1G8IA 4PE0A 4DCKA 1WLZA 1BOCA 1CTRA 4PDZA 2PSRA 1JF2A 1UHKA 1C7VA 1PVAA 2MLEC 2KQ6A 1DMOA 2BCAA 2FOTA 4QJ4B 1KWOB 2BECA 1XFXO 1UHNA 2MRDA 2OTGC 4CFQA 4DS7A 2L5XB 2F3ZA 1V1FA 5F6TA 2OS8C 1C7WA 1RJVA 3DF0A 1OMVA 1U5IA 1TNXA 1CFPA 3H4SE 1Y1UA 2A4JA 5B8IB 1ZMZA 2Q91A 1SYMA 2FJUB 1GGWA 2LMTA 1YURA 1TNQA 1M39A 1NUBA 1J7RA 1OQPA 2BBMA 3K21A 3OX5A 4NDDA 4ZCVA 1QLKA 1UWOA 4PHNA 3NSOA 1TIZA 2M8UA 3EK4A 3CTNA 3OB1B 1BJFA 1DTLA 1J1EA 1M45A 1SCMC 4ZCUA 5TNCA 1K2HA 1NX1A 3JTDC 1JBAA 4CIDA 1E8AA 4YBHB 5DKNA 2ZNDA 2Y5IA 3TUYC 1S3PA 4USLA 1UHHA 2WOSA 1B7TZ 1SPYA 3VRNA 1SMGA 2F8PA 2BCXA 2KI6C 2ZFDA 2FCEA 1XA5A 1XK4C 2BCBA 2ZN9A 1OZSA 5I8NA 1A29A 1K94A 4XJKA 2LM5A 1YTZC 2B1UA 2LE9B 2OTGB 3ICBA 3SG4A 2KOTA 3SJSA 2LLTA 2F3YA 2OS8B 3QRXA 1A2XA 2F2OA 2MAZA 4WQ3A 4YGEB 2KAXA 2O5GA 2L50A 3GK1A 3O78A 1MQ1A 4AOMA 1B8RA 1S36A 3FIAA 1ODBA 1IG5A 1BT6A 1L7ZA 3TDIA 1SK6D 3I5IC 3TDZA 4OVNF 2KGBC 1J7PA 2JWWA 2L4HA 2GV5A 2L98A 1IQ3A 1SCMB 3SIAA 3BXKA 5JOLA 1KK8C 1RFJA 1CMFA 1XFVO 3JTDB 2I94A 5HKZA 1SL9A 3NXAA 2PALA 1B8CA 1UHIA 3DVEA 2BKIB 2LCPA 1KFUL 1DJXA 2KYCA 3TUYB 1FW4A 2Y1MA 3TDUA 2F2PA 4I5NB 4YI8A 2BBNA 1ALWA 2PVBA 1G4YR 3I5FC 1A4PA 5BPJA 2OPOA 2GGZA 1QVIY 3AAJA 3O6BA 3PLFB 1K9KA 4ETOA 1ZUZA 2KSPA 4BY4A 3MSEB 1NP8A 2M1KB 3DVMA 1A75A 3D0YA 2PASA 2EGDA 2G2BA 2COLB 4NQGA 3BUMB 4UPGA 2NZ0A 1G33A 1B47A 1J55A 4N1FA 2M0RA 3EK7A 4FTGA 3JVTC 4MLWA 3SG6A 4DRWA 2LAPA 3LL8B 4HREE 4ORCB 4PHJA 2LVIA 3GOFA 1EXRA 1Y1AA 1B1GA 1CLMA 1YR5A 2O60A 1D1OA 1WDCC 1H8BA 1EL4A 1LINA 1QV0A 4GFTA 2H61C 1JFKA 2I2RE 1OMDA 2KI4C 3I5IB 4N1GA 2LHIA 1NX2A 2M3WA 1TCFA 2EHBA 2BE4A 2HQ8A 1YVHA 1DJZA 2NXQA 4PHKA 2K8MB 4CPVA 4D1EA 2G9BA 3SG7A 1MF8B 1CLBA 4HRHA 3WHUB 4GNKB 4ORBB 1DJHA 4PCWA 1KK8B 1DVIA 5AEQA 3RLZA 4MSPA 1IH0A 1Y6WA 4MEWA 3CS1A 5IBWA 5KSZA 2L0PA 2M97A 4N5XA 5CPVA 1EH2A 1JSAA 2DOQA 1QX2A 2SCPA 2JNXA 1AVSA 5CSJA 4BY5A 2BKHB 1HQVA 1S5GZ 1F8HA 2M7LA 2NCOA 1NX3A 4JWQA 1XVJA 3HX4A 4PE7A 1XFZO 2AUCA 2LMVA 1FPWA 4GUKA 2KFFA 4PE1A 3I5FB 1BMOA 2JC2A 3NSIA 4YRUA 1MUXA 1JWDA 1FI6A 1IGVA 1W7JB 2CT9A 2HETA 2ZNEA 2ZRSA 3EVRA 4U8DA 4AQIA 4CFRA 4DUQA 3O4YA 1RWYA 4MBEA 3WXAA 3JVTB 1V1GA 1J7QA 4PHMA 2JU0A 3LLEA 1QATA 1WDCB 1YUUA 1QIVA 1SKTA 3VGOA 4JQ0D 1TCOB 5AANA 1KFXS 1HT9A 1K9PA 2K7CA 2KI4B 2LVVA 1OZOA 2JT3A 5AFPA 1KQMC 1KFXL 4YGBB 4GPLB 3BUWB 1KK7Z 1LA0A 3EKHA 4HSZA 1XFUO 1OOJA 3EVUA 4DIRA 4MRYA 3CR4X 2CBLA 2WCEA 1QV1A 2M49B 2JQ6A 3AAKA 2LV7A 3AKAA 1KQVA 3KPXA 1IRJA 1J7OA 1BODA 1OSAA 1XFWO 3PFVA 1N2DA 1RROA 1AP4A 1BR4B 1DGUA 1QIWA 1KSOA 1XYDA 4ICBA 1TN4A 2D8NA 1PRWA 1QX7A 1UURA 1K90D 1MXLC 5HKWA 1SL8A 1K93D 1CDPA 1CNPA 1SW8A 2L51A 1Y0VH 1ZACA 1B9AA 1VRKA 1UHJA 3BOWB 4L9MA 2KYFA 2KDHA 1CKKA 5KTYA 1QLSA 1YX8A 2KAYA 5AERA 1F55A 4MZLA 4GGNA 3RM1A 1CB1A 1JC2A 2LLUA 3M0WA 1YUTA 4NDBA 4FQOA 2M29A 4OKHA 5J3XA 1YRTB 1XK4A 2CNPA 4GGFA 4M2QA 2I7AA 3WHTB 2WNDA 1PALA 1KQMB 4OV2A 2ISDA 1F4QA 2KFHA 2LVJA 2HPSA 2KGRA 2GGMA 1KFUS 2JULA 1QX5B 4IL1A 1GJYA 2WORA 3GK2A 3PN7C 4F0ZB 4E68A 5HLVA 2EC6C 1B8LA 2JZIA 2H2KA 1CM1A 1CDLA 1S1EA 3NSLA 2MA2A 3SG2A 3ZWHA 2TN4A 2LANA 2V53A 2FCDA 3LK0A 1EJ3A 1RK9A 3CLNA 2K0JA 4MZKA 2LP2A 2MLFC 1GQMA 1W7IB 1BF5A 1K96A 1TRFA 4MRXA 2WC8A 5I2QA 5DKRA 1AJ4A 1RTP1 1NPQA 1JFJA 2WCBA 1MR8A 1DF0B 3C1VA 1OE9B 5I2OA 2JTZA 2L2EA 3BUXB 1S6CA 2E30A 1SY9A 3A8RA 1FF1A 1SBJA 1YX7A 2F33A 3O2PA 4HRGA 4YI9A 1K8UA 1F54A 3BYAA 3NSKA 3VRRA 4QJ5B 3I5GC 3IF7A 2KQYA 1NCXA 1MXEA 3EK8A 2JPTA 1WRZA 2BE6A 2Q4UA 3IQQA 1IQ5A 5HYDA 4GBAA 2VRGA 4A4BA 4M2OA 2EC6B 1CFFA 1DJGA 3CR5X 1MHOA 4WRIA 1SL7A 1TTXA 1QVIZ 3IQOA 4I5LB 1NSHA 4XYNA 1SCVA 1B7TY 3ZNIA 1NWDA 2H61A 4JPZB 4OCIA 1NX0A 1C07A 1F71A 4P5OE 1YRUB 5PALA 1B4CA 4A4CA 3SIBA 4GAOA
chains in the Genus database with same CATH superfamily
1S26D 1EG3A 1RECA 3OX6A 2KBMA 2MHHA 3N7HA 2JTTA 1SRAA 4NDCA 2K7BA 2P6BB 2KLDA 2BL0C 1IKUA 2QPTA 3PALA 1F70A 1YUSA 1IWQA 1PK0D 1K95A 1QTXA 1NCYA 1LVCD 3LCPC 5ER4X 3QMEA 2KHNA 5GQQC 3D76A 4CLNA 1QJTA 1OMRA 2HF5A 2LMUA 3EKJA 3L4LA 4TNCA 1XFYO 1N65A 1JF0A 2KNEA 3GK4X 3BUOB 2SASA 1QXPA 1IJ5A 1P28A 3OB2B 2Y1NA 3B86A 3KEVA 4I5JA 5G08A 3E3RA 5FI2A 2K7DA 1PULA 1YVLA 3LK1A 1X02A 3DF0B 4Q04A 4WQ2A 1JUOA 3I5GB 3VRQA 1U5IB 1A03A 2CXJA 1CFDA 1EG4A 1ZOTB 4MZJA 3I5HC 4YGCB 5KU1A 3HCMA 4C0LA 1LKJA 3BOWA 3WNXB 4IJ7A 3CR2A 2JNFA 1R6PA 5HLOA 3BQ3A 5CSFA 5D7FA 5ER5A 2FJYA 3EVVA 2AAOA 1QASA 3DZTA 3TS5C 4M2PA 4ORAB 4C0JA 2K2AA 2KI6D 3DXLA 3A4UB 2IS9A 1TUJA 3PSRA 4DUQA 1DGVA 4PALA 4QJ3B 1BLQA 3FWCA 1FI5A 1ALVA 1BU3A 3KHEA 4YGAA 5HKYA 4GGFC 2KAVA 2CCMA 3CGAA 2K7OA 1UP5A 3CABA 1CFCA 1J1DA 3BUNB 5EL2A 1NCZA 2PMYA 2JRFA 3OHMB 4R1EA 3VROA 1DT7B 2LNKA 1Y1XA 1OOFA 2BL0B 5DKQA 2K2FA 2CTNA 2L4IA 2KFGA 1AJ5A 2MBXA 3L4AA 3R1PA 4PE4A 5CSIA 1WY9A 1CDMA 4OR9B 1BR1B 1SR6C 1M31A 2MJWB 1DEKA 4XJKB 1AUIB 2AMIA 2K61A 1L2OC 2M7NA 5K89A 3PM8A 1CM4A 1GGZA 3FE9A 1PSBA 2LUXA 1S6IA 3VRPA 4MN0A 2RGIA 5I2LA 1M46A 2ERBA 1PSRA 1F4OA 3I5HB 2LLSA 4C0KA 3OP0A 2E6WA 3DD4A 3SG5A 1DF0A 1Q80A 2M1UA 4P2YB 1SNLA 1DJWA 3D78A 1TNPA 3F45A 1WRLA 3S0GA 3TS5B 3NHTA 1S5GY 2LHLA 3KF9A 2I18A 2M9GA 1KWOC 1XO5A 3SG3A 5FYXA 1TNWA 2LP3A 2NCPA 1CDNA 2QACA 2LC5A 