1IG5A

Bovine calbindin d9k binding mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
b'KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN, INTESTINAL
publication title Structural basis for the negative allostery between Ca(2+)- and Mg(2+)-binding in the intracellular Ca(2+)-receptor calbindin D9k.
pubmed rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ig5A00
1PRWA 2JWWA 1YURA 1M39A 2EC6C 2WCFA 1CDPA 2K7DA 4C0JA 1K9KA 3TDZA 1KFUL 1QIVA 2LUCA 1KK8B 3SIAA 1W7IB 2M0RA 3EVRA 3WNXB 3AAJA 2KHNA 1SKTA 4QJ4B 2Y4QA 4GNKB 1G4YR 1XVJA 2LE9B 1RK9A 1BODA 2IS9A 4XJKA 2OTGC 1TTXA 2M1KB 2BKIB 1KSOA 3GK4X 1KQVA 5AXIA 1Q80A 2AUCA 1XA5A 4JPZB 2LUXA 2H61A 3I5FB 1YUTA 1PVBA 1BT6A 1MUXA 2KFHA 2SASA 3DF0A 3FWCA 5I2OA 3PM8A 2BCAA 5CSNA 3I5HB 1IJ6A 3JTDC 4WRIA 2M7LA 4N5XA 4DRWA 4AQJA 1F70A 3IF7A 2M1UA 1S6IA 1MR8A 1C7VA 4MN0A 1WLMA 1OQPA 3KF9A 5I2QA 1L2OC 2LHIA 4JWQA 5GQQC 2EC6B 2CCMA 1UP5A 2JNFA 1S36A 2E6WA 2WCEA 1ZACA 3O2PA 3CZTX 3GK2A 1WDCC 1TIZA 2JOJA 4PHJA 1DVIA 1UHNA 4ORCB 1OOJA 1LKJA 3JVTC 4MBEA 1ZOTB 4P5OE 1OZSA 3EKHA 1EH2A 1IG5A 3WXAA 4GGNA 2MBXA 1DF0B 5BPJA 3NSKA 2MLEC 1IWQA 2MLFC 3F45A 5HYDA 1B4CA 1RECA 1N0YA 5CSFA 4BY4A 1SNLA 3I5GB 4DS7A 1K94A 4ETOA 1OSAA 4JQ0D 5F6TA 3BOWB 3O6BA 2JT8A 1OMDA 5JOLA 4OV2A 2QPTA 1NIWA 3VRPA 1DT7B 1TNXA 3CR2A 5D69A 1QV0A 2F2PA 2G9BA 2WCBA 2FCDA 1A4PA 4C0LA 2LC5A 3TS5C 2HETA 2F3YA 2KAVA 1YX8A 1S5GZ 2MHHA 1XK4A 1FF1A 1TRFA 2K7CA 1SW8A 5J3XA 3OB2B 2WOSA 1CNPA 2LCPA 1L2OB 3SG3A 1TN4A 3EVUA 1MF8B 1DTLA 3LL8B 3NSLA 1BJFA 1DJGA 3EKJA 4GGFC 1AHRA 1B9AA 1A29A 2HPSA 2LMTA 1UHHA 1NX3A 1KQMC 3JVTB 2H2KA 1K2HA 1Y1XA 1NCXA 1PALA 2L4HA 2M9GA 5G08A 3VGOA 1Y0VH 1YX7A 3CWGA 1OMRA 1A75A 3DD4A 4MRYA 1K93D 2JZIA 2PASA 1D1OA 1DJYA 5KSZA 4PCWA 3EK8A 1CLLA 1GJYA 1SCMB 4PHNA 3PN7B 1A03A 1CKKA 1J7RA 1QASA 2NCPA 2JTZA 4YRUA 2CBLA 1C07A 1LXFC 2KI6D 1CLBA 2KFFA 1NUBA 2CTNA 4PE0A 2KAXA 1GQMA 1NP8A 1GGZA 4A4BA 4PE1A 1K9PA 1S3PA 2D8NA 2LNKA 3EVVA 3I5IC 1BF5A 1TNPA 3KHEA 3OB1B 2E30A 2LLSA 1RWYA 2COLB 1KQMB 2F33A 1S1EA 1TNWA 1FI5A 2HQ8A 2P6BB 3KO0A 4ICBA 5HLVA 3DVMA 1RTP1 3AKBA 1CFCA 4NDBA 3LK1A 1IQ5A 4NDCA 2KGBC 2LP2A 1B7TY 2Y1MA 4YGCB 1HQVA 1K8UA 4U8DA 1MHOA 2O60A 5CSIA 4BY5A 1B8RA 2LLUA 1IQ3A 3CR4X 1GGWA 5ER5A 2B1UA 4GFTA 2FJUB 2DOQA 1NX2A 2JTTA 3D0YB 4UPGA 1J7QA 2KOTA 3I5GC 4MZLA 1TOPA 1MQ1A 1CDNA 2L50A 1TCOB 3E3RA 3K21A 3DVJA 3TDIA 3FIAA 1S6CA 1J1DA 1SL8A 2K0JA 3HX4A 4CIDA 1DJXA 1SCVA 4NDDA 1NPQA 1PSBA 1QLKA 2AMIA 3AKAA 1KK7Y 1TNQA 2M7NA 2M8UA 5DKNA 1BG1A 3I5IB 1SR6C 4ZCVA 3RLZA 3ZWHA 2ZN9A 3D10A 4MLWA 4YBHB 3BOWA 1Y6WA 4ORAB 1RJVA 2BKHB 1NX0A 4OCIA 3GK1A 1RROA 5KU1A 4PE4A 1G33A 1ZMZA 1F54A 1NCYA 2LMVA 3OHMB 1E8AA 1N65A 1UURA 3CS1A 3TUYC 3PALA 1EJ3A 2JXLA 1FBVA 2JPTA 3ZNIA 2LV7A 4AQIA 1YUUA 3BUWB 4R1EA 4IL1A 3DVKA 2ZRTA 5CPVA 3H4SE 5HKWA 1SCMC 3SJSA 2NXQA 5HLOA 1OMVA 3PN7C 4QJ3B 2RGIA 1K96A 1QX5B 1SPYA 1R6PA 1QVIY 1SR6B 1U5IA 1F4QA 2PVBA 3DF0B 3MSEB 4MVFA 4MZKA 4PDZA 4PHMA 3O4YA 1B8CA 2L4IA 4DCKA 4YGEB 1CMGA 2BL0C 1AJ4A 2OPOA 2K2AA 2K61A 4GUKA 2JU0A 5I8NA 2L5XB 2Q91A 2KBIA 3EK4A 4L9MA 1AK8A 2ISDA 1AVSA 2CNPA 4GPLB 1Y1UA 1CFDA 2NZ0A 1JFJA 1CDLA 3SIBA 2JT0A 1JC2A 2AAOA 1Y1AA 1BLQA 1N2DA 1XFYO 2LVKA 5TNCA 1F4OA 2KFGA 3TUYB 2KSPA 2HQWA 2L51A 1PVAA 1SYMA 4N1FA 2PMYA 2NCOA 3SG4A 2PRUA 1OE9B 4PE7A 3NXAA 4GGFA 2ZRSA 4M2OA 2KQ6A 1YR5A 3KEVA 4HREE 1LA3A 3HCMA 1HT9A 1KFXL 1UWOA 2KDHA 3CGAA 4I5NB 1QLSA 4ZCUA 1WLZA 3OP0A 4QJ5B 1QTXA 2K7OA 4CFRA 2QACA 1JF0A 1QV1A 5HKZA 1B1GA 2KGRA 2BBMA 1UUSA 1NCZA 1C7WA 2BL0B 3NSIA 3PATA 3CLNA 1K95A 2SCPA 3NSOA 2LM5A 4HRGA 1NYAA 3BUXB 2M97A 1DMOA 1F8HA 1J7OA 1XFUO 1TCFA 1X02A 2ZNDA 1K90D 3D0YA 3QRXA 4YGBB 2R2IA 1DGVA 4HSZA 2KNEA 2CT9A 2GGMA 2BCBA 1M63B 2F8PA 4AOMA 1SY9A 1VRKA 1J1EA 2WC8A 5DKRA 4GAOA 1SRAA 4MSPA 3SG6A 2I2RE 2JXCA 1SMGA 1PK0D 3OX6A 4NQGA 2JQ6A 1QX2A 2BBNA 1PSRA 1KK7Z 1K9UA 1S6JA 4OKHA 5I2LA 4HRHA 4TNCA 5AFPA 3BYAA 3ICBA 2ZNEA 1EG3A 5B8IB 4YGAA 1IH0A 2FOTA 4DIRA 1BR4B 1NWDA 1OZOA 2JNXA 1LINA 5CSJA 2PSRA 2NLNA 1JFKA 3PLFB 2F2OA 1BU3A 2BCXA 2WORA 1YVHA 1WRKA 1JWDA 5K89A 1AP4A 1CB1A 2KQYA 3IQOA 4M2QA 4CPVA 2OS8B 1YTZC 2I94A 4GBAA 2L0PA 1DJIA 1DF0A 1XFXO 2L2EA 2H61C 2LHLA 1KFXS 1QATA 2VRGA 3PFVA 4USLA 3VROA 5ER4X 1BOCA 1QXPA 2F3ZA 2KAYA 3IQQA 4YI8A 5AANA 1WRLA 2CXJA 1H4BA 4PALA 1PULA 1G8IA 2LP3A 2EHBA 1YVLA 4I5KA 2LVIA 1KWOB 1SL7A 4OR9B 4ORBB 1MWNA 1BMOA 3LCPC 4WQ3A 5D7FA 3LK0A 1QVIZ 2V53A 4WQ2A 4MRXA 1LVCD 2K7BA 2MJWB 1FPWA 1XYDA 1QS7A 1UHJA 1AUIB 3TDUA 1M46A 4YGDB 1EG4A 4XJKB 1YRUB 1R2UA 1NSHA 2Y5IA 2LLTA 2LANA 5FYXA 3A8RA 2K2FA 1ALVA 2GV5A 2BE6A 4E68A 3LLEA 1ZUZA 1WY9A 1QX7A 5AERA 1JF2A 2K8MB 5DKQA 2HF5A 1JUOA 1UHKA 1CM4A 1YUSA 2ZKMX 2OTGB 1IKUA 2KI6C 1MXLC 2M3WA 2WNDA 2ZFDA 3FWBA 3TZ1A 3C1VA 1KSMA 1LA0A 2JT3A 2FCEA 1BR1B 2KBMA 1DJZA 1RFJA 1XFVO 1IJ5A 2JULA 1KFUS 1XK4C 2BE4A 1SL9A 1JSAA 3BUMB 4C0KA 2KI4C 1V1GA 1F55A 3WHTB 3FS7A 1CDMA 3WHUB 3M0WA 3SG7A 3JTDB 4XYNA 4P2YB 2G2BA 3BUNB 3BQ3A 4A4CA 3CR5X 1W7JB 1J7PA 1FI6A 1L7ZA 4CFQA 1DJHA 2L98A 1DJWA 5HKYA 1FW4A 1B8LA 1EXRA 1MXEA 1SBJA 1CTRA 4M2PA 3VRQA 1QIWA 2I18A 1IGVA 2LMUA 4N1GA 5PALA 2KYFA 4DUQA 1S26D 1SK6D 1CFFA 3KPXA 1V1FA 1WDCB 3A4UB 2MRDA 1ZFSA 4FQOA 3DVEA 1NX1A 1XO5A 1ODBA 5KTYA 1M31A 1XFWO 2LVJA 1H8BA 2MAZA 3O78A 1ALWA 1EL4A 4MEWA 1S5GY 3BXKA 1UHIA 1J55A 1QJTA 3CTNA 2OS8C 1B7TZ 1KK8C 2MA2A 1U5IB 1XFZO 4I5LB 2JRFA 1YRTB 3OX5A 2KI4B 1A2XA 2M49B 4I5JA 1B47A 2M29A 5IBWA 2KYCA 2A4JA 2ZN8A 5JJGA 2EGDA 4F0ZB 3AAKA 4FTGA 3VRNA 1CMFA 3BUOB 3GOFA 1IRJA 3TS5B 4PHKA 4Q04A 3EK7A 3I5FC 4YI9A 1KWOC 1AJ5A 3PSRA 1CLMA 1WRZA 1DGUA 2TN4A 2Y1NA 2O5GA 3I5HC 5AEQA 3SG5A 3RM1A 3VRRA 2PALA 2BECA 4MZJA 4OVNF 1A75B 2I7AA 1M45A 2LAPA 1KCYA 2JC2A 2GGZA 1CM1A 1JBAA 3SG2A 1F71A 4CLNA 1CFPA 4D1EA 2LVVA 2Q4UA
