1IG5A

Bovine calbindin d9k binding mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN, INTESTINAL
publication title Structural basis for the negative allostery between Ca(2+)- and Mg(2+)-binding in the intracellular Ca(2+)-receptor calbindin D9k.
pubmed rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ig5A00
2KAVA 2KI4C 3ZNIA 5K89A 2OTGB 1G33A 3DVEA 2I18A 1KK7Z 5DKNA 4YGCB 3VRNA 1QX2A 2H2KA 2BCAA 4HRHA 1CFPA 1F54A 2HPSA 1YTZC 3CR2A 4ICBA 2BE4A 2M97A 4YGEB 2F3YA 1SKTA 1FI5A 1CDLA 1KQMB 1RROA 1ZFSA 3TDZA 1EG4A 2CNPA 2CXJA 3FIAA 2SASA 4JWQA 1Y6WA 1KQMC 4AQIA 1YX8A 1B8RA 2PALA 3CWGA 4GPLB 4MZJA 4PHMA 3TUYB 3MSEB 4I5NB 1FBVA 2LP3A 4YBHB 4ZCUA 3TUYC 1BU3A 4PE1A 1J55A 3A8RA 2KOTA 4OVNF 1V1GA 1NYAA 1BJFA 1TNQA 2EC6B 4N1FA 1ZACA 1X02A 3OB1B 1EJ3A 1K93D 2ZRSA 3CR4X 2M3WA 2EC6C 4MZLA 1DTLA 3I5HB 4PHKA 4MSPA 1CLBA 1MWNA 4DRWA 2K8MB 2NCPA 2JULA 3I5HC 4OKHA 1RECA 1OOJA 2COLB 3CR5X 5D7FA 4MRXA 5HYDA 1W7JB 2I7AA 2M7LA 2GV5A 1Q80A 1QLSA 1N2DA 2BBMA 1JC2A 4I5JA 3OP0A 1NP8A 2BCBA 5JJGA 1V1FA 2L0PA 1MQ1A 3EK7A 5DKQA 1OE9B 4YGAA 1PALA 1KK7Y 2ZFDA 4ORCB 2TN4A 3DF0B 1IRJA 2JU0A 3DVJA 2PRUA 1NIWA 1PVAA 4GGFA 2KFGA 1ODBA 1K9PA 3BUMB 1SPYA 5J3XA 1BLQA 1DJWA 5HKYA 2F3ZA 1OZOA 3RM1A 2BCXA 1TRFA 1NX0A 1A75B 2F2PA 3ICBA 3BYAA 1DJHA 1QATA 1SL7A 2G9BA 1UHIA 1IG5A 2PASA 1K2HA 2CTNA 3CLNA 3D10A 1HT9A 1ALWA 3KPXA 1G4YR 4MEWA 5GQQC 1C07A 3PFVA 1U5IA 2B1UA 2NCOA 4M2OA 1XK4C 4YI9A 5KSZA 2JQ6A 2K61A 4BY4A 1QXPA 2E6WA 5CSFA 1BG1A 1B7TZ 1B8CA 1CDNA 1J1DA 1UWOA 1EXRA 1KFXL 1WDCB 3TDIA 2CCMA 1QX7A 3QRXA 1TNPA 4PDZA 3O4YA 1S6IA 1WDCC 2M9GA 2ZN8A 1DJXA 2PVBA 4OV2A 4PALA 1OMDA 1CFCA 1SBJA 1MUXA 3SG7A 1A03A 1TTXA 3KO0A 2LP2A 1KK8B 1R6PA 3LK1A 5HLOA 1CFFA 4TNCA 3ZWHA 2Y4QA 2F8PA 1KK8C 1XFUO 3EVUA 1DJIA 1YX7A 1NWDA 2MAZA 1DT7B 2MRDA 4DS7A 5BPJA 2AUCA 4PE4A 1K9KA 4I5KA 2MLFC 1MXEA 1TCOB 2M7NA 3NSLA 1BR1B 2LHIA 1SRAA 1UHHA 1Y1XA 4PHNA 1SCMC 1MXLC 4N1GA 2KSPA 1W7IB 1YUSA 1JUOA 2OTGC 2JTTA 3C1VA 1NX3A 1K9UA 2L98A 2JOJA 5KTYA 2LE9B 2RGIA 1OSAA 2ZKMX 1QASA 4PHJA 1AVSA 2IS9A 1WY9A 2JWWA 2LUXA 1KFXS 4L9MA 1BMOA 1SMGA 1QV0A 5ER5A 3SG2A 1B7TY 1UHNA 4ORBB 1CKKA 2KDHA 1CM1A 3WXAA 4XJKB 2KFFA 4WQ3A 1JBAA 1OZSA 1JSAA 2L4IA 1XA5A 4FTGA 2L4HA 1UP5A 1DJYA 3M0WA 4R1EA 4CPVA 2KGBC 3CGAA 2OS8B 2K7CA 5F6TA 4YRUA 3HX4A 3JTDB 3OB2B 3OHMB 2KAYA 2OS8C 3GK4X 5G08A 1L2OB 1XO5A 1K96A 2M8UA 4YI8A 1PSBA 1RTP1 2LM5A 2LMTA 1KSMA 2ZNDA 1L2OC 1PULA 1AK8A 3KHEA 1A4PA 1NX2A 2JC2A 4AOMA 5AERA 4CFRA 4XYNA 1XFZO 4HREE 3KEVA 4MRYA 2KBIA 3PSRA 2LVJA 2L5XB 1CDPA 3EK4A 1CLLA 1JF0A 1NX1A 1UURA 5JOLA 2K0JA 1L7ZA 5IBWA 3VROA 3I5FC 1TNXA 3AAJA 1KFUL 4QJ5B 4NQGA 1AUIB 1TN4A 1SCVA 2MJWB 1S36A 3GOFA 1FPWA 1JWDA 2JT0A 1B4CA 3HCMA 3VGOA 1M39A 1IH0A 1SL8A 2ZNEA 2Q91A 2KYFA 1ZOTB 2AAOA 2NZ0A 2K2AA 2KI6D 5CSIA 4E68A 3D0YA 3IQOA 3GK2A 4C0JA 2PMYA 5I2OA 1F4QA 2JPTA 1IQ5A 3IQQA 1IKUA 2M0RA 1SYMA 2JT8A 2BKHB 3EKHA 3K21A 3DF0A 4GNKB 2LNKA 3LL8B 5KU1A 4C0LA 1D1OA 1EG3A 1CTRA 2QPTA 2L51A 3O6BA 4M2QA 3TDUA 1OMVA 1YURA 1ALVA 4NDCA 2WNDA 1JFKA 1M63B 2BBNA 3VRPA 1U5IB 2FJUB 2Y1MA 3EK8A 1DF0A 2JZIA 3EVRA 1RFJA 1M31A 1DVIA 3E3RA 2KI6C 2LC5A 1A75A 1NCXA 2Y5IA 1PVBA 3I5IB 4JQ0D 1YRUB 2VRGA 1CMFA 4YGBB 1BR4B 1IJ5A 2H61A 4BY5A 1CB1A 3DD4A 1MF8B 3SG4A 2WOSA 3I5IC 1AHRA 1YR5A 5AANA 1AJ4A 1XK4A 1LINA 4A4BA 2JTZA 4PCWA 1S26D 5AEQA 1QIWA 1KSOA 1RJVA 5FYXA 3BOWB 4CFQA 2FOTA 4OCIA 1CNPA 2BE6A 2LAPA 2G2BA 1XFWO 1EH2A 2JNFA 1SL9A 1HQVA 1WRLA 2WC8A 1A2XA 1M45A 1IGVA 1EL4A 1TCFA 1XFVO 2MHHA 2K7OA 1K94A 4GBAA 1NCZA 2BL0B 2O5GA 1S5GZ 1B8LA 1XYDA 2FCDA 2PSRA 4F0ZB 4MBEA 1TOPA 4C0KA 1S6CA 2GGMA 2BL0C 2NLNA 1B1GA 2Y1NA 2WCFA 3NSIA 4Q04A 3BUOB 1N0YA 2KQYA 4WRIA 5HKZA 3AKBA 1GJYA 3VRQA 4USLA 2D8NA 3BUNB 1QV1A 1DJZA 1QVIZ 2ISDA 1PK0D 4MVFA 3CS1A 2JNXA 1SNLA 2M1UA 5I2LA 3BUXB 3NXAA 1LKJA 3O78A 1AJ5A 3AKAA 2CBLA 1H8BA 2E30A 1YVLA 2LVIA 3H4SE 1TNWA 1F8HA 4OR9B 1GGWA 3JVTB 4MN0A 2Q4UA 2WORA 5ER4X 1NCYA 1CDMA 2LLUA 1KWOB 3NSOA 3JVTC 1WRKA 2HQ8A 4P5OE 3WHUB 1KWOC 2LVVA 1C7VA 1CM4A 1OQPA 1A29A 2HF5A 1SK6D 3PLFB 1VRKA 3JTDC 1H4BA 3TZ1A 2BECA 3CTNA 4NDBA 1J7OA 4M2PA 4XJKA 2L2EA 3PALA 4NDDA 3DVKA 3SIBA 4D1EA 3BQ3A 1F71A 1CLMA 2LLSA 1RWYA 1K95A 1WLMA 1FF1A 3OX5A 1K8UA 3AAKA 1S5GY 3CZTX 4DCKA 1QJTA 5DKRA 4ORAB 1RK9A 1J7QA 2EGDA 2DOQA 3GK1A 1S3PA 1MR8A 1BOCA 1Y0VH 4MLWA 5AXIA 1R2UA 1WLZA 1KCYA 5I8NA 1XFXO 2LHLA 2JRFA 4CLNA 1DGVA 3VRRA 4HRGA 3FS7A 3F45A 1ZMZA 1QVIY 2QACA 2KNEA 2OPOA 4U8DA 2LMUA 2K7BA 4ZCVA 1Y1UA 2ZN9A 4JPZB 1PSRA 2M29A 3I5GB 3SIAA 1TIZA 3D0YB 5CPVA 3SG5A 1DMOA 1KQVA 4GGFC 1FW4A 2V53A 1YVHA 2WCEA 3I5GC 2KGRA 2CT9A 1OMRA 5HLVA 1J1EA 3NSKA 2LCPA 4FQOA 1QS7A 2F33A 1QTXA 4HSZA 2M1KB 1BODA 4I5LB 4DUQA 2HQWA 1LA3A 1M46A 2LVKA 1NUBA 1J7RA 4AQJA 1B9AA 3WHTB 1GQMA 2LANA 3FWCA 1UHKA 1JFJA 3LK0A 2JXLA 2WCBA 5D69A 2KFHA 2BKIB 1G8IA 3TS5B 2LLTA 1DF0B 1LVCD 1SY9A 4GGNA 4IL1A 1BT6A 1LA0A 3RLZA 3TS5C 4CIDA 3EKJA 1SR6B 2LMVA 3I5FB 1CMGA 1YUTA 3OX6A 1S1EA 2MLEC 4PE7A 1IQ3A 3O2PA 4GFTA 1SR6C 1F4OA 2A4JA 1KFUS 1XFYO 1QX5B 1QIVA 1DGUA 2H61C 1GGZA 2K2FA 3BUWB 3KF9A 2KQ6A 2M49B 4UPGA 1FI6A 4GAOA 1N65A 1YUUA 1C7WA 1IJ6A 2KAXA 5CSJA 2R2IA 1AP4A 1Y1AA 2LV7A 1DJGA 1B47A 4P2YB 4GUKA 1BF5A 4WQ2A 2MA2A 2NXQA 1UHJA 4N5XA 3SG3A 3LCPC 4YGDB 5I2QA 1K90D 3BXKA 2SCPA 4QJ4B 3A4UB 2JT3A 4A4CA 1J7PA 2AMIA 1UUSA 2EHBA 2F2OA 2I2RE 2JXCA 3LLEA 2KYCA 4MZKA 2K7DA 3DVMA 1F55A 3SJSA 1IWQA 2KBMA 1LXFC 3BOWA 3FWBA 1CFDA 2ZRTA 3PN7B 3IF7A 1F70A 3WNXB 5TNCA 5B8IB 1QLKA 1WRZA 2FCEA 5HKWA 5AFPA 4DIRA 3PN7C 1NPQA 4PE0A 3SG6A 2O60A 2KHNA 5PALA 1XVJA 1ZUZA 1E8AA 1MHOA 2P6BB 5CSNA 1JF2A 1NSHA 1SW8A 2MBXA 2GGZA 3PM8A 2KI4B 2HETA 2L50A 1S6JA 1SCMB 2LUCA 3EVVA 4QJ3B 4ETOA 3PATA 2I94A 1YRTB 1PRWA