3D10A 3TZ1A 1S6JA 2KBIA 4YGDB 3FS7A 3D74A 2Y4QA 1IJ6A 1MWNA 2K60A 1R2UA 5CSNA 2ZN8A 1K9UA 1BG1A 1PVBA 1TOPA 2JT8A 2JXLA 2ZRTA 1UUSA 1NYAA 2NLNA 2HQWA 4FQTA 1AHRA 5AXIA 1CLLA 4MVFA 2GTEA 1N0YA 5JJGA 3PATA 2QEOA 2PRUA 2WCFA 3CZ1A 1M63B 4AQJA 3FWBA 1WLMA 1SR6B 3DVKA 3CZ0A 1QS7A 1WRKA 3R1OA 3DVJA 1L2OB 3KO0A 3S0BA 3CZTX 1A75B 3D0YB 2JXCA 1H4BA 1DJYA 3PN7B 2JT0A 1NIWA 1AK8A 2LVKA 1KK7Y 1LXFC 5D69A 2P71A 3CWGA 1DJIA 2JOJA 2ZKMX 2LUCA 2R2IA 3AKBA 1ZFSA 1XFRA 1KCYA 4I5KA 1KSMA 1FBVA 1LA3A 1CMGA 1G8IA 4PE0A 4DCKA 1WLZA 1BOCA 1CTRA 2WCKA 4PDZA 2PSRA 1JF2A 1UHKA 1C7VA 1PVAA 2MLEC 2KQ6A 3IVTA 1DMOA 2BCAA 2FOTA 4QJ4B 1KWOB 2BECA 1XFXO 1UHNA 2MRDA 2OTGC 4CFQA 3UO9A 4DS7A 2L5XB 2F3ZA 1V1FA 5F6TA 2OS8C 1C7WA 1RJVA 3DF0A 1DQEA 1OMVA 1TNXA 1U5IA 2YGUA 3H4SE 1Y1UA 1CFPA 2A4JA 5B8IB 1ZMZA 1T14A 2Q91A 3PM2A 1SYMA 2FJUB 1GGWA 2LMTA 1YURA 1TNQA 1M39A 1NUBA 1J7RA 1OQPA 2BBMA 3K21A 3OX5A 4NDDA 4ZCVA 1QLKA 1UWOA 4PHNA 1TWOA 2QEVA 3NSOA 1TIZA 2L2CA 2M8UA 3EK4A 3CTNA 1SSEB 3OB1B 3EG5B 1BJFA 1DTLA 1J1EA 1M45A 1SCMC 3K1EA 5FI6A 4ZCUA 5TNCA 4JKTA 1K2HA 3S0AA 1NX1A 3JTDC 1JBAA 1CLBA 4CIDA 1E8AA 4YBHB 5DKNA 2ZNDA 2Y5IA 3TUYC 1S3PA 4USLA 1UHHA 2WOSA 1B7TZ 1SPYA 3VRNA 1SMGA 2F8PA 2BCXA 1OOHA 2KI6C 2ZFDA 2FCEA 1XA5A 1XK4C 3V2LA 2BCBA 2ZN9A 1OZSA 5I8NA 1A29A 4OZDA 1K94A 4XJKA 2LM5A 1YTZC 2B1UA 2LE9B 1OW4A 2OTGB 3ICBA 3SG4A 2KOTA 3SJSA 2LLTA 1OOGA 2F3YA 3PJIA 2OS8B 3QRXA 5FI7A 1A2XA 1OOIX 2WCHA 3BFBA 2F2OA 2MAZA 4WQ3A 4YGEB 2KAXA 3DYEA 2O5GA 2L50A 3GK1A 3O78A 1MQ1A 4AOMA 1B8RA 1S36A 3NGVA 3FIAA 3BJHA 1ODBA 1IG5A 1BT6A 1L7ZA 3TDIA 1SK6D 3I5IC 3TDZA 3L47A 4OVNF 2KGBC 1J7PA 2JWWA 2L4HA 2GV5A 2L98A 1IQ3A 3B6XA 1SCMB 3SIAA 3BXKA 5JOLA 1KK8C 1RFJA 1CMFA 1XFVO 3JTDB 2I94A 5HKZA 1SL9A 3NXAA 2PALA 1B8CA 3D77A 1UHIA 3DVEA 4INWA 2BKIB 2LCPA 1KFUL 1DJXA 2KYCA 3TUYB 1FW4A 2Y1MA 3TDUA 2F2PA 2WC5A 4I5NB 4YI8A 2BBNA 3RZSA 1ALWA 3B88A 3VB1A 2PVBA 1G4YR 3I5FC 1A4PA 5BPJA 2OPOA 3B7AA 2GGZA 1QVIY 2WCLA 3AAJA 3O6BA 3CZ2A 1K9KA 3PLFB 4ETOA 1ZUZA 2KSPA 4BY4A 3MSEB 1NP8A 2M1KB 3DVMA 1A75A 3D0YA 2PASA 2EGDA 2G2BA 2PYQA 2COLB 4NQGA 3BUMB 4UPGA 2NZ0A 1G33A 1ORGA 1B47A 1J55A 4N1FA 2M0RA 3EK7A 4FTGA 3JVTC 4MLWA 3SG6A 4DRWA 2LAPA 3LL8B 4HREE 4ORCB 4PHJA 2LVIA 3GOFA 1EXRA 1Y1AA 3R1VA 1B1GA 1CLMA 1YR5A 2O60A 2QEHA 1WDCC 1D1OA 1EL4A 1H8BA 1LINA 1QV0A 4GFTA 2H61C 1JFKA 1Z2CB 2I2RE 1OMDA 2KI4C 3I5IB 1IIOA 4N1GA 2LHIA 1NX2A 2M3WA 1TCFA 2EHBA 2BE4A 2HQ8A 1YVHA 1DJZA 1LS8A 2NXQA 2K8MB 2KPHA 4PHKA 2G9BA 2PQLA 1MF8B 3SG7A 4CPVA 4D1EA 4HRHA 3WHUB 4GNKB 4ORBB 1DJHA 4PCWA 1KK8B 1DVIA 5AEQA 2WCJA 3SS4A 3RLZA 4MSPA 1IH0A 1Y6WA 4MEWA 3CS1A 5IBWA 5KSZA 2L0PA 2M97A 4N5XA 5CPVA 1EH2A 1JSAA 2DOQA 1QX2A 2SCPA 2JNXA 1AVSA 5CSJA 4BY5A 1HQVA 1S5GZ 2BKHB 1F8HA 2M7LA 2NCOA 1NX3A 4JWQA 1XVJA 3B87A 3HX4A 4PE7A 1XFZO 2AUCA 5I94A 2LMVA 1FPWA 3FE8A 4GUKA 2KFFA 4PE1A 3I5FB 1BMOA 2JC2A 3CYZA 3D73A 3NSIA 4YRUA 1MUXA 1JWDA 3CDNA 1FI6A 1GM0A 1IGVA 1W7JB 1TUZA 2CT9A 2HETA 1QWVA 2ZNEA 2ZRSA 3EVRA 4U8DA 4AQIA 4CFRA 3BFAA 3O4YA 1RWYA 4MBEA 3WXAA 3JVTB 1V1GA 1J7QA 4PHMA 2JU0A 3LLEA 1DC1A 4PT1A 1QATA 1WDCB 1YUUA 1QIVA 1SKTA 3VGOA 4JQ0D 1TCOB 5AANA 1KFXS 1HT9A 1K9PA 2K7CA 2KI4B 2LVVA 1OZOA 2JT3A 5AFPA 1KQMC 1KFXL 4YGBB 4GPLB 3BUWB 1C3ZA 1KK7Z 1LA0A 3EKHA 4HSZA 1XFUO 1OOJA 3EVUA 4DIRA 4MRYA 3UNWA 2WCMA 2CBLA 3CR4X 2WCEA 1QV1A 2M49B 2JQ6A 3AAKA 2LV7A 3AKAA 3D75A 2KLEA 1KQVA 3KPXA 1IRJA 1J7OA 1DELA 1W9ZA 2BAPA 1BODA 1OSAA 1XFWO 3PFVA 1N2DA 1RROA 1AP4A 1BR4B 1DGUA 1QIWA 1KSOA 1XYDA 3OBVA 1TN4A 2D8NA 1PRWA 4ICBA 1QX7A 1UURA 4JD9A 1K90D 1MXLC 2WC6A 5HKWA 1SL8A 1K93D 1CDPA 1CNPA 1SW8A 2L51A 1Y0VH 1ZACA 1B9AA 1VRKA 1UHJA 3BOWB 4L9MA 2KYFA 2KDHA 3SS5A 1CKKA 5KTYA 1QLSA 1YX8A 2KAYA 5AERA 1F55A 4MZLA 4GGNA 3RM1A 1CB1A 1JC2A 2LLUA 3M0WA 1YUTA 2JPOA 2P70A 4NDBA 4FQOA 2M29A 4OKHA 5J3XA 1YRTB 1XK4A 3FE6A 2CNPA 4GGFA 4M2QA 2I7AA 3WHTB 2WNDA 5HL1A 1PALA 1KQMB 4OV2A 2ISDA 1F4QA 2KFHA 2LVJA 2HPSA 2KGRA 2GGMA 1KFUS 3SS3A 3Q8IA 2JULA 2QDIA 1QX5B 3OGNA 3BFHA 4IL1A 1GJYA 2WORA 2L5YA 5DICA 3S0FA 1C3YA 3GK2A 3PN7C 3R72A 4F0ZB 4E68A 5HLVA 2EC6C 1B8LA 2JZIA 2H2KA 1CM1A 1CDLA 1S1EA 2QEBA 3NSLA 2MA2A 3SG2A 3ZWHA 2TN4A 2LANA 2V53A 2FCDA 3LK0A 1EJ3A 1RK9A 3CLNA 2K0JA 4MZKA 2LP2A 2MLFC 1GQMA 1W7IB 3S0DA 4KYNA 1K96A 1BF5A 1TRFA 2H8VA 2BNXA 4MRXA 2WC8A 4F7FA 5I2QA 5DKRA 1AJ4A 1RTP1 1NPQA 1JFJA 2WCBA 1MR8A 1DF0B 3C1VA 1OE9B 5I2OA 4INXA 2JTZA 2L2EA 3BUXB 1S6CA 2E30A 3NHIA 1SY9A 3A8RA 1FF1A 1SBJA 1YX7A 2F33A 1Z4HA 3O2PA 4HRGA 4YI9A 1K8UA 1F54A 3BYAA 3NSKA 3VRRA 4QJ5B 3I5GC 3IF7A 2KQYA 1NCXA 1MXEA 3EK8A 2JPTA 3O4XA 1WRZA 2BE6A 2Q4UA 3DY9A 3IQQA 1IQ5A 5HYDA 4GBAA 2VRGA 4A4BA 4M2OA 2EC6B 1CFFA 1DJGA 3CR5X 1MHOA 4WRIA 1SL7A 1TTXA 1QVIZ 3IQOA 4I5LB 1NSHA 3S0EA 4XYNA 1SCVA 1B7TY 3ZNIA 1NWDA 2H61A 4JPZB 4OCIA 1NX0A 5D3OA 1C07A 1F71A 4P5OE 1YRUB 5PALA 1B4CA 4A4CA 3SIBA 4GAOA
chains in the Genus database with same CATH topology
