3MSEB

Crystal structure of c-terminal domain of pf110239.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
168
Chain Sequence
b'ISPNVLNNMKSYMKHSNIRNIIINIMAHELSVINNHIKYINELFYKLDTNHNGSLSHREIYTVLASVGIKKWDINRILQALDINDRGNITYTEFMAGCYRWKNITFLKAAFNKIDKDEDGYISKSDIVSLVHDKVLDNNDIDNFFLSVHSIINKISFQEFKDYMLSTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protein kinase, putative
molecule tags Transferase
source organism Plasmodium falciparum
publication title Crystal structure of C-terminal domain of PF110239
rcsb
total genus 60
structure length 168
sequence length 179
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3mseB00
4MSPA 3FS7A 3KO0A 3MSEB 2RGIA 1AVSA 1M63B 1N0YA 3LCPC 1AHRA 2M1KB 1K90D 1BR4B 1QASA 1MR8A 1MUXA 1RK9A 2KFHA 2PVBA 1UWOA 3JVTB 5KU1A 4IL1A 5TNCA 1U5IB 1TCFA 2OS8C 1QIVA 3D0YA 1IKUA 1QX5B 4GGFA 5CSJA 4CPVA 5KTYA 1KK8C 2LM5A 2COLB 1OMDA 5HLVA 2KAXA 1JF0A 4ORCB 2DOQA 1TNPA 1IJ5A 2K2FA 1PULA 1SPYA 1DT7B 1NX0A 3PN7B 2GGZA 4NDCA 4FQOA 2PSRA 1YVHA 1EG3A 3I5IB 1J55A 1JC2A 2GV5A 3FWBA 3E3RA 1CFCA 5ER5A 3BOWB 1KK8B 5KSZA 2MLFC 3TDUA 2LP3A 2F3YA 3GOFA 3KPXA 3DF0A 3VRQA 4I5JA 5HLOA 2LE9B 2L50A 1NCYA 3LK0A 2E6WA 1XFYO 1B8RA 2MRDA 1YX8A 4CLNA 1F70A 2LVIA 4ZCVA 1TN4A 2KFGA 1JWDA 4MVFA 1OOJA 2M9GA 3RM1A 1Y6WA 1CFDA 2KI4B 1KK7Z 3GK4X 4I5NB 3D10A 2PRUA 5G08A 2K7CA 1D1OA 2KDHA 1CLMA 2Y1NA 5I8NA 1J7QA 5HKZA 1JUOA 2F2PA 1CM4A 1QLSA 1A75A 4YGDB 1G4YR 1TCOB 3I5HB 1FI6A 1K93D 1NX1A 3BUMB 1K94A 1JBAA 1SMGA 4WQ2A 2I18A 2ZKMX 4AQIA 2CNPA 4YRUA 4QJ3B 1QLKA 2LVVA 2SASA 1TTXA 2BBNA 2NXQA 4DRWA 1ODBA 3AKBA 1LA3A 1SNLA 1QIWA 5D7FA 1TNWA 1RWYA 3CS1A 1R6PA 2OPOA 4GAOA 2M0RA 3OX6A 3VRRA 5K89A 1N65A 3CZTX 1QVIY 1S6IA 2L5XB 1RTP1 1QVIZ 2L4IA 4ORAB 3NXAA 3K21A 5AFPA 1B7TZ 2JT0A 3DVJA 4GUKA 1A03A 5J3XA 2P6BB 3BUXB 2L98A 4PE0A 2ISDA 1QTXA 3KHEA 2HQ8A 1S1EA 1WRKA 2LUCA 1OMVA 4GNKB 4MN0A 2K8MB 3SG7A 2LVKA 3FIAA 1M45A 5I2OA 4YGBB 2KQYA 1S36A 4DIRA 3KF9A 3RLZA 2JRFA 1OQPA 1MXLC 2WOSA 2I94A 3EK4A 1M31A 1L7ZA 2KHNA 1YRTB 5HYDA 5HKWA 1SKTA 1DGVA 3CLNA 1IG5A 1J7PA 1DF0B 1LA0A 3BXKA 1PALA 2ZRTA 1F8HA 4GGFC 1BG1A 2K7BA 4I5KA 1SL7A 1L2OC 1UP5A 2KOTA 1UUSA 1G8IA 3NSOA 1F4QA 3O78A 1IH0A 2PASA 2BKIB 3ICBA 3TDZA 1NCXA 1UHIA 1K2HA 1CKKA 1TOPA 2LC5A 4MBEA 2EGDA 1B1GA 1S3PA 4XJKA 1EH2A 2M29A 3SG4A 2JTZA 2WNDA 3PM8A 3WHTB 1CFPA 2JNXA 1QATA 2CBLA 1CLLA 1KQMB 1DJYA 1IGVA 2H2KA 2QPTA 3CWGA 1QX2A 1FI5A 1X02A 2FCDA 1UHNA 2SCPA 1YURA 2JQ6A 1EJ3A 2K0JA 2KAVA 2KYCA 1S5GZ 3OB2B 1FPWA 1CDPA 1KFUL 2KI6D 4HREE 1XFXO 4GPLB 1QJTA 2ZFDA 1A29A 5DKRA 2FCEA 3NSLA 3IQQA 1XYDA 2CXJA 3TUYC 1B47A 4M2OA 1PRWA 4C0JA 3HX4A 1H8BA 4YGEB 2LMVA 3JTDC 2LLSA 1CDLA 1YVLA 1QV0A 2M3WA 2OTGB 5I2QA 1F55A 4U8DA 1SCVA 3GK1A 3PLFB 1KFUS 1QXPA 3VRNA 5AERA 2G2BA 1IQ3A 1NIWA 1NUBA 3H4SE 4MEWA 1WLMA 5I2LA 4PDZA 1EL4A 4MZJA 4PE7A 3EVVA 1FW4A 2NZ0A 4USLA 1ZFSA 2I2RE 2JXLA 1B9AA 4PHNA 1UURA 1DJHA 3OP0A 1S5GY 1WRLA 1JF2A 1Y1UA 3O4YA 3I5HC 2MBXA 1BMOA 4Q04A 1BOCA 1QX7A 1YR5A 1CTRA 2Y1MA 3FWCA 2BCAA 1K8UA 5IBWA 1CM1A 1UHJA 1KFXS 1RFJA 3BUNB 5AXIA 1CMGA 1AJ5A 2R2IA 4N1GA 2LMTA 1PVAA 1BT6A 3VGOA 2JT3A 3O6BA 5FYXA 3SIAA 2KBIA 2MJWB 2ZN9A 1K96A 1ALVA 3LK1A 2F2OA 2HF5A 2KAYA 2NLNA 3JVTC 4L9MA 1ALWA 1DJGA 2M49B 2CTNA 1L2OB 2AAOA 2Y4QA 1HT9A 5F6TA 4JQ0D 3EK8A 1KSMA 1SR6B 1NSHA 1KQVA 4HRHA 4BY5A 2BE4A 2D8NA 1GGZA 2KSPA 2NCOA 1AJ4A 4MRXA 1NPQA 3O2PA 2TN4A 4NQGA 2BE6A 2QACA 3SIBA 3BUOB 1SYMA 1BODA 4YGCB 1PSBA 1DF0A 2ZRSA 1B4CA 1NYAA 2ZNEA 3BYAA 4D1EA 3CTNA 3VROA 2OS8B 4OVNF 2KGBC 3D0YB 4GBAA 1F4OA 1WDCC 2VRGA 1LXFC 2B1UA 1LINA 1KK7Y 1DTLA 1XK4C 3AAKA 4CFQA 3C1VA 2H61A 1N2DA 3PSRA 4WRIA 