chains in the Genus database with same CATH superfamily
2KAVA 2KI4C 3ZNIA 5K89A 2OTGB 1G33A 3DVEA 1OOGA 2I18A 1KK7Z 5DKNA 4YGCB 3VRNA 1QX2A 2H2KA 2BCAA 4HRHA 1CFPA 1F54A 2HPSA 1YTZC 3CR2A 4ICBA 2BE4A 2M97A 3EG5B 2F3YA 4YGEB 1SKTA 5HL1A 1FI5A 1CDLA 3PM2A 1KQMB 1RROA 1ZFSA 1P28A 2KLDA 3TDZA 1EG4A 2CNPA 2CXJA 2KLEA 2SASA 3FIAA 4JWQA 1Y6WA 1KQMC 3D73A 4AQIA 1YX8A 1B8RA 2L5YA 1DELA 2PALA 3CWGA 4GPLB 4MZJA 4PHMA 3MSEB 4I5NB 1FBVA 3R72A 3TUYB 2LP3A 4YBHB 4ZCUA 3TUYC 4FQTA 1BU3A 4PE1A 1J55A 3A8RA 2KOTA 4OVNF 1V1GA 1NYAA 1BJFA 1SSEB 1TNQA 2EC6B 4N1FA 2BAPA 3V2LA 1ZACA 2WCLA 1X02A 1OOFA 1EJ3A 3OB1B 1K93D 1TWOA 2ZRSA 3CR4X 2M3WA 2EC6C 4MZLA 1DTLA 3I5HB 4PHKA 4MSPA 1CLBA 1MWNA 4DRWA 2K8MB 2NCPA 2JULA 2QEVA 3I5HC 4OKHA 1RECA 1OOJA 2COLB 3CR5X 5D7FA 4MRXA 5HYDA 1W7JB 2I7AA 4PT1A 2M7LA 2GV5A 1Q80A 1QLSA 1N2DA 2BBMA 1JC2A 4I5JA 3OP0A 1NP8A 2BCBA 5JJGA 1V1FA 2L0PA 1MQ1A 3EK7A 5DKQA 1OE9B 4YGAA 1PALA 1KK7Y 2ZFDA 4ORCB 2TN4A 3DF0B 1IRJA 2JU0A 3DVJA 2PRUA 1NIWA 3BJHA 4F7FA 1ORGA 1XFRA 1PVAA 4GGFA 2KFGA 1ODBA 1K9PA 3BUMB 1SPYA 5J3XA 1BLQA 1DJWA 5HKYA 2F3ZA 1OZOA 3RM1A 2BCXA 1TRFA 1NX0A 1A75B 2F2PA 3ICBA 1TUJA 3BYAA 3CABA 3R1VA 1DJHA 1QATA 1SL7A 2G9BA 1W9ZA 1UHIA 1IG5A 2L2CA 2PASA 1K2HA 2CTNA 3CLNA 3D10A 1HT9A 1ALWA 3KPXA 1G4YR 4MEWA 5GQQC 1C07A 3PFVA 1U5IA 2B1UA 2NCOA 4M2OA 3S0FA 1XK4C 2BNXA 4YI9A 5KSZA 3SS4A 2JQ6A 2K61A 2QDIA 4BY4A 1QXPA 2E6WA 5CSFA 3PJIA 1BG1A 1B7TZ 1B8CA 3R1OA 1CDNA 1J1DA 2ERBA 1UWOA 1WDCB 1EXRA 1KFXL 3TDIA 2CCMA 1LS8A 3O4XA 1QX7A 3QRXA 1TNPA 4PDZA 3O4YA 1S6IA 1WDCC 2M9GA 2ZN8A 1DJXA 2PVBA 4OV2A 4PALA 1OMDA 1CFCA 1SBJA 1MUXA 3SG7A 5I94A 1A03A 1TTXA 3KO0A 2LP2A 1KK8B 1R6PA 3LK1A 5HLOA 1CFFA 4TNCA 3ZWHA 2Y4QA 2F8PA 1KK8C 1XFUO 4KYNA 2WC5A 3EVUA 1DJIA 1YX7A 1NWDA 2MAZA 1DT7B 2MRDA 4DS7A 5BPJA 2AUCA 4PE4A 1K9KA 4I5KA 2MLFC 1Z4HA 3OBVA 1MXEA 1TCOB 2M7NA 3L4LA 3NSLA 1BR1B 2LHIA 1SRAA 1UHHA 1Y1XA 4PHNA 1SCMC 3S0AA 1MXLC 4N1GA 2KSPA 1W7IB 1YUSA 1JUOA 2OTGC 2JTTA 3C1VA 1NX3A 1K9UA 2L98A 2JOJA 5KTYA 2LE9B 3IVTA 3S0DA 2RGIA 1OSAA 2ZKMX 1QASA 3BFBA 4PHJA 1AVSA 2IS9A 1WY9A 2JWWA 3B6XA 5FI7A 2LUXA 1KFXS 2FJYA 1BMOA 4L9MA 1SMGA 1QV0A 5ER5A 3SG2A 1B7TY 1UHNA 4ORBB 1CKKA 2KDHA 1CM1A 3WXAA 4XJKB 2KFFA 4WQ3A 1JBAA 1OZSA 1JSAA 2L4IA 1XA5A 3FE9A 4FTGA 2L4HA 1UP5A 1DJYA 3M0WA 3VB1A 4R1EA 4CPVA 2KGBC 2QEBA 2OS8B 2K7CA 3CGAA 3QMEA 5F6TA 4YRUA 3HX4A 3JTDB 3OB2B 3OHMB 2KAYA 2OS8C 3GK4X 5G08A 1L2OB 1XO5A 1K96A 2M8UA 4YI8A 1PSBA 1RTP1 2LM5A 2LMTA 1KSMA 3NGVA 2ZNDA 1L2OC 3FE8A 1PULA 1AK8A 3KHEA 1DQEA 1A4PA 1NX2A 2JC2A 4OZDA 4AOMA 1DEKA 5AERA 4CFRA 4XYNA 1XFZO 4HREE 3KEVA 4MRYA 2KBIA 3PSRA 2LVJA 2L5XB 1CDPA 3EK4A 1CLLA 1JF0A 1NX1A 1UURA 5JOLA 2K0JA 1L7ZA 5IBWA 3VROA 3I5FC 1TNXA 3AAJA 1KFUL 4QJ5B 4NQGA 1AUIB 1TN4A 1SCVA 2MJWB 1S36A 3GOFA 1FPWA 1JWDA 2JT0A 1B4CA 3HCMA 3VGOA 1M39A 1IH0A 1SL8A 2ZNEA 2Q91A 2KYFA 1ZOTB 2PYQA 2AAOA 2NZ0A 2K2AA 2KI6D 3R1PA 5CSIA 4E68A 3D0YA 2WCJA 3IQOA 3GK2A 4C0JA 2PMYA 5I2OA 1T14A 1F4QA 3FE6A 2QEOA 2JPTA 1C3ZA 1IQ5A 3IQQA 1IKUA 2M0RA 1SYMA 2JT8A 2BKHB 3EKHA 3K21A 3DF0A 4GNKB 2LNKA 3LL8B 5KU1A 4C0LA 3DXLA 1D1OA 1EG3A 1CTRA 3DYEA 2QPTA 2L51A 3O6BA 4M2QA 3TDUA 1OMVA 1YURA 1ALVA 4NDCA 2WNDA 1JFKA 1M63B 2BBNA 3B87A 3VRPA 1U5IB 2FJUB 2Y1MA 3EK8A 1DF0A 2JZIA 2KPHA 3EVRA 1RFJA 1TUZA 1M31A 1DVIA 3E3RA 2KI6C 2LC5A 1A75A 1NCXA 2Y5IA 2YGUA 3OGNA 1PVBA 3I5IB 3B7AA 4JQ0D 1YRUB 2VRGA 3S0EA 1CMFA 4YGBB 1BR4B 1IJ5A 2H61A 4BY5A 1CB1A 3DD4A 1MF8B 4JD9A 3SG4A 2WOSA 3I5IC 3CZ2A 1AHRA 3L4AA 1YR5A 5AANA 1AJ4A 1XK4A 1LINA 2P70A 2JTZA 2QEHA 4PCWA 1S26D 5AEQA 4A4BA 1QIWA 1KSOA 1RJVA 5FYXA 3BOWB 4CFQA 2FOTA 4OCIA 1CNPA 2BE6A 3D77A 2LAPA 2G2BA 3BFAA 1XFWO 1EH2A 2JNFA 1SL9A 1HQVA 1WRLA 2WC8A 1A2XA 1M45A 3CZ0A 1IGVA 4INXA 1EL4A 5FI6A 1TCFA 1XFVO 2MHHA 2K7OA 1K94A 4GBAA 3NHIA 3RZSA 1NCZA 2BL0B 2O5GA 1S5GZ 1B8LA 1XYDA 2FCDA 2JPOA 2PSRA 3BFHA 4MBEA 1TOPA 4F0ZB 4C0KA 1S6CA 2GGMA 3UO9A 2BL0C 2NLNA 1B1GA 2Y1NA 2WCFA 3NSIA 4Q04A 3BUOB 1N0YA 2KQYA 4WRIA 5HKZA 3SS3A 3AKBA 1GJYA 3Q8IA 4USLA 3VRQA 2D8NA 3BUNB 1OW4A 1QV1A 5FI2A 1DJZA 1QVIZ 2ISDA 1PK0D 4MVFA 3CS1A 2JNXA 1SNLA 2M1UA 3DZTA 3BUXB 3NXAA 5I2LA 1LKJA 3O78A 1C3YA 1AJ5A 3AKAA 2CBLA 1H8BA 2E30A 1YVLA 2LVIA 3H4SE 1TNWA 1F8HA 4OR9B 1GGWA 3SS5A 3JVTB 1OOHA 4MN0A 2Q4UA 2WORA 5ER4X 3S0GA 1NCYA 1CDMA 2LLUA 1KWOB 3NSOA 3JVTC 1WRKA 2HQ8A 4P5OE 3WHUB 1KWOC 2LVVA 1C7VA 1CM4A 1OQPA 1A29A 2GTEA 3CYZA 2HF5A 1SK6D 3PLFB 1VRKA 3JTDC 1H4BA 3TZ1A 2BECA 3CTNA 3B86A 4NDBA 1J7OA 4M2PA 3D78A 4XJKA 2L2EA 3PALA 4NDDA 3DVKA 5D3OA 3SIBA 4D1EA 3BQ3A 5EL2A 1CLMA 2LLSA 1F71A 1RWYA 1K95A 1WLMA 1FF1A 3OX5A 1K8UA 3AAKA 1S5GY 3CZTX 4DCKA 2WCHA 1QJTA 5DKRA 4ORAB 1RK9A 1J7QA 2EGDA 2DOQA 4INWA 3GK1A 1S3PA 1MR8A 1BOCA 1Y0VH 1OOIX 4MLWA 5AXIA 1R2UA 1WLZA 1KCYA 5I8NA 3L47A 1XFXO 2LHLA 2JRFA 4CLNA 1DGVA 3VRRA 4HRGA 3FS7A 3F45A 1ZMZA 3CZ1A 4IJ7A 1QVIY 2QACA 2KNEA 2OPOA 4U8DA 2LMUA 2K7BA 4ZCVA 1Y1UA 2ZN9A 4JPZB 1PSRA 2M29A 2WCKA 3I5GB 3SIAA 1TIZA 3D0YB 3D75A 5CPVA 3SG5A 1DMOA 1KQVA 4GGFC 1FW4A 2V53A 1YVHA 2WCEA 3I5GC 2KGRA 2CT9A 1OMRA 5HLVA 1J1EA 