1S26D 1EG3A 1RECA 3OX6A 2KBMA 2MHHA 2JTTA 1SRAA 4NDCA 2K7BA 2P6BB 2BL0C 1IKUA 2QPTA 3PALA 1F70A 1YUSA 1IWQA 1PK0D 1K95A 1QTXA 1NCYA 1LVCD 3LCPC 5ER4X 2KHNA 5GQQC 4CLNA 1QJTA 1OMRA 2HF5A 2LMUA 3EKJA 4TNCA 1XFYO 1N65A 1JF0A 2KNEA 3GK4X 3BUOB 2SASA 1QXPA 1IJ5A 3OB2B 4I5JA 2Y1NA 5G08A 3KEVA 3E3RA 2K7DA 1PULA 1YVLA 3LK1A 1X02A 3DF0B 4Q04A 4WQ2A 1JUOA 3I5GB 3VRQA 1U5IB 1A03A 2CXJA 1CFDA 1EG4A 1ZOTB 4MZJA 3I5HC 4YGCB 5KU1A 3HCMA 4C0LA 1LKJA 3BOWA 3WNXB 3CR2A 2JNFA 1R6PA 5HLOA 3BQ3A 5CSFA 5D7FA 5ER5A 3EVVA 2AAOA 1QASA 3TS5C 4M2PA 4ORAB 4C0JA 2K2AA 2KI6D 3A4UB 2IS9A 3PSRA 1DGVA 4PALA 4QJ3B 1BLQA 3FWCA 1FI5A 1ALVA 1BU3A 3KHEA 4YGAA 5HKYA 4GGFC 2KAVA 2CCMA 3CGAA 2K7OA 1UP5A 1CFCA 1J1DA 3BUNB 1NCZA 2PMYA 2JRFA 3OHMB 4R1EA 3VROA 1DT7B 2LNKA 1Y1XA 2BL0B 5DKQA 2K2FA 2CTNA 2L4IA 2KFGA 1AJ5A 2MBXA 4PE4A 5CSIA 1WY9A 1CDMA 4OR9B 1BR1B 1SR6C 1M31A 2MJWB 4XJKB 1AUIB 2AMIA 2K61A 1L2OC 2M7NA 5K89A 3PM8A 1CM4A 1GGZA 1PSBA 2LUXA 1S6IA 3VRPA 4MN0A 2RGIA 5I2LA 1M46A 1PSRA 1F4OA 3I5HB 2LLSA 4C0KA 3OP0A 2E6WA 3DD4A 3SG5A 1DF0A 1Q80A 2M1UA 4P2YB 1SNLA 1DJWA 1TNPA 3F45A 1WRLA 3TS5B 1S5GY 2LHLA 3KF9A 2I18A 2M9GA 1KWOC 1XO5A 3SG3A 5FYXA 1TNWA 2LP3A 2NCPA 1CDNA 2QACA 2LC5A 3D10A 3TZ1A 1S6JA 2KBIA 4YGDB 3FS7A 2Y4QA 1IJ6A 1MWNA 1R2UA 5CSNA 2ZN8A 1K9UA 1BG1A 1PVBA 1TOPA 2JT8A 2JXLA 2ZRTA 1UUSA 1NYAA 2NLNA 2HQWA 5AXIA 1AHRA 1CLLA 4MVFA 5JJGA 1N0YA 3PATA 2PRUA 2WCFA 1M63B 4AQJA 3FWBA 1WLMA 1SR6B 3DVKA 1QS7A 1WRKA 3DVJA 1L2OB 3KO0A 3CZTX 1A75B 3D0YB 2JXCA 1H4BA 1DJYA 3PN7B 2JT0A 1NIWA 1AK8A 2LVKA 1KK7Y 1LXFC 5D69A 3CWGA 1DJIA 2JOJA 2ZKMX 2LUCA 2R2IA 3AKBA 1ZFSA 1KCYA 4I5KA 1KSMA 1FBVA 1LA3A 1CMGA 1G8IA 4PE0A 4DCKA 1WLZA 1BOCA 1CTRA 4PDZA 2PSRA 1JF2A 1UHKA 1C7VA 1PVAA 2MLEC 2KQ6A 1DMOA 2BCAA 2FOTA 4QJ4B 1KWOB 2BECA 1XFXO 1UHNA 2MRDA 2OTGC 4CFQA 4DS7A 2L5XB 2F3ZA 1V1FA 5F6TA 2OS8C 1C7WA 1RJVA 3DF0A 1OMVA 1U5IA 1TNXA 1CFPA 3H4SE 1Y1UA 2A4JA 5B8IB 1ZMZA 2Q91A 1SYMA 2FJUB 1GGWA 2LMTA 1YURA 1TNQA 1M39A 1NUBA 1J7RA 1OQPA 2BBMA 3K21A 3OX5A 4NDDA 4ZCVA 1QLKA 1UWOA 4PHNA 3NSOA 1TIZA 2M8UA 3EK4A 3CTNA 3OB1B 1BJFA 1DTLA 1J1EA 1M45A 1SCMC 4ZCUA 5TNCA 1K2HA 1NX1A 3JTDC 1JBAA 4CIDA 1E8AA 4YBHB 5DKNA 2ZNDA 2Y5IA 3TUYC 1S3PA 4USLA 1UHHA 2WOSA 1B7TZ 1SPYA 3VRNA 1SMGA 2F8PA 2BCXA 2KI6C 2ZFDA 2FCEA 1XA5A 1XK4C 2BCBA 2ZN9A 1OZSA 5I8NA 1A29A 1K94A 4XJKA 2LM5A 1YTZC 2B1UA 2LE9B 2OTGB 3ICBA 3SG4A 2KOTA 3SJSA 2LLTA 2F3YA 2OS8B 3QRXA 1A2XA 2F2OA 2MAZA 4WQ3A 4YGEB 2KAXA 2O5GA 2L50A 3GK1A 3O78A 1MQ1A 4AOMA 1B8RA 1S36A 3FIAA 1ODBA 1IG5A 1BT6A 1L7ZA 3TDIA 1SK6D 3I5IC 3TDZA 4OVNF 2KGBC 1J7PA 2JWWA 2L4HA 2GV5A 2L98A 1IQ3A 1SCMB 3SIAA 3BXKA 5JOLA 1KK8C 1RFJA 1CMFA 1XFVO 3JTDB 2I94A 5HKZA 1SL9A 3NXAA 2PALA 1B8CA 1UHIA 3DVEA 2BKIB 2LCPA 1KFUL 1DJXA 2KYCA 3TUYB 1FW4A 2Y1MA 3TDUA 2F2PA 4I5NB 4YI8A 2BBNA 1ALWA 2PVBA 1G4YR 3I5FC 1A4PA 5BPJA 2OPOA 2GGZA 1QVIY 3AAJA 3O6BA 3PLFB 1K9KA 4ETOA 1ZUZA 2KSPA 4BY4A 3MSEB 1NP8A 2M1KB 3DVMA 1A75A 3D0YA 2PASA 2EGDA 2G2BA 2COLB 4NQGA 3BUMB 4UPGA 2NZ0A 1G33A 1B47A 1J55A 4N1FA 2M0RA 3EK7A 4FTGA 3JVTC 4MLWA 3SG6A 4DRWA 2LAPA 3LL8B 4HREE 4ORCB 4PHJA 2LVIA 3GOFA 1EXRA 1Y1AA 1B1GA 1CLMA 1YR5A 2O60A 1D1OA 1WDCC 1H8BA 1EL4A 1LINA 1QV0A 4GFTA 2H61C 1JFKA 2I2RE 1OMDA 2KI4C 3I5IB 4N1GA 2LHIA 1NX2A 2M3WA 1TCFA 2EHBA 2BE4A 2HQ8A 1YVHA 1DJZA 2NXQA 4PHKA 2K8MB 4CPVA 4D1EA 2G9BA 3SG7A 1MF8B 1CLBA 4HRHA 3WHUB 4GNKB 4ORBB 1DJHA 4PCWA 1KK8B 1DVIA 5AEQA 3RLZA 4MSPA 1IH0A 1Y6WA 4MEWA 3CS1A 5IBWA 5KSZA 2L0PA 2M97A 4N5XA 5CPVA 1EH2A 1JSAA 2DOQA 1QX2A 2SCPA 2JNXA 1AVSA 5CSJA 4BY5A 2BKHB 1HQVA 1S5GZ 1F8HA 2M7LA 2NCOA 1NX3A 4JWQA 1XVJA 3HX4A 4PE7A 1XFZO 2AUCA 2LMVA 1FPWA 4GUKA 2KFFA 4PE1A 3I5FB 1BMOA 2JC2A 3NSIA 4YRUA 1MUXA 1JWDA 1FI6A 1IGVA 1W7JB 2CT9A 2HETA 2ZNEA 2ZRSA 3EVRA 4U8DA 4AQIA 4CFRA 4DUQA 3O4YA 1RWYA 4MBEA 3WXAA 3JVTB 1V1GA 1J7QA 4PHMA 2JU0A 3LLEA 1QATA 1WDCB 1YUUA 1QIVA 1SKTA 3VGOA 4JQ0D 1TCOB 5AANA 1KFXS 1HT9A 1K9PA 2K7CA 2KI4B 2LVVA 1OZOA 2JT3A 5AFPA 1KQMC 1KFXL 4YGBB 4GPLB 3BUWB 1KK7Z 1LA0A 3EKHA 4HSZA 1XFUO 1OOJA 3EVUA 4DIRA 4MRYA 3CR4X 2CBLA 2WCEA 1QV1A 2M49B 2JQ6A 3AAKA 2LV7A 3AKAA 1KQVA 3KPXA 1IRJA 1J7OA 1BODA 1OSAA 1XFWO 3PFVA 1N2DA 1RROA 1AP4A 1BR4B 1DGUA 1QIWA 1KSOA 1XYDA 4ICBA 1TN4A 2D8NA 1PRWA 1QX7A 1UURA 1K90D 1MXLC 5HKWA 1SL8A 1K93D 1CDPA 1CNPA 1SW8A 2L51A 1Y0VH 1ZACA 1B9AA 1VRKA 1UHJA 3BOWB 4L9MA 2KYFA 2KDHA 1CKKA 5KTYA 1QLSA 1YX8A 2KAYA 5AERA 1F55A 4MZLA 4GGNA 3RM1A 1CB1A 1JC2A 2LLUA 3M0WA 1YUTA 4NDBA 4FQOA 2M29A 4OKHA 5J3XA 1YRTB 1XK4A 2CNPA 4GGFA 4M2QA 2I7AA 3WHTB 2WNDA 1PALA 1KQMB 4OV2A 2ISDA 1F4QA 2KFHA 2LVJA 2HPSA 2KGRA 2GGMA 1KFUS 2JULA 1QX5B 4IL1A 1GJYA 2WORA 3GK2A 3PN7C 4F0ZB 4E68A 5HLVA 2EC6C 1B8LA 2JZIA 2H2KA 1CM1A 1CDLA 1S1EA 3NSLA 2MA2A 3SG2A 3ZWHA 2TN4A 2LANA 2V53A 2FCDA 3LK0A 1EJ3A 1RK9A 3CLNA 2K0JA 4MZKA 2LP2A 2MLFC 1GQMA 1W7IB 1BF5A 1K96A 1TRFA 4MRXA 2WC8A 5I2QA 5DKRA 1AJ4A 1RTP1 1NPQA 1JFJA 2WCBA 1MR8A 1DF0B 3C1VA 1OE9B 5I2OA 2JTZA 2L2EA 3BUXB 1S6CA 2E30A 1SY9A 3A8RA 1FF1A 1SBJA 1YX7A 2F33A 3O2PA 4HRGA 4YI9A 1K8UA 1F54A 3BYAA 3NSKA 3VRRA 4QJ5B 3I5GC 3IF7A 2KQYA 1NCXA 1MXEA 3EK8A 2JPTA 1WRZA 2BE6A 2Q4UA 3IQQA 1IQ5A 5HYDA 4GBAA 2VRGA 4A4BA 4M2OA 2EC6B 1CFFA 1DJGA 3CR5X 1MHOA 4WRIA 1SL7A 1TTXA 1QVIZ 3IQOA 4I5LB 1NSHA 4XYNA 1SCVA 1B7TY 3ZNIA 1NWDA 2H61A 4JPZB 4OCIA 1NX0A 1C07A 1F71A 4P5OE 1YRUB 5PALA 1B4CA 4A4CA 3SIBA 4GAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S26 D;  1EG3 A;  1REC A;  3OX6 A;  2KBM A;  2MHH A;  2JTT A;  1SRA A;  4NDC A;  2K7B A;  2P6B B;  2BL0 C;  1IKU A;  2QPT A;  3PAL A;  1F70 A;  1YUS A;  1IWQ A;  1PK0 D;  1K95 A;  1QTX A;  1NCY A;  1LVC D;  3LCP C;  5ER4 X;  2KHN A;  5GQQ C;  4CLN A;  1QJT A;  1OMR A;  2HF5 A;  2LMU A;  3EKJ A;  4TNC A;  1XFY O;  1N65 A;  1JF0 A;  2KNE A;  3GK4 X;  3BUO B;  2SAS A;  1QXP A;  1IJ5 A;  3OB2 B;  4I5J A;  2Y1N A;  5G08 A;  3KEV A;  3E3R A;  2K7D A;  1PUL A;  1YVL A;  3LK1 A;  1X02 A;  3DF0 B;  4Q04 A;  4WQ2 A;  1JUO A;  3I5G B;  3VRQ A;  1U5I B;  1A03 A;  2CXJ A;  1CFD A;  1EG4 A;  1ZOT B;  4MZJ A;  3I5H C;  4YGC B;  5KU1 A;  3HCM A;  4C0L A;  1LKJ A;  3BOW A;  3WNX B;  3CR2 A;  2JNF A;  1R6P A;  5HLO A;  3BQ3 A;  5CSF A;  5D7F A;  5ER5 A;  3EVV A;  2AAO A;  1QAS A;  3TS5 C;  4M2P A;  4ORA B;  4C0J A;  2K2A A;  2KI6 D;  3A4U B;  2IS9 A;  3PSR A;  1DGV A;  4PAL A;  4QJ3 B;  1BLQ A;  3FWC A;  1FI5 A;  1ALV A;  1BU3 A;  3KHE A;  4YGA A;  5HKY A;  4GGF C;  2KAV A;  2CCM A;  3CGA A;  2K7O A;  1UP5 A;  1CFC A;  1J1D A;  3BUN B;  1NCZ A;  2PMY A;  2JRF A;  3OHM B;  4R1E A;  3VRO A;  1DT7 B;  2LNK A;  1Y1X A;  2BL0 B;  5DKQ A;  2K2F A;  2CTN A;  2L4I A;  2KFG A;  1AJ5 A;  2MBX A;  4PE4 A;  5CSI A;  1WY9 A;  1CDM A;  4OR9 B;  1BR1 B;  1SR6 C;  1M31 A;  2MJW B;  4XJK B;  1AUI B;  2AMI A;  2K61 A;  1L2O C;  2M7N A;  5K89 A;  3PM8 A;  1CM4 A;  1GGZ A;  1PSB A;  2LUX A;  1S6I A;  3VRP A;  4MN0 A;  2RGI A;  5I2L A;  1M46 A;  1PSR A;  1F4O A;  3I5H B;  2LLS A;  4C0K A;  3OP0 A;  2E6W A;  3DD4 A;  3SG5 A;  1DF0 A;  1Q80 A;  2M1U A;  4P2Y B;  1SNL A;  1DJW A;  1TNP A;  3F45 A;  1WRL A;  3TS5 B;  1S5G Y;  2LHL A;  3KF9 A;  2I18 A;  2M9G A;  1KWO C;  1XO5 A;  3SG3 A;  5FYX A;  1TNW A;  2LP3 A;  2NCP A;  1CDN A;  2QAC A;  2LC5 A;  3D10 A;  3TZ1 A;  1S6J A;  2KBI A;  4YGD B;  3FS7 A;  2Y4Q A;  1IJ6 A;  1MWN A;  1R2U A;  5CSN A;  2ZN8 A;  1K9U A;  1BG1 A;  1PVB A;  1TOP A;  2JT8 A;  2JXL A;  2ZRT A;  1UUS A;  1NYA A;  2NLN A;  2HQW A;  5AXI A;  1AHR A;  1CLL A;  4MVF A;  5JJG A;  1N0Y A;  3PAT A;  2PRU A;  2WCF A;  1M63 B;  4AQJ A;  3FWB A;  1WLM A;  1SR6 B;  3DVK A;  1QS7 A;  1WRK A;  3DVJ A;  1L2O B;  3KO0 A;  3CZT X;  1A75 B;  3D0Y B;  2JXC A;  1H4B A;  1DJY A;  3PN7 B;  2JT0 A;  1NIW A;  1AK8 A;  2LVK A;  1KK7 Y;  1LXF C;  5D69 A;  3CWG A;  1DJI A;  2JOJ A;  2ZKM X;  2LUC A;  2R2I A;  3AKB A;  1ZFS A;  1KCY A;  4I5K A;  1KSM A;  1FBV A;  1LA3 A;  1CMG A;  1G8I A;  4PE0 A;  4DCK A;  1WLZ A;  1BOC A;  1CTR A;  4PDZ A;  2PSR A;  1JF2 A;  1UHK A;  1C7V A;  1PVA A;  2MLE C;  2KQ6 A;  1DMO A;  2BCA A;  2FOT A;  4QJ4 B;  1KWO B;  2BEC A;  1XFX O;  1UHN A;  2MRD A;  2OTG C;  4CFQ A;  4DS7 A;  2L5X B;  2F3Z A;  1V1F A;  5F6T A;  2OS8 C;  1C7W A;  1RJV A;  3DF0 A;  1OMV A;  1U5I A;  1TNX A;  1CFP A;  3H4S E;  1Y1U A;  2A4J A;  5B8I B;  1ZMZ A;  2Q91 A;  1SYM A;  2FJU B;  1GGW A;  2LMT A;  1YUR A;  1TNQ A;  1M39 A;  1NUB A;  1J7R A;  1OQP A;  2BBM A;  3K21 A;  3OX5 A;  4NDD A;  4ZCV A;  1QLK A;  1UWO A;  4PHN A;  3NSO A;  1TIZ A;  2M8U A;  3EK4 A;  3CTN A;  3OB1 B;  1BJF A;  1DTL A;  1J1E A;  1M45 A;  1SCM C;  4ZCU A;  5TNC A;  1K2H A;  1NX1 A;  3JTD C;  1JBA A;  4CID A;  1E8A A;  4YBH B;  5DKN A;  2ZND A;  2Y5I A;  3TUY C;  1S3P A;  4USL A;  1UHH A;  2WOS A;  1B7T Z;  1SPY A;  3VRN A;  1SMG A;  2F8P A;  2BCX A;  2KI6 C;  2ZFD A;  2FCE A;  1XA5 A;  1XK4 C;  2BCB A;  2ZN9 A;  1OZS A;  5I8N A;  1A29 A;  1K94 A;  4XJK A;  2LM5 A;  1YTZ C;  2B1U A;  2LE9 B;  2OTG B;  3ICB A;  3SG4 A;  2KOT A;  3SJS A;  2LLT A;  2F3Y A;  2OS8 B;  3QRX A;  1A2X A;  2F2O A;  2MAZ A;  4WQ3 A;  4YGE B;  2KAX A;  2O5G A;  2L50 A;  3GK1 A;  3O78 A;  1MQ1 A;  4AOM A;  1B8R A;  1S36 A;  3FIA A;  1ODB A;  1IG5 A;  1BT6 A;  1L7Z A;  3TDI A;  1SK6 D;  3I5I C;  3TDZ A;  4OVN F;  2KGB C;  1J7P A;  2JWW A;  2L4H A;  2GV5 A;  2L98 A;  1IQ3 A;  1SCM B;  3SIA A;  3BXK A;  5JOL A;  1KK8 C;  1RFJ A;  1CMF A;  1XFV O;  3JTD B;  2I94 A;  5HKZ A;  1SL9 A;  3NXA A;  2PAL A;  1B8C A;  1UHI A;  3DVE A;  2BKI B;  2LCP A;  1KFU L;  1DJX A;  2KYC A;  3TUY B;  1FW4 A;  2Y1M A;  3TDU A;  2F2P A;  4I5N B;  4YI8 A;  2BBN A;  1ALW A;  2PVB A;  1G4Y R;  3I5F C;  1A4P A;  5BPJ A;  2OPO A;  2GGZ A;  1QVI Y;  3AAJ A;  3O6B A;  3PLF B;  1K9K A;  4ETO A;  1ZUZ A;  2KSP A;  4BY4 A;  3MSE B;  1NP8 A;  2M1K B;  3DVM A;  1A75 A;  3D0Y A;  2PAS A;  2EGD A;  2G2B A;  2COL B;  4NQG A;  3BUM B;  4UPG A;  2NZ0 A;  1G33 A;  1B47 A;  1J55 A;  4N1F A;  2M0R A;  3EK7 A;  4FTG A;  3JVT C;  4MLW A;  3SG6 A;  4DRW A;  2LAP A;  3LL8 B;  4HRE E;  4ORC B;  4PHJ A;  2LVI A;  3GOF A;  1EXR A;  1Y1A A;  1B1G A;  1CLM A;  1YR5 A;  2O60 A;  1D1O A;  1WDC C;  1H8B A;  1EL4 A;  1LIN A;  1QV0 A;  4GFT A;  2H61 C;  1JFK A;  2I2R E;  1OMD A;  2KI4 C;  3I5I B;  4N1G A;  2LHI A;  1NX2 A;  2M3W A;  1TCF A;  2EHB A;  2BE4 A;  2HQ8 A;  1YVH A;  1DJZ A;  2NXQ A;  4PHK A;  2K8M B;  4CPV A;  4D1E A;  2G9B A;  3SG7 A;  1MF8 B;  1CLB A;  4HRH A;  3WHU B;  4GNK