4JPZB 3ZNIA 1MWNA 3LL8B 4YI9A 2JULA 4OV2A 2WCFA 2HQWA 3GK2A 5BPJA 3CR4X 3I5IC 4C0LA 1JFJA 1C07A 1SK6D 1GQMA 4XJKB 3BOWA 1IJ6A 1JSAA 1KWOC 2BKHB 4NDDA 2F3ZA 1NCZA 4HSZA 1A75B 2KFFA 2V53A 1CDMA 2L51A 3CR5X 3DD4A 3DF0B 1DJIA 4MRYA 1NX2A 1K9UA 3SG5A 2WCEA 2CCMA 2M97A 3PFVA 1BR1B 4ICBA 2HPSA 1W7IB 3QRXA 1MF8B 2F33A 3CR2A 2JPTA 4PHJA 2MAZA 1TIZA 1KSOA 1YTZC 1YX7A 3DVEA 4GGNA 2LUXA 3AAJA 1J1DA 1OZSA 2LLUA 1XVJA 1WRZA 2M1UA 3JTDB 3SG6A 1WLZA 2OTGC 1J7OA 2M7NA 2EHBA 1S6CA 2WORA 4JWQA 4NDBA 2KQ6A 5D69A 5DKNA 4PCWA 3SG3A 1DVIA 2LAPA 5JJGA 2Y5IA 4ORBB 2FOTA 1SCMC 2JOJA 3EKJA 5JOLA 1AK8A 4TNCA 4PE4A 1DMOA 1J7RA 4PHMA 2KI6C 2FJUB 1LVCD 4FTGA 1KCYA 5CSNA 4AOMA 4DS7A 4MZLA 3WNXB 2F8PA 4YBHB 4ZCUA 1XFZO 5DKQA 4ETOA 1J1EA 1QS7A 1UHHA 1E8AA 2LANA 2LNKA 3BQ3A 4OR9B 1S26D 1YUTA 1Y0VH 2AUCA 4M2PA 4N1FA 4UPGA 3HCMA 4PE1A 2JU0A 4BY4A 2NCPA 1SR6C 1W7JB 1PSRA 1IQ5A 2K2AA 1M39A 2WC8A 3BUWB 2JZIA 4M2QA 2KBMA 1Y1AA 1V1GA 2Q91A 3AKAA 3LLEA 1U5IA 2O60A 3SG2A 1B8LA 4WQ3A 1EG4A 2LLTA 5CSFA 2EC6C 1CDNA 3ZWHA 1XFWO 3WHUB 4A4CA 2K7OA 4PHKA 3PN7C 2AMIA 2HETA 2IS9A 1OE9B 2BCXA 2BL0C 1AUIB 3TS5C 1QV1A 4MLWA 2MLEC 3I5GB 4XYNA 2LCPA 1PVBA 4R1EA 1SY9A 2O5GA 1KFXL 1CMFA 3TDIA 1GGWA 2JXCA 1ZACA 1Q80A 2KYFA 5PALA 1TNXA 1TRFA 2L4HA 1K9PA 2GGMA 1OSAA 2MA2A 1LKJA 2BL0B 1FF1A 3TS5B 3EVUA 3I5GC 1BU3A 1UHKA 4AQJA 2JWWA 1V1FA 2JTTA 2L0PA 2M8UA 1KWOB 3IF7A 1XK4A 1K95A 2H61C 1YUUA 4QJ5B 5HKYA 1PK0D 3TZ1A 1NX3A 1XFUO 3PATA 4A4BA 1CNPA 1XA5A 1WDCB 3DVKA 1SRAA 3NSIA 2ZN8A 2BECA 1IWQA 3CGAA 1FBVA 3NSKA 1JFKA 3IQOA 3I5FC 3VRPA 1AP4A 1KQMC 4YI8A 4P5OE 3M0WA 2E30A 4OCIA 5CSIA 2LHIA 1BJFA 1B7TY 2G9BA 4CIDA 1C7WA 1K9KA 1SBJA 1YRUB 1S6JA 4GFTA 3EK7A 1F54A 1A4PA 2M7LA 1CB1A 1ZMZA 5AANA 3I5FB 2KGRA 1GJYA 2K61A 5CPVA 1A2XA 1BF5A 3TUYB 2CT9A 1SL9A 2MHHA 3SJSA 1M46A 2KI4C 1CFFA 1RROA 1CLBA 1DGUA 2BBMA 3A4UB 2JC2A 3WXAA 2BCBA 1OMRA 4PALA 1RECA 4P2YB 4C0KA 2ZNDA 1OZOA 1RJVA 3OX5A 2PALA 2I7AA 4I5LB 1EXRA 2JNFA 2K7DA 2LHLA 3EVRA 1G33A 2LMUA 1XFVO 3EKHA 4E68A 1F71A 1H4BA 1NWDA 1SL8A 1IRJA 2LVJA 2LV7A 4N5XA 2JT8A 1ZOTB 4F0ZB 1C7VA 1HQVA 1DJXA 1BLQA 3OHMB 5AEQA 3A8RA 4MZKA 2A4JA 3PALA 4QJ4B 3KEVA 1DJZA 1MXEA 1NP8A 2LP2A 2WCBA 3OB1B 4DUQA 2PMYA 4OKHA 1TNQA 5GQQC 1R2UA 1SW8A 1VRKA 1SCMB 1WY9A 1YUSA 4DCKA 1DJWA 4HRGA 3F45A 2EC6B 5ER4X 2Q4UA 4YGAA 1ZUZA 2L2EA 2KNEA 1MQ1A 3DVMA 4CFRA 1B8CA 1XO5A 1MHOA 1Y1XA 5B8IB
chains in the Genus database with same CATH superfamily
4MSPA 3FS7A 3KO0A 3MSEB 2RGIA 1AVSA 1DELA 1M63B 1N0YA 3LCPC 2YGUA 3CZ0A 1AHRA 2M1KB 1K90D 1BR4B 3BFBA 1QASA 1MR8A 1MUXA 1RK9A 2KFHA 2PVBA 1UWOA 3B87A 3JVTB 3QMEA 3R1PA 4IL1A 5TNCA 5KU1A 1U5IB 1TCFA 2BAPA 1QIVA 2OS8C 3D0YA 1QX5B 1IKUA 4GGFA 5CSJA 4CPVA 5KTYA 1KK8C 2LM5A 2COLB 1OMDA 3OGNA 5HLVA 2KAXA 1XFRA 1JF0A 4ORCB 2DOQA 1TNPA 1IJ5A 2K2FA 1PULA 1SPYA 1DT7B 1NX0A 3PN7B 2GGZA 4NDCA 4FQOA 2PSRA 1YVHA 1EG3A 3I5IB 1J55A 1JC2A 2GV5A 3FWBA 3E3RA 1CFCA 5ER5A 3BOWB 1KK8B 5KSZA 2MLFC 2WCJA 3TDUA 2LP3A 1C3ZA 2F3YA 3GOFA 3KPXA 3DF0A 3SS5A 3VRQA 4I5JA 5HLOA 2LE9B 2L50A 1NCYA 3LK0A 2E6WA 1XFYO 1B8RA 2MRDA 1YX8A 4CLNA 1OOIX 2PYQA 2LVIA 4ZCVA 1F70A 1TN4A 2KFGA 1JWDA 4MVFA 1OOJA 2M9GA 3RM1A 1Y6WA 2QEOA 1CFDA 2KI4B 1KK7Z 3GK4X 4I5NB 3D10A 2PRUA 5G08A 2K7CA 1D1OA 2KDHA 1CLMA 2Y1NA 5I8NA 1J7QA 5HKZA 1JUOA 2F2PA 1CM4A 1QLSA 1A75A 2QDIA 5D3OA 4YGDB 3Q8IA 1G4YR 1TCOB 3I5HB 3S0BA 1FI6A 1K93D 1NX1A 1P28A 3BUMB 1K94A 1JBAA 1SMGA 4WQ2A 2I18A 2ZKMX 4AQIA 2CNPA 4YRUA 4QJ3B 1QLKA 2LVVA 2SASA 1TTXA 2BBNA 2NXQA 3S0GA 4DRWA 1ODBA 3AKBA 3VB1A 1LA3A 1SNLA 1QIWA 5D7FA 1TNWA 2H8VA 1RWYA 3CS1A 1R6PA 2OPOA 4GAOA 2M0RA 3OX6A 3VRRA 5K89A 1N65A 