3K1EA 3NSKA 2LCPA 3CDNA 1QS7A 4FQOA 1Z2CB 2F33A 1QTXA 4HSZA 2K60A 2M1KB 1BODA 4I5LB 4DUQA 1IIOA 2HQWA 1LA3A 1DC1A 1M46A 2LVKA 1NUBA 1J7RA 4AQJA 1B9AA 3WHTB 1GQMA 2LANA 3FWCA 1UHKA 1JFJA 3LK0A 2JXLA 2WCBA 5D69A 2KFHA 2BKIB 1G8IA 3TS5B 3B88A 2LLTA 1DF0B 1LVCD 1SY9A 4GGNA 4IL1A 1BT6A 1LA0A 3RLZA 3TS5C 2WC6A 4CIDA 3EKJA 1SR6B 2PQLA 2LMVA 3I5FB 1CMGA 1YUTA 3OX6A 1S1EA 2MLEC 4PE7A 1IQ3A 3O2PA 4GFTA 1SR6C 1F4OA 2A4JA 1KFUS 1XFYO 1QX5B 1QIVA 1DGUA 2H61C 1GGZA 2K2FA 3BUWB 3KF9A 2KQ6A 2M49B 4JKTA 4UPGA 2H8VA 1FI6A 4GAOA 1N65A 1YUUA 1C7WA 1IJ6A 2KAXA 3S0BA 5CSJA 2R2IA 5DICA 1AP4A 1Y1AA 2LV7A 1DJGA 1B47A 4P2YB 4GUKA 3D76A 1BF5A 4WQ2A 2MA2A 1QWVA 2NXQA 1UHJA 4N5XA 3SG3A 3LCPC 4YGDB 5I2QA 1K90D 3BXKA 2SCPA 4QJ4B 3A4UB 2JT3A 4A4CA 1J7PA 3UNWA 2AMIA 1UUSA 2EHBA 2F2OA 2I2RE 2JXCA 3LLEA 3D74A 1GM0A 2KYCA 4MZKA 3NHTA 2K7DA 3DVMA 1F55A 3SJSA 1IWQA 2KBMA 1LXFC 3BOWA 3FWBA 1CFDA 2ZRTA 3PN7B 3IF7A 1F70A 3WNXB 5TNCA 5B8IB 3DY9A 1QLKA 1WRZA 2FCEA 5HKWA 5AFPA 4DIRA 3PN7C 1NPQA 4PE0A 3SG6A 2O60A 2KHNA 5PALA 1XVJA 1ZUZA 1E8AA 1MHOA 2P71A 2P6BB 5CSNA 1JF2A 2WCMA 1NSHA 1SW8A 2MBXA 2GGZA 3PM8A 2KI4B 2HETA 2L50A 1S6JA 1SCMB 2LUCA 3EVVA 3N7HA 4QJ3B 4ETOA 3PATA 2I94A 1YRTB 1PRWA
chains in the Genus database with same CATH topology
2KAVA 2KI4C 3ZNIA 5K89A 2OTGB 1G33A 3DVEA 2I18A 1KK7Z 5DKNA 4YGCB 3VRNA 1QX2A 2H2KA 2BCAA 4HRHA 1CFPA 1F54A 2HPSA 1YTZC 3CR2A 4ICBA 2BE4A 2M97A 4YGEB 2F3YA 1SKTA 1FI5A 1CDLA 1KQMB 1RROA 1ZFSA 3TDZA 1EG4A 2CNPA 2CXJA 3FIAA 2SASA 4JWQA 1Y6WA 1KQMC 4AQIA 1YX8A 1B8RA 2PALA 3CWGA 4GPLB 4MZJA 4PHMA 3TUYB 3MSEB 4I5NB 1FBVA 2LP3A 4YBHB 4ZCUA 3TUYC 1BU3A 4PE1A 1J55A 3A8RA 2KOTA 4OVNF 1V1GA 1NYAA 1BJFA 1TNQA 2EC6B 4N1FA 1ZACA 1X02A 3OB1B 1EJ3A 1K93D 2ZRSA 3CR4X 2M3WA 2EC6C 4MZLA 1DTLA 3I5HB 4PHKA 4MSPA 1CLBA 1MWNA 4DRWA 2K8MB 2NCPA 2JULA 3I5HC 4OKHA 1RECA 1OOJA 2COLB 3CR5X 5D7FA 4MRXA 5HYDA 1W7JB 2I7AA 2M7LA 2GV5A 1Q80A 1QLSA 1N2DA 2BBMA 1JC2A 4I5JA 3OP0A 1NP8A 2BCBA 5JJGA 1V1FA 2L0PA 1MQ1A 3EK7A 5DKQA 1OE9B 4YGAA 1PALA 1KK7Y 2ZFDA 4ORCB 2TN4A 3DF0B 1IRJA 2JU0A 3DVJA 2PRUA 1NIWA 1PVAA 4GGFA 2KFGA 1ODBA 1K9PA 3BUMB 1SPYA 5J3XA 1BLQA 1DJWA 5HKYA 2F3ZA 1OZOA 3RM1A 2BCXA 1TRFA 1NX0A 1A75B 2F2PA 3ICBA 3BYAA 1DJHA 1QATA 1SL7A 2G9BA 1UHIA 1IG5A 2PASA 1K2HA 2CTNA 3CLNA 3D10A 1HT9A 1ALWA 3KPXA 1G4YR 4MEWA 5GQQC 1C07A 3PFVA 1U5IA 2B1UA 2NCOA 4M2OA 1XK4C 4YI9A 5KSZA 2JQ6A 2K61A 4BY4A 1QXPA 2E6WA 5CSFA 1BG1A 1B7TZ 1B8CA 1CDNA 1J1DA 1UWOA 1EXRA 1KFXL 1WDCB 3TDIA 2CCMA 1QX7A 3QRXA 1TNPA 4PDZA 3O4YA 1S6IA 1WDCC 2M9GA 2ZN8A 1DJXA 2PVBA 4OV2A 4PALA 1OMDA 1CFCA 1SBJA 1MUXA 3SG7A 1A03A 1TTXA 3KO0A 2LP2A 1KK8B 1R6PA 3LK1A 5HLOA 1CFFA 4TNCA 3ZWHA 2Y4QA 2F8PA 1KK8C 1XFUO 3EVUA 1DJIA 1YX7A 1NWDA 2MAZA 1DT7B 2MRDA 4DS7A 5BPJA 2AUCA 4PE4A 1K9KA 4I5KA 2MLFC 1MXEA 1TCOB 2M7NA 3NSLA 1BR1B 2LHIA 1SRAA 1UHHA 1Y1XA 4PHNA 1SCMC 1MXLC 4N1GA 2KSPA 1W7IB 1YUSA 1JUOA 2OTGC 2JTTA 3C1VA 1NX3A 1K9UA 2L98A 2JOJA 5KTYA 2LE9B 2RGIA 1OSAA 2ZKMX 1QASA 4PHJA 1AVSA 2IS9A 1WY9A 2JWWA 2LUXA 1KFXS 4L9MA 1BMOA 1SMGA 1QV0A 5ER5A 3SG2A 1B7TY 1UHNA 4ORBB 1CKKA 2KDHA 1CM1A 3WXAA 4XJKB 2KFFA 4WQ3A 1JBAA 1OZSA 1JSAA 2L4IA 1XA5A 4FTGA 2L4HA 1UP5A 1DJYA 3M0WA 4R1EA 4CPVA 2KGBC 3CGAA 2OS8B 2K7CA 5F6TA 4YRUA 3HX4A 3JTDB 3OB2B 3OHMB 2KAYA 2OS8C 3GK4X 5G08A 1L2OB 1XO5A 1K96A 2M8UA 4YI8A 1PSBA 1RTP1 2LM5A 2LMTA 1KSMA 2ZNDA 1L2OC 1PULA 1AK8A 3KHEA 1A4PA 1NX2A 2JC2A 4AOMA 5AERA 4CFRA 4XYNA 1XFZO 4HREE 3KEVA 4MRYA 2KBIA 3PSRA 2LVJA 2L5XB 1CDPA 3EK4A 1CLLA 1JF0A 1NX1A 1UURA 5JOLA 2K0JA 1L7ZA 5IBWA 3VROA 3I5FC 1TNXA 3AAJA 1KFUL 4QJ5B 4NQGA 1AUIB 1TN4A 1SCVA 2MJWB 1S36A 3GOFA 1FPWA 1JWDA 2JT0A 1B4CA 3HCMA 3VGOA 1M39A 1IH0A 1SL8A 2ZNEA 2Q91A 2KYFA 1ZOTB 2AAOA 2NZ0A 2K2AA 2KI6D 5CSIA 4E68A 3D0YA 3IQOA 3GK2A 4C0JA 2PMYA 5I2OA 1F4QA 2JPTA 1IQ5A 3IQQA 1IKUA 2M0RA 1SYMA 2JT8A 2BKHB 3EKHA 3K21A 3DF0A 4GNKB 2LNKA 3LL8B 5KU1A 4C0LA 1D1OA 1EG3A 1CTRA 2QPTA 2L51A 3O6BA 4M2QA 3TDUA 1OMVA 1YURA 1ALVA 4NDCA 2WNDA 1JFKA 1M63B 2BBNA 3VRPA 1U5IB 2FJUB 2Y1MA 3EK8A 1DF0A 2JZIA 3EVRA 1RFJA 1M31A 1DVIA 3E3RA 2KI6C 2LC5A 1A75A 1NCXA 2Y5IA 1PVBA 3I5IB 4JQ0D 1YRUB 2VRGA 1CMFA 4YGBB 1BR4B 1IJ5A 2H61A 4BY5A 1CB1A 3DD4A 1MF8B 3SG4A 2WOSA 3I5IC 1AHRA 1YR5A 5AANA 1AJ4A 1XK4A 1LINA 4A4BA 2JTZA 4PCWA 1S26D 5AEQA 1QIWA 1KSOA 1RJVA 5FYXA 3BOWB 4CFQA 2FOTA 4OCIA 1CNPA 2BE6A 2LAPA 2G2BA 1XFWO 1EH2A 2JNFA 1SL9A 1HQVA 1WRLA 2WC8A 1A2XA 1M45A 1IGVA 1EL4A 1TCFA 1XFVO 2MHHA 2K7OA 1K94A 4GBAA 1NCZA 2BL0B 2O5GA 1S5GZ 1B8LA 1XYDA 2FCDA 2PSRA 4F0ZB 4MBEA 1TOPA 4C0KA 1S6CA 2GGMA 2BL0C 2NLNA 1B1GA 2Y1NA 2WCFA 3NSIA 4Q04A 3BUOB 1N0YA 2KQYA 4WRIA 5HKZA 3AKBA 1GJYA 3VRQA 4USLA 2D8NA 3BUNB 1QV1A 1DJZA 1QVIZ 2ISDA 1PK0D 4MVFA 3CS1A 2JNXA 1SNLA 2M1UA 5I2LA 3BUXB 3NXAA 1LKJA 3O78A 1AJ5A 3AKAA 2CBLA 1H8BA 2E30A 1YVLA 2LVIA 3H4SE 1TNWA 1F8HA 4OR9B 1GGWA 3JVTB 4MN0A 2Q4UA 2WORA 5ER4X 1NCYA 1CDMA 2LLUA 1KWOB 3NSOA 3JVTC 1WRKA 2HQ8A 4P5OE 3WHUB 1KWOC 2LVVA 1C7VA 1CM4A 1OQPA 1A29A 2HF5A 1SK6D 3PLFB 1VRKA 3JTDC 1H4BA 3TZ1A 2BECA 3CTNA 4NDBA 1J7OA 4M2PA 4XJKA 2L2EA 3PALA 4NDDA 3DVKA 3SIBA 4D1EA 3BQ3A 1F71A 1CLMA 2LLSA 1RWYA 1K95A 1WLMA 1FF1A 3OX5A 1K8UA 3AAKA 1S5GY 3CZTX 4DCKA 1QJTA 5DKRA 4ORAB 1RK9A 1J7QA 2EGDA 2DOQA 3GK1A 1S3PA 1MR8A 1BOCA 1Y0VH 4MLWA 5AXIA 1R2UA 1WLZA 1KCYA 5I8NA 1XFXO 2LHLA 2JRFA 4CLNA 1DGVA 3VRRA 4HRGA 3FS7A 3F45A 1ZMZA 1QVIY 2QACA 2KNEA 