chains in the Genus database with same CATH superfamily
1PRWA 2JWWA 1YURA 1M39A 2EC6C 2WCFA 1CDPA 2K7DA 4C0JA 4JKTA 1K9KA 3TDZA 1KFUL 1QIVA 2LUCA 1KK8B 3IVTA 3SIAA 1W7IB 2M0RA 3EVRA 3WNXB 3AAJA 2KHNA 1SKTA 4QJ4B 2Y4QA 4GNKB 1G4YR 1XVJA 2LE9B 1RK9A 1BODA 2IS9A 4XJKA 2OTGC 1TTXA 2M1KB 2BKIB 1KSOA 3GK4X 1KQVA 5AXIA 1C3ZA 3BFBA 1Q80A 2AUCA 1XA5A 3R72A 4JPZB 3FE8A 2LUXA 2H61A 3I5FB 1YUTA 1PVBA 1BT6A 1MUXA 2KFHA 2SASA 3DF0A 3FWCA 5I2OA 3PM8A 1QWVA 2BCAA 5CSNA 3I5HB 1IJ6A 3JTDC 4WRIA 2M7LA 4N5XA 4DRWA 4AQJA 1F70A 3IF7A 2BNXA 2M1UA 3B6XA 1S6IA 2L5YA 2KLEA 1MR8A 1C7VA 4MN0A 1WLMA 1OQPA 3KF9A 3O4XA 5I2QA 1L2OC 3NGVA 2LHIA 4JWQA 5GQQC 2EC6B 2CCMA 1UP5A 2JNFA 1S36A 2E6WA 2ERBA 2WCEA 1ZACA 3O2PA 3CZTX 3GK2A 1WDCC 1TIZA 2JOJA 4PHJA 1DVIA 1UHNA 4ORCB 3S0FA 1OOJA 1LKJA 3JVTC 3D78A 4MBEA 1ZOTB 4P5OE 1OZSA 3EKHA 1EH2A 1IG5A 3WXAA 4GGNA 2MBXA 1DF0B 5BPJA 3NSKA 2MLEC 2GTEA 1IWQA 2MLFC 3F45A 5HYDA 1B4CA 1RECA 1N0YA 5CSFA 3DXLA 1SNLA 4BY4A 3I5GB 4DS7A 1K94A 4ETOA 1OSAA 4JQ0D 5F6TA 3BOWB 3O6BA 2JT8A 1OMDA 3OBVA 5JOLA 4OV2A 2QPTA 1NIWA 3VRPA 1DT7B 1TNXA 3CR2A 5D69A 1QV0A 2F2PA 2G9BA 2WCBA 4INXA 2FCDA 1A4PA 4C0LA 2LC5A 3TS5C 2HETA 2F3YA 2KAVA 1YX8A 1S5GZ 2K60A 2MHHA 1XK4A 1FF1A 1TRFA 2K7CA 1SW8A 5J3XA 3OB2B 2WOSA 1CNPA 2LCPA 1L2OB 1TWOA 3SG3A 1TN4A 3BFHA 3EVUA 1MF8B 1ORGA 1TUZA 1DTLA 3LL8B 3CZ2A 3NSLA 1BJFA 1P28A 1DJGA 2YGUA 3EKJA 3CDNA 1GM0A 4GGFC 1AHRA 3VROA 1B9AA 1A29A 2HPSA 2LMTA 1UHHA 1NX3A 1KQMC 3JVTB 2H2KA 3DZTA 1K2HA 1Y1XA 1NCXA 1PALA 2L4HA 2M9GA 5G08A 3VGOA 1Y0VH 1YX7A 3CWGA 1OMRA 1A75A 3DD4A 4MRYA 1K93D 2JZIA 2PASA 1D1OA 1DJYA 5KSZA 4PCWA 3EK8A 1CLLA 1GJYA 1SCMB 4PHNA 3PN7B 1A03A 1CKKA 1J7RA 1QASA 5EL2A 2NCPA 2JTZA 3NHTA 4YRUA 2CBLA 1C07A 1LXFC 2KI6D 1CLBA 2KFFA 1NUBA 2CTNA 4PE0A 2KAXA 1GQMA 1NP8A 3L4LA 1GGZA 4A4BA 4PE1A 1K9PA 1S3PA 2D8NA 2LNKA 2QDIA 3EVVA 3I5IC 1BF5A 1TNPA 3KHEA 3OB1B 2E30A 2LLSA 1RWYA 2COLB 1KQMB 2F33A 1S1EA 1TNWA 1FI5A 2HQ8A 2P6BB 3KO0A 4ICBA 5HLVA 3DVMA 1RTP1 2WCKA 3AKBA 1CFCA 4NDBA 3LK1A 1IQ5A 4NDCA 2KGBC 2LP2A 1B7TY 2Y1MA 2H8VA 4YGCB 1HQVA 1K8UA 4U8DA 1MHOA 2O60A 5CSIA 4BY5A 1B8RA 4JD9A 2LLUA 4OZDA 2QEBA 3CR4X 1IQ3A 5ER5A 1GGWA 2B1UA 4GFTA 4F7FA 2FJUB 2DOQA 1NX2A 2JTTA 3D0YB 4UPGA 1J7QA 2KPHA 2KOTA 3L4AA 3I5GC 4MZLA 1TOPA 1MQ1A 1CDNA 5I94A 2L50A 1TCOB 3E3RA 3K21A 3DVJA 3TDIA 3FIAA 1S6CA 1J1DA 1SL8A 2K0JA 2QEVA 3HX4A 4CIDA 1DJXA 1SCVA 4KYNA 1NPQA 1OOHA 1PSBA 1QLKA 2AMIA 3AKAA 4NDDA 1KK7Y 3UO9A 1TNQA 2M7NA 2M8UA 5DKNA 1BG1A 3I5IB 1SR6C 4ZCVA 3RLZA 3ZWHA 2ZN9A 5D3OA 3D10A 4MLWA 3EG5B 3S0AA 4YBHB 3BOWA 4IJ7A 1Y6WA 4ORAB 3NHIA 1RJVA 2BKHB 1NX0A 4OCIA 3GK1A 1RROA 5KU1A 4PE4A 1G33A 1ZMZA 1F54A 1NCYA 2LMVA 3DYEA 3OHMB 1W9ZA 1E8AA 1N65A 1UURA 3CS1A 3QMEA 3VB1A 3TUYC 2L2CA 3CABA 3PALA 1EJ3A 2JXLA 1FBVA 2JPTA 3ZNIA 2LV7A 4AQIA 1YUUA 3BUWB 4FQTA 4R1EA 4IL1A 3DVKA 2ZRTA 3B88A 4INWA 5CPVA 3H4SE 5HKWA 1SCMC 3SJSA 2NXQA 5HLOA 1OMVA 3SS5A 3PN7C 4QJ3B 2RGIA 1K96A 1QX5B 1SPYA 1R6PA 1QVIY 1SR6B 1U5IA 1F4QA 2PVBA 3DF0B 3MSEB 4MVFA 4MZKA 4PDZA 3S0EA 4PHMA 3O4YA 1B8CA 2L4IA 3V2LA 4DCKA 4YGEB 1CMGA 2BL0C 1AJ4A 2OPOA 2K2AA 2K61A 4GUKA 2JU0A 5I8NA 3D76A 2L5XB 2Q91A 2KBIA 3EK4A 4L9MA 1AK8A 2ISDA 1AVSA 2CNPA 4GPLB 3S0BA 1Y1UA 3D74A 1CFDA 2NZ0A 3B7AA 1JFJA 1CDLA 3DY9A 3SIBA 2JT0A 2QEOA 1C3YA 2AAOA 1JC2A 1Y1AA 1BLQA 1N2DA 1XFYO 2LVKA 5TNCA 1F4OA 2KFGA 3TUYB 2KSPA 1Z4HA 2HQWA 2L51A 1PVAA 1SYMA 4N1FA 2PMYA 2NCOA 3SG4A 2PRUA 1OE9B 3PJIA 4PE7A 3NXAA 4GGFA 2ZRSA 4M2OA 2KQ6A 1YR5A 3KEVA 4HREE 1LA3A 3HCMA 1HT9A 1KFXL 1UWOA 2KDHA 3CGAA 4I5NB 1QLSA 4ZCUA 1WLZA 3OP0A 4QJ5B 1QTXA 3UNWA 2K7OA 4CFRA 2QACA 1JF0A 1QV1A 5HKZA 1B1GA 2KGRA 2BBMA 1UUSA 1NCZA 1C7WA 2BL0B 3NSIA 3PATA 3CLNA 1K95A 2SCPA 3NSOA 2LM5A 4HRGA 1NYAA 3BUXB 3B86A 2M97A 1DMOA 1F8HA 1J7OA 1XFUO 1TCFA 1X02A 2ZNDA 1K90D 3D0YA 3QRXA 4YGBB 2R2IA 1DGVA 3K1EA 5FI7A 4HSZA 2KNEA 4PT1A 2CT9A 2GGMA 2BCBA 1M63B 2F8PA 2PQLA 4AOMA 3CZ0A 1SY9A 1VRKA 1J1EA 2WC8A 5DKRA 4GAOA 1SRAA 2FJYA 4MSPA 2I2RE 2JXCA 3SG6A 2WC5A 1SMGA 1PK0D 3OX6A 4NQGA 2JQ6A 1OOIX 1QX2A 2BBNA 1PSRA 1KK7Z 1K9UA 1S6JA 4OKHA 5I2LA 4HRHA 4TNCA 5AFPA 1OW4A 3BYAA 3ICBA 2ZNEA 1EG3A 3CZ1A 5FI2A 5B8IB 4YGAA 1IH0A 2FOTA 4DIRA 1BR4B 1NWDA 1OZOA 2JNXA 1LINA 5CSJA 2PSRA 2NLNA 1JFKA 3PLFB 2F2OA 1BU3A 2BCXA 2WORA 1YVHA 1WRKA 1JWDA 5K89A 1AP4A 1CB1A 2KQYA 3IQOA 4M2QA 4CPVA 2OS8B 1YTZC 2I94A 2WC6A 4GBAA 2L0PA 1DJIA 1DF0A 1XFXO 2BAPA 2H61C 2L2EA 1KFXS 1QATA 2LHLA 2VRGA 3PFVA 4USLA 5ER4X 1BOCA 1QXPA 2F3ZA 2KAYA 3IQQA 4YI8A 5AANA 1WRLA 2CXJA 2PYQA 4PALA 1H4BA 1PULA 1G8IA 2LP3A 2EHBA 3Q8IA 1OOFA 1YVLA 4I5KA 2LVIA 1KWOB 1SL7A 4OR9B 4ORBB 1MWNA 1BMOA 3LCPC 4WQ3A 2WCJA 5D7FA 3LK0A 1QVIZ 2V53A 4WQ2A 4MRXA 3N7HA 1LVCD 3PM2A 2K7BA 2MJWB 1FPWA 1OOGA 1XYDA 3BFAA 3CYZA 1QS7A 3D73A 1UHJA 3D77A 5FI6A 1AUIB 3L47A 3TDUA 1M46A 4YGDB 1EG4A 4XJKB 1YRUB 1R2UA 1NSHA 2Y5IA 2LLTA 2LANA 5FYXA 3A8RA 2K2FA 1ALVA 2GV5A 3RZSA 2BE6A 4E68A 5HL1A 3LLEA 1ZUZA 1WY9A 1QX7A 5AERA 1JF2A 2K8MB 3R1OA 5DKQA 3S0GA 2HF5A 1JUOA 1UHKA 1CM4A 1YUSA 2ZKMX 