3CZTX 1QVIY 1S6IA 2L5XB 1RTP1 4KYNA 1QVIZ 2L4IA 4ORAB 3NXAA 3K21A 5AFPA 1B7TZ 2JT0A 3DVJA 4GUKA 1A03A 5J3XA 2P6BB 3BUXB 2L98A 4PE0A 2ISDA 1GM0A 1QTXA 3KHEA 1WRKA 1S1EA 2HQ8A 2LUCA 3R1VA 3SS3A 1OMVA 4GNKB 4MN0A 2K8MB 3SG7A 2LVKA 3FIAA 1M45A 5I2OA 4YGBB 2KQYA 1S36A 4DIRA 3KF9A 3RLZA 2JRFA 1OQPA 1MXLC 1DC1A 2WOSA 2I94A 1SSEB 3EK4A 1M31A 1L7ZA 2KHNA 1YRTB 5HYDA 5HKWA 1SKTA 1DGVA 3CLNA 2WCMA 1IG5A 1J7PA 1DF0B 1LA0A 3L4LA 3BXKA 1PALA 2ZRTA 3FE8A 1F8HA 4GGFC 1BG1A 2K7BA 4I5KA 1SL7A 1L2OC 1UP5A 2KOTA 4OZDA 1UUSA 1G8IA 3NSOA 1F4QA 3O78A 4F7FA 2PASA 2BKIB 1IH0A 5FI2A 3ICBA 3TDZA 1NCXA 1UHIA 1K2HA 1DEKA 3B7AA 1CKKA 1TOPA 2LC5A 4MBEA 2EGDA 1B1GA 1S3PA 4XJKA 1EH2A 2M29A 3SG4A 2JTZA 2WNDA 3PM8A 3WHTB 1CFPA 2JNXA 1QATA 2CBLA 1CLLA 1KQMB 1DJYA 1IGVA 2H2KA 2QPTA 3CWGA 1QX2A 2WCKA 1FI5A 1X02A 2FCDA 1UHNA 2SCPA 1YURA 2JQ6A 1EJ3A 2K0JA 2KAVA 2KYCA 1S5GZ 3OB2B 1FPWA 1CDPA 1KFUL 2KI6D 4HREE 1XFXO 3K1EA 4PT1A 4GPLB 1QJTA 2ZFDA 1A29A 5DKRA 2FCEA 3UNWA 3NSLA 3IQQA 3R72A 1XYDA 2CXJA 2K60A 3TUYC 1B47A 4M2OA 1PRWA 4C0JA 3HX4A 1H8BA 4YGEB 1W9ZA 3R1OA 2LMVA 3JTDC 2LLSA 1CDLA 1YVLA 1QV0A 2M3WA 2OTGB 5I2QA 1F55A 4U8DA 1QWVA 1SCVA 3GK1A 3DYEA 3PLFB 3RZSA 1KFUS 1QXPA 3VRNA 5AERA 2G2BA 1IQ3A 1NIWA 1NUBA 3H4SE 4MEWA 1WLMA 5I2LA 4PDZA 1EL4A 4MZJA 4PE7A 3EVVA 1FW4A 2NZ0A 4USLA 3L47A 1C3YA 1ZFSA 2I2RE 2JXLA 1B9AA 3D76A 1UURA 1DJHA 3OP0A 4PHNA 1S5GY 1WRLA 1JF2A 1Y1UA 3O4YA 3I5HC 2MBXA 1BMOA 3NHIA 4Q04A 3S0DA 1BOCA 1QX7A 1YR5A 1CTRA 2Y1MA 3FWCA 2BCAA 1K8UA 3S0EA 1CM1A 5IBWA 1UHJA 5FI7A 1KFXS 1RFJA 3BUNB 3FE9A 5AXIA 1CMGA 1AJ5A 3NGVA 2R2IA 3FE6A 4N1GA 2LMTA 1PVAA 1BT6A 3VGOA 2JT3A 3O6BA 3PM2A 5FYXA 3SIAA 3BFAA 3CDNA 2KBIA 2MJWB 2ZN9A 1K96A 1ALVA 3LK1A 2F2OA 2HF5A 3NHTA 2KAYA 2NLNA 3D77A 3JVTC 4L9MA 1ALWA 1DJGA 1Z4HA 2M49B 2CTNA 4DUQA 4INXA 1L2OB 2AAOA 2Y4QA 1HT9A 5F6TA 4JQ0D 3EK8A 1KSMA 1SR6B 1NSHA 3CZ2A 4HRHA 1KQVA 4BY5A 2BE4A 2D8NA 1GGZA 2KSPA 2NCOA 1AJ4A 1TUJA 4MRXA 1NPQA 3O2PA 2TN4A 4NQGA 1DQEA 3IVTA 2BE6A 2QACA 3SIBA 3BUOB 1SYMA 3V2LA 1BODA 4YGCB 2JPOA 1PSBA 1DF0A 2ZRSA 1B4CA 1NYAA 2ZNEA 3BYAA 4D1EA 3CTNA 3VROA 2OS8B 4OVNF 2KGBC 3D0YB 4GBAA 1F4OA 1WDCC 2VRGA 4JKTA 1LXFC 2B1UA 1LINA 1KK7Y 1DTLA 1IIOA 1XK4C 3AAKA 4CFQA 3C1VA 3B88A 2H61A 1N2DA 3PSRA 4WRIA 4JPZB 3ZNIA 1MWNA 3LL8B 4YI9A 2JULA 4OV2A 2WCFA 2HQWA 3GK2A 5BPJA 3CR4X 3I5IC 3D78A 4C0LA 1JFJA 1C07A 1SK6D 1GQMA 3DZTA 4XJKB 1T14A 3BOWA 1IJ6A 3DY9A 1KWOC 1JSAA 2BKHB 4NDDA 2F3ZA 1NCZA 4HSZA 1A75B 5I94A 2KFFA 2V53A 1CDMA 2L51A 3CR5X 3DD4A 3DF0B 3O4XA 1DJIA 4MRYA 1NX2A 1K9UA 3SG5A 2WCEA 3S0AA 2CCMA 2M97A 3PFVA 1BR1B 4ICBA 3D74A 2HPSA 1W7IB 3QRXA 3L4AA 2WC6A 1MF8B 2F33A 3CR2A 2KLDA 2JPTA 4PHJA 2MAZA 1TIZA 1KSOA 1LS8A 1YTZC 1YX7A 3DVEA 2P71A 4GGNA 3B6XA 3BJHA 2LUXA 3AAJA 1J1DA 1OZSA 2LLUA 1XVJA 1WRZA 2M1UA 3JTDB 3PJIA 1WLZA 3SG6A 2OTGC 1J7OA 2M7NA 2EHBA 1S6CA 2WORA 4JWQA 4NDBA 2KQ6A 5D69A 5DKNA 4PCWA 3SG3A 1DVIA 2LAPA 5JJGA 2Y5IA 4ORBB 2FOTA 1SCMC 2JOJA 3EKJA 5JOLA 1AK8A 4TNCA 4PE4A 1DMOA 1J7RA 4PHMA 2KPHA 2KI6C 2FJUB 1LVCD 2GTEA 4FTGA 1KCYA 5CSNA 5EL2A 4AOMA 4DS7A 4MZLA 3WNXB 2F8PA 4YBHB 4ZCUA 2BNXA 1XFZO 5DKQA 3CYZA 4ETOA 1J1EA 1QS7A 1UHHA 1E8AA 2LANA 2LNKA 3BQ3A 4OR9B 1S26D 1YUTA 1Y0VH 2AUCA 4M2PA 2QEBA 4N1FA 4UPGA 3HCMA 2QEVA 4PE1A 2JU0A 3DXLA 4BY4A 2NCPA 1SR6C 1W7JB 1PSRA 1IQ5A 2K2AA 4INWA 1M39A 2WC8A 3BUWB 2JZIA 4M2QA 2KBMA 1Y1AA 1V1GA 2Q91A 3AKAA 3LLEA 2WC5A 1U5IA 3CABA 2O60A 3SG2A 1B8LA 4WQ3A 1EG4A 2LLTA 2KLEA 5CSFA 2EC6C 1CDNA 3ZWHA 1XFWO 3WHUB 4A4CA 2K7OA 5FI6A 4PHKA 3PN7C 2AMIA 2HETA 1Z2CB 2IS9A 1OE9B 1OOHA 2BCXA 2BL0C 1AUIB 3TS5C 3S0FA 1QV1A 4MLWA 2MLEC 3I5GB 4XYNA 