2OPOA 4U8DA 2LMUA 2K7BA 4ZCVA 1Y1UA 2ZN9A 4JPZB 1PSRA 2M29A 3I5GB 3SIAA 1TIZA 3D0YB 5CPVA 3SG5A 1DMOA 1KQVA 4GGFC 1FW4A 2V53A 1YVHA 2WCEA 3I5GC 2KGRA 2CT9A 1OMRA 5HLVA 1J1EA 3NSKA 2LCPA 4FQOA 1QS7A 2F33A 1QTXA 4HSZA 2M1KB 1BODA 4I5LB 4DUQA 2HQWA 1LA3A 1M46A 2LVKA 1NUBA 1J7RA 4AQJA 1B9AA 3WHTB 1GQMA 2LANA 3FWCA 1UHKA 1JFJA 3LK0A 2JXLA 2WCBA 5D69A 2KFHA 2BKIB 1G8IA 3TS5B 2LLTA 1DF0B 1LVCD 1SY9A 4GGNA 4IL1A 1BT6A 1LA0A 3RLZA 3TS5C 4CIDA 3EKJA 1SR6B 2LMVA 3I5FB 1CMGA 1YUTA 3OX6A 1S1EA 2MLEC 4PE7A 1IQ3A 3O2PA 4GFTA 1SR6C 1F4OA 2A4JA 1KFUS 1XFYO 1QX5B 1QIVA 1DGUA 2H61C 1GGZA 2K2FA 3BUWB 3KF9A 2KQ6A 2M49B 4UPGA 1FI6A 4GAOA 1N65A 1YUUA 1C7WA 1IJ6A 2KAXA 5CSJA 2R2IA 1AP4A 1Y1AA 2LV7A 1DJGA 1B47A 4P2YB 4GUKA 1BF5A 4WQ2A 2MA2A 2NXQA 1UHJA 4N5XA 3SG3A 3LCPC 4YGDB 5I2QA 1K90D 3BXKA 2SCPA 4QJ4B 3A4UB 2JT3A 4A4CA 1J7PA 2AMIA 1UUSA 2EHBA 2F2OA 2I2RE 2JXCA 3LLEA 2KYCA 4MZKA 2K7DA 3DVMA 1F55A 3SJSA 1IWQA 2KBMA 1LXFC 3BOWA 3FWBA 1CFDA 2ZRTA 3PN7B 3IF7A 1F70A 3WNXB 5TNCA 5B8IB 1QLKA 1WRZA 2FCEA 5HKWA 5AFPA 4DIRA 3PN7C 1NPQA 4PE0A 3SG6A 2O60A 2KHNA 5PALA 1XVJA 1ZUZA 1E8AA 1MHOA 2P6BB 5CSNA 1JF2A 1NSHA 1SW8A 2MBXA 2GGZA 3PM8A 2KI4B 2HETA 2L50A 1S6JA 1SCMB 2LUCA 3EVVA 4QJ3B 4ETOA 3PATA 2I94A 1YRTB 1PRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAV A;  2KI4 C;  3ZNI A;  5K89 A;  2OTG B;  1G33 A;  3DVE A;  2I18 A;  1KK7 Z;  5DKN A;  4YGC B;  3VRN A;  1QX2 A;  2H2K A;  2BCA A;  4HRH A;  1CFP A;  1F54 A;  2HPS A;  1YTZ C;  3CR2 A;  4ICB A;  2BE4 A;  2M97 A;  4YGE B;  2F3Y A;  1SKT A;  1FI5 A;  1CDL A;  1KQM B;  1RRO A;  1ZFS A;  3TDZ A;  1EG4 A;  2CNP A;  2CXJ A;  3FIA A;  2SAS A;  4JWQ A;  1Y6W A;  1KQM C;  4AQI A;  1YX8 A;  1B8R A;  2PAL A;  3CWG A;  4GPL B;  4MZJ A;  4PHM A;  3TUY B;  3MSE B;  4I5N B;  1FBV A;  2LP3 A;  4YBH B;  4ZCU A;  3TUY C;  1BU3 A;  4PE1 A;  1J55 A;  3A8R A;  2KOT A;  4OVN F;  1V1G A;  1NYA A;  1BJF A;  1TNQ A;  2EC6 B;  4N1F A;  1ZAC A;  1X02 A;  3OB1 B;  1EJ3 A;  1K93 D;  2ZRS A;  3CR4 X;  2M3W A;  2EC6 C;  4MZL A;  1DTL A;  3I5H B;  4PHK A;  4MSP A;  1CLB A;  1MWN A;  4DRW A;  2K8M B;  2NCP A;  2JUL A;  3I5H C;  4OKH A;  1REC A;  1OOJ A;  2COL B;  3CR5 X;  5D7F A;  4MRX A;  5HYD A;  1W7J B;  2I7A A;  2M7L A;  2GV5 A;  1Q80 A;  1QLS A;  1N2D A;  2BBM A;  1JC2 A;  4I5J A;  3OP0 A;  1NP8 A;  2BCB A;  5JJG A;  1V1F A;  2L0P A;  1MQ1 A;  3EK7 A;  5DKQ A;  1OE9 B;  4YGA A;  1PAL A;  1KK7 Y;  2ZFD A;  4ORC B;  2TN4 A;  3DF0 B;  1IRJ A;  2JU0 A;  3DVJ A;  2PRU A;  1NIW A;  1PVA A;  4GGF A;  2KFG A;  1ODB A;  1K9P A;  3BUM B;  1SPY A;  5J3X A;  1BLQ A;  1DJW A;  5HKY A;  2F3Z A;  1OZO A;  3RM1 A;  2BCX A;  1TRF A;  1NX0 A;  1A75 B;  2F2P A;  3ICB A;  3BYA A;  1DJH A;  1QAT A;  1SL7 A;  2G9B A;  1UHI A;  1IG5 A;  2PAS A;  1K2H A;  2CTN A;  3CLN A;  3D10 A;  1HT9 A;  1ALW A;  3KPX A;  1G4Y R;  4MEW A;  5GQQ C;  1C07 A;  3PFV A;  1U5I A;  2B1U A;  2NCO A;  4M2O A;  1XK4 C;  4YI9 A;  5KSZ A;  2JQ6 A;  2K61 A;  4BY4 A;  1QXP A;  2E6W A;  5CSF A;  1BG1 A;  1B7T Z;  1B8C A;  1CDN A;  1J1D A;  1UWO A;  1EXR A;  1KFX L;  1WDC B;  3TDI A;  2CCM A;  1QX7 A;  3QRX A;  1TNP A;  4PDZ A;  3O4Y A;  1S6I A;  1WDC C;  2M9G A;  2ZN8 A;  1DJX A;  2PVB A;  4OV2 A;  4PAL A;  1OMD A;  1CFC A;  1SBJ A;  1MUX A;  3SG7 A;  1A03 A;  1TTX A;  3KO0 A;  2LP2 A;  1KK8 B;  1R6P A;  3LK1 A;  5HLO A;  1CFF A;  4TNC A;  3ZWH A;  2Y4Q A;  2F8P A;  1KK8 C;  1XFU O;  3EVU A;  1DJI A;  1YX7 A;  1NWD A;  2MAZ A;  1DT7 B;  2MRD A;  4DS7 A;  5BPJ A;  2AUC A;  4PE4 A;  1K9K A;  4I5K A;  2MLF C;  1MXE A;  1TCO B;  2M7N A;  3NSL A;  1BR1 B;  2LHI A;  1SRA A;  1UHH A;  1Y1X A;  4PHN A;  1SCM C;  1MXL C;  4N1G A;  2KSP A;  1W7I B;  1YUS A;  1JUO A;  2OTG C;  2JTT A;  3C1V A;  1NX3 A;  1K9U A;  2L98 A;  2JOJ A;  5KTY A;  2LE9 B;  2RGI A;  1OSA A;  2ZKM X;  1QAS A;  4PHJ A;  1AVS A;  2IS9 A;  1WY9 A;  2JWW A;  2LUX A;  1KFX S;  4L9M A;  1BMO A;  1SMG A;  1QV0 A;  5ER5 A;  3SG2 A;  1B7T Y;  1UHN A;  4ORB B;  1CKK A;  2KDH A;  1CM1 A;  3WXA A;  4XJK B;  2KFF A;  4WQ3 A;  1JBA A;  1OZS A;  1JSA A;  2L4I A;  1XA5 A;  4FTG A;  2L4H A;  1UP5 A;  1DJY A;  3M0W A;  4R1E A;  4CPV A;  2KGB C;  3CGA A;  2OS8 B;  2K7C A;  5F6T A;  4YRU A;  3HX4 A;  3JTD B;  3OB2 B;  3OHM B;  2KAY A;  2OS8 C;  3GK4 X;  5G08 A;  1L2O B;  1XO5 A;  1K96 A;  2M8U A;  4YI8 A;  1PSB A;  1RTP 1;  2LM5 A;  2LMT A;  1KSM A;  2ZND A;  1L2O C;  1PUL A;  1AK8 A;  3KHE A;  1A4P A;  1NX2 A;  2JC2 A;  4AOM A;  5AER A;  4CFR A;  4XYN A;  1XFZ O;  4HRE E;  3KEV A;  4MRY A;  2KBI A;  3PSR A;  2LVJ A;  2L5X B;  1CDP A;  3EK4 A;  1CLL A;  1JF0 A;  1NX1 A;  1UUR A;  5JOL A;  2K0J A;  1L7Z A;  5IBW A;  3VRO A;  3I5F C;  1TNX A;  3AAJ A;  1KFU L;  4QJ5 B;  4NQG A;  1AUI B;  1TN4 A;  1SCV A;  2MJW B;  1S36 A;  3GOF A;  1FPW A;  1JWD A;  2JT0 A;  1B4C A;  3HCM A;  3VGO A;  1M39 A;  1IH0 A;  1SL8 A;  2ZNE A;  2Q91 A;  2KYF A;  1ZOT B;  2AAO A;  2NZ0 A;  2K2A A;  2KI6 D;  5CSI A;  4E68 A;  3D0Y A;  3IQO A;  3GK2 A;  4C0J A;  2PMY A;  5I2O A;  1F4Q A;  2JPT A;  1IQ5 A;  3IQQ A;  1IKU A;  2M0R A;  1SYM A;  2JT8 A;  2BKH B;  3EKH A;  3K21 A;  3DF0 A;  4GNK B;  2LNK A;  3LL8 B;  5KU1 A;  4C0L A;  1D1O A;  1EG3 A;  1CTR A;  2QPT A;  2L51 A;  3O6B A;  4M2Q A;  3TDU A;  1OMV A;  1YUR A;  1ALV A;  4NDC A;  2WND A;  1JFK A;  1M63 