B;  4ORB B;  1DJH A;  4PCW A;  1KK8 B;  1DVI A;  5AEQ A;  3RLZ A;  4MSP A;  1IH0 A;  1Y6W A;  4MEW A;  3CS1 A;  5IBW A;  5KSZ A;  2L0P A;  2M97 A;  4N5X A;  5CPV A;  1EH2 A;  1JSA A;  2DOQ A;  1QX2 A;  2SCP A;  2JNX A;  1AVS A;  5CSJ A;  4BY5 A;  2BKH B;  1HQV A;  1S5G Z;  1F8H A;  2M7L A;  2NCO A;  1NX3 A;  4JWQ A;  1XVJ A;  3HX4 A;  4PE7 A;  1XFZ O;  2AUC A;  2LMV A;  1FPW A;  4GUK A;  2KFF A;  4PE1 A;  3I5F B;  1BMO A;  2JC2 A;  3NSI A;  4YRU A;  1MUX A;  1JWD A;  1FI6 A;  1IGV A;  1W7J B;  2CT9 A;  2HET A;  2ZNE A;  2ZRS A;  3EVR A;  4U8D A;  4AQI A;  4CFR A;  4DUQ A;  3O4Y A;  1RWY A;  4MBE A;  3WXA A;  3JVT B;  1V1G A;  1J7Q A;  4PHM A;  2JU0 A;  3LLE A;  1QAT A;  1WDC B;  1YUU A;  1QIV A;  1SKT A;  3VGO A;  4JQ0 D;  1TCO B;  5AAN A;  1KFX S;  1HT9 A;  1K9P A;  2K7C A;  2KI4 B;  2LVV A;  1OZO A;  2JT3 A;  5AFP A;  1KQM C;  1KFX L;  4YGB B;  4GPL B;  3BUW B;  1KK7 Z;  1LA0 A;  3EKH A;  4HSZ A;  1XFU O;  1OOJ A;  3EVU A;  4DIR A;  4MRY A;  3CR4 X;  2CBL A;  2WCE A;  1QV1 A;  2M49 B;  2JQ6 A;  3AAK A;  2LV7 A;  3AKA A;  1KQV A;  3KPX A;  1IRJ A;  1J7O A;  1BOD A;  1OSA A;  1XFW O;  3PFV A;  1N2D A;  1RRO A;  1AP4 A;  1BR4 B;  1DGU A;  1QIW A;  1KSO A;  1XYD A;  4ICB A;  1TN4 A;  2D8N A;  1PRW A;  1QX7 A;  1UUR A;  1K90 D;  1MXL C;  5HKW A;  1SL8 A;  1K93 D;  1CDP A;  1CNP A;  1SW8 A;  2L51 A;  1Y0V H;  1ZAC A;  1B9A A;  1VRK A;  1UHJ A;  3BOW B;  4L9M A;  2KYF A;  2KDH A;  1CKK A;  5KTY A;  1QLS A;  1YX8 A;  2KAY A;  5AER A;  1F55 A;  4MZL A;  4GGN A;  3RM1 A;  1CB1 A;  1JC2 A;  2LLU A;  3M0W A;  1YUT A;  4NDB A;  4FQO A;  2M29 A;  4OKH A;  5J3X A;  1YRT B;  1XK4 A;  2CNP A;  4GGF A;  4M2Q A;  2I7A A;  3WHT B;  2WND A;  1PAL A;  1KQM B;  4OV2 A;  2ISD A;  1F4Q A;  2KFH A;  2LVJ A;  2HPS A;  2KGR A;  2GGM A;  1KFU S;  2JUL A;  1QX5 B;  4IL1 A;  1GJY A;  2WOR A;  3GK2 A;  3PN7 C;  4F0Z B;  4E68 A;  5HLV A;  2EC6 C;  1B8L A;  2JZI A;  2H2K A;  1CM1 A;  1CDL A;  1S1E A;  3NSL A;  2MA2 A;  3SG2 A;  3ZWH A;  2TN4 A;  2LAN A;  2V53 A;  2FCD A;  3LK0 A;  1EJ3 A;  1RK9 A;  3CLN A;  2K0J A;  4MZK A;  2LP2 A;  2MLF C;  1GQM A;  1W7I B;  1BF5 A;  1K96 A;  1TRF A;  4MRX A;  2WC8 A;  5I2Q A;  5DKR A;  1AJ4 A;  1RTP 1;  1NPQ A;  1JFJ A;  2WCB A;  1MR8 A;  1DF0 B;  3C1V A;  1OE9 B;  5I2O A;  2JTZ A;  2L2E A;  3BUX B;  1S6C A;  2E30 A;  1SY9 A;  3A8R A;  1FF1 A;  1SBJ A;  1YX7 A;  2F33 A;  3O2P A;  4HRG A;  4YI9 A;  1K8U A;  1F54 A;  3BYA A;  3NSK A;  3VRR A;  4QJ5 B;  3I5G C;  3IF7 A;  2KQY A;  1NCX A;  1MXE A;  3EK8 A;  2JPT A;  1WRZ A;  2BE6 A;  2Q4U A;  3IQQ A;  1IQ5 A;  5HYD A;  4GBA A;  2VRG A;  4A4B A;  4M2O A;  2EC6 B;  1CFF A;  1DJG A;  3CR5 X;  1MHO A;  4WRI A;  1SL7 A;  1TTX A;  1QVI Z;  3IQO A;  4I5L B;  1NSH A;  4XYN A;  1SCV A;  1B7T Y;  3ZNI A;  1NWD A;  2H61 A;  4JPZ B;  4OCI A;  1NX0 A;  1C07 A;  1F71 A;  4P5O E;  1YRU B;  5PAL A;  1B4C A;  4A4C A;  3SIB A;  4GAO A; 
#chains in the Genus database with same CATH topology
 1S26 D;  1EG3 A;  1REC A;  3OX6 A;  2KBM A;  2MHH A;  3N7H A;  2JTT A;  1SRA A;  4NDC A;  2K7B A;  2P6B B;  2KLD A;  2BL0 C;  1IKU A;  2QPT A;  3PAL A;  1F70 A;  1YUS A;  1IWQ A;  1PK0 D;  1K95 A;  1QTX A;  1NCY A;  1LVC D;  3LCP C;  5ER4 X;  3QME A;  2KHN A;  5GQQ C;  3D76 A;  4CLN A;  1QJT A;  1OMR A;  2HF5 A;  2LMU A;  3EKJ A;  3L4L A;  4TNC A;  1XFY O;  1N65 A;  1JF0 A;  2KNE A;  3GK4 X;  3BUO B;  2SAS A;  1QXP A;  1IJ5 A;  1P28 A;  3OB2 B;  2Y1N A;  3B86 A;  3KEV A;  4I5J A;  5G08 A;  3E3R A;  5FI2 A;  2K7D A;  1PUL A;  1YVL A;  3LK1 A;  1X02 A;  3DF0 B;  4Q04 A;  4WQ2 A;  1JUO A;  3I5G B;  3VRQ A;  1U5I B;  1A03 A;  2CXJ A;  1CFD A;  1EG4 A;  1ZOT B;  4MZJ A;  3I5H C;  4YGC B;  5KU1 A;  3HCM A;  4C0L A;  1LKJ A;  3BOW A;  3WNX B;  4IJ7 A;  3CR2 A;  2JNF A;  1R6P A;  5HLO A;  3BQ3 A;  5CSF A;  5D7F A;  5ER5 A;  2FJY A;  3EVV A;  2AAO A;  1QAS A;  3DZT A;  3TS5 C;  4M2P A;  4ORA B;  4C0J A;  2K2A A;  2KI6 D;  3DXL A;  3A4U B;  2IS9 A;  1TUJ A;  3PSR A;  4DUQ A;  1DGV A;  4PAL A;  4QJ3 B;  1BLQ A;  3FWC A;  1FI5 A;  1ALV A;  1BU3 A;  3KHE A;  4YGA A;  5HKY A;  4GGF C;  2KAV A;  2CCM A;  3CGA A;  2K7O A;  1UP5 A;  3CAB A;  1CFC A;  1J1D A;  3BUN B;  5EL2 A;  1NCZ A;  2PMY A;  2JRF A;  3OHM B;  4R1E A;  3VRO A;  1DT7 B;  2LNK A;  1Y1X A;  1OOF A;  2BL0 B;  5DKQ A;  2K2F A;  2CTN A;  2L4I A;  2KFG A;  1AJ5 A;  2MBX A;  3L4A A;  3R1P A;  4PE4 A;  5CSI A;  1WY9 A;  1CDM A;  4OR9 B;  1BR1 B;  1SR6 C;  1M31 A;  2MJW B;  1DEK A;  4XJK B;  1AUI B;  2AMI A;  2K61 A;  1L2O C;  2M7N A;  5K89 A;  3PM8 A;  1CM4 A;  1GGZ A;  3FE9 A;  1PSB A;  2LUX A;  1S6I A;  3VRP A;  4MN0 A;  2RGI A;  5I2L A;  1M46 A;  2ERB A;  1PSR A;  1F4O A;  3I5H B;  2LLS A;  4C0K A;  3OP0 A;  2E6W A;  3DD4 A;  3SG5 A;  1DF0 A;  1Q80 A;  2M1U A;  4P2Y B;  1SNL A;  1DJW A;  3D78 A;  1TNP A;  3F45 A;  1WRL A;  3S0G A;  3TS5 B;  3NHT A;  1S5G Y;  2LHL A;  3KF9 A;  2I18 A;  2M9G A;  1KWO C;  1XO5 A;  3SG3 A;  5FYX A;  1TNW A;  2LP3 A;  2NCP A;  1CDN A;  2QAC A;  2LC5 A;  3D10 A;  3TZ1 A;  1S6J A;  2KBI A;  