1TUZA 2LCPA 1PVBA 3B86A 4R1EA 1SY9A 2O5GA 1KFXL 1CMFA 3TDIA 1OW4A 1GGWA 2JXCA 1ZACA 3OBVA 4IJ7A 1Q80A 2KYFA 3D75A 1TNXA 1TRFA 5PALA 2L4HA 1K9PA 2GGMA 1OSAA 2MA2A 1LKJA 2BL0B 1FF1A 3TS5B 3SS4A 3EVUA 3I5GC 1BU3A 1UHKA 4AQJA 2JWWA 1V1FA 5HL1A 2JTTA 2L0PA 2L5YA 2M8UA 1KWOB 3IF7A 1XK4A 1K95A 2H61C 1YUUA 4QJ5B 5HKYA 1PK0D 3TZ1A 2ERBA 1NX3A 1OOFA 1XFUO 3PATA 4A4BA 1CNPA 1XA5A 1WDCB 3DVKA 1SRAA 3NSIA 2ZN8A 2BECA 1IWQA 3CGAA 1FBVA 3NSKA 1JFKA 3IQOA 3I5FC 3VRPA 1AP4A 1KQMC 3CZ1A 4YI8A 4P5OE 3M0WA 2E30A 4OCIA 5CSIA 2LHIA 1BJFA 1B7TY 2G9BA 4CIDA 2PQLA 1C7WA 1K9KA 1SBJA 1YRUB 2QEHA 1S6JA 2L2CA 4GFTA 4JD9A 3EK7A 1F54A 5DICA 1A4PA 2M7LA 1CB1A 1ZMZA 5AANA 3I5FB 2KGRA 1GJYA 2K61A 5CPVA 1A2XA 1BF5A 3TUYB 2CT9A 1SL9A 2MHHA 3SJSA 1M46A 2KI4C 2P70A 1RROA 1CFFA 1CLBA 1DGUA 2BBMA 3A4UB 2JC2A 3WXAA 2BCBA 1OMRA 4PALA 1RECA 4P2YB 4C0KA 2ZNDA 1OZOA 1RJVA 3OX5A 2PALA 4FQTA 2I7AA 4I5LB 3UO9A 1EXRA 2JNFA 2K7DA 2LHLA 3EVRA 1G33A 2LMUA 1XFVO 3EKHA 4E68A 1F71A 1ORGA 1H4BA 1NWDA 1SL8A 1IRJA 2LVJA 2LV7A 4N5XA 2JT8A 1ZOTB 4F0ZB 1C7VA 1HQVA 1DJXA 1BLQA 3OHMB 5AEQA 3A8RA 4MZKA 2A4JA 3PALA 4QJ4B 3KEVA 1DJZA 1MXEA 1NP8A 2LP2A 1TWOA 2WCBA 3OB1B 2PMYA 1OOGA 4OKHA 1TNQA 5GQQC 1R2UA 1SW8A 1VRKA 1SCMB 1WY9A 1YUSA 2WCHA 1DJWA 4DCKA 4HRGA 2WCLA 3F45A 3N7HA 2EC6B 3D73A 5ER4X 2Q4UA 4YGAA 1ZUZA 2FJYA 2KNEA 1MQ1A 2L2EA 3DVMA 4CFRA 3EG5B 1B8CA 3BFHA 1XO5A 1MHOA 1Y1XA 5B8IB
chains in the Genus database with same CATH topology
4MSPA 3FS7A 3KO0A 3MSEB 2RGIA 1AVSA 1M63B 1N0YA 3LCPC 1AHRA 2M1KB 1K90D 1BR4B 1QASA 1MR8A 1MUXA 1RK9A 2KFHA 2PVBA 1UWOA 3JVTB 5KU1A 4IL1A 5TNCA 1U5IB 1TCFA 2OS8C 1QIVA 3D0YA 1IKUA 1QX5B 4GGFA 5CSJA 4CPVA 5KTYA 1KK8C 2LM5A 2COLB 1OMDA 5HLVA 2KAXA 1JF0A 4ORCB 2DOQA 1TNPA 1IJ5A 2K2FA 1PULA 1SPYA 1DT7B 1NX0A 3PN7B 2GGZA 4NDCA 4FQOA 2PSRA 1YVHA 1EG3A 3I5IB 1J55A 1JC2A 2GV5A 3FWBA 3E3RA 1CFCA 5ER5A 3BOWB 1KK8B 5KSZA 2MLFC 3TDUA 2LP3A 2F3YA 3GOFA 3KPXA 3DF0A 3VRQA 4I5JA 5HLOA 2LE9B 2L50A 1NCYA 3LK0A 2E6WA 1XFYO 1B8RA 2MRDA 1YX8A 4CLNA 1F70A 2LVIA 4ZCVA 1TN4A 2KFGA 1JWDA 4MVFA 1OOJA 2M9GA 3RM1A 1Y6WA 1CFDA 2KI4B 1KK7Z 3GK4X 4I5NB 3D10A 2PRUA 5G08A 2K7CA 1D1OA 2KDHA 1CLMA 2Y1NA 5I8NA 1J7QA 5HKZA 1JUOA 2F2PA 1CM4A 1QLSA 1A75A 4YGDB 1G4YR 1TCOB 3I5HB 1FI6A 1K93D 1NX1A 3BUMB 1K94A 1JBAA 1SMGA 4WQ2A 2I18A 2ZKMX 4AQIA 2CNPA 4YRUA 4QJ3B 1QLKA 2LVVA 2SASA 1TTXA 2BBNA 2NXQA 4DRWA 1ODBA 3AKBA 1LA3A 1SNLA 1QIWA 5D7FA 1TNWA 1RWYA 3CS1A 1R6PA 2OPOA 4GAOA 2M0RA 3OX6A 3VRRA 5K89A 1N65A 3CZTX 1QVIY 1S6IA 2L5XB 1RTP1 1QVIZ 2L4IA 4ORAB 3NXAA 3K21A 5AFPA 1B7TZ 2JT0A 3DVJA 4GUKA 1A03A 5J3XA 2P6BB 3BUXB 2L98A 4PE0A 2ISDA 1QTXA 3KHEA 2HQ8A 1S1EA 1WRKA 2LUCA 1OMVA 4GNKB 4MN0A 2K8MB 3SG7A 2LVKA 3FIAA 1M45A 5I2OA 4YGBB 2KQYA 1S36A 4DIRA 3KF9A 3RLZA 2JRFA 1OQPA 1MXLC 2WOSA 2I94A 3EK4A 1M31A 1L7ZA 2KHNA 1YRTB 5HYDA 5HKWA 1SKTA 1DGVA 3CLNA 1IG5A 1J7PA 1DF0B 1LA0A 3BXKA 1PALA 2ZRTA 1F8HA 4GGFC 1BG1A 2K7BA 4I5KA 1SL7A 1L2OC 1UP5A 2KOTA 1UUSA 1G8IA 3NSOA 1F4QA 3O78A 1IH0A 2PASA 2BKIB 3ICBA 3TDZA 1NCXA 1UHIA 1K2HA 1CKKA 1TOPA 2LC5A 4MBEA 2EGDA 1B1GA 1S3PA 4XJKA 1EH2A 2M29A 3SG4A 2JTZA 2WNDA 3PM8A 3WHTB 1CFPA 2JNXA 1QATA 2CBLA 1CLLA 1KQMB 1DJYA 1IGVA 2H2KA 2QPTA 3CWGA 1QX2A 1FI5A 1X02A 2FCDA 1UHNA 2SCPA 1YURA 2JQ6A 1EJ3A 2K0JA 2KAVA 2KYCA 1S5GZ 3OB2B 1FPWA 1CDPA 1KFUL 2KI6D 4HREE 1XFXO 4GPLB 1QJTA 2ZFDA 1A29A 5DKRA 2FCEA 3NSLA 3IQQA 1XYDA 2CXJA 3TUYC 1B47A 4M2OA 1PRWA 4C0JA 3HX4A 1H8BA 4YGEB 2LMVA 3JTDC 2LLSA 1CDLA 1YVLA 1QV0A 2M3WA 2OTGB 5I2QA 1F55A 4U8DA 1SCVA 3GK1A 3PLFB 1KFUS 1QXPA 3VRNA 5AERA 2G2BA 1IQ3A 1NIWA 1NUBA 3H4SE 4MEWA 1WLMA 5I2LA 4PDZA 1EL4A 4MZJA 