B;  2BBN A;  3VRP A;  1U5I B;  2FJU B;  2Y1M A;  3EK8 A;  1DF0 A;  2JZI A;  3EVR A;  1RFJ A;  1M31 A;  1DVI A;  3E3R A;  2KI6 C;  2LC5 A;  1A75 A;  1NCX A;  2Y5I A;  1PVB A;  3I5I B;  4JQ0 D;  1YRU B;  2VRG A;  1CMF A;  4YGB B;  1BR4 B;  1IJ5 A;  2H61 A;  4BY5 A;  1CB1 A;  3DD4 A;  1MF8 B;  3SG4 A;  2WOS A;  3I5I C;  1AHR A;  1YR5 A;  5AAN A;  1AJ4 A;  1XK4 A;  1LIN A;  4A4B A;  2JTZ A;  4PCW A;  1S26 D;  5AEQ A;  1QIW A;  1KSO A;  1RJV A;  5FYX A;  3BOW B;  4CFQ A;  2FOT A;  4OCI A;  1CNP A;  2BE6 A;  2LAP A;  2G2B A;  1XFW O;  1EH2 A;  2JNF A;  1SL9 A;  1HQV A;  1WRL A;  2WC8 A;  1A2X A;  1M45 A;  1IGV A;  1EL4 A;  1TCF A;  1XFV O;  2MHH A;  2K7O A;  1K94 A;  4GBA A;  1NCZ A;  2BL0 B;  2O5G A;  1S5G Z;  1B8L A;  1XYD A;  2FCD A;  2PSR A;  4F0Z B;  4MBE A;  1TOP A;  4C0K A;  1S6C A;  2GGM A;  2BL0 C;  2NLN A;  1B1G A;  2Y1N A;  2WCF A;  3NSI A;  4Q04 A;  3BUO B;  1N0Y A;  2KQY A;  4WRI A;  5HKZ A;  3AKB A;  1GJY A;  3VRQ A;  4USL A;  2D8N A;  3BUN B;  1QV1 A;  1DJZ A;  1QVI Z;  2ISD A;  1PK0 D;  4MVF A;  3CS1 A;  2JNX A;  1SNL A;  2M1U A;  5I2L A;  3BUX B;  3NXA A;  1LKJ A;  3O78 A;  1AJ5 A;  3AKA A;  2CBL A;  1H8B A;  2E30 A;  1YVL A;  2LVI A;  3H4S E;  1TNW A;  1F8H A;  4OR9 B;  1GGW A;  3JVT B;  4MN0 A;  2Q4U A;  2WOR A;  5ER4 X;  1NCY A;  1CDM A;  2LLU A;  1KWO B;  3NSO A;  3JVT C;  1WRK A;  2HQ8 A;  4P5O E;  3WHU B;  1KWO C;  2LVV A;  1C7V A;  1CM4 A;  1OQP A;  1A29 A;  2HF5 A;  1SK6 D;  3PLF B;  1VRK A;  3JTD C;  1H4B A;  3TZ1 A;  2BEC A;  3CTN A;  4NDB A;  1J7O A;  4M2P A;  4XJK A;  2L2E A;  3PAL A;  4NDD A;  3DVK A;  3SIB A;  4D1E A;  3BQ3 A;  1F71 A;  1CLM A;  2LLS A;  1RWY A;  1K95 A;  1WLM A;  1FF1 A;  3OX5 A;  1K8U A;  3AAK A;  1S5G Y;  3CZT X;  4DCK A;  1QJT A;  5DKR A;  4ORA B;  1RK9 A;  1J7Q A;  2EGD A;  2DOQ A;  3GK1 A;  1S3P A;  1MR8 A;  1BOC A;  1Y0V H;  4MLW A;  5AXI A;  1R2U A;  1WLZ A;  1KCY A;  5I8N A;  1XFX O;  2LHL A;  2JRF A;  4CLN A;  1DGV A;  3VRR A;  4HRG A;  3FS7 A;  3F45 A;  1ZMZ A;  1QVI Y;  2QAC A;  2KNE A;  2OPO A;  4U8D A;  2LMU A;  2K7B A;  4ZCV A;  1Y1U A;  2ZN9 A;  4JPZ B;  1PSR A;  2M29 A;  3I5G B;  3SIA A;  1TIZ A;  3D0Y B;  5CPV A;  3SG5 A;  1DMO A;  1KQV A;  4GGF C;  1FW4 A;  2V53 A;  1YVH A;  2WCE A;  3I5G C;  2KGR A;  2CT9 A;  1OMR A;  5HLV A;  1J1E A;  3NSK A;  2LCP A;  4FQO A;  1QS7 A;  2F33 A;  1QTX A;  4HSZ A;  2M1K B;  1BOD A;  4I5L B;  4DUQ A;  2HQW A;  1LA3 A;  1M46 A;  2LVK A;  1NUB A;  1J7R A;  4AQJ A;  1B9A A;  3WHT B;  1GQM A;  2LAN A;  3FWC A;  1UHK A;  1JFJ A;  3LK0 A;  2JXL A;  2WCB A;  5D69 A;  2KFH A;  2BKI B;  1G8I A;  3TS5 B;  2LLT A;  1DF0 B;  1LVC D;  1SY9 A;  4GGN A;  4IL1 A;  1BT6 A;  1LA0 A;  3RLZ A;  3TS5 C;  4CID A;  3EKJ A;  1SR6 B;  2LMV A;  3I5F B;  1CMG A;  1YUT A;  3OX6 A;  1S1E A;  2MLE C;  4PE7 A;  1IQ3 A;  3O2P A;  4GFT A;  1SR6 C;  1F4O A;  2A4J A;  1KFU S;  1XFY O;  1QX5 B;  1QIV A;  1DGU A;  2H61 C;  1GGZ A;  2K2F A;  3BUW B;  3KF9 A;  2KQ6 A;  2M49 B;  4UPG A;  1FI6 A;  4GAO A;  1N65 A;  1YUU A;  1C7W A;  1IJ6 A;  2KAX A;  5CSJ A;  2R2I A;  1AP4 A;  1Y1A A;  2LV7 A;  1DJG A;  1B47 A;  4P2Y B;  4GUK A;  1BF5 A;  4WQ2 A;  2MA2 A;  2NXQ A;  1UHJ A;  4N5X A;  3SG3 A;  3LCP C;  4YGD B;  5I2Q A;  1K90 D;  3BXK A;  2SCP A;  4QJ4 B;  3A4U B;  2JT3 A;  4A4C A;  1J7P A;  2AMI A;  1UUS A;  2EHB A;  2F2O A;  2I2R E;  2JXC A;  3LLE A;  2KYC A;  4MZK A;  2K7D A;  3DVM A;  1F55 A;  3SJS A;  1IWQ A;  2KBM A;  1LXF C;  3BOW A;  3FWB A;  1CFD A;  2ZRT A;  3PN7 B;  3IF7 A;  1F70 A;  3WNX B;  5TNC A;  5B8I B;  1QLK A;  1WRZ A;  2FCE A;  5HKW A;  5AFP A;  4DIR A;  3PN7 C;  1NPQ A;  4PE0 A;  3SG6 A;  2O60 A;  2KHN A;  5PAL A;  1XVJ A;  1ZUZ A;  1E8A A;  1MHO A;  2P6B B;  5CSN A;  1JF2 A;  1NSH A;  1SW8 A;  2MBX A;  2GGZ A;  3PM8 A;  2KI4 B;  2HET A;  2L50 A;  1S6J A;  1SCM B;  2LUC A;  3EVV A;  4QJ3 B;  4ETO A;  3PAT A;  2I94 A;  1YRT B;  1PRW A; 
#chains in the Genus database with same CATH topology
 2KAV A;  2KI4 C;  3ZNI A;  5K89 A;  2OTG B;  1G33 A;  3DVE A;  1OOG A;  2I18 A;  1KK7 Z;  5DKN A;  4YGC B;  3VRN A;  1QX2 A;  2H2K A;  2BCA A;  4HRH A;  1CFP A;  1F54 A;  2HPS A;  1YTZ C;  3CR2 A;  4ICB A;  2BE4 A;  2M97 A;  3EG5 B;  2F3Y A;  4YGE B;  1SKT A;  5HL1 A;  1FI5 A;  1CDL A;  3PM2 A;  1KQM B;  1RRO A;  1ZFS A;  1P28 A;  2KLD A;  3TDZ A;  1EG4 A;  2CNP A;  2CXJ A;  2KLE A;  2SAS A;  3FIA A;  4JWQ A;  1Y6W A;  1KQM C;  3D73 A;  4AQI A;  1YX8 A;  1B8R A;  2L5Y A;  1DEL A;  2PAL A;  3CWG A;  4GPL B;  4MZJ A;  4PHM A;  3MSE B;  4I5N B;  1FBV A;  3R72 A;  3TUY B;  2LP3 A;  4YBH B;  4ZCU A;  3TUY C;  4FQT A;  1BU3 A;  4PE1 A;  1J55 A;  3A8R A;  2KOT A;  4OVN F;  1V1G A;  1NYA A;  1BJF A;  1SSE B;  1TNQ A;  2EC6 B;  4N1F A;  2BAP A;  3V2L A;  1ZAC A;  2WCL A;  1X02 A;  1OOF A;  1EJ3 A;  3OB1 B;  1K93 D;  1TWO A;  2ZRS A;  3CR4 X;  2M3W A;  2EC6 C;  4MZL A;  1DTL A;  3I5H B;  4PHK A;  4MSP A;  1CLB A;  1MWN A;  4DRW A;  2K8M B;  2NCP A;  2JUL A;  2QEV A;  3I5H C;  4OKH A;  1REC A;  1OOJ A;  2COL B;  3CR5 X;  5D7F A;  4MRX A;  5HYD A;  1W7J B;  2I7A A;  4PT1 A;  2M7L A;  2GV5 A;  1Q80 A;  1QLS A;  1N2D A;  2BBM A;  1JC2 A;  4I5J A;  3OP0 A;  1NP8 A;  2BCB A;  5JJG A;  1V1F A;  2L0P A;  1MQ1 A;  3EK7 A;  5DKQ A;  1OE9 B;  4YGA A;  1PAL A;  1KK7 Y;  2ZFD A;  4ORC