2OTGB 1IKUA 2KI6C 1MXLC 2M3WA 2WNDA 2ZFDA 2WCHA 3FWBA 3TZ1A 3C1VA 1KSMA 3R1VA 1LA0A 2JT3A 2FCEA 1BR1B 2KBMA 1DJZA 1RFJA 1XFVO 1IJ5A 1DELA 2JULA 1KFUS 1XK4C 2BE4A 1SL9A 1JSAA 3BUMB 4C0KA 2KI4C 1DQEA 1V1GA 1F55A 3WHTB 3FS7A 1CDMA 3WHUB 3M0WA 3SG7A 5DICA 3JTDB 4XYNA 4P2YB 1IIOA 2G2BA 3BUNB 3BQ3A 4A4CA 3CR5X 1W7JB 1J7PA 1FI6A 1L7ZA 4CFQA 1DJHA 2L98A 1DJWA 1LS8A 1DEKA 1T14A 5HKYA 3SS3A 1FW4A 1B8LA 1EXRA 1MXEA 1SBJA 1CTRA 2P70A 4M2PA 3VRQA 1QIWA 2I18A 1IGVA 2LMUA 4N1GA 5PALA 2KYFA 4DUQA 1S26D 1SK6D 1CFFA 3KPXA 1V1FA 1WDCB 3A4UB 1TUJA 2MRDA 1ZFSA 3SS4A 4FQOA 3DVEA 1NX1A 1XO5A 1ODBA 3BJHA 1M31A 1XFWO 5KTYA 2LVJA 1H8BA 2MAZA 3O78A 1ALWA 1EL4A 4MEWA 1S5GY 1Z2CB 3BXKA 1UHIA 1J55A 1QJTA 3CTNA 2OS8C 1B7TZ 1KK8C 3R1PA 2MA2A 1U5IB 1XFZO 2JPOA 1DC1A 4I5LB 2JRFA 1YRTB 3OX5A 2KI4B 1A2XA 2M49B 4I5JA 1B47A 2M29A 5IBWA 2KYCA 2A4JA 2ZN8A 5JJGA 2EGDA 4F0ZB 3AAKA 4FTGA 3VRNA 2WCMA 3BUOB 3GOFA 1CMFA 1IRJA 3TS5B 4PHKA 2P71A 4Q04A 3EK7A 3FE6A 3I5FC 1XFRA 4YI9A 2QEHA 2KLDA 1KWOC 1AJ5A 3PSRA 1CLMA 1WRZA 1DGUA 2TN4A 2WCLA 2O5GA 2Y1NA 3B87A 3I5HC 3OGNA 5AEQA 3RM1A 1SSEB 3SG5A 3VRRA 2PALA 2BECA 4MZJA 4OVNF 1A75B 3FE9A 2I7AA 1M45A 2LAPA 1KCYA 3S0DA 2JC2A 2GGZA 3D75A 1CM1A 1JBAA 3SG2A 1F71A 4CLNA 1CFPA 4D1EA 2LVVA 2Q4UA
chains in the Genus database with same CATH topology
1PRWA 2JWWA 1YURA 1M39A 2EC6C 2WCFA 1CDPA 2K7DA 4C0JA 1K9KA 3TDZA 1KFUL 1QIVA 2LUCA 1KK8B 3SIAA 1W7IB 2M0RA 3EVRA 3WNXB 3AAJA 2KHNA 1SKTA 4QJ4B 2Y4QA 4GNKB 1G4YR 1XVJA 2LE9B 1RK9A 1BODA 2IS9A 4XJKA 2OTGC 1TTXA 2M1KB 2BKIB 1KSOA 3GK4X 1KQVA 5AXIA 1Q80A 2AUCA 1XA5A 4JPZB 2LUXA 2H61A 3I5FB 1YUTA 1PVBA 1BT6A 1MUXA 2KFHA 2SASA 3DF0A 3FWCA 5I2OA 3PM8A 2BCAA 5CSNA 3I5HB 1IJ6A 3JTDC 4WRIA 2M7LA 4N5XA 4DRWA 4AQJA 1F70A 3IF7A 2M1UA 1S6IA 1MR8A 1C7VA 4MN0A 1WLMA 1OQPA 3KF9A 5I2QA 1L2OC 2LHIA 4JWQA 5GQQC 2EC6B 2CCMA 1UP5A 2JNFA 1S36A 2E6WA 2WCEA 1ZACA 3O2PA 3CZTX 3GK2A 1WDCC 1TIZA 2JOJA 4PHJA 1DVIA 1UHNA 4ORCB 1OOJA 1LKJA 3JVTC 4MBEA 1ZOTB 4P5OE 1OZSA 3EKHA 1EH2A 1IG5A 3WXAA 4GGNA 2MBXA 1DF0B 5BPJA 3NSKA 2MLEC 1IWQA 2MLFC 3F45A 5HYDA 1B4CA 1RECA 1N0YA 5CSFA 4BY4A 1SNLA 3I5GB 4DS7A 1K94A 4ETOA 1OSAA 4JQ0D 5F6TA 3BOWB 3O6BA 2JT8A 1OMDA 5JOLA 4OV2A 2QPTA 1NIWA 3VRPA 1DT7B 1TNXA 3CR2A 5D69A 1QV0A 2F2PA 2G9BA 2WCBA 2FCDA 1A4PA 4C0LA 2LC5A 3TS5C 2HETA 2F3YA 2KAVA 1YX8A 1S5GZ 2MHHA 1XK4A 1FF1A 1TRFA 2K7CA 1SW8A 5J3XA 3OB2B 2WOSA 1CNPA 2LCPA 1L2OB 3SG3A 1TN4A 3EVUA 1MF8B 1DTLA 3LL8B 3NSLA 1BJFA 1DJGA 3EKJA 4GGFC 1AHRA 1B9AA 1A29A 2HPSA 2LMTA 1UHHA 1NX3A 1KQMC 3JVTB 2H2KA 1K2HA 1Y1XA 1NCXA 1PALA 2L4HA 2M9GA 5G08A 3VGOA 1Y0VH 1YX7A 3CWGA 1OMRA 1A75A 3DD4A 4MRYA 1K93D 2JZIA 2PASA 1D1OA 1DJYA 5KSZA 4PCWA 3EK8A 1CLLA 1GJYA 1SCMB 4PHNA 3PN7B 1A03A 1CKKA 1J7RA 1QASA 2NCPA 2JTZA 4YRUA 2CBLA 1C07A 1LXFC 2KI6D 1CLBA 2KFFA 1NUBA 2CTNA 4PE0A 2KAXA 1GQMA 1NP8A 1GGZA 4A4BA 4PE1A 1K9PA 1S3PA 2D8NA 2LNKA 3EVVA 3I5IC 1BF5A 1TNPA 3KHEA 3OB1B 2E30A 2LLSA 1RWYA 2COLB 1KQMB 2F33A 1S1EA 1TNWA 1FI5A 2HQ8A 2P6BB 3KO0A 4ICBA 5HLVA 3DVMA 1RTP1 3AKBA 1CFCA 4NDBA 3LK1A 1IQ5A 4NDCA 2KGBC 2LP2A 1B7TY 2Y1MA 4YGCB 1HQVA 1K8UA 4U8DA 1MHOA 2O60A 5CSIA 4BY5A 1B8RA 2LLUA 1IQ3A 3CR4X 1GGWA 5ER5A 2B1UA 4GFTA 2FJUB 2DOQA 1NX2A 2JTTA 3D0YB 4UPGA 1J7QA 2KOTA 3I5GC 4MZLA 1TOPA 1MQ1A 1CDNA 2L50A 1TCOB 3E3RA 3K21A 3DVJA 3TDIA 3FIAA 1S6CA 1J1DA 1SL8A 2K0JA 3HX4A 4CIDA 1DJXA 1SCVA 4NDDA 1NPQA 1PSBA 1QLKA 2AMIA 3AKAA 1KK7Y 1TNQA 2M7NA 2M8UA 5DKNA 1BG1A 3I5IB 1SR6C 4ZCVA 3RLZA 3ZWHA 2ZN9A 3D10A 4MLWA 4YBHB 3BOWA 1Y6WA 4ORAB 1RJVA 2BKHB 1NX0A 4OCIA 3GK1A 1RROA 5KU1A 4PE4A 1G33A 1ZMZA 1F54A 1NCYA 2LMVA 3OHMB 1E8AA 1N65A 1UURA 3CS1A 3TUYC 3PALA 1EJ3A 2JXLA 1FBVA 2JPTA 3ZNIA 2LV7A 4AQIA 1YUUA 3BUWB 4R1EA 4IL1A 3DVKA 2ZRTA 5CPVA 3H4SE 5HKWA 1SCMC 3SJSA 2NXQA 5HLOA 1OMVA 3PN7C 4QJ3B 2RGIA 1K96A 1QX5B 1SPYA 1R6PA 1QVIY 1SR6B 1U5IA 1F4QA 2PVBA 3DF0B 3MSEB 4MVFA 4MZKA 4PDZA 4PHMA 3O4YA 1B8CA 2L4IA 4DCKA 4YGEB 1CMGA 2BL0C 1AJ4A 2OPOA 2K2AA 2K61A 4GUKA 2JU0A 5I8NA 2L5XB 2Q91A 2KBIA 3EK4A 4L9MA 1AK8A 2ISDA 1AVSA 2CNPA 4GPLB 1Y1UA 1CFDA 2NZ0A 1JFJA 1CDLA 3SIBA 2JT0A 1JC2A 2AAOA 1Y1AA 1BLQA 1N2DA 1XFYO 2LVKA 5TNCA 1F4OA 2KFGA 3TUYB 2KSPA 2HQWA 2L51A 1PVAA 1SYMA 4N1FA 2PMYA 2NCOA 3SG4A 2PRUA 1OE9B 4PE7A 3NXAA 4GGFA 2ZRSA 4M2OA 2KQ6A 1YR5A 3KEVA 4HREE 1LA3A 3HCMA 1HT9A 1KFXL 1UWOA 2KDHA 3CGAA 4I5NB 1QLSA 4ZCUA 1WLZA 3OP0A 4QJ5B 1QTXA 2K7OA 4CFRA 2QACA 1JF0A 1QV1A 5HKZA 1B1GA 2KGRA 2BBMA 1UUSA 1NCZA 1C7WA 2BL0B 3NSIA 3PATA 3CLNA 1K95A 2SCPA 3NSOA 2LM5A 4HRGA 1NYAA 3BUXB 2M97A 1DMOA 1F8HA 1J7OA 1XFUO 1TCFA 1X02A 2ZNDA 1K90D 3D0YA 3QRXA 4YGBB 2R2IA 1DGVA 4HSZA 2KNEA 2CT9A 2GGMA 2BCBA 1M63B 2F8PA 4AOMA 1SY9A 1VRKA 1J1EA 2WC8A 5DKRA 4GAOA 1SRAA 4MSPA 3SG6A 2I2RE 2JXCA 1SMGA 1PK0D 3OX6A 4NQGA 2JQ6A 1QX2A 2BBNA 1PSRA 1KK7Z 1K9UA 1S6JA 4OKHA 5I2LA 4HRHA 4TNCA 5AFPA 3BYAA 3ICBA 2ZNEA 1EG3A 5B8IB 4YGAA 1IH0A 2FOTA 4DIRA 1BR4B 1NWDA 1OZOA 2JNXA 1LINA 5CSJA 2PSRA 2NLNA 1JFKA 3PLFB 2F2OA 1BU3A 2BCXA 2WORA 1YVHA 1WRKA 1JWDA 5K89A 1AP4A 1CB1A 2KQYA 3IQOA 4M2QA 4CPVA 2OS8B 1YTZC 2I94A 4GBAA 2L0PA 1DJIA 1DF0A 1XFXO 2L2EA 2H61C 2LHLA 1KFXS 1QATA 2VRGA 3PFVA 4USLA 3VROA 5ER4X 1BOCA 1QXPA 2F3ZA 2KAYA 3IQQA 4YI8A 5AANA 1WRLA 2CXJA 1H4BA 4PALA 1PULA 1G8IA 2LP3A 2EHBA 1YVLA 4I5KA 2LVIA 1KWOB 1SL7A 4OR9B 4ORBB 1MWNA 1BMOA 3LCPC 4WQ3A 5D7FA 3LK0A 1QVIZ 2V53A 4WQ2A 4MRXA 1LVCD 2K7BA 2MJWB 1FPWA 1XYDA 