4PE7A 3EVVA 1FW4A 2NZ0A 4USLA 1ZFSA 2I2RE 2JXLA 1B9AA 4PHNA 1UURA 1DJHA 3OP0A 1S5GY 1WRLA 1JF2A 1Y1UA 3O4YA 3I5HC 2MBXA 1BMOA 4Q04A 1BOCA 1QX7A 1YR5A 1CTRA 2Y1MA 3FWCA 2BCAA 1K8UA 5IBWA 1CM1A 1UHJA 1KFXS 1RFJA 3BUNB 5AXIA 1CMGA 1AJ5A 2R2IA 4N1GA 2LMTA 1PVAA 1BT6A 3VGOA 2JT3A 3O6BA 5FYXA 3SIAA 2KBIA 2MJWB 2ZN9A 1K96A 1ALVA 3LK1A 2F2OA 2HF5A 2KAYA 2NLNA 3JVTC 4L9MA 1ALWA 1DJGA 2M49B 2CTNA 1L2OB 2AAOA 2Y4QA 1HT9A 5F6TA 4JQ0D 3EK8A 1KSMA 1SR6B 1NSHA 1KQVA 4HRHA 4BY5A 2BE4A 2D8NA 1GGZA 2KSPA 2NCOA 1AJ4A 4MRXA 1NPQA 3O2PA 2TN4A 4NQGA 2BE6A 2QACA 3SIBA 3BUOB 1SYMA 1BODA 4YGCB 1PSBA 1DF0A 2ZRSA 1B4CA 1NYAA 2ZNEA 3BYAA 4D1EA 3CTNA 3VROA 2OS8B 4OVNF 2KGBC 3D0YB 4GBAA 1F4OA 1WDCC 2VRGA 1LXFC 2B1UA 1LINA 1KK7Y 1DTLA 1XK4C 3AAKA 4CFQA 3C1VA 2H61A 1N2DA 3PSRA 4WRIA 4JPZB 3ZNIA 1MWNA 3LL8B 4YI9A 2JULA 4OV2A 2WCFA 2HQWA 3GK2A 5BPJA 3CR4X 3I5IC 4C0LA 1JFJA 1C07A 1SK6D 1GQMA 4XJKB 3BOWA 1IJ6A 1JSAA 1KWOC 2BKHB 4NDDA 2F3ZA 1NCZA 4HSZA 1A75B 2KFFA 2V53A 1CDMA 2L51A 3CR5X 3DD4A 3DF0B 1DJIA 4MRYA 1NX2A 1K9UA 3SG5A 2WCEA 2CCMA 2M97A 3PFVA 1BR1B 4ICBA 2HPSA 1W7IB 3QRXA 1MF8B 2F33A 3CR2A 2JPTA 4PHJA 2MAZA 1TIZA 1KSOA 1YTZC 1YX7A 3DVEA 4GGNA 2LUXA 3AAJA 1J1DA 1OZSA 2LLUA 1XVJA 1WRZA 2M1UA 3JTDB 3SG6A 1WLZA 2OTGC 1J7OA 2M7NA 2EHBA 1S6CA 2WORA 4JWQA 4NDBA 2KQ6A 5D69A 5DKNA 4PCWA 3SG3A 1DVIA 2LAPA 5JJGA 2Y5IA 4ORBB 2FOTA 1SCMC 2JOJA 3EKJA 5JOLA 1AK8A 4TNCA 4PE4A 1DMOA 1J7RA 4PHMA 2KI6C 2FJUB 1LVCD 4FTGA 1KCYA 5CSNA 4AOMA 4DS7A 4MZLA 3WNXB 2F8PA 4YBHB 4ZCUA 1XFZO 5DKQA 4ETOA 1J1EA 1QS7A 1UHHA 1E8AA 2LANA 2LNKA 3BQ3A 4OR9B 1S26D 1YUTA 1Y0VH 2AUCA 4M2PA 4N1FA 4UPGA 3HCMA 4PE1A 2JU0A 4BY4A 2NCPA 1SR6C 1W7JB 1PSRA 1IQ5A 2K2AA 1M39A 2WC8A 3BUWB 2JZIA 4M2QA 2KBMA 1Y1AA 1V1GA 2Q91A 3AKAA 3LLEA 1U5IA 2O60A 3SG2A 1B8LA 4WQ3A 1EG4A 2LLTA 5CSFA 2EC6C 1CDNA 3ZWHA 1XFWO 3WHUB 4A4CA 2K7OA 4PHKA 3PN7C 2AMIA 2HETA 2IS9A 1OE9B 2BCXA 2BL0C 1AUIB 3TS5C 1QV1A 4MLWA 2MLEC 3I5GB 4XYNA 2LCPA 1PVBA 4R1EA 1SY9A 2O5GA 1KFXL 1CMFA 3TDIA 1GGWA 2JXCA 1ZACA 1Q80A 2KYFA 5PALA 1TNXA 1TRFA 2L4HA 1K9PA 2GGMA 1OSAA 2MA2A 1LKJA 2BL0B 1FF1A 3TS5B 3EVUA 3I5GC 1BU3A 1UHKA 4AQJA 2JWWA 1V1FA 2JTTA 2L0PA 2M8UA 1KWOB 3IF7A 1XK4A 1K95A 2H61C 1YUUA 4QJ5B 5HKYA 1PK0D 3TZ1A 1NX3A 1XFUO 3PATA 4A4BA 1CNPA 1XA5A 1WDCB 3DVKA 1SRAA 3NSIA 2ZN8A 2BECA 1IWQA 3CGAA 1FBVA 3NSKA 1JFKA 3IQOA 3I5FC 3VRPA 1AP4A 1KQMC 4YI8A 4P5OE 3M0WA 2E30A 4OCIA 5CSIA 2LHIA 1BJFA 1B7TY 2G9BA 4CIDA 1C7WA 1K9KA 1SBJA 1YRUB 1S6JA 4GFTA 3EK7A 1F54A 1A4PA 2M7LA 1CB1A 1ZMZA 5AANA 3I5FB 2KGRA 1GJYA 2K61A 5CPVA 1A2XA 1BF5A 3TUYB 2CT9A 1SL9A 2MHHA 3SJSA 1M46A 2KI4C 1CFFA 1RROA 1CLBA 1DGUA 2BBMA 3A4UB 2JC2A 3WXAA 2BCBA 1OMRA 4PALA 1RECA 4P2YB 4C0KA 2ZNDA 1OZOA 1RJVA 3OX5A 2PALA 2I7AA 4I5LB 1EXRA 2JNFA 2K7DA 2LHLA 3EVRA 1G33A 2LMUA 1XFVO 3EKHA 4E68A 1F71A 1H4BA 1NWDA 1SL8A 1IRJA 2LVJA 2LV7A 4N5XA 2JT8A 1ZOTB 4F0ZB 1C7VA 1HQVA 1DJXA 1BLQA 3OHMB 5AEQA 3A8RA 4MZKA 2A4JA 3PALA 4QJ4B 3KEVA 1DJZA 1MXEA 1NP8A 2LP2A 2WCBA 3OB1B 4DUQA 2PMYA 4OKHA 1TNQA 5GQQC 1R2UA 1SW8A 1VRKA 1SCMB 1WY9A 1YUSA 4DCKA 1DJWA 4HRGA 3F45A 2EC6B 5ER4X 2Q4UA 4YGAA 1ZUZA 2L2EA 2KNEA 1MQ1A 3DVMA 4CFRA 1B8CA 1XO5A 1MHOA 1Y1XA 5B8IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSP A;  3FS7 A;  3KO0 A;  3MSE B;  2RGI A;  1AVS A;  1M63 B;  1N0Y A;  3LCP C;  1AHR A;  2M1K B;  1K90 D;  1BR4 B;  1QAS A;  1MR8 A;  1MUX A;  1RK9 A;  2KFH A;  2PVB A;  1UWO A;  3JVT B;  5KU1 A;  4IL1 A;  5TNC A;  1U5I B;  1TCF A;  2OS8 C;  1QIV A;  3D0Y A;  1IKU A;  1QX5 B;  4GGF A;  5CSJ A;  4CPV A;  5KTY A;  1KK8 C;  2LM5 A;  2COL B;  1OMD A;  5HLV A;  2KAX A;  