B;  2TN4 A;  3DF0 B;  1IRJ A;  2JU0 A;  3DVJ A;  2PRU A;  1NIW A;  3BJH A;  4F7F A;  1ORG A;  1XFR A;  1PVA A;  4GGF A;  2KFG A;  1ODB A;  1K9P A;  3BUM B;  1SPY A;  5J3X A;  1BLQ A;  1DJW A;  5HKY A;  2F3Z A;  1OZO A;  3RM1 A;  2BCX A;  1TRF A;  1NX0 A;  1A75 B;  2F2P A;  3ICB A;  1TUJ A;  3BYA A;  3CAB A;  3R1V A;  1DJH A;  1QAT A;  1SL7 A;  2G9B A;  1W9Z A;  1UHI A;  1IG5 A;  2L2C A;  2PAS A;  1K2H A;  2CTN A;  3CLN A;  3D10 A;  1HT9 A;  1ALW A;  3KPX A;  1G4Y R;  4MEW A;  5GQQ C;  1C07 A;  3PFV A;  1U5I A;  2B1U A;  2NCO A;  4M2O A;  3S0F A;  1XK4 C;  2BNX A;  4YI9 A;  5KSZ A;  3SS4 A;  2JQ6 A;  2K61 A;  2QDI A;  4BY4 A;  1QXP A;  2E6W A;  5CSF A;  3PJI A;  1BG1 A;  1B7T Z;  1B8C A;  3R1O A;  1CDN A;  1J1D A;  2ERB A;  1UWO A;  1WDC B;  1EXR A;  1KFX L;  3TDI A;  2CCM A;  1LS8 A;  3O4X A;  1QX7 A;  3QRX A;  1TNP A;  4PDZ A;  3O4Y A;  1S6I A;  1WDC C;  2M9G A;  2ZN8 A;  1DJX A;  2PVB A;  4OV2 A;  4PAL A;  1OMD A;  1CFC A;  1SBJ A;  1MUX A;  3SG7 A;  5I94 A;  1A03 A;  1TTX A;  3KO0 A;  2LP2 A;  1KK8 B;  1R6P A;  3LK1 A;  5HLO A;  1CFF A;  4TNC A;  3ZWH A;  2Y4Q A;  2F8P A;  1KK8 C;  1XFU O;  4KYN A;  2WC5 A;  3EVU A;  1DJI A;  1YX7 A;  1NWD A;  2MAZ A;  1DT7 B;  2MRD A;  4DS7 A;  5BPJ A;  2AUC A;  4PE4 A;  1K9K A;  4I5K A;  2MLF C;  1Z4H A;  3OBV A;  1MXE A;  1TCO B;  2M7N A;  3L4L A;  3NSL A;  1BR1 B;  2LHI A;  1SRA A;  1UHH A;  1Y1X A;  4PHN A;  1SCM C;  3S0A A;  1MXL C;  4N1G A;  2KSP A;  1W7I B;  1YUS A;  1JUO A;  2OTG C;  2JTT A;  3C1V A;  1NX3 A;  1K9U A;  2L98 A;  2JOJ A;  5KTY A;  2LE9 B;  3IVT A;  3S0D A;  2RGI A;  1OSA A;  2ZKM X;  1QAS A;  3BFB A;  4PHJ A;  1AVS A;  2IS9 A;  1WY9 A;  2JWW A;  3B6X A;  5FI7 A;  2LUX A;  1KFX S;  2FJY A;  1BMO A;  4L9M A;  1SMG A;  1QV0 A;  5ER5 A;  3SG2 A;  1B7T Y;  1UHN A;  4ORB B;  1CKK A;  2KDH A;  1CM1 A;  3WXA A;  4XJK B;  2KFF A;  4WQ3 A;  1JBA A;  1OZS A;  1JSA A;  2L4I A;  1XA5 A;  3FE9 A;  4FTG A;  2L4H A;  1UP5 A;  1DJY A;  3M0W A;  3VB1 A;  4R1E A;  4CPV A;  2KGB C;  2QEB A;  2OS8 B;  2K7C A;  3CGA A;  3QME A;  5F6T A;  4YRU A;  3HX4 A;  3JTD B;  3OB2 B;  3OHM B;  2KAY A;  2OS8 C;  3GK4 X;  5G08 A;  1L2O B;  1XO5 A;  1K96 A;  2M8U A;  4YI8 A;  1PSB A;  1RTP 1;  2LM5 A;  2LMT A;  1KSM A;  3NGV A;  2ZND A;  1L2O C;  3FE8 A;  1PUL A;  1AK8 A;  3KHE A;  1DQE A;  1A4P A;  1NX2 A;  2JC2 A;  4OZD A;  4AOM A;  1DEK A;  5AER A;  4CFR A;  4XYN A;  1XFZ O;  4HRE E;  3KEV A;  4MRY A;  2KBI A;  3PSR A;  2LVJ A;  2L5X B;  1CDP A;  3EK4 A;  1CLL A;  1JF0 A;  1NX1 A;  1UUR A;  5JOL A;  2K0J A;  1L7Z A;  5IBW A;  3VRO A;  3I5F C;  1TNX A;  3AAJ A;  1KFU L;  4QJ5 B;  4NQG A;  1AUI B;  1TN4 A;  1SCV A;  2MJW B;  1S36 A;  3GOF A;  1FPW A;  1JWD A;  2JT0 A;  1B4C A;  3HCM A;  3VGO A;  1M39 A;  1IH0 A;  1SL8 A;  2ZNE A;  2Q91 A;  2KYF A;  1ZOT B;  2PYQ A;  2AAO A;  2NZ0 A;  2K2A A;  2KI6 D;  3R1P A;  5CSI A;  4E68 A;  3D0Y A;  2WCJ A;  3IQO A;  3GK2 A;  4C0J A;  2PMY A;  5I2O A;  1T14 A;  1F4Q A;  3FE6 A;  2QEO A;  2JPT A;  1C3Z A;  1IQ5 A;  3IQQ A;  1IKU A;  2M0R A;  1SYM A;  2JT8 A;  2BKH B;  3EKH A;  3K21 A;  3DF0 A;  4GNK B;  2LNK A;  3LL8 B;  5KU1 A;  4C0L A;  3DXL A;  1D1O A;  1EG3 A;  1CTR A;  3DYE A;  2QPT A;  2L51 A;  3O6B A;  4M2Q A;  3TDU A;  1OMV A;  1YUR A;  1ALV A;  4NDC A;  2WND A;  1JFK A;  1M63 B;  2BBN A;  3B87 A;  3VRP A;  1U5I B;  2FJU B;  2Y1M A;  3EK8 A;  1DF0 A;  2JZI A;  2KPH A;  3EVR A;  1RFJ A;  1TUZ A;  1M31 A;  1DVI A;  3E3R A;  2KI6 C;  2LC5 A;  1A75 A;  1NCX A;  2Y5I A;  2YGU A;  3OGN A;  1PVB A;  3I5I B;  3B7A A;  4JQ0 D;  1YRU B;  2VRG A;  3S0E A;  1CMF A;  4YGB B;  1BR4 B;  1IJ5 A;  2H61 A;  4BY5 A;  1CB1 A;  3DD4 A;  1MF8 B;  4JD9 A;  3SG4 A;  2WOS A;  3I5I C;  3CZ2 A;  1AHR A;  3L4A A;  1YR5 A;  5AAN A;  1AJ4 A;  1XK4 A;  1LIN A;  2P70 A;  2JTZ A;  2QEH A;  4PCW A;  1S26 D;  5AEQ A;  4A4B A;  1QIW A;  1KSO A;  1RJV A;  5FYX A;  3BOW B;  4CFQ A;  2FOT A;  4OCI A;  1CNP A;  2BE6 A;  3D77 A;  2LAP A;  2G2B A;  3BFA A;  1XFW O;  1EH2 A;  2JNF A;  1SL9 A;  1HQV A;  1WRL A;  2WC8 A;  1A2X A;  1M45 A;  3CZ0 A;  1IGV A;  4INX A;  1EL4 A;  5FI6 A;  1TCF A;  1XFV O;  2MHH A;  2K7O A;  1K94 A;  4GBA A;  3NHI A;  3RZS A;  1NCZ A;  2BL0 B;  2O5G A;  1S5G Z;  1B8L A;  1XYD A;  2FCD A;  2JPO A;  2PSR A;  3BFH A;  4MBE A;  1TOP A;  4F0Z B;  4C0K A;  1S6C A;  2GGM A;  3UO9 A;  2BL0 C;  2NLN A;  1B1G A;  2Y1N A;  2WCF A;  3NSI A;  4Q04 A;  3BUO B;  1N0Y A;  2KQY A;  4WRI A;  5HKZ A;  3SS3 A;  3AKB A;  1GJY A;  3Q8I A;  4USL A;  3VRQ A;  2D8N A;  3BUN B;  1OW4 A;  1QV1 A;  5FI2 A;  1DJZ A;  1QVI Z;  2ISD A;  1PK0 D;  4MVF A;  3CS1 A;  2JNX A;  1SNL A;  2M1U A;  3DZT A;  3BUX B;  3NXA A;  5I2L A;  1LKJ A;  3O78 A;  1C3Y A;  1AJ5 A;  3AKA A;  2CBL A;  1H8B A;  2E30 A;  1YVL A;  2LVI A;  3H4S E;  1TNW A;  1F8H A;  4OR9 B;  1GGW A;  3SS5 A;  3JVT B;  1OOH A;  4MN0 A;  2Q4U A;  2WOR A;  5ER4 X;  3S0G A;  1NCY A;  1CDM A;  2LLU A;  1KWO B;  3NSO A;  3JVT C;  1WRK A;  2HQ8 A;  4P5O E;  3WHU B;  1KWO C;  2LVV A;  1C7V A;  1CM4 A;  1OQP A;  1A29 A;  2GTE A;  3CYZ A;  2HF5 A;  1SK6 D;  3PLF B;  1VRK A;  3JTD C;  1H4B A;  3TZ1 A;  2BEC A;  3CTN A;  3B86 A;  4NDB A;  1J7O A;  4M2P A;  3D78 A;  4XJK A;  2L2E A;  3PAL A;  4NDD A;  3DVK A;  5D3O A;  3SIB A;  4D1E A;  3BQ3 A;  5EL2 