4YGD B;  3FS7 A;  3D74 A;  2Y4Q A;  1IJ6 A;  1MWN A;  2K60 A;  1R2U A;  5CSN A;  2ZN8 A;  1K9U A;  1BG1 A;  1PVB A;  1TOP A;  2JT8 A;  2JXL A;  2ZRT A;  1UUS A;  1NYA A;  2NLN A;  2HQW A;  4FQT A;  1AHR A;  5AXI A;  1CLL A;  4MVF A;  2GTE A;  1N0Y A;  5JJG A;  3PAT A;  2QEO A;  2PRU A;  2WCF A;  3CZ1 A;  1M63 B;  4AQJ A;  3FWB A;  1WLM A;  1SR6 B;  3DVK A;  3CZ0 A;  1QS7 A;  1WRK A;  3R1O A;  3DVJ A;  1L2O B;  3KO0 A;  3S0B A;  3CZT X;  1A75 B;  3D0Y B;  2JXC A;  1H4B A;  1DJY A;  3PN7 B;  2JT0 A;  1NIW A;  1AK8 A;  2LVK A;  1KK7 Y;  1LXF C;  5D69 A;  2P71 A;  3CWG A;  1DJI A;  2JOJ A;  2ZKM X;  2LUC A;  2R2I A;  3AKB A;  1ZFS A;  1XFR A;  1KCY A;  4I5K A;  1KSM A;  1FBV A;  1LA3 A;  1CMG A;  1G8I A;  4PE0 A;  4DCK A;  1WLZ A;  1BOC A;  1CTR A;  2WCK A;  4PDZ A;  2PSR A;  1JF2 A;  1UHK A;  1C7V A;  1PVA A;  2MLE C;  2KQ6 A;  3IVT A;  1DMO A;  2BCA A;  2FOT A;  4QJ4 B;  1KWO B;  2BEC A;  1XFX O;  1UHN A;  2MRD A;  2OTG C;  4CFQ A;  3UO9 A;  4DS7 A;  2L5X B;  2F3Z A;  1V1F A;  5F6T A;  2OS8 C;  1C7W A;  1RJV A;  3DF0 A;  1DQE A;  1OMV A;  1TNX A;  1U5I A;  2YGU A;  3H4S E;  1Y1U A;  1CFP A;  2A4J A;  5B8I B;  1ZMZ A;  1T14 A;  2Q91 A;  3PM2 A;  1SYM A;  2FJU B;  1GGW A;  2LMT A;  1YUR A;  1TNQ A;  1M39 A;  1NUB A;  1J7R A;  1OQP A;  2BBM A;  3K21 A;  3OX5 A;  4NDD A;  4ZCV A;  1QLK A;  1UWO A;  4PHN A;  1TWO A;  2QEV A;  3NSO A;  1TIZ A;  2L2C A;  2M8U A;  3EK4 A;  3CTN A;  1SSE B;  3OB1 B;  3EG5 B;  1BJF A;  1DTL A;  1J1E A;  1M45 A;  1SCM C;  3K1E A;  5FI6 A;  4ZCU A;  5TNC A;  4JKT A;  1K2H A;  3S0A A;  1NX1 A;  3JTD C;  1JBA A;  1CLB A;  4CID A;  1E8A A;  4YBH B;  5DKN A;  2ZND A;  2Y5I A;  3TUY C;  1S3P A;  4USL A;  1UHH A;  2WOS A;  1B7T Z;  1SPY A;  3VRN A;  1SMG A;  2F8P A;  2BCX A;  1OOH A;  2KI6 C;  2ZFD A;  2FCE A;  1XA5 A;  1XK4 C;  3V2L A;  2BCB A;  2ZN9 A;  1OZS A;  5I8N A;  1A29 A;  4OZD A;  1K94 A;  4XJK A;  2LM5 A;  1YTZ C;  2B1U A;  2LE9 B;  1OW4 A;  2OTG B;  3ICB A;  3SG4 A;  2KOT A;  3SJS A;  2LLT A;  1OOG A;  2F3Y A;  3PJI A;  2OS8 B;  3QRX A;  5FI7 A;  1A2X A;  1OOI X;  2WCH A;  3BFB A;  2F2O A;  2MAZ A;  4WQ3 A;  4YGE B;  2KAX A;  3DYE A;  2O5G A;  2L50 A;  3GK1 A;  3O78 A;  1MQ1 A;  4AOM A;  1B8R A;  1S36 A;  3NGV A;  3FIA A;  3BJH A;  1ODB A;  1IG5 A;  1BT6 A;  1L7Z A;  3TDI A;  1SK6 D;  3I5I C;  3TDZ A;  3L47 A;  4OVN F;  2KGB C;  1J7P A;  2JWW A;  2L4H A;  2GV5 A;  2L98 A;  1IQ3 A;  3B6X A;  1SCM B;  3SIA A;  3BXK A;  5JOL A;  1KK8 C;  1RFJ A;  1CMF A;  1XFV O;  3JTD B;  2I94 A;  5HKZ A;  1SL9 A;  3NXA A;  2PAL A;  1B8C A;  3D77 A;  1UHI A;  3DVE A;  4INW A;  2BKI B;  2LCP A;  1KFU L;  1DJX A;  2KYC A;  3TUY B;  1FW4 A;  2Y1M A;  3TDU A;  2F2P A;  2WC5 A;  4I5N B;  4YI8 A;  2BBN A;  3RZS A;  1ALW A;  3B88 A;  3VB1 A;  2PVB A;  1G4Y R;  3I5F C;  1A4P A;  5BPJ A;  2OPO A;  3B7A A;  2GGZ A;  1QVI Y;  2WCL A;  3AAJ A;  3O6B A;  3CZ2 A;  1K9K A;  3PLF B;  4ETO A;  1ZUZ A;  2KSP A;  4BY4 A;  3MSE B;  1NP8 A;  2M1K B;  3DVM A;  1A75 A;  3D0Y A;  2PAS A;  2EGD A;  2G2B A;  2PYQ A;  2COL B;  4NQG A;  3BUM B;  4UPG A;  2NZ0 A;  1G33 A;  1ORG A;  1B47 A;  1J55 A;  4N1F A;  2M0R A;  3EK7 A;  4FTG A;  3JVT C;  4MLW A;  3SG6 A;  4DRW A;  2LAP A;  3LL8 B;  4HRE E;  4ORC B;  4PHJ A;  2LVI A;  3GOF A;  1EXR A;  1Y1A A;  3R1V A;  1B1G A;  1CLM A;  1YR5 A;  2O60 A;  2QEH A;  1WDC C;  1D1O A;  1EL4 A;  1H8B A;  1LIN A;  1QV0 A;  4GFT A;  2H61 C;  1JFK A;  1Z2C B;  2I2R E;  1OMD A;  2KI4 C;  3I5I B;  1IIO A;  4N1G A;  2LHI A;  1NX2 A;  2M3W A;  1TCF A;  2EHB A;  2BE4 A;  2HQ8 A;  1YVH A;  1DJZ A;  1LS8 A;  2NXQ A;  2K8M B;  2KPH A;  4PHK A;  2G9B A;  2PQL A;  1MF8 B;  3SG7 A;  4CPV A;  4D1E A;  4HRH A;  3WHU B;  4GNK B;  4ORB B;  1DJH A;  4PCW A;  1KK8 B;  1DVI A;  5AEQ A;  2WCJ A;  3SS4 A;  3RLZ A;  4MSP A;  1IH0 A;  1Y6W A;  4MEW A;  3CS1 A;  5IBW A;  5KSZ A;  2L0P A;  2M97 A;  4N5X A;  5CPV A;  1EH2 A;  1JSA A;  2DOQ A;  1QX2 A;  2SCP A;  2JNX A;  1AVS A;  5CSJ A;  4BY5 A;  1HQV A;  1S5G Z;  2BKH B;  1F8H A;  2M7L A;  2NCO A;  1NX3 A;  4JWQ A;  1XVJ A;  3B87 A;  3HX4 A;  4PE7 A;  1XFZ O;  2AUC A;  5I94 A;  2LMV A;  1FPW A;  3FE8 A;  4GUK A;  2KFF A;  4PE1 A;  3I5F B;  1BMO A;  2JC2 A;  3CYZ A;  3D73 A;  3NSI A;  4YRU A;  1MUX A;  1JWD A;  3CDN A;  1FI6 A;  1GM0 A;  1IGV A;  1W7J B;  1TUZ A;  2CT9 A;  2HET A;  1QWV A;  2ZNE A;  2ZRS A;  3EVR A;  4U8D A;  4AQI A;  4CFR A;  3BFA A;  3O4Y A;  1RWY A;  4MBE A;  3WXA A;  3JVT B;  1V1G A;  1J7Q A;  4PHM A;  2JU0 A;  3LLE A;  1DC1 A;  4PT1 A;  1QAT A;  1WDC B;  1YUU A;  1QIV A;  1SKT A;  3VGO A;  4JQ0 D;  1TCO B;  5AAN A;  1KFX S;  1HT9 A;  1K9P A;  2K7C A;  2KI4 B;  2LVV A;  1OZO A;  2JT3 A;  5AFP A;  1KQM C;  1KFX L;  4YGB B;  4GPL B;  3BUW B;  1C3Z A;  1KK7 Z;  1LA0 A;  3EKH A;  4HSZ A;  1XFU O;  1OOJ A;  3EVU A;  4DIR A;  4MRY A;  3UNW A;  2WCM A;  2CBL A;  3CR4 X;  2WCE A;  1QV1 A;  2M49 B;  2JQ6 A;  3AAK A;  2LV7 A;  3AKA A;  3D75 A;  2KLE A;  1KQV A;  3KPX A;  1IRJ A;  1J7O A;  1DEL A;  1W9Z A;  2BAP A;  1BOD A;  1OSA A;  1XFW