1JF0 A;  4ORC B;  2DOQ A;  1TNP A;  1IJ5 A;  2K2F A;  1PUL A;  1SPY A;  1DT7 B;  1NX0 A;  3PN7 B;  2GGZ A;  4NDC A;  4FQO A;  2PSR A;  1YVH A;  1EG3 A;  3I5I B;  1J55 A;  1JC2 A;  2GV5 A;  3FWB A;  3E3R A;  1CFC A;  5ER5 A;  3BOW B;  1KK8 B;  5KSZ A;  2MLF C;  3TDU A;  2LP3 A;  2F3Y A;  3GOF A;  3KPX A;  3DF0 A;  3VRQ A;  4I5J A;  5HLO A;  2LE9 B;  2L50 A;  1NCY A;  3LK0 A;  2E6W A;  1XFY O;  1B8R A;  2MRD A;  1YX8 A;  4CLN A;  1F70 A;  2LVI A;  4ZCV A;  1TN4 A;  2KFG A;  1JWD A;  4MVF A;  1OOJ A;  2M9G A;  3RM1 A;  1Y6W A;  1CFD A;  2KI4 B;  1KK7 Z;  3GK4 X;  4I5N B;  3D10 A;  2PRU A;  5G08 A;  2K7C A;  1D1O A;  2KDH A;  1CLM A;  2Y1N A;  5I8N A;  1J7Q A;  5HKZ A;  1JUO A;  2F2P A;  1CM4 A;  1QLS A;  1A75 A;  4YGD B;  1G4Y R;  1TCO B;  3I5H B;  1FI6 A;  1K93 D;  1NX1 A;  3BUM B;  1K94 A;  1JBA A;  1SMG A;  4WQ2 A;  2I18 A;  2ZKM X;  4AQI A;  2CNP A;  4YRU A;  4QJ3 B;  1QLK A;  2LVV A;  2SAS A;  1TTX A;  2BBN A;  2NXQ A;  4DRW A;  1ODB A;  3AKB A;  1LA3 A;  1SNL A;  1QIW A;  5D7F A;  1TNW A;  1RWY A;  3CS1 A;  1R6P A;  2OPO A;  4GAO A;  2M0R A;  3OX6 A;  3VRR A;  5K89 A;  1N65 A;  3CZT X;  1QVI Y;  1S6I A;  2L5X B;  1RTP 1;  1QVI Z;  2L4I A;  4ORA B;  3NXA A;  3K21 A;  5AFP A;  1B7T Z;  2JT0 A;  3DVJ A;  4GUK A;  1A03 A;  5J3X A;  2P6B B;  3BUX B;  2L98 A;  4PE0 A;  2ISD A;  1QTX A;  3KHE A;  2HQ8 A;  1S1E A;  1WRK A;  2LUC A;  1OMV A;  4GNK B;  4MN0 A;  2K8M B;  3SG7 A;  2LVK A;  3FIA A;  1M45 A;  5I2O A;  4YGB B;  2KQY A;  1S36 A;  4DIR A;  3KF9 A;  3RLZ A;  2JRF A;  1OQP A;  1MXL C;  2WOS A;  2I94 A;  3EK4 A;  1M31 A;  1L7Z A;  2KHN A;  1YRT B;  5HYD A;  5HKW A;  1SKT A;  1DGV A;  3CLN A;  1IG5 A;  1J7P A;  1DF0 B;  1LA0 A;  3BXK A;  1PAL A;  2ZRT A;  1F8H A;  4GGF C;  1BG1 A;  2K7B A;  4I5K A;  1SL7 A;  1L2O C;  1UP5 A;  2KOT A;  1UUS A;  1G8I A;  3NSO A;  1F4Q A;  3O78 A;  1IH0 A;  2PAS A;  2BKI B;  3ICB A;  3TDZ A;  1NCX A;  1UHI A;  1K2H A;  1CKK A;  1TOP A;  2LC5 A;  4MBE A;  2EGD A;  1B1G A;  1S3P A;  4XJK A;  1EH2 A;  2M29 A;  3SG4 A;  2JTZ A;  2WND A;  3PM8 A;  3WHT B;  1CFP A;  2JNX A;  1QAT A;  2CBL A;  1CLL A;  1KQM B;  1DJY A;  1IGV A;  2H2K A;  2QPT A;  3CWG A;  1QX2 A;  1FI5 A;  1X02 A;  2FCD A;  1UHN A;  2SCP A;  1YUR A;  2JQ6 A;  1EJ3 A;  2K0J A;  2KAV A;  2KYC A;  1S5G Z;  3OB2 B;  1FPW A;  1CDP A;  1KFU L;  2KI6 D;  4HRE E;  1XFX O;  4GPL B;  1QJT A;  2ZFD A;  1A29 A;  5DKR A;  2FCE A;  3NSL A;  3IQQ A;  1XYD A;  2CXJ A;  3TUY C;  1B47 A;  4M2O A;  1PRW A;  4C0J A;  3HX4 A;  1H8B A;  4YGE B;  2LMV A;  3JTD C;  2LLS A;  1CDL A;  1YVL A;  1QV0 A;  2M3W A;  2OTG B;  5I2Q A;  1F55 A;  4U8D A;  1SCV A;  3GK1 A;  3PLF B;  1KFU S;  1QXP A;  3VRN A;  5AER A;  2G2B A;  1IQ3 A;  1NIW A;  1NUB A;  3H4S E;  4MEW A;  1WLM A;  5I2L A;  4PDZ A;  1EL4 A;  4MZJ A;  4PE7 A;  3EVV A;  1FW4 A;  2NZ0 A;  4USL A;  1ZFS A;  2I2R E;  2JXL A;  1B9A A;  4PHN A;  1UUR A;  1DJH A;  3OP0 A;  1S5G Y;  1WRL A;  1JF2 A;  1Y1U A;  3O4Y A;  3I5H C;  2MBX A;  1BMO A;  4Q04 A;  1BOC A;  1QX7 A;  1YR5 A;  1CTR A;  2Y1M A;  3FWC A;  2BCA A;  1K8U A;  5IBW A;  1CM1 A;  1UHJ A;  1KFX S;  1RFJ A;  3BUN B;  5AXI A;  1CMG A;  1AJ5 A;  2R2I A;  4N1G A;  2LMT A;  1PVA A;  1BT6 A;  3VGO A;  2JT3 A;  3O6B A;  5FYX A;  3SIA A;  2KBI A;  2MJW B;  2ZN9 A;  1K96 A;  1ALV A;  3LK1 A;  2F2O A;  2HF5 A;  2KAY A;  2NLN A;  3JVT C;  4L9M A;  1ALW A;  1DJG A;  2M49 B;  2CTN A;  1L2O B;  2AAO A;  2Y4Q A;  1HT9 A;  5F6T A;  4JQ0 D;  3EK8 A;  1KSM A;  1SR6 B;  1NSH A;  1KQV A;  4HRH A;  4BY5 A;  2BE4 A;  2D8N A;  1GGZ A;  2KSP