A;  1CLM A;  2LLS A;  1F71 A;  1RWY A;  1K95 A;  1WLM A;  1FF1 A;  3OX5 A;  1K8U A;  3AAK A;  1S5G Y;  3CZT X;  4DCK A;  2WCH A;  1QJT A;  5DKR A;  4ORA B;  1RK9 A;  1J7Q A;  2EGD A;  2DOQ A;  4INW A;  3GK1 A;  1S3P A;  1MR8 A;  1BOC A;  1Y0V H;  1OOI X;  4MLW A;  5AXI A;  1R2U A;  1WLZ A;  1KCY A;  5I8N A;  3L47 A;  1XFX O;  2LHL A;  2JRF A;  4CLN A;  1DGV A;  3VRR A;  4HRG A;  3FS7 A;  3F45 A;  1ZMZ A;  3CZ1 A;  4IJ7 A;  1QVI Y;  2QAC A;  2KNE A;  2OPO A;  4U8D A;  2LMU A;  2K7B A;  4ZCV A;  1Y1U A;  2ZN9 A;  4JPZ B;  1PSR A;  2M29 A;  2WCK A;  3I5G B;  3SIA A;  1TIZ A;  3D0Y B;  3D75 A;  5CPV A;  3SG5 A;  1DMO A;  1KQV A;  4GGF C;  1FW4 A;  2V53 A;  1YVH A;  2WCE A;  3I5G C;  2KGR A;  2CT9 A;  1OMR A;  5HLV A;  1J1E A;  3K1E A;  3NSK A;  2LCP A;  3CDN A;  1QS7 A;  4FQO A;  1Z2C B;  2F33 A;  1QTX A;  4HSZ A;  2K60 A;  2M1K B;  1BOD A;  4I5L B;  4DUQ A;  1IIO A;  2HQW A;  1LA3 A;  1DC1 A;  1M46 A;  2LVK A;  1NUB A;  1J7R A;  4AQJ A;  1B9A A;  3WHT B;  1GQM A;  2LAN A;  3FWC A;  1UHK A;  1JFJ A;  3LK0 A;  2JXL A;  2WCB A;  5D69 A;  2KFH A;  2BKI B;  1G8I A;  3TS5 B;  3B88 A;  2LLT A;  1DF0 B;  1LVC D;  1SY9 A;  4GGN A;  4IL1 A;  1BT6 A;  1LA0 A;  3RLZ A;  3TS5 C;  2WC6 A;  4CID A;  3EKJ A;  1SR6 B;  2PQL A;  2LMV A;  3I5F B;  1CMG A;  1YUT A;  3OX6 A;  1S1E A;  2MLE C;  4PE7 A;  1IQ3 A;  3O2P A;  4GFT A;  1SR6 C;  1F4O A;  2A4J A;  1KFU S;  1XFY O;  1QX5 B;  1QIV A;  1DGU A;  2H61 C;  1GGZ A;  2K2F A;  3BUW B;  3KF9 A;  2KQ6 A;  2M49 B;  4JKT A;  4UPG A;  2H8V A;  1FI6 A;  4GAO A;  1N65 A;  1YUU A;  1C7W A;  1IJ6 A;  2KAX A;  3S0B A;  5CSJ A;  2R2I A;  5DIC A;  1AP4 A;  1Y1A A;  2LV7 A;  1DJG A;  1B47 A;  4P2Y B;  4GUK A;  3D76 A;  1BF5 A;  4WQ2 A;  2MA2 A;  1QWV A;  2NXQ A;  1UHJ A;  4N5X A;  3SG3 A;  3LCP C;  4YGD B;  5I2Q A;  1K90 D;  3BXK A;  2SCP A;  4QJ4 B;  3A4U B;  2JT3 A;  4A4C A;  1J7P A;  3UNW A;  2AMI A;  1UUS A;  2EHB A;  2F2O A;  2I2R E;  2JXC A;  3LLE A;  3D74 A;  1GM0 A;  2KYC A;  4MZK A;  3NHT A;  2K7D A;  3DVM A;  1F55 A;  3SJS A;  1IWQ A;  2KBM A;  1LXF C;  3BOW A;  3FWB A;  1CFD A;  2ZRT A;  3PN7 B;  3IF7 A;  1F70 A;  3WNX B;  5TNC A;  5B8I B;  3DY9 A;  1QLK A;  1WRZ A;  2FCE A;  5HKW A;  5AFP A;  4DIR A;  3PN7 C;  1NPQ A;  4PE0 A;  3SG6 A;  2O60 A;  2KHN A;  5PAL A;  1XVJ A;  1ZUZ A;  1E8A A;  1MHO A;  2P71 A;  2P6B B;  5CSN A;  1JF2 A;  2WCM A;  1NSH A;  1SW8 A;  2MBX A;  2GGZ A;  3PM8 A;  2KI4 B;  2HET A;  2L50 A;  1S6J A;  1SCM B;  2LUC A;  3EVV A;  3N7H A;  4QJ3 B;  4ETO A;  3PAT A;  2I94 A;  1YRT B;  1PRW A; 
#chains in the Genus database with same CATH homology
 2KAV A;  2KI4 C;  3ZNI A;  5K89 A;  2OTG B;  1G33 A;  3DVE A;  2I18 A;  1KK7 Z;  5DKN A;  4YGC B;  3VRN A;  1QX2 A;  2H2K A;  2BCA A;  4HRH A;  1CFP A;  1F54 A;  2HPS A;  1YTZ C;  3CR2 A;  4ICB A;  2BE4 A;  2M97 A;  4YGE B;  2F3Y A;  1SKT A;  1FI5 A;  1CDL A;  1KQM B;  1RRO A;  1ZFS A;  3TDZ A;  1EG4 A;  2CNP A;  2CXJ A;  3FIA A;  2SAS A;  4JWQ A;  1Y6W A;  1KQM C;  4AQI A;  1YX8 A;  1B8R A;  2PAL A;  3CWG A;  4GPL B;  4MZJ A;  4PHM A;  3TUY B;  3MSE B;  4I5N B;  1FBV A;  2LP3 A;  4YBH B;  4ZCU A;  3TUY C;  1BU3 A;  4PE1 A;  1J55 A;  3A8R A;  2KOT A;  4OVN F;  1V1G A;  1NYA A;  1BJF A;  1TNQ A;  2EC6 B;  4N1F A;  1ZAC A;  1X02 A;  3OB1 B;  1EJ3 A;  1K93 D;  2ZRS A;  3CR4 X;  2M3W A;  2EC6 C;  4MZL A;  1DTL A;  3I5H B;  4PHK A;  4MSP A;  1CLB A;  1MWN A;  4DRW A;  2K8M B;  2NCP A;  2JUL A;  3I5H C;  4OKH A;  1REC A;  1OOJ A;  2COL B;  3CR5 X;  5D7F A;  4MRX A;  5HYD A;  1W7J B;  2I7A A;  2M7L A;  2GV5 A;  1Q80 A;  1QLS A;  1N2D A;  2BBM A;  1JC2 A;  4I5J A;  3OP0 A;  1NP8 A;  2BCB A;  5JJG A;  1V1F A;  2L0P A;  1MQ1 A;  3EK7 A;  5DKQ A;  1OE9 B;  4YGA A;  1PAL A;  1KK7 Y;  2ZFD A;  4ORC B;  2TN4 A;  3DF0 B;  1IRJ A;  2JU0 A;  3DVJ A;  2PRU A;  1NIW A;  1PVA A;  4GGF A;  2KFG A;  1ODB A;  1K9P A;  3BUM B;  1SPY A;  5J3X A;  1BLQ A;  1DJW A;  5HKY A;  2F3Z A;  1OZO A;  3RM1 A;  2BCX A;  1TRF A;  1NX0 A;  1A75 B;  2F2P A;  3ICB A;  3BYA A;  1DJH A;  1QAT A;  1SL7 A;  2G9B A;  1UHI A;  1IG5 A;  2PAS A;  1K2H A;  2CTN A;  3CLN A;  3D10 A;  1HT9 A;  1ALW A;  3KPX A;  1G4Y R;  4MEW A;  5GQQ C;  1C07 A;  3PFV A;  1U5I A;  2B1U A;  2NCO A;  4M2O A;  1XK4 C;  4YI9 A;  5KSZ A;  2JQ6 A;  2K61 A;  4BY4 A;  1QXP A;  2E6W A;  5CSF A;  1BG1 A;  1B7T Z;  1B8C A;  1CDN A;  1J1D A;  1UWO A;  1EXR A;  1KFX L;  1WDC B;  3TDI A;  2CCM A;  1QX7 A;  3QRX A;  1TNP A;  4PDZ A;  3O4Y A;  1S6I A;  1WDC C;  2M9G A;  2ZN8 A;  1DJX A;  2PVB A;  4OV2 A;  4PAL A;  1OMD A;  1CFC A;  1SBJ A;  1MUX A;  3SG7 A;  1A03 A;  1TTX A;  3KO0 A;  2LP2 A;  1KK8 B;  1R6P A;  3LK1 A;  5HLO A;  1CFF A;  4TNC A;  3ZWH A;  2Y4Q A;  2F8P A;  1KK8 C;  1XFU O;  3EVU A;  1DJI A;  1YX7 A;  1NWD A;  2MAZ A;  1DT7 B;  2MRD A;  4DS7 A;  5BPJ A;  2AUC A;  4PE4 A;  1K9K A;  4I5K A;  2MLF C;  1MXE A;  1TCO B;  2M7N A;  3NSL A;  1BR1 B;  2LHI A;  1SRA A;  1UHH A;  1Y1X A;  4PHN A;  1SCM C;  1MXL C;  4N1G A;  2KSP A;  1W7I B;  1YUS A;  1JUO A;  2OTG C;  2JTT A;  3C1V A;  1NX3 A;  1K9U A;  2L98 A;  2JOJ A;  5KTY A;  2LE9 B;  2RGI A;  1OSA A;  2ZKM X;  1QAS A;  4PHJ A;  1AVS A;  2IS9 A;  1WY9 A;  2JWW A;  2LUX A;  1KFX S;  4L9M A;  1BMO A;  1SMG A;  1QV0 A;  5ER5 A;  3SG2 A;  1B7T Y;  1UHN A;  4ORB