1QS7A 1UHJA 1AUIB 3TDUA 1M46A 4YGDB 1EG4A 4XJKB 1YRUB 1R2UA 1NSHA 2Y5IA 2LLTA 2LANA 5FYXA 3A8RA 2K2FA 1ALVA 2GV5A 2BE6A 4E68A 3LLEA 1ZUZA 1WY9A 1QX7A 5AERA 1JF2A 2K8MB 5DKQA 2HF5A 1JUOA 1UHKA 1CM4A 1YUSA 2ZKMX 2OTGB 1IKUA 2KI6C 1MXLC 2M3WA 2WNDA 2ZFDA 3FWBA 3TZ1A 3C1VA 1KSMA 1LA0A 2JT3A 2FCEA 1BR1B 2KBMA 1DJZA 1RFJA 1XFVO 1IJ5A 2JULA 1KFUS 1XK4C 2BE4A 1SL9A 1JSAA 3BUMB 4C0KA 2KI4C 1V1GA 1F55A 3WHTB 3FS7A 1CDMA 3WHUB 3M0WA 3SG7A 3JTDB 4XYNA 4P2YB 2G2BA 3BUNB 3BQ3A 4A4CA 3CR5X 1W7JB 1J7PA 1FI6A 1L7ZA 4CFQA 1DJHA 2L98A 1DJWA 5HKYA 1FW4A 1B8LA 1EXRA 1MXEA 1SBJA 1CTRA 4M2PA 3VRQA 1QIWA 2I18A 1IGVA 2LMUA 4N1GA 5PALA 2KYFA 4DUQA 1S26D 1SK6D 1CFFA 3KPXA 1V1FA 1WDCB 3A4UB 2MRDA 1ZFSA 4FQOA 3DVEA 1NX1A 1XO5A 1ODBA 5KTYA 1M31A 1XFWO 2LVJA 1H8BA 2MAZA 3O78A 1ALWA 1EL4A 4MEWA 1S5GY 3BXKA 1UHIA 1J55A 1QJTA 3CTNA 2OS8C 1B7TZ 1KK8C 2MA2A 1U5IB 1XFZO 4I5LB 2JRFA 1YRTB 3OX5A 2KI4B 1A2XA 2M49B 4I5JA 1B47A 2M29A 5IBWA 2KYCA 2A4JA 2ZN8A 5JJGA 2EGDA 4F0ZB 3AAKA 4FTGA 3VRNA 1CMFA 3BUOB 3GOFA 1IRJA 3TS5B 4PHKA 4Q04A 3EK7A 3I5FC 4YI9A 1KWOC 1AJ5A 3PSRA 1CLMA 1WRZA 1DGUA 2TN4A 2Y1NA 2O5GA 3I5HC 5AEQA 3SG5A 3RM1A 3VRRA 2PALA 2BECA 4MZJA 4OVNF 1A75B 2I7AA 1M45A 2LAPA 1KCYA 2JC2A 2GGZA 1CM1A 1JBAA 3SG2A 1F71A 4CLNA 1CFPA 4D1EA 2LVVA 2Q4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRW A;  2JWW A;  1YUR A;  1M39 A;  2EC6 C;  2WCF A;  1CDP A;  2K7D A;  4C0J A;  1K9K A;  3TDZ A;  1KFU L;  1QIV A;  2LUC A;  1KK8 B;  3SIA A;  1W7I B;  2M0R A;  3EVR A;  3WNX B;  3AAJ A;  2KHN A;  1SKT A;  4QJ4 B;  2Y4Q A;  4GNK B;  1G4Y R;  1XVJ A;  2LE9 B;  1RK9 A;  1BOD A;  2IS9 A;  4XJK A;  2OTG C;  1TTX A;  2M1K B;  2BKI B;  1KSO A;  3GK4 X;  1KQV A;  5AXI A;  1Q80 A;  2AUC A;  1XA5 A;  4JPZ B;  2LUX A;  2H61 A;  3I5F B;  1YUT A;  1PVB A;  1BT6 A;  1MUX A;  2KFH A;  2SAS A;  3DF0 A;  3FWC A;  5I2O A;  3PM8 A;  2BCA A;  5CSN A;  3I5H B;  1IJ6 A;  3JTD C;  4WRI A;  2M7L A;  4N5X A;  4DRW A;  4AQJ A;  1F70 A;  3IF7 A;  2M1U A;  1S6I A;  1MR8 A;  1C7V A;  4MN0 A;  1WLM A;  1OQP A;  3KF9 A;  5I2Q A;  1L2O C;  2LHI A;  4JWQ A;  5GQQ C;  2EC6 B;  2CCM A;  1UP5 A;  2JNF A;  1S36 A;  2E6W A;  2WCE A;  1ZAC A;  3O2P A;  3CZT X;  3GK2 A;  1WDC C;  1TIZ A;  2JOJ A;  4PHJ A;  1DVI A;  1UHN A;  4ORC B;  1OOJ A;  1LKJ A;  3JVT C;  4MBE A;  1ZOT B;  4P5O E;  1OZS A;  3EKH A;  1EH2 A;  1IG5 A;  3WXA A;  4GGN A;  2MBX A;  1DF0 B;  5BPJ A;  3NSK A;  2MLE C;  1IWQ A;  2MLF C;  3F45 A;  5HYD A;  1B4C A;  1REC A;  1N0Y A;  5CSF A;  4BY4 A;  1SNL A;  3I5G B;  4DS7 A;  1K94 A;  4ETO A;  1OSA A;  4JQ0 D;  5F6T A;  3BOW B;  3O6B A;  2JT8 A;  1OMD A;  5JOL A;  4OV2 A;  2QPT A;  1NIW A;  3VRP A;  1DT7 B;  1TNX A;  3CR2 A;  5D69 A;  1QV0 A;  2F2P A;  2G9B A;  2WCB A;  2FCD A;  1A4P A;  4C0L A;  2LC5 A;  3TS5 C;  2HET A;  2F3Y A;  2KAV A;  1YX8 A;  1S5G Z;  2MHH A;  1XK4 A;  1FF1 A;  1TRF A;  2K7C A;  1SW8 A;  5J3X A;  3OB2 B;  2WOS A;  1CNP A;  2LCP A;  1L2O B;  3SG3 A;  1TN4 A;  3EVU A;  1MF8 B;  1DTL A;  3LL8 B;  3NSL A;  1BJF A;  1DJG A;  3EKJ A;  4GGF C;  1AHR A;  1B9A A;  1A29 A;  2HPS A;  2LMT A;  1UHH A;  1NX3 A;  1KQM C;  3JVT B;  2H2K A;  1K2H A;  1Y1X A;  1NCX A;  1PAL A;  2L4H A;  2M9G A;  5G08 A;  3VGO A;  1Y0V H;  1YX7 A;  3CWG A;  1OMR A;  1A75 A;  3DD4 A;  4MRY A;  1K93 D;  2JZI A;  2PAS A;  1D1O A;  1DJY A;  5KSZ A;  4PCW A;  3EK8 A;  1CLL A;  1GJY A;  1SCM B;  4PHN A;  3PN7 B;  1A03 A;  1CKK A;  1J7R A;  1QAS A;  2NCP A;  2JTZ A;  4YRU A;  2CBL A;  1C07 A;  1LXF C;  2KI6 D;  1CLB A;  2KFF A;  1NUB A;  2CTN A;  4PE0 A;  2KAX A;  1GQM A;  1NP8 A;  1GGZ A;  4A4B A;  4PE1 A;  1K9P A;  1S3P A;  2D8N A;  2LNK A;  3EVV A;  3I5I C;  1BF5 A;  1TNP A;  3KHE A;  3OB1 B;  2E30 A;  2LLS A;  1RWY A;  2COL B;  1KQM B;  2F33 A;  1S1E A;  1TNW A;  1FI5 A;  2HQ8 A;  2P6B B;  3KO0 A;  4ICB A;  5HLV A;  3DVM A;  1RTP 1;  3AKB A;  1CFC A;  4NDB A;  3LK1 A;  1IQ5 A;  4NDC A;  2KGB C;  2LP2 A;  1B7T Y;  2Y1M A;  4YGC B;  1HQV A;  1K8U A;  4U8D A;  1MHO A;  2O60 A;  5CSI A;  4BY5 A;  1B8R A;  2LLU A;  1IQ3 A;  3CR4 X;  1GGW A;  5ER5 A;  2B1U A;  4GFT A;  2FJU B;  2DOQ A;  1NX2 A;  2JTT A;  3D0Y B;  4UPG A;  1J7Q A;  2KOT A;  3I5G C;  4MZL A;  1TOP A;  1MQ1 A;  1CDN A;  2L50 A;  1TCO B;  3E3R A;  3K21 A;  3DVJ A;  3TDI A;  3FIA A;  1S6C A;  1J1D A;  1SL8 A;  2K0J A;  3HX4 A;  4CID A;  1DJX A;  1SCV A;  4NDD A;  1NPQ A;  1PSB A;  1QLK A;  2AMI A;  3AKA A;  1KK7 Y;  1TNQ A;  2M7N A;  2M8U A;  5DKN A;  1BG1 A;  3I5I B;  1SR6 C;  4ZCV A;  3RLZ A;  3ZWH A;  2ZN9 A;  3D10 A;  4MLW A;  4YBH B;  3BOW A;  1Y6W A;  4ORA B;  1RJV A;  2BKH B;  1NX0 A;  4OCI A;  3GK1 A;  1RRO A;  5KU1 A;  4PE4 A;  1G33 A;  1ZMZ A;  1F54 A;  1NCY A;  2LMV A;  3OHM B;  1E8A A;  1N65 A;  1UUR A;  3CS1 A;  3TUY C;  3PAL A;  1EJ3 A;  2JXL A;  1FBV A;  2JPT A;  3ZNI A;  2LV7 A;  4AQI A;  1YUU A;  3BUW B;  4R1E A;  4IL1 A;  3DVK A;  2ZRT A;  5CPV A;  3H4S E;  5HKW A;  1SCM C;  3SJS A;  2NXQ A;  5HLO A;  1OMV A;  3PN7 C;  4QJ3 B;  2RGI A;  1K96 A;  1QX5 B;  1SPY A;  1R6P A;  1QVI Y;  1SR6 B;  1U5I A;  1F4Q A;  2PVB A;  3DF0 B;  3MSE B;  4MVF A;  4MZK A;  4PDZ A;  4PHM A;  3O4Y A;  1B8C A;  2L4I A;  4DCK A;  4YGE B;  1CMG A;  2BL0 C;  1AJ4 A;  2OPO A;  2K2A A;  2K61 A;  4GUK A;  2JU0 A;  5I8N A;  2L5X B;  2Q91 A;  2KBI A;  3EK4 A;  4L9M