A;  2NCO A;  1AJ4 A;  4MRX A;  1NPQ A;  3O2P A;  2TN4 A;  4NQG A;  2BE6 A;  2QAC A;  3SIB A;  3BUO B;  1SYM A;  1BOD A;  4YGC B;  1PSB A;  1DF0 A;  2ZRS A;  1B4C A;  1NYA A;  2ZNE A;  3BYA A;  4D1E A;  3CTN A;  3VRO A;  2OS8 B;  4OVN F;  2KGB C;  3D0Y B;  4GBA A;  1F4O A;  1WDC C;  2VRG A;  1LXF C;  2B1U A;  1LIN A;  1KK7 Y;  1DTL A;  1XK4 C;  3AAK A;  4CFQ A;  3C1V A;  2H61 A;  1N2D A;  3PSR A;  4WRI A;  4JPZ B;  3ZNI A;  1MWN A;  3LL8 B;  4YI9 A;  2JUL A;  4OV2 A;  2WCF A;  2HQW A;  3GK2 A;  5BPJ A;  3CR4 X;  3I5I C;  4C0L A;  1JFJ A;  1C07 A;  1SK6 D;  1GQM A;  4XJK B;  3BOW A;  1IJ6 A;  1JSA A;  1KWO C;  2BKH B;  4NDD A;  2F3Z A;  1NCZ A;  4HSZ A;  1A75 B;  2KFF A;  2V53 A;  1CDM A;  2L51 A;  3CR5 X;  3DD4 A;  3DF0 B;  1DJI A;  4MRY A;  1NX2 A;  1K9U A;  3SG5 A;  2WCE A;  2CCM A;  2M97 A;  3PFV A;  1BR1 B;  4ICB A;  2HPS A;  1W7I B;  3QRX A;  1MF8 B;  2F33 A;  3CR2 A;  2JPT A;  4PHJ A;  2MAZ A;  1TIZ A;  1KSO A;  1YTZ C;  1YX7 A;  3DVE A;  4GGN A;  2LUX A;  3AAJ A;  1J1D A;  1OZS A;  2LLU A;  1XVJ A;  1WRZ A;  2M1U A;  3JTD B;  3SG6 A;  1WLZ A;  2OTG C;  1J7O A;  2M7N A;  2EHB A;  1S6C A;  2WOR A;  4JWQ A;  4NDB A;  2KQ6 A;  5D69 A;  5DKN A;  4PCW A;  3SG3 A;  1DVI A;  2LAP A;  5JJG A;  2Y5I A;  4ORB B;  2FOT A;  1SCM C;  2JOJ A;  3EKJ A;  5JOL A;  1AK8 A;  4TNC A;  4PE4 A;  1DMO A;  1J7R A;  4PHM A;  2KI6 C;  2FJU B;  1LVC D;  4FTG A;  1KCY A;  5CSN A;  4AOM A;  4DS7 A;  4MZL A;  3WNX B;  2F8P A;  4YBH B;  4ZCU A;  1XFZ O;  5DKQ A;  4ETO A;  1J1E A;  1QS7 A;  1UHH A;  1E8A A;  2LAN A;  2LNK A;  3BQ3 A;  4OR9 B;  1S26 D;  1YUT A;  1Y0V H;  2AUC A;  4M2P A;  4N1F A;  4UPG A;  3HCM A;  4PE1 A;  2JU0 A;  4BY4 A;  2NCP A;  1SR6 C;  1W7J B;  1PSR A;  1IQ5 A;  2K2A A;  1M39 A;  2WC8 A;  3BUW B;  2JZI A;  4M2Q A;  2KBM A;  1Y1A A;  1V1G A;  2Q91 A;  3AKA A;  3LLE A;  1U5I A;  2O60 A;  3SG2 A;  1B8L A;  4WQ3 A;  1EG4 A;  2LLT A;  5CSF A;  2EC6 C;  1CDN A;  3ZWH A;  1XFW O;  3WHU B;  4A4C A;  2K7O A;  4PHK A;  3PN7 C;  2AMI A;  2HET A;  2IS9 A;  1OE9 B;  2BCX A;  2BL0 C;  1AUI B;  3TS5 C;  1QV1 A;  4MLW A;  2MLE C;  3I5G B;  4XYN A;  2LCP A;  1PVB A;  4R1E A;  1SY9 A;  2O5G A;  1KFX L;  1CMF A;  3TDI A;  1GGW A;  2JXC A;  1ZAC A;  1Q80 A;  2KYF A;  5PAL A;  1TNX A;  1TRF A;  2L4H A;  1K9P A;  2GGM A;  1OSA A;  2MA2 A;  1LKJ A;  2BL0 B;  1FF1 A;  3TS5 B;  3EVU A;  3I5G C;  1BU3 A;  1UHK A;  4AQJ A;  2JWW A;  1V1F A;  2JTT A;  2L0P A;  2M8U A;  1KWO B;  3IF7 A;  1XK4 A;  1K95 A;  2H61 C;  1YUU A;  4QJ5 B;  5HKY A;  1PK0 D;  3TZ1 A;  1NX3 A;  1XFU O;  3PAT A;  4A4B A;  1CNP A;  1XA5 A;  1WDC B;  3DVK A;  1SRA A;  3NSI A;  2ZN8 A;  2BEC A;  1IWQ A;  3CGA A;  1FBV A;  3NSK A;  1JFK A;  3IQO A;  3I5F C;  3VRP A;  1AP4 A;  1KQM C;  4YI8 A;  4P5O E;  3M0W A;  2E30 A;  4OCI A;  5CSI A;  2LHI A;  1BJF A;  1B7T Y;  2G9B A;  4CID A;  1C7W A;  1K9K A;  1SBJ A;  1YRU B;  1S6J A;  4GFT A;  3EK7 A;  1F54 A;  1A4P A;  2M7L A;  1CB1 A;  1ZMZ A;  5AAN A;  3I5F B;  2KGR A;  1GJY A;  2K61 A;  5CPV A;  1A2X A;  1BF5 A;  3TUY B;  2CT9 A;  1SL9 A;  2MHH A;  3SJS A;  1M46 A;  2KI4 C;  1CFF A;  1RRO A;  1CLB A;  1DGU A;  2BBM A;  3A4U B;  2JC2 A;  3WXA A;  2BCB A;  1OMR A;  4PAL A;  1REC A;  4P2Y B;  4C0K A;  2ZND A;  1OZO A;  1RJV A;  3OX5 A;  2PAL A;  2I7A A;  4I5L B;  1EXR A;  2JNF A;  2K7D A;  2LHL A;  3EVR A;  1G33 A;  2LMU A;  1XFV O;  3EKH A;  4E68 A;  1F71 A;  1H4B A;  1NWD A;  1SL8 A;  1IRJ A;  2LVJ A;  2LV7 A;  4N5X A;  2JT8 A;  1ZOT B;  4F0Z B;  1C7V A;  1HQV A;  1DJX A;  1BLQ A;  3OHM B;  5AEQ A;  3A8R A;  4MZK A;  2A4J A;  3PAL A;  4QJ4 B;  3KEV A;  1DJZ A;  1MXE A;  1NP8 A;  2LP2 A;  2WCB A;  3OB1 B;  4DUQ A;  2PMY A;  4OKH A;  1TNQ A;  5GQQ C;  1R2U A;  1SW8 A;  1VRK A;  1SCM B;  1WY9 A;  1YUS A;  4DCK A;  1DJW A;  4HRG A;  3F45 A;  2EC6 B;  5ER4 X;  2Q4U A;  4YGA A;  1ZUZ A;  2L2E A;  2KNE A;  1MQ1 A;  3DVM A;  4CFR A;  1B8C A;  1XO5 A;  1MHO A;  1Y1X A;  5B8I B; 