O;  3PFV A;  1N2D A;  1RRO A;  1AP4 A;  1BR4 B;  1DGU A;  1QIW A;  1KSO A;  1XYD A;  3OBV A;  1TN4 A;  2D8N A;  1PRW A;  4ICB A;  1QX7 A;  1UUR A;  4JD9 A;  1K90 D;  1MXL C;  2WC6 A;  5HKW A;  1SL8 A;  1K93 D;  1CDP A;  1CNP A;  1SW8 A;  2L51 A;  1Y0V H;  1ZAC A;  1B9A A;  1VRK A;  1UHJ A;  3BOW B;  4L9M A;  2KYF A;  2KDH A;  3SS5 A;  1CKK A;  5KTY A;  1QLS A;  1YX8 A;  2KAY A;  5AER A;  1F55 A;  4MZL A;  4GGN A;  3RM1 A;  1CB1 A;  1JC2 A;  2LLU A;  3M0W A;  1YUT A;  2JPO A;  2P70 A;  4NDB A;  4FQO A;  2M29 A;  4OKH A;  5J3X A;  1YRT B;  1XK4 A;  3FE6 A;  2CNP A;  4GGF A;  4M2Q A;  2I7A A;  3WHT B;  2WND A;  5HL1 A;  1PAL A;  1KQM B;  4OV2 A;  2ISD A;  1F4Q A;  2KFH A;  2LVJ A;  2HPS A;  2KGR A;  2GGM A;  1KFU S;  3SS3 A;  3Q8I A;  2JUL A;  2QDI A;  1QX5 B;  3OGN A;  3BFH A;  4IL1 A;  1GJY A;  2WOR A;  2L5Y A;  5DIC A;  3S0F A;  1C3Y A;  3GK2 A;  3PN7 C;  3R72 A;  4F0Z B;  4E68 A;  5HLV A;  2EC6 C;  1B8L A;  2JZI A;  2H2K A;  1CM1 A;  1CDL A;  1S1E A;  2QEB A;  3NSL A;  2MA2 A;  3SG2 A;  3ZWH A;  2TN4 A;  2LAN A;  2V53 A;  2FCD A;  3LK0 A;  1EJ3 A;  1RK9 A;  3CLN A;  2K0J A;  4MZK A;  2LP2 A;  2MLF C;  1GQM A;  1W7I B;  3S0D A;  4KYN A;  1K96 A;  1BF5 A;  1TRF A;  2H8V A;  2BNX A;  4MRX A;  2WC8 A;  4F7F A;  5I2Q A;  5DKR A;  1AJ4 A;  1RTP 1;  1NPQ A;  1JFJ A;  2WCB A;  1MR8 A;  1DF0 B;  3C1V A;  1OE9 B;  5I2O A;  4INX A;  2JTZ A;  2L2E A;  3BUX B;  1S6C A;  2E30 A;  3NHI A;  1SY9 A;  3A8R A;  1FF1 A;  1SBJ A;  1YX7 A;  2F33 A;  1Z4H A;  3O2P A;  4HRG A;  4YI9 A;  1K8U A;  1F54 A;  3BYA A;  3NSK A;  3VRR A;  4QJ5 B;  3I5G C;  3IF7 A;  2KQY A;  1NCX A;  1MXE A;  3EK8 A;  2JPT A;  3O4X A;  1WRZ A;  2BE6 A;  2Q4U A;  3DY9 A;  3IQQ A;  1IQ5 A;  5HYD A;  4GBA A;  2VRG A;  4A4B A;  4M2O A;  2EC6 B;  1CFF A;  1DJG A;  3CR5 X;  1MHO A;  4WRI A;  1SL7 A;  1TTX A;  1QVI Z;  3IQO A;  4I5L B;  1NSH A;  3S0E A;  4XYN A;  1SCV A;  1B7T Y;  3ZNI A;  1NWD A;  2H61 A;  4JPZ B;  4OCI A;  1NX0 A;  5D3O A;  1C07 A;  1F71 A;  4P5O E;  1YRU B;  5PAL A;  1B4C A;  4A4C A;  3SIB A;  4GAO A; 
#chains in the Genus database with same CATH homology
 1S26 D;  1EG3 A;  1REC A;  3OX6 A;  2KBM A;  2MHH A;  2JTT A;  1SRA A;  4NDC A;  2K7B A;  2P6B B;  2BL0 C;  1IKU A;  2QPT A;  3PAL A;  1F70 A;  1YUS A;  1IWQ A;  1PK0 D;  1K95 A;  1QTX A;  1NCY A;  1LVC D;  3LCP C;  5ER4 X;  2KHN A;  5GQQ C;  4CLN A;  1QJT A;  1OMR A;  2HF5 A;  2LMU A;  3EKJ A;  4TNC A;  1XFY O;  1N65 A;  1JF0 A;  2KNE A;  3GK4 X;  3BUO B;  2SAS A;  1QXP A;  1IJ5 A;  3OB2 B;  4I5J A;  2Y1N A;  5G08 A;  3KEV A;  3E3R A;  2K7D A;  1PUL A;  1YVL A;  3LK1 A;  1X02 A;  3DF0 B;  4Q04 A;  4WQ2 A;  1JUO A;  3I5G B;  3VRQ A;  1U5I B;  1A03 A;  2CXJ A;  1CFD A;  1EG4 A;  1ZOT B;  4MZJ A;  3I5H C;  4YGC B;  5KU1 A;  3HCM A;  4C0L A;  1LKJ A;  3BOW A;  3WNX B;  3CR2 A;  2JNF A;  1R6P A;  5HLO A;  3BQ3 A;  5CSF A;  5D7F A;  5ER5 A;  3EVV A;  2AAO A;  1QAS A;  3TS5 C;  4M2P A;  4ORA B;  4C0J A;  2K2A A;  2KI6 D;  3A4U B;  2IS9 A;  3PSR A;  1DGV A;  4PAL A;  4QJ3 B;  1BLQ A;  3FWC A;  1FI5 A;  1ALV A;  1BU3 A;  3KHE A;  4YGA A;  5HKY A;  4GGF C;  2KAV A;  2CCM A;  3CGA A;  2K7O A;  1UP5 A;  1CFC A;  1J1D A;  3BUN B;  1NCZ A;  2PMY A;  2JRF A;  3OHM B;  4R1E A;  3VRO A;  1DT7 B;  2LNK A;  1Y1X A;  2BL0 B;  5DKQ A;  2K2F A;  2CTN A;  2L4I A;  2KFG A;  1AJ5 A;  2MBX A;  4PE4 A;  5CSI A;  1WY9 A;  1CDM A;  4OR9 B;  1BR1 B;  1SR6 C;  1M31 A;  2MJW B;  4XJK B;  1AUI B;  2AMI A;  2K61 A;  1L2O C;  2M7N A;  5K89 A;  3PM8 A;  1CM4 A;  1GGZ A;  1PSB A;  2LUX A;  1S6I A;  3VRP A;  4MN0 A;  2RGI A;  5I2L A;  1M46 A;  1PSR A;  1F4O A;  3I5H B;  2LLS A;  4C0K A;  3OP0 A;  2E6W A;  3DD4 A;  3SG5 A;  1DF0 A;  1Q80 A;  2M1U A;  4P2Y B;  1SNL A;  1DJW A;  1TNP A;  3F45 A;  1WRL A;  3TS5 B;  1S5G Y;  2LHL A;  3KF9 A;  2I18 A;  2M9G A;  1KWO C;  1XO5 A;  3SG3 A;  5FYX A;  1TNW A;  2LP3 A;  2NCP A;  1CDN A;  2QAC A;  2LC5 A;  3D10 A;  3TZ1 A;  1S6J A;  2KBI A;  4YGD B;  3FS7 A;  2Y4Q A;  1IJ6 A;  1MWN A;  1R2U A;  5CSN A;  2ZN8 A;  1K9U A;  1BG1 A;  1PVB A;  1TOP A;  2JT8 A;  2JXL A;  2ZRT A;  1UUS A;  1NYA A;  2NLN A;  2HQW A;  5AXI A;  1AHR A;  1CLL A;  4MVF A;  5JJG A;  1N0Y A;  3PAT A;  2PRU A;  2WCF A;  1M63 B;  4AQJ A;  3FWB A;  1WLM A;  1SR6 B;  3DVK A;  1QS7 A;  1WRK A;  3DVJ A;  1L2O B;  3KO0 A;  3CZT X;  1A75 B;  3D0Y B;  2JXC A;  1H4B A;  1DJY A;  3PN7 B;  2JT0 A;  1NIW A;  1AK8 A;  2LVK A;  1KK7 Y;  1LXF C;  5D69 A;  3CWG A;  1DJI A;  2JOJ A;  2ZKM X;  2LUC A;  2R2I A;  3AKB A;  1ZFS A;  1KCY A;  4I5K A;  1KSM A;  1FBV A;  1LA3 A;  1CMG A;  1G8I A;  4PE0 A;  4DCK A;  1WLZ A;  1BOC A;  1CTR A;  4PDZ A;  2PSR A;  1JF2 A;  1UHK A;  1C7V A;  1PVA A;  2MLE C;  2KQ6 A;  1DMO A;  2BCA A;  2FOT A;  4QJ4 B;  1KWO B;  2BEC A;  1XFX O;  1UHN A;  2MRD A;  2OTG C;  4CFQ A;  4DS7 A;  2L5X B;  2F3Z A;  1V1F A;  5F6T A;  2OS8 C;  1C7W A;  1RJV A;  3DF0 A;  1OMV A;  1U5I A;  1TNX A;  1CFP A;  3H4S E;  1Y1U A;  2A4J A;  5B8I B;  1ZMZ A;  2Q91 A;  1SYM A;  2FJU B;  1GGW A;  2LMT A;  1YUR A;  