B;  1CKK A;  2KDH A;  1CM1 A;  3WXA A;  4XJK B;  2KFF A;  4WQ3 A;  1JBA A;  1OZS A;  1JSA A;  2L4I A;  1XA5 A;  4FTG A;  2L4H A;  1UP5 A;  1DJY A;  3M0W A;  4R1E A;  4CPV A;  2KGB C;  3CGA A;  2OS8 B;  2K7C A;  5F6T A;  4YRU A;  3HX4 A;  3JTD B;  3OB2 B;  3OHM B;  2KAY A;  2OS8 C;  3GK4 X;  5G08 A;  1L2O B;  1XO5 A;  1K96 A;  2M8U A;  4YI8 A;  1PSB A;  1RTP 1;  2LM5 A;  2LMT A;  1KSM A;  2ZND A;  1L2O C;  1PUL A;  1AK8 A;  3KHE A;  1A4P A;  1NX2 A;  2JC2 A;  4AOM A;  5AER A;  4CFR A;  4XYN A;  1XFZ O;  4HRE E;  3KEV A;  4MRY A;  2KBI A;  3PSR A;  2LVJ A;  2L5X B;  1CDP A;  3EK4 A;  1CLL A;  1JF0 A;  1NX1 A;  1UUR A;  5JOL A;  2K0J A;  1L7Z A;  5IBW A;  3VRO A;  3I5F C;  1TNX A;  3AAJ A;  1KFU L;  4QJ5 B;  4NQG A;  1AUI B;  1TN4 A;  1SCV A;  2MJW B;  1S36 A;  3GOF A;  1FPW A;  1JWD A;  2JT0 A;  1B4C A;  3HCM A;  3VGO A;  1M39 A;  1IH0 A;  1SL8 A;  2ZNE A;  2Q91 A;  2KYF A;  1ZOT B;  2AAO A;  2NZ0 A;  2K2A A;  2KI6 D;  5CSI A;  4E68 A;  3D0Y A;  3IQO A;  3GK2 A;  4C0J A;  2PMY A;  5I2O A;  1F4Q A;  2JPT A;  1IQ5 A;  3IQQ A;  1IKU A;  2M0R A;  1SYM A;  2JT8 A;  2BKH B;  3EKH A;  3K21 A;  3DF0 A;  4GNK B;  2LNK A;  3LL8 B;  5KU1 A;  4C0L A;  1D1O A;  1EG3 A;  1CTR A;  2QPT A;  2L51 A;  3O6B A;  4M2Q A;  3TDU A;  1OMV A;  1YUR A;  1ALV A;  4NDC A;  2WND A;  1JFK A;  1M63 B;  2BBN A;  3VRP A;  1U5I B;  2FJU B;  2Y1M A;  3EK8 A;  1DF0 A;  2JZI A;  3EVR A;  1RFJ A;  1M31 A;  1DVI A;  3E3R A;  2KI6 C;  2LC5 A;  1A75 A;  1NCX A;  2Y5I A;  1PVB A;  3I5I B;  4JQ0 D;  1YRU B;  2VRG A;  1CMF A;  4YGB B;  1BR4 B;  1IJ5 A;  2H61 A;  4BY5 A;  1CB1 A;  3DD4 A;  1MF8 B;  3SG4 A;  2WOS A;  3I5I C;  1AHR A;  1YR5 A;  5AAN A;  1AJ4 A;  1XK4 A;  1LIN A;  4A4B A;  2JTZ A;  4PCW A;  1S26 D;  5AEQ A;  1QIW A;  1KSO A;  1RJV A;  5FYX A;  3BOW B;  4CFQ A;  2FOT A;  4OCI A;  1CNP A;  2BE6 A;  2LAP A;  2G2B A;  1XFW O;  1EH2 A;  2JNF A;  1SL9 A;  1HQV A;  1WRL A;  2WC8 A;  1A2X A;  1M45 A;  1IGV A;  1EL4 A;  1TCF A;  1XFV O;  2MHH A;  2K7O A;  1K94 A;  4GBA A;  1NCZ A;  2BL0 B;  2O5G A;  1S5G Z;  1B8L A;  1XYD A;  2FCD A;  2PSR A;  4F0Z B;  4MBE A;  1TOP A;  4C0K A;  1S6C A;  2GGM A;  2BL0 C;  2NLN A;  1B1G A;  2Y1N A;  2WCF A;  3NSI A;  4Q04 A;  3BUO B;  1N0Y A;  2KQY A;  4WRI A;  5HKZ A;  3AKB A;  1GJY A;  3VRQ A;  4USL A;  2D8N A;  3BUN B;  1QV1 A;  1DJZ A;  1QVI Z;  2ISD A;  1PK0 D;  4MVF A;  3CS1 A;  2JNX A;  1SNL A;  2M1U A;  5I2L A;  3BUX B;  3NXA A;  1LKJ A;  3O78 A;  1AJ5 A;  3AKA A;  2CBL A;  1H8B A;  2E30 A;  1YVL A;  2LVI A;  3H4S E;  1TNW A;  1F8H A;  4OR9 B;  1GGW A;  3JVT B;  4MN0 A;  2Q4U A;  2WOR A;  5ER4 X;  1NCY A;  1CDM A;  2LLU A;  1KWO B;  3NSO A;  3JVT C;  1WRK A;  2HQ8 A;  4P5O E;  3WHU B;  1KWO C;  2LVV A;  1C7V A;  1CM4 A;  1OQP A;  1A29 A;  2HF5 A;  1SK6 D;  3PLF B;  1VRK A;  3JTD C;  1H4B A;  3TZ1 A;  2BEC A;  3CTN A;  4NDB A;  1J7O A;  4M2P A;  4XJK A;  2L2E A;  3PAL A;  4NDD A;  3DVK A;  3SIB A;  4D1E A;  3BQ3 A;  1F71 A;  1CLM A;  2LLS A;  1RWY A;  1K95 A;  1WLM A;  1FF1 A;  3OX5 A;  1K8U A;  3AAK A;  1S5G Y;  3CZT X;  4DCK A;  1QJT A;  5DKR A;  4ORA B;  1RK9 A;  1J7Q A;  2EGD A;  2DOQ A;  3GK1 A;  1S3P A;  1MR8 A;  1BOC A;  1Y0V H;  4MLW A;  5AXI A;  1R2U A;  1WLZ A;  1KCY A;  5I8N A;  1XFX O;  2LHL A;  2JRF A;  4CLN A;  1DGV A;  3VRR A;  4HRG A;  3FS7 A;  3F45 A;  1ZMZ A;  1QVI Y;  2QAC A;  2KNE A;  2OPO A;  4U8D A;  2LMU A;  2K7B A;  4ZCV A;  1Y1U A;  2ZN9 A;  4JPZ B;  1PSR A;  2M29 A;  3I5G B;  3SIA A;  1TIZ A;  3D0Y B;  5CPV A;  3SG5 A;  1DMO A;  1KQV A;  4GGF C;  1FW4 A;  2V53 A;  1YVH A;  2WCE A;  3I5G C;  2KGR A;  2CT9 A;  1OMR A;  5HLV A;  1J1E A;  3NSK A;  2LCP A;  4FQO A;  1QS7 A;  2F33 A;  1QTX A;  4HSZ A;  2M1K B;  1BOD A;  4I5L B;  4DUQ A;  2HQW A;  1LA3 A;  1M46 A;  2LVK A;  1NUB A;  1J7R A;  4AQJ A;  1B9A A;  3WHT B;  1GQM A;  2LAN A;  3FWC A;  1UHK A;  1JFJ A;  3LK0 A;  2JXL A;  2WCB A;  5D69 A;  2KFH A;  2BKI B;  1G8I A;  3TS5 B;  2LLT A;  1DF0 B;  1LVC D;  1SY9 A;  4GGN A;  4IL1 A;  1BT6 A;  1LA0 A;  3RLZ A;  3TS5 C;  4CID A;  3EKJ A;  1SR6 B;  2LMV A;  3I5F B;  1CMG A;  1YUT A;  3OX6 A;  1S1E A;  2MLE C;  4PE7 A;  1IQ3 A;  3O2P A;  4GFT A;  1SR6 C;  1F4O A;  2A4J A;  1KFU S;  1XFY O;  1QX5 B;  1QIV A;  1DGU A;  2H61 C;  1GGZ A;  2K2F A;  3BUW B;  3KF9 A;  2KQ6 A;  2M49 B;  4UPG A;  1FI6 A;  4GAO A;  1N65 A;  1YUU A;  1C7W A;  1IJ6 A;  2KAX A;  5CSJ A;  2R2I A;  1AP4 A;  1Y1A A;  2LV7 A;  1DJG A;  1B47 A;  4P2Y B;  4GUK A;  1BF5 A;  4WQ2 A;  2MA2 A;  2NXQ A;  1UHJ A;  4N5X A;  3SG3 A;  3LCP C;  4YGD B;  5I2Q A;  1K90 D;  3BXK A;  2SCP A;  4QJ4 B;  3A4U B;  2JT3 A;  4A4C A;  1J7P A;  2AMI A;  1UUS A;  2EHB A;  2F2O A;  2I2R E;  2JXC A;  3LLE A;  2KYC A;  4MZK A;  2K7D A;  3DVM A;  1F55 A;  3SJS A;  1IWQ A;  2KBM A;  1LXF C;  3BOW A;  3FWB A;  1CFD A;  2ZRT A;  3PN7 B;  3IF7 A;  1F70 A;  3WNX B;  5TNC A;  5B8I B;  1QLK A;  1WRZ A;  2FCE A;  5HKW A;  5AFP A;  4DIR A;  3PN7 C;  1NPQ A;  4PE0 A;  3SG6 A;  2O60 A;  2KHN A;  5PAL A;  1XVJ A;  1ZUZ A;  1E8A A;  1MHO A;  2P6B B;  5CSN A;  1JF2 A;  1NSH A;  1SW8 A;  2MBX A;  2GGZ A;  3PM8 A;  2KI4 B;  2HET A;  2L50 A;  1S6J A;  1SCM B;  2LUC A;  3EVV A;  4QJ3 B;  4ETO A;  3PAT A;  2I94 A;  1YRT B;  1PRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...