#chains in the Genus database with same CATH topology
 4MSP A;  3FS7 A;  3KO0 A;  3MSE B;  2RGI A;  1AVS A;  1DEL A;  1M63 B;  1N0Y A;  3LCP C;  2YGU A;  3CZ0 A;  1AHR A;  2M1K B;  1K90 D;  1BR4 B;  3BFB A;  1QAS A;  1MR8 A;  1MUX A;  1RK9 A;  2KFH A;  2PVB A;  1UWO A;  3B87 A;  3JVT B;  3QME A;  3R1P A;  4IL1 A;  5TNC A;  5KU1 A;  1U5I B;  1TCF A;  2BAP A;  1QIV A;  2OS8 C;  3D0Y A;  1QX5 B;  1IKU A;  4GGF A;  5CSJ A;  4CPV A;  5KTY A;  1KK8 C;  2LM5 A;  2COL B;  1OMD A;  3OGN A;  5HLV A;  2KAX A;  1XFR A;  1JF0 A;  4ORC B;  2DOQ A;  1TNP A;  1IJ5 A;  2K2F A;  1PUL A;  1SPY A;  1DT7 B;  1NX0 A;  3PN7 B;  2GGZ A;  4NDC A;  4FQO A;  2PSR A;  1YVH A;  1EG3 A;  3I5I B;  1J55 A;  1JC2 A;  2GV5 A;  3FWB A;  3E3R A;  1CFC A;  5ER5 A;  3BOW B;  1KK8 B;  5KSZ A;  2MLF C;  2WCJ A;  3TDU A;  2LP3 A;  1C3Z A;  2F3Y A;  3GOF A;  3KPX A;  3DF0 A;  3SS5 A;  3VRQ A;  4I5J A;  5HLO A;  2LE9 B;  2L50 A;  1NCY A;  3LK0 A;  2E6W A;  1XFY O;  1B8R A;  2MRD A;  1YX8 A;  4CLN A;  1OOI X;  2PYQ A;  2LVI A;  4ZCV A;  1F70 A;  1TN4 A;  2KFG A;  1JWD A;  4MVF A;  1OOJ A;  2M9G A;  3RM1 A;  1Y6W A;  2QEO A;  1CFD A;  2KI4 B;  1KK7 Z;  3GK4 X;  4I5N B;  3D10 A;  2PRU A;  5G08 A;  2K7C A;  1D1O A;  2KDH A;  1CLM A;  2Y1N A;  5I8N A;  1J7Q A;  5HKZ A;  1JUO A;  2F2P A;  1CM4 A;  1QLS A;  1A75 A;  2QDI A;  5D3O A;  4YGD B;  3Q8I A;  1G4Y R;  1TCO B;  3I5H B;  3S0B A;  1FI6 A;  1K93 D;  1NX1 A;  1P28 A;  3BUM B;  1K94 A;  1JBA A;  1SMG A;  4WQ2 A;  2I18 A;  2ZKM X;  4AQI A;  2CNP A;  4YRU A;  4QJ3 B;  1QLK A;  2LVV A;  2SAS A;  1TTX A;  2BBN A;  2NXQ A;  3S0G A;  4DRW A;  1ODB A;  3AKB A;  3VB1 A;  1LA3 A;  1SNL A;  1QIW A;  5D7F A;  1TNW A;  2H8V A;  1RWY A;  3CS1 A;  1R6P A;  2OPO A;  4GAO A;  2M0R A;  3OX6 A;  3VRR A;  5K89 A;  1N65 A;  3CZT X;  1QVI Y;  1S6I A;  2L5X B;  1RTP 1;  4KYN A;  1QVI Z;  2L4I A;  4ORA B;  3NXA A;  3K21 A;  5AFP A;  1B7T Z;  2JT0 A;  3DVJ A;  4GUK A;  1A03 A;  5J3X A;  2P6B B;  3BUX B;  2L98 A;  4PE0 A;  2ISD A;  1GM0 A;  1QTX A;  3KHE A;  1WRK A;  1S1E A;  2HQ8 A;  2LUC A;  3R1V A;  3SS3 A;  1OMV A;  4GNK B;  4MN0 A;  2K8M B;  3SG7 A;  2LVK A;  3FIA A;  1M45 A;  5I2O A;  4YGB B;  2KQY A;  1S36 A;  4DIR A;  3KF9 A;  3RLZ A;  2JRF A;  1OQP A;  1MXL C;  1DC1 A;  2WOS A;  2I94 A;  1SSE B;  3EK4 A;  1M31 A;  1L7Z A;  2KHN A;  1YRT B;  5HYD A;  5HKW A;  1SKT A;  1DGV A;  3CLN A;  2WCM A;  1IG5 A;  1J7P A;  1DF0 B;  1LA0 A;  3L4L A;  3BXK A;  1PAL A;  2ZRT A;  3FE8 A;  1F8H A;  4GGF C;  1BG1 A;  2K7B A;  4I5K A;  1SL7 A;  1L2O C;  1UP5 A;  2KOT A;  4OZD A;  1UUS A;  1G8I A;  3NSO A;  1F4Q A;  3O78 A;  4F7F A;  2PAS A;  2BKI B;  1IH0 A;  5FI2 A;  3ICB A;  3TDZ A;  1NCX A;  1UHI A;  1K2H A;  1DEK A;  3B7A A;  1CKK A;  1TOP A;  2LC5 A;  4MBE A;  2EGD A;  1B1G A;  1S3P A;  4XJK A;  1EH2 A;  2M29 A;  3SG4 A;  2JTZ A;  2WND A;  3PM8 A;  3WHT B;  1CFP A;  2JNX A;  1QAT A;  2CBL A;  1CLL A;  1KQM B;  1DJY A;  1IGV A;  2H2K A;  2QPT A;  3CWG A;  1QX2 A;  2WCK A;  1FI5 A;  1X02 A;  2FCD A;  1UHN A;  2SCP A;  1YUR A;  2JQ6 A;  1EJ3 A;  2K0J A;  2KAV A;  2KYC A;  1S5G Z;  3OB2 B;  1FPW A;  1CDP A;  1KFU L;  2KI6 D;  4HRE E;  1XFX O;  3K1E A;  4PT1 