A;  1AK8 A;  2ISD A;  1AVS A;  2CNP A;  4GPL B;  1Y1U A;  1CFD A;  2NZ0 A;  1JFJ A;  1CDL A;  3SIB A;  2JT0 A;  1JC2 A;  2AAO A;  1Y1A A;  1BLQ A;  1N2D A;  1XFY O;  2LVK A;  5TNC A;  1F4O A;  2KFG A;  3TUY B;  2KSP A;  2HQW A;  2L51 A;  1PVA A;  1SYM A;  4N1F A;  2PMY A;  2NCO A;  3SG4 A;  2PRU A;  1OE9 B;  4PE7 A;  3NXA A;  4GGF A;  2ZRS A;  4M2O A;  2KQ6 A;  1YR5 A;  3KEV A;  4HRE E;  1LA3 A;  3HCM A;  1HT9 A;  1KFX L;  1UWO A;  2KDH A;  3CGA A;  4I5N B;  1QLS A;  4ZCU A;  1WLZ A;  3OP0 A;  4QJ5 B;  1QTX A;  2K7O A;  4CFR A;  2QAC A;  1JF0 A;  1QV1 A;  5HKZ A;  1B1G A;  2KGR A;  2BBM A;  1UUS A;  1NCZ A;  1C7W A;  2BL0 B;  3NSI A;  3PAT A;  3CLN A;  1K95 A;  2SCP A;  3NSO A;  2LM5 A;  4HRG A;  1NYA A;  3BUX B;  2M97 A;  1DMO A;  1F8H A;  1J7O A;  1XFU O;  1TCF A;  1X02 A;  2ZND A;  1K90 D;  3D0Y A;  3QRX A;  4YGB B;  2R2I A;  1DGV A;  4HSZ A;  2KNE A;  2CT9 A;  2GGM A;  2BCB A;  1M63 B;  2F8P A;  4AOM A;  1SY9 A;  1VRK A;  1J1E A;  2WC8 A;  5DKR A;  4GAO A;  1SRA A;  4MSP A;  3SG6 A;  2I2R E;  2JXC A;  1SMG A;  1PK0 D;  3OX6 A;  4NQG A;  2JQ6 A;  1QX2 A;  2BBN A;  1PSR A;  1KK7 Z;  1K9U A;  1S6J A;  4OKH A;  5I2L A;  4HRH A;  4TNC A;  5AFP A;  3BYA A;  3ICB A;  2ZNE A;  1EG3 A;  5B8I B;  4YGA A;  1IH0 A;  2FOT A;  4DIR A;  1BR4 B;  1NWD A;  1OZO A;  2JNX A;  1LIN A;  5CSJ A;  2PSR A;  2NLN A;  1JFK A;  3PLF B;  2F2O A;  1BU3 A;  2BCX A;  2WOR A;  1YVH A;  1WRK A;  1JWD A;  5K89 A;  1AP4 A;  1CB1 A;  2KQY A;  3IQO A;  4M2Q A;  4CPV A;  2OS8 B;  1YTZ C;  2I94 A;  4GBA A;  2L0P A;  1DJI A;  1DF0 A;  1XFX O;  2L2E A;  2H61 C;  2LHL A;  1KFX S;  1QAT A;  2VRG A;  3PFV A;  4USL A;  3VRO A;  5ER4 X;  1BOC A;  1QXP A;  2F3Z A;  2KAY A;  3IQQ A;  4YI8 A;  5AAN A;  1WRL A;  2CXJ A;  1H4B A;  4PAL A;  1PUL A;  1G8I A;  2LP3 A;  2EHB A;  1YVL A;  4I5K A;  2LVI A;  1KWO B;  1SL7 A;  4OR9 B;  4ORB B;  1MWN A;  1BMO A;  3LCP C;  4WQ3 A;  5D7F A;  3LK0 A;  1QVI Z;  2V53 A;  4WQ2 A;  4MRX A;  1LVC D;  2K7B A;  2MJW B;  1FPW A;  1XYD A;  1QS7 A;  1UHJ A;  1AUI B;  3TDU A;  1M46 A;  4YGD B;  1EG4 A;  4XJK B;  1YRU B;  1R2U A;  1NSH A;  2Y5I A;  2LLT A;  2LAN A;  5FYX A;  3A8R A;  2K2F A;  1ALV A;  2GV5 A;  2BE6 A;  4E68 A;  3LLE A;  1ZUZ A;  1WY9 A;  1QX7 A;  5AER A;  1JF2 A;  2K8M B;  5DKQ A;  2HF5 A;  1JUO A;  1UHK A;  1CM4 A;  1YUS A;  2ZKM X;  2OTG B;  1IKU A;  2KI6 C;  1MXL C;  2M3W A;  2WND A;  2ZFD A;  3FWB A;  3TZ1 A;  3C1V A;  1KSM A;  1LA0 A;  2JT3 A;  2FCE A;  1BR1 B;  2KBM A;  1DJZ A;  1RFJ A;  1XFV O;  1IJ5 A;  2JUL A;  1KFU S;  1XK4 C;  2BE4 A;  1SL9 A;  1JSA A;  3BUM B;  4C0K A;  2KI4 C;  1V1G A;  1F55 A;  3WHT B;  3FS7 A;  1CDM A;  3WHU B;  3M0W A;  3SG7 A;  3JTD B;  4XYN A;  4P2Y B;  2G2B A;  3BUN B;  3BQ3 A;  4A4C A;  3CR5 X;  1W7J B;  1J7P A;  1FI6 A;  1L7Z A;  4CFQ A;  1DJH A;  2L98 A;  1DJW A;  5HKY A;  1FW4 A;  1B8L A;  1EXR A;  1MXE A;  1SBJ A;  1CTR A;  4M2P A;  3VRQ A;  1QIW A;  2I18 A;  1IGV A;  2LMU A;  4N1G A;  5PAL A;  2KYF A;  4DUQ A;  1S26 D;  1SK6 D;  1CFF A;  3KPX A;  1V1F A;  1WDC B;  3A4U B;  2MRD A;  1ZFS A;  4FQO A;  3DVE A;  1NX1 A;  1XO5 A;  1ODB A;  5KTY A;  1M31 A;  1XFW O;  2LVJ A;  1H8B A;  2MAZ A;  3O78 A;  1ALW A;  1EL4 A;  4MEW A;  1S5G Y;  3BXK A;  1UHI A;  1J55 A;  1QJT A;  3CTN A;  2OS8 C;  1B7T Z;  1KK8 C;  2MA2 A;  1U5I B;  1XFZ O;  4I5L B;  2JRF A;  1YRT B;  3OX5 A;  2KI4 B;  1A2X A;  2M49 B;  4I5J A;  1B47 A;  2M29 A;  5IBW A;  2KYC A;  2A4J A;  2ZN8 A;  5JJG A;  2EGD A;  4F0Z B;  3AAK A;  4FTG A;  3VRN A;  1CMF A;  3BUO B;  3GOF A;  1IRJ A;  3TS5 B;  4PHK A;  4Q04 A;  3EK7 A;  3I5F C;  4YI9 A;  1KWO C;  1AJ5 A;  3PSR A;  1CLM A;  1WRZ A;  1DGU A;  2TN4 A;  2Y1N A;  2O5G A;  3I5H C;  5AEQ A;  3SG5 A;  3RM1 A;  3VRR A;  2PAL A;  2BEC A;  4MZJ A;  4OVN F;  1A75 B;  2I7A A;  1M45 A;  2LAP A;  1KCY A;  2JC2 A;  2GGZ A;  1CM1 A;  1JBA A;  3SG2 A;  1F71 A;  4CLN A;  1CFP A;  4D1E A;  2LVV A;  2Q4U A; 
#chains in the Genus database with same CATH topology
 1PRW A;  2JWW A;  1YUR A;  1M39 A;  2EC6 C;  2WCF A;  1CDP A;  2K7D A;  4C0J A;  4JKT A;  1K9K A;  3TDZ A;  1KFU L;  1QIV A;  2LUC A;  1KK8 B;  3IVT A;  3SIA A;  1W7I B;  2M0R A;  3EVR A;  3WNX B;  3AAJ A;  2KHN A;  1SKT A;  4QJ4 B;  2Y4Q A;  4GNK B;  1G4Y R;  1XVJ A;  2LE9 B;  1RK9 A;  1BOD A;  2IS9 A;  4XJK A;  2OTG C;  1TTX A;  2M1K B;  2BKI B;  1KSO A;  3GK4 X;  1KQV A;  5AXI A;  1C3Z A;  3BFB A;  1Q80 A;  2AUC A;  1XA5 A;  3R72 A;  4JPZ B;  3FE8 A;  2LUX A;  2H61 A;  3I5F B;  1YUT A;  1PVB A;  1BT6 A;  1MUX A;  2KFH A;  2SAS A;  3DF0 A;  3FWC A;  5I2O A;  3PM8 A;  1QWV A;  2BCA A;  5CSN A;  3I5H B;  1IJ6 A;  3JTD C;  4WRI A;  2M7L A;  4N5X A;  4DRW A;  4AQJ A;  1F70 A;  3IF7 A;  2BNX A;  2M1U A;  3B6X A;  1S6I A;  2L5Y A;  2KLE A;  1MR8 A;  1C7V A;  4MN0 A;  1WLM A;  1OQP A;  3KF9 A;  3O4X A;  5I2Q A;  1L2O C;  3NGV A;  2LHI A;  4JWQ A;  5GQQ C;  2EC6 B;  2CCM A;  1UP5 A;  2JNF A;  1S36 A;  2E6W A;  2ERB A;  2WCE A;  1ZAC A;  3O2P A;  3CZT X;  3GK2 A;  1WDC C;  1TIZ A;  2JOJ A;  4PHJ A;  1DVI A;  1UHN A;  4ORC B;  3S0F A;  1OOJ A;  1LKJ A;  3JVT C;  3D78 A;  4MBE A;  1ZOT B;  4P5O E;  1OZS A;  3EKH A;  1EH2 A;  1IG5 A;  3WXA A;  4GGN A;  2MBX A;  1DF0 B;  5BPJ A;  3NSK A;  2MLE C;  2GTE A;  1IWQ A;  2MLF C;  3F45 A;  5HYD A;  1B4C A;  