1TNQ A;  1M39 A;  1NUB A;  1J7R A;  1OQP A;  2BBM A;  3K21 A;  3OX5 A;  4NDD A;  4ZCV A;  1QLK A;  1UWO A;  4PHN A;  3NSO A;  1TIZ A;  2M8U A;  3EK4 A;  3CTN A;  3OB1 B;  1BJF A;  1DTL A;  1J1E A;  1M45 A;  1SCM C;  4ZCU A;  5TNC A;  1K2H A;  1NX1 A;  3JTD C;  1JBA A;  4CID A;  1E8A A;  4YBH B;  5DKN A;  2ZND A;  2Y5I A;  3TUY C;  1S3P A;  4USL A;  1UHH A;  2WOS A;  1B7T Z;  1SPY A;  3VRN A;  1SMG A;  2F8P A;  2BCX A;  2KI6 C;  2ZFD A;  2FCE A;  1XA5 A;  1XK4 C;  2BCB A;  2ZN9 A;  1OZS A;  5I8N A;  1A29 A;  1K94 A;  4XJK A;  2LM5 A;  1YTZ C;  2B1U A;  2LE9 B;  2OTG B;  3ICB A;  3SG4 A;  2KOT A;  3SJS A;  2LLT A;  2F3Y A;  2OS8 B;  3QRX A;  1A2X A;  2F2O A;  2MAZ A;  4WQ3 A;  4YGE B;  2KAX A;  2O5G A;  2L50 A;  3GK1 A;  3O78 A;  1MQ1 A;  4AOM A;  1B8R A;  1S36 A;  3FIA A;  1ODB A;  1IG5 A;  1BT6 A;  1L7Z A;  3TDI A;  1SK6 D;  3I5I C;  3TDZ A;  4OVN F;  2KGB C;  1J7P A;  2JWW A;  2L4H A;  2GV5 A;  2L98 A;  1IQ3 A;  1SCM B;  3SIA A;  3BXK A;  5JOL A;  1KK8 C;  1RFJ A;  1CMF A;  1XFV O;  3JTD B;  2I94 A;  5HKZ A;  1SL9 A;  3NXA A;  2PAL A;  1B8C A;  1UHI A;  3DVE A;  2BKI B;  2LCP A;  1KFU L;  1DJX A;  2KYC A;  3TUY B;  1FW4 A;  2Y1M A;  3TDU A;  2F2P A;  4I5N B;  4YI8 A;  2BBN A;  1ALW A;  2PVB A;  1G4Y R;  3I5F C;  1A4P A;  5BPJ A;  2OPO A;  2GGZ A;  1QVI Y;  3AAJ A;  3O6B A;  3PLF B;  1K9K A;  4ETO A;  1ZUZ A;  2KSP A;  4BY4 A;  3MSE B;  1NP8 A;  2M1K B;  3DVM A;  1A75 A;  3D0Y A;  2PAS A;  2EGD A;  2G2B A;  2COL B;  4NQG A;  3BUM B;  4UPG A;  2NZ0 A;  1G33 A;  1B47 A;  1J55 A;  4N1F A;  2M0R A;  3EK7 A;  4FTG A;  3JVT C;  4MLW A;  3SG6 A;  4DRW A;  2LAP A;  3LL8 B;  4HRE E;  4ORC B;  4PHJ A;  2LVI A;  3GOF A;  1EXR A;  1Y1A A;  1B1G A;  1CLM A;  1YR5 A;  2O60 A;  1D1O A;  1WDC C;  1H8B A;  1EL4 A;  1LIN A;  1QV0 A;  4GFT A;  2H61 C;  1JFK A;  2I2R E;  1OMD A;  2KI4 C;  3I5I B;  4N1G A;  2LHI A;  1NX2 A;  2M3W A;  1TCF A;  2EHB A;  2BE4 A;  2HQ8 A;  1YVH A;  1DJZ A;  2NXQ A;  4PHK A;  2K8M B;  4CPV A;  4D1E A;  2G9B A;  3SG7 A;  1MF8 B;  1CLB A;  4HRH A;  3WHU B;  4GNK B;  4ORB B;  1DJH A;  4PCW A;  1KK8 B;  1DVI A;  5AEQ A;  3RLZ A;  4MSP A;  1IH0 A;  1Y6W A;  4MEW A;  3CS1 A;  5IBW A;  5KSZ A;  2L0P A;  2M97 A;  4N5X A;  5CPV A;  1EH2 A;  1JSA A;  2DOQ A;  1QX2 A;  2SCP A;  2JNX A;  1AVS A;  5CSJ A;  4BY5 A;  2BKH B;  1HQV A;  1S5G Z;  1F8H A;  2M7L A;  2NCO A;  1NX3 A;  4JWQ A;  1XVJ A;  3HX4 A;  4PE7 A;  1XFZ O;  2AUC A;  2LMV A;  1FPW A;  4GUK A;  2KFF A;  4PE1 A;  3I5F B;  1BMO A;  2JC2 A;  3NSI A;  4YRU A;  1MUX A;  1JWD A;  1FI6 A;  1IGV A;  1W7J B;  2CT9 A;  2HET A;  2ZNE A;  2ZRS A;  3EVR A;  4U8D A;  4AQI A;  4CFR A;  4DUQ A;  3O4Y A;  1RWY A;  4MBE A;  3WXA A;  3JVT B;  1V1G A;  1J7Q A;  4PHM A;  2JU0 A;  3LLE A;  1QAT A;  1WDC B;  1YUU A;  1QIV A;  1SKT A;  3VGO A;  4JQ0 D;  1TCO B;  5AAN A;  1KFX S;  1HT9 A;  1K9P A;  2K7C A;  2KI4 B;  2LVV A;  1OZO A;  2JT3 A;  5AFP A;  1KQM C;  1KFX L;  4YGB B;  4GPL B;  3BUW B;  1KK7 Z;  1LA0 A;  3EKH A;  4HSZ A;  1XFU O;  1OOJ A;  3EVU A;  4DIR A;  4MRY A;  3CR4 X;  2CBL A;  2WCE A;  1QV1 A;  2M49 B;  2JQ6 A;  3AAK A;  2LV7 A;  3AKA A;  1KQV A;  3KPX A;  1IRJ A;  1J7O A;  1BOD A;  1OSA A;  1XFW O;  3PFV A;  1N2D A;  1RRO A;  1AP4 A;  1BR4 B;  1DGU A;  1QIW A;  1KSO A;  1XYD A;  4ICB A;  1TN4 A;  2D8N A;  1PRW A;  1QX7 A;  1UUR A;  1K90 D;  1MXL C;  5HKW A;  1SL8 A;  1K93 D;  1CDP A;  1CNP A;  1SW8 A;  2L51 A;  1Y0V H;  1ZAC A;  1B9A A;  1VRK A;  1UHJ A;  3BOW B;  4L9M A;  2KYF A;  2KDH A;  1CKK A;  5KTY A;  1QLS A;  1YX8 A;  2KAY A;  5AER A;  1F55 A;  4MZL A;  4GGN A;  3RM1 A;  1CB1 A;  1JC2 A;  2LLU A;  3M0W A;  1YUT A;  4NDB A;  4FQO A;  2M29 A;  4OKH A;  5J3X A;  1YRT B;  1XK4 A;  2CNP A;  4GGF A;  4M2Q A;  2I7A A;  3WHT B;  2WND A;  1PAL A;  1KQM B;  4OV2 A;  2ISD A;  1F4Q A;  2KFH A;  2LVJ A;  2HPS A;  2KGR A;  2GGM A;  1KFU S;  2JUL A;  1QX5 B;  4IL1 A;  1GJY A;  2WOR A;  3GK2 A;  3PN7 C;  4F0Z B;  4E68 A;  5HLV A;  2EC6 C;  1B8L A;  2JZI A;  2H2K A;  1CM1 A;  1CDL A;  1S1E A;  3NSL A;  2MA2 A;  3SG2 A;  3ZWH A;  2TN4 A;  2LAN A;  2V53 A;  2FCD A;  3LK0 A;  1EJ3 A;  1RK9 A;  3CLN A;  2K0J A;  4MZK A;  2LP2 A;  2MLF C;  1GQM A;  1W7I B;  1BF5 A;  1K96 A;  1TRF A;  4MRX A;  2WC8 A;  5I2Q A;  5DKR A;  1AJ4 A;  1RTP 1;  1NPQ A;  1JFJ A;  2WCB A;  1MR8 A;  1DF0 B;  3C1V A;  1OE9 B;  5I2O A;  2JTZ A;  2L2E A;  3BUX B;  1S6C A;  2E30 A;  1SY9 A;  3A8R A;  1FF1 A;  1SBJ A;  1YX7 A;  2F33 A;  3O2P A;  4HRG A;  4YI9 A;  1K8U A;  1F54 A;  3BYA A;  3NSK A;  3VRR A;  4QJ5 B;  3I5G C;  3IF7 A;  2KQY A;  1NCX A;  1MXE A;  3EK8 A;  2JPT A;  1WRZ A;  2BE6 A;  2Q4U A;  3IQQ A;  1IQ5 A;  5HYD A;  4GBA A;  2VRG A;  4A4B A;  4M2O A;  2EC6 B;  1CFF A;  1DJG A;  3CR5 X;  1MHO A;  4WRI A;  1SL7 A;  1TTX A;  1QVI Z;  3IQO A;  4I5L B;  1NSH A;  4XYN A;  1SCV A;  1B7T Y;  3ZNI A;  1NWD A;  2H61 A;  4JPZ B;  4OCI A;  1NX0 A;  1C07 A;  1F71 A;  4P5O E;  1YRU B;  5PAL A;  1B4C A;  4A4C A;  3SIB A;  4GAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...