1REC A;  1N0Y A;  5CSF A;  3DXL A;  1SNL A;  4BY4 A;  3I5G B;  4DS7 A;  1K94 A;  4ETO A;  1OSA A;  4JQ0 D;  5F6T A;  3BOW B;  3O6B A;  2JT8 A;  1OMD A;  3OBV A;  5JOL A;  4OV2 A;  2QPT A;  1NIW A;  3VRP A;  1DT7 B;  1TNX A;  3CR2 A;  5D69 A;  1QV0 A;  2F2P A;  2G9B A;  2WCB A;  4INX A;  2FCD A;  1A4P A;  4C0L A;  2LC5 A;  3TS5 C;  2HET A;  2F3Y A;  2KAV A;  1YX8 A;  1S5G Z;  2K60 A;  2MHH A;  1XK4 A;  1FF1 A;  1TRF A;  2K7C A;  1SW8 A;  5J3X A;  3OB2 B;  2WOS A;  1CNP A;  2LCP A;  1L2O B;  1TWO A;  3SG3 A;  1TN4 A;  3BFH A;  3EVU A;  1MF8 B;  1ORG A;  1TUZ A;  1DTL A;  3LL8 B;  3CZ2 A;  3NSL A;  1BJF A;  1P28 A;  1DJG A;  2YGU A;  3EKJ A;  3CDN A;  1GM0 A;  4GGF C;  1AHR A;  3VRO A;  1B9A A;  1A29 A;  2HPS A;  2LMT A;  1UHH A;  1NX3 A;  1KQM C;  3JVT B;  2H2K A;  3DZT A;  1K2H A;  1Y1X A;  1NCX A;  1PAL A;  2L4H A;  2M9G A;  5G08 A;  3VGO A;  1Y0V H;  1YX7 A;  3CWG A;  1OMR A;  1A75 A;  3DD4 A;  4MRY A;  1K93 D;  2JZI A;  2PAS A;  1D1O A;  1DJY A;  5KSZ A;  4PCW A;  3EK8 A;  1CLL A;  1GJY A;  1SCM B;  4PHN A;  3PN7 B;  1A03 A;  1CKK A;  1J7R A;  1QAS A;  5EL2 A;  2NCP A;  2JTZ A;  3NHT A;  4YRU A;  2CBL A;  1C07 A;  1LXF C;  2KI6 D;  1CLB A;  2KFF A;  1NUB A;  2CTN A;  4PE0 A;  2KAX A;  1GQM A;  1NP8 A;  3L4L A;  1GGZ A;  4A4B A;  4PE1 A;  1K9P A;  1S3P A;  2D8N A;  2LNK A;  2QDI A;  3EVV A;  3I5I C;  1BF5 A;  1TNP A;  3KHE A;  3OB1 B;  2E30 A;  2LLS A;  1RWY A;  2COL B;  1KQM B;  2F33 A;  1S1E A;  1TNW A;  1FI5 A;  2HQ8 A;  2P6B B;  3KO0 A;  4ICB A;  5HLV A;  3DVM A;  1RTP 1;  2WCK A;  3AKB A;  1CFC A;  4NDB A;  3LK1 A;  1IQ5 A;  4NDC A;  2KGB C;  2LP2 A;  1B7T Y;  2Y1M A;  2H8V A;  4YGC B;  1HQV A;  1K8U A;  4U8D A;  1MHO A;  2O60 A;  5CSI A;  4BY5 A;  1B8R A;  4JD9 A;  2LLU A;  4OZD A;  2QEB A;  3CR4 X;  1IQ3 A;  5ER5 A;  1GGW A;  2B1U A;  4GFT A;  4F7F A;  2FJU B;  2DOQ A;  1NX2 A;  2JTT A;  3D0Y B;  4UPG A;  1J7Q A;  2KPH A;  2KOT A;  3L4A A;  3I5G C;  4MZL A;  1TOP A;  1MQ1 A;  1CDN A;  5I94 A;  2L50 A;  1TCO B;  3E3R A;  3K21 A;  3DVJ A;  3TDI A;  3FIA A;  1S6C A;  1J1D A;  1SL8 A;  2K0J A;  2QEV A;  3HX4 A;  4CID A;  1DJX A;  1SCV A;  4KYN A;  1NPQ A;  1OOH A;  1PSB A;  1QLK A;  2AMI A;  3AKA A;  4NDD A;  1KK7 Y;  3UO9 A;  1TNQ A;  2M7N A;  2M8U A;  5DKN A;  1BG1 A;  3I5I B;  1SR6 C;  4ZCV A;  3RLZ A;  3ZWH A;  2ZN9 A;  5D3O A;  3D10 A;  4MLW A;  3EG5 B;  3S0A A;  4YBH B;  3BOW A;  4IJ7 A;  1Y6W A;  4ORA B;  3NHI A;  1RJV A;  2BKH B;  1NX0 A;  4OCI A;  3GK1 A;  1RRO A;  5KU1 A;  4PE4 A;  1G33 A;  1ZMZ A;  1F54 A;  1NCY A;  2LMV A;  3DYE A;  3OHM B;  1W9Z A;  1E8A A;  1N65 A;  1UUR A;  3CS1 A;  3QME A;  3VB1 A;  3TUY C;  2L2C A;  3CAB A;  3PAL A;  1EJ3 A;  2JXL A;  1FBV A;  2JPT A;  3ZNI A;  2LV7 A;  4AQI A;  1YUU A;  3BUW B;  4FQT A;  4R1E A;  4IL1 A;  3DVK A;  2ZRT A;  3B88 A;  4INW A;  5CPV A;  3H4S E;  5HKW A;  1SCM C;  3SJS A;  2NXQ A;  5HLO A;  1OMV A;  3SS5 A;  3PN7 C;  4QJ3 B;  2RGI A;  1K96 A;  1QX5 B;  1SPY A;  1R6P A;  1QVI Y;  1SR6 B;  1U5I A;  1F4Q A;  2PVB A;  3DF0 B;  3MSE B;  4MVF A;  4MZK A;  4PDZ A;  3S0E A;  4PHM A;  3O4Y A;  1B8C A;  2L4I A;  3V2L A;  4DCK A;  4YGE B;  1CMG A;  2BL0 C;  1AJ4 A;  2OPO A;  2K2A A;  2K61 A;  4GUK A;  2JU0 A;  5I8N A;  3D76 A;  2L5X B;  2Q91 A;  2KBI A;  3EK4 A;  4L9M A;  1AK8 A;  2ISD A;  1AVS A;  2CNP A;  4GPL B;  3S0B A;  1Y1U A;  3D74 A;  1CFD A;  2NZ0 A;  3B7A A;  1JFJ A;  1CDL A;  3DY9 A;  3SIB A;  2JT0 A;  2QEO A;  1C3Y A;  2AAO A;  1JC2 A;  1Y1A A;  1BLQ A;  1N2D A;  1XFY O;  2LVK A;  5TNC A;  1F4O A;  2KFG A;  3TUY B;  2KSP A;  1Z4H A;  2HQW A;  2L51 A;  1PVA A;  1SYM A;  4N1F A;  2PMY A;  2NCO A;  3SG4 A;  2PRU A;  1OE9 B;  3PJI A;  4PE7 A;  3NXA A;  4GGF A;  2ZRS A;  4M2O A;  2KQ6 A;  1YR5 A;  3KEV A;  4HRE E;  1LA3 A;  3HCM A;  1HT9 A;  1KFX L;  1UWO A;  2KDH A;  3CGA A;  4I5N B;  1QLS A;  4ZCU A;  1WLZ A;  3OP0 A;  4QJ5 B;  1QTX A;  3UNW A;  2K7O A;  4CFR A;  2QAC A;  1JF0 A;  1QV1 A;  5HKZ A;  1B1G A;  2KGR A;  2BBM A;  1UUS A;  1NCZ A;  1C7W A;  2BL0 B;  3NSI A;  3PAT A;  3CLN A;  1K95 A;  2SCP A;  3NSO A;  2LM5 A;  4HRG A;  1NYA A;  3BUX B;  3B86 A;  2M97 A;  1DMO A;  1F8H A;  1J7O A;  1XFU O;  1TCF A;  1X02 A;  2ZND A;  1K90 D;  3D0Y A;  3QRX A;  4YGB B;  2R2I A;  1DGV A;  3K1E A;  5FI7 A;  4HSZ A;  2KNE A;  4PT1 A;  2CT9 A;  2GGM A;  2BCB A;  1M63 B;  2F8P A;  2PQL A;  4AOM A;  3CZ0 A;  1SY9 A;  1VRK A;  1J1E A;  2WC8 A;  5DKR A;  4GAO A;  1SRA A;  2FJY A;  4MSP A;  2I2R E;  2JXC A;  3SG6 A;  2WC5 A;  1SMG A;  1PK0 D;  3OX6 A;  4NQG A;  2JQ6 A;  1OOI X;  1QX2 A;  2BBN A;  1PSR A;  1KK7 Z;  1K9U A;  1S6J A;  4OKH A;  5I2L A;  4HRH A;  4TNC A;  5AFP A;  1OW4 A;  3BYA A;  3ICB A;  2ZNE A;  1EG3 A;  3CZ1 A;  5FI2 A;  5B8I B;  4YGA A;  1IH0 A;  2FOT A;  4DIR A;  1BR4 B;  1NWD A;  1OZO A;  2JNX A;  1LIN A;  5CSJ A;  2PSR A;  2NLN A;  1JFK A;  3PLF B;  2F2O A;  1BU3 A;  2BCX A;  2WOR A;  1YVH A;  1WRK A;  1JWD A;  5K89 A;  1AP4 A;  1CB1 A;  2KQY A;  3IQO A;  4M2Q A;  4CPV A;  2OS8 B;  1YTZ C;  2I94 A;  2WC6 A;  4GBA A;  2L0P A;  1DJI A;  1DF0 A;  1XFX O;  2BAP A;  2H61 C;  2L2E A;  1KFX S;  1QAT A;  2LHL A;  2VRG A;  3PFV A;  4USL A;  5ER4 X;  1BOC A;  1QXP A;  2F3Z A;  2KAY A;  3IQQ A;  4YI8 A;  5AAN A;  1WRL A;  2CXJ A;  2PYQ A;  4PAL A;  1H4B A;  1PUL A;  1G8I A;  2LP3 A;  2EHB A;  3Q8I A;  1OOF A;  1YVL A;  4I5K A;  2LVI A;  1KWO B;  1SL7 A;  4OR9 B;  4ORB B;  1MWN A;  1BMO A;  3LCP C;  4WQ3 A;  2WCJ A;  5D7F A;  3LK0 A;  1QVI Z;  2V53 A;  4WQ2 A;  4MRX A;  3N7H A;  1LVC D;  3PM2 A;  2K7B A;  2MJW B;  1FPW A;  1OOG A;  1XYD A;  3BFA A;  3CYZ A;  1QS7 A;  3D73 A;  1UHJ A;  3D77 A;  5FI6 A;  1AUI B;  3L47 A;  3TDU A;  1M46 A;  4YGD B;  1EG4 A;  4XJK B;  1YRU B;  1R2U A;  1NSH A;  2Y5I A;  2LLT A;  2LAN A;  5FYX A;  3A8R A;  2K2F A;  1ALV A;  2GV5 A;  3RZS A;  2BE6 A;  4E68 A;  5HL1 A;  3LLE A;  1ZUZ A;  1WY9 A;  1QX7 A;  5AER A;  1JF2 A;  2K8M B;  3R1O A;  5DKQ A;  3S0G A;  2HF5 A;  1JUO A;  1UHK A;  1CM4 A;  1YUS A;  2ZKM X;  2OTG B;  1IKU A;  2KI6 C;  1MXL C;  2M3W A;  2WND A;  2ZFD A;  2WCH A;  3FWB A;  3TZ1 A;  3C1V A;  1KSM A;  3R1V A;  1LA0 A;  2JT3 A;  2FCE A;  1BR1 B;  2KBM A;  1DJZ A;  1RFJ A;  1XFV O;  1IJ5 A;  1DEL A;  2JUL A;  1KFU S;  1XK4 C;  2BE4 A;  1SL9 A;  1JSA A;  3BUM B;  4C0K A;  2KI4 C;  1DQE A;  1V1G A;  1F55 A;  3WHT B;  3FS7 A;  1CDM A;  3WHU B;  3M0W A;  3SG7 A;  5DIC A;  3JTD B;  4XYN A;  4P2Y B;  1IIO A;  2G2B A;  3BUN B;  3BQ3 A;  4A4C A;  3CR5 X;  1W7J B;  1J7P A;  1FI6 A;  1L7Z A;  4CFQ A;  1DJH A;  2L98 A;  1DJW A;  1LS8 A;  1DEK A;  1T14 A;  5HKY A;  3SS3 A;  1FW4 A;  1B8L A;  1EXR A;  1MXE A;  1SBJ A;  1CTR A;  2P70 A;  4M2P A;  3VRQ A;  1QIW A;  2I18 A;  1IGV A;  2LMU A;  4N1G A;  5PAL A;  2KYF A;  4DUQ A;  1S26 D;  1SK6 D;  1CFF A;  3KPX A;  1V1F A;  1WDC B;  3A4U B;  1TUJ A;  2MRD A;  1ZFS A;  3SS4 A;  4FQO A;  3DVE A;  1NX1 A;  1XO5 A;  1ODB A;  3BJH A;  1M31 A;  1XFW O;  5KTY A;  2LVJ A;  1H8B A;  2MAZ A;  3O78 A;  1ALW A;  1EL4 A;  4MEW A;  1S5G Y;  1Z2C B;  3BXK A;  1UHI A;  1J55 A;  1QJT A;  3CTN A;  2OS8 C;  1B7T Z;  1KK8 C;  3R1P A;  2MA2 A;  1U5I B;  1XFZ O;  2JPO A;  1DC1 A;  4I5L B;  2JRF A;  1YRT B;  3OX5 A;  2KI4 B;  1A2X A;  2M49 B;  4I5J A;  1B47 A;  2M29 A;  5IBW A;  2KYC A;  2A4J A;  2ZN8 A;  5JJG A;  2EGD A;  4F0Z B;  3AAK A;  4FTG A;  3VRN A;  2WCM A;  3BUO B;  3GOF A;  1CMF A;  1IRJ A;  3TS5 B;  4PHK A;  2P71 A;  4Q04 A;  3EK7 A;  3FE6 A;  3I5F C;  1XFR A;  4YI9 A;  2QEH A;  2KLD A;  1KWO C;  1AJ5 A;  3PSR A;  1CLM A;  1WRZ A;  1DGU A;  2TN4 A;  2WCL A;  2O5G A;  2Y1N A;  3B87 A;  3I5H C;  3OGN A;  5AEQ A;  3RM1 A;  1SSE B;  3SG5 A;  3VRR A;  2PAL A;  2BEC A;  4MZJ A;  4OVN F;  1A75 B;  3FE9 A;  2I7A A;  1M45 A;  2LAP A;  1KCY A;  3S0D A;  2JC2 A;  2GGZ A;  3D75 A;  1CM1 A;  1JBA A;  3SG2 A;  1F71 A;  4CLN A;  1CFP A;  4D1E A;  2LVV A;  2Q4U A; 
#chains in the Genus database with same CATH homology
 1PRW A;  2JWW A;  1YUR A;  1M39 A;  2EC6 C;  2WCF A;  1CDP A;  2K7D A;  4C0J A;  1K9K A;  3TDZ A;  1KFU L;  1QIV A;  2LUC A;  1KK8 B;  3SIA A;  1W7I B;  2M0R A;  3EVR A;  3WNX B;  3AAJ A;  2KHN A;  1SKT A;  4QJ4 B;  2Y4Q A;  4GNK B;  1G4Y R;  1XVJ A;  2LE9 B;  1RK9 A;  1BOD A;  2IS9 A;  4XJK A;  2OTG C;  1TTX A;  2M1K B;  2BKI B;  1KSO A;  3GK4 X;  1KQV A;  5AXI A;  1Q80 A;  2AUC A;  1XA5 A;  4JPZ B;  2LUX A;  2H61 A;  3I5F B;  1YUT A;  1PVB A;  1BT6 A;  1MUX A;  2KFH A;  2SAS A;  3DF0 A;  3FWC A;  5I2O A;  3PM8 A;  2BCA A;  5CSN A;  3I5H B;  1IJ6 A;  3JTD C;  4WRI A;  2M7L A;  4N5X A;  4DRW A;  4AQJ A;  1F70 A;  3IF7 A;  2M1U A;  1S6I A;  1MR8 A;  1C7V A;  4MN0 A;  1WLM A;  1OQP A;  3KF9 A;  5I2Q A;  1L2O C;  2LHI A;  4JWQ A;  5GQQ C;  2EC6 B;  2CCM A;  1UP5 A;  2JNF A;  1S36 A;  2E6W A;  2WCE A;  1ZAC A;  3O2P A;  3CZT X;  3GK2 A;  1WDC C;  1TIZ A;  2JOJ A;  4PHJ A;  1DVI A;  1UHN A;  4ORC B;  1OOJ A;  1LKJ A;  3JVT C;  4MBE A;  1ZOT B;  4P5O E;  1OZS A;  3EKH A;  1EH2 A;  1IG5 A;  3WXA A;  4GGN A;  2MBX A;  1DF0 B;  5BPJ A;  3NSK A;  2MLE C;  1IWQ A;  2MLF C;  3F45 A;  5HYD A;  1B4C A;  1REC A;  1N0Y A;  5CSF A;  4BY4 A;  1SNL A;  3I5G B;  4DS7 A;  1K94 A;  4ETO A;  1OSA A;  4JQ0 D;  5F6T A;  3BOW B;  3O6B A;  2JT8 A;  1OMD A;  5JOL A;  4OV2 A;  2QPT A;  1NIW A;  3VRP A;  1DT7 B;  1TNX A;  3CR2 A;  5D69 A;  1QV0 A;  2F2P A;  2G9B A;  2WCB A;  2FCD A;  1A4P A;  4C0L A;  2LC5 A;  3TS5 C;  2HET A;  2F3Y A;  2KAV A;  1YX8 A;  1S5G Z;  2MHH A;  1XK4 A;  1FF1 A;  1TRF A;  2K7C A;  1SW8 A;  5J3X A;  3OB2 B;  2WOS A;  1CNP A;  2LCP A;  1L2O B;  3SG3 A;  1TN4 A;  3EVU A;  1MF8 B;  1DTL A;  3LL8 B;  3NSL A;  1BJF A;  1DJG A;  3EKJ A;  4GGF C;  1AHR A;  1B9A A;  1A29 A;  2HPS A;  2LMT A;  1UHH A;  1NX3 A;  1KQM C;  3JVT B;  2H2K A;  1K2H A;  1Y1X A;  1NCX A;  1PAL A;  2L4H A;  2M9G A;  5G08 A;  3VGO A;  1Y0V H;  1YX7 A;  3CWG A;  1OMR A;  1A75 A;  3DD4 A;  4MRY A;  1K93 D;  2JZI A;  2PAS A;  1D1O A;  1DJY A;  5KSZ A;  4PCW A;  3EK8 A;  1CLL A;  1GJY A;  1SCM B;  4PHN A;  3PN7 B;  1A03 A;  1CKK A;  1J7R A;  1QAS A;  2NCP A;  2JTZ A;  4YRU A;  2CBL A;  1C07 A;  1LXF C;  2KI6 D;  1CLB A;  2KFF A;  1NUB A;  2CTN A;  4PE0 A;  2KAX A;  1GQM A;  1NP8 A;  1GGZ A;  4A4B A;  4PE1 A;  1K9P A;  1S3P A;  2D8N A;  2LNK A;  3EVV A;  3I5I C;  1BF5 A;  1TNP A;  3KHE A;  3OB1 B;  2E30 A;  2LLS A;  1RWY A;  2COL B;  1KQM B;  2F33 A;  1S1E A;  1TNW A;  1FI5 A;  2HQ8 A;  2P6B B;  3KO0 A;  4ICB A;  5HLV A;  3DVM A;  1RTP 1;  3AKB A;  1CFC A;  4NDB A;  3LK1 A;  1IQ5 A;  4NDC A;  2KGB C;  2LP2 A;  1B7T Y;  2Y1M A;  4YGC B;  1HQV A;  1K8U A;  4U8D A;  1MHO A;  2O60 A;  5CSI A;  4BY5 A;  1B8R A;  2LLU A;  1IQ3 A;  3CR4 X;  1GGW A;  5ER5 A;  2B1U A;  4GFT A;  2FJU B;  2DOQ A;  1NX2 A;  2JTT A;  3D0Y B;  4UPG A;  1J7Q A;  2KOT A;  3I5G C;  4MZL A;  1TOP A;  1MQ1 A;  1CDN A;  2L50 A;  1TCO B;  3E3R A;  3K21 A;  3DVJ A;  3TDI A;  3FIA A;  1S6C A;  1J1D A;  1SL8 A;  2K0J A;  3HX4 A;  4CID A;  1DJX A;  1SCV A;  4NDD A;  1NPQ A;  1PSB A;  1QLK A;  2AMI A;  3AKA A;  1KK7 Y;  1TNQ A;  2M7N A;  2M8U A;  5DKN A;  1BG1 A;  3I5I B;  1SR6 C;  4ZCV A;  3RLZ A;  3ZWH A;  2ZN9 A;  3D10 A;  4MLW A;  4YBH B;  3BOW A;  1Y6W A;  4ORA B;  1RJV A;  2BKH B;  1NX0 A;  4OCI A;  3GK1 A;  1RRO A;  5KU1 A;  4PE4 A;  1G33 A;  1ZMZ A;  1F54 A;  1NCY A;  2LMV A;  3OHM B;  1E8A A;  1N65 A;  1UUR A;  3CS1 A;  3TUY C;  3PAL A;  1EJ3 A;  2JXL A;  1FBV A;  2JPT A;  3ZNI A;  2LV7 A;  4AQI A;  1YUU A;  3BUW B;  4R1E A;  4IL1 A;  3DVK A;  2ZRT A;  5CPV A;  3H4S E;  5HKW A;  1SCM C;  3SJS A;  2NXQ A;  5HLO A;  1OMV A;  3PN7 C;  4QJ3 B;  2RGI A;  1K96 A;  1QX5 B;  1SPY A;  1R6P A;  1QVI Y;  1SR6 B;  1U5I A;  1F4Q A;  2PVB A;  3DF0 B;  3MSE B;  4MVF A;  4MZK A;  4PDZ A;  4PHM A;  3O4Y A;  1B8C A;  2L4I A;  4DCK A;  4YGE B;  1CMG A;  2BL0 C;  1AJ4 A;  2OPO A;  2K2A A;  2K61 A;  4GUK A;  2JU0 A;  5I8N A;  2L5X B;  2Q91 A;  2KBI A;  3EK4 A;  4L9M A;  1AK8 A;  2ISD A;  1AVS A;  2CNP A;  4GPL B;  1Y1U A;  1CFD A;  2NZ0 A;  1JFJ A;  1CDL A;  3SIB A;  2JT0 A;  1JC2 A;  2AAO A;  1Y1A A;  1BLQ A;  1N2D A;  1XFY O;  2LVK A;  5TNC A;  1F4O A;  2KFG A;  3TUY B;  2KSP A;  2HQW A;  2L51 A;  1PVA A;  1SYM A;  4N1F A;  2PMY A;  2NCO A;  3SG4 A;  2PRU A;  1OE9 B;  4PE7 A;  3NXA A;  4GGF A;  2ZRS A;  4M2O A;  2KQ6 A;  1YR5 A;  3KEV A;  4HRE E;  1LA3 A;  3HCM A;  1HT9 A;  1KFX L;  1UWO A;  2KDH A;  3CGA A;  4I5N B;  1QLS A;  4ZCU A;  1WLZ A;  3OP0 A;  4QJ5 B;  1QTX A;  2K7O A;  4CFR A;  2QAC A;  1JF0 A;  1QV1 A;  5HKZ A;  1B1G A;  2KGR A;  2BBM A;  1UUS A;  1NCZ A;  1C7W A;  2BL0 B;  3NSI A;  3PAT A;  3CLN A;  1K95 A;  2SCP A;  3NSO A;  2LM5 A;  4HRG A;  1NYA A;  3BUX B;  2M97 A;  1DMO A;  1F8H A;  1J7O A;  1XFU O;  1TCF A;  1X02 A;  2ZND A;  1K90 D;  3D0Y A;  3QRX A;  4YGB B;  2R2I A;  1DGV A;  4HSZ A;  2KNE A;  2CT9 A;  2GGM A;  2BCB A;  1M63 B;  2F8P A;  4AOM A;  1SY9 A;  1VRK A;  1J1E A;  2WC8 A;  5DKR A;  4GAO A;  1SRA A;  4MSP A;  3SG6 A;  2I2R E;  2JXC A;  1SMG A;  1PK0 D;  3OX6 A;  4NQG A;  2JQ6 A;  1QX2 A;  2BBN A;  1PSR A;  1KK7 Z;  1K9U A;  1S6J A;  4OKH A;  5I2L A;  4HRH A;  4TNC A;  5AFP A;  3BYA A;  3ICB A;  2ZNE A;  1EG3 A;  5B8I B;  4YGA A;  1IH0 A;  2FOT A;  4DIR A;  1BR4 B;  1NWD A;  1OZO A;  2JNX A;  1LIN A;  5CSJ A;  2PSR A;  2NLN A;  1JFK A;  3PLF B;  2F2O A;  1BU3 A;  2BCX A;  2WOR A;  1YVH A;  1WRK A;  1JWD A;  5K89 A;  1AP4 A;  1CB1 A;  2KQY A;  3IQO A;  4M2Q A;  4CPV A;  2OS8 B;  1YTZ C;  2I94 A;  4GBA A;  2L0P A;  1DJI A;  1DF0 A;  1XFX O;  2L2E A;  2H61 C;  2LHL A;  1KFX S;  1QAT A;  2VRG A;  3PFV A;  4USL A;  3VRO A;  5ER4 X;  1BOC A;  1QXP A;  2F3Z A;  2KAY A;  3IQQ A;  4YI8 A;  5AAN A;  1WRL A;  2CXJ A;  1H4B A;  4PAL A;  1PUL A;  1G8I A;  2LP3 A;  2EHB A;  1YVL A;  4I5K A;  2LVI A;  1KWO B;  1SL7 A;  4OR9 B;  4ORB B;  1MWN A;  1BMO A;  3LCP C;  4WQ3 A;  5D7F A;  3LK0 A;  1QVI Z;  2V53 A;  4WQ2 A;  4MRX A;  1LVC D;  2K7B A;  2MJW B;  1FPW A;  1XYD A;  1QS7 A;  1UHJ A;  1AUI B;  3TDU A;  1M46 A;  4YGD B;  1EG4 A;  4XJK B;  1YRU B;  1R2U A;  1NSH A;  2Y5I A;  2LLT A;  2LAN A;  5FYX A;  3A8R A;  2K2F A;  1ALV A;  2GV5 A;  2BE6 A;  4E68 A;  3LLE A;  1ZUZ A;  1WY9 A;  1QX7 A;  5AER A;  1JF2 A;  2K8M B;  5DKQ A;  2HF5 A;  1JUO A;  1UHK A;  1CM4 A;  1YUS A;  2ZKM X;  2OTG B;  1IKU A;  2KI6 C;  1MXL C;  2M3W A;  2WND A;  2ZFD A;  3FWB A;  3TZ1 A;  3C1V A;  1KSM A;  1LA0 A;  2JT3 A;  2FCE A;  1BR1 B;  2KBM A;  1DJZ A;  1RFJ A;  1XFV O;  1IJ5 A;  2JUL A;  1KFU S;  1XK4 C;  2BE4 A;  1SL9 A;  1JSA A;  3BUM B;  4C0K A;  2KI4 C;  1V1G A;  1F55 A;  3WHT B;  3FS7 A;  1CDM A;  3WHU B;  3M0W A;  3SG7 A;  3JTD B;  4XYN A;  4P2Y B;  2G2B A;  3BUN B;  3BQ3 A;  4A4C A;  3CR5 X;  1W7J B;  1J7P A;  1FI6 A;  1L7Z A;  4CFQ A;  1DJH A;  2L98 A;  1DJW A;  5HKY A;  1FW4 A;  1B8L A;  1EXR A;  1MXE A;  1SBJ A;  1CTR A;  4M2P A;  3VRQ A;  1QIW A;  2I18 A;  1IGV A;  2LMU A;  4N1G A;  5PAL A;  2KYF A;  4DUQ A;  1S26 D;  1SK6 D;  1CFF A;  3KPX A;  1V1F A;  1WDC B;  3A4U B;  2MRD A;  1ZFS A;  4FQO A;  3DVE A;  1NX1 A;  1XO5 A;  1ODB A;  5KTY A;  1M31 A;  1XFW O;  2LVJ A;  1H8B A;  2MAZ A;  3O78 A;  1ALW A;  1EL4 A;  4MEW A;  1S5G Y;  3BXK A;  1UHI A;  1J55 A;  1QJT A;  3CTN A;  2OS8 C;  1B7T Z;  1KK8 C;  2MA2 A;  1U5I B;  1XFZ O;  4I5L B;  2JRF A;  1YRT B;  3OX5 A;  2KI4 B;  1A2X A;  2M49 B;  4I5J A;  1B47 A;  2M29 A;  5IBW A;  2KYC A;  2A4J A;  2ZN8 A;  5JJG A;  2EGD A;  4F0Z B;  3AAK A;  4FTG A;  3VRN A;  1CMF A;  3BUO B;  3GOF A;  1IRJ A;  3TS5 B;  4PHK A;  4Q04 A;  3EK7 A;  3I5F C;  4YI9 A;  1KWO C;  1AJ5 A;  3PSR A;  1CLM A;  1WRZ A;  1DGU A;  2TN4 A;  2Y1N A;  2O5G A;  3I5H C;  5AEQ A;  3SG5 A;  3RM1 A;  3VRR A;  2PAL A;  2BEC A;  4MZJ A;  4OVN F;  1A75 B;  2I7A A;  1M45 A;  2LAP A;  1KCY A;  2JC2 A;  2GGZ A;  1CM1 A;  1JBA A;  3SG2 A;  1F71 A;  4CLN A;  1CFP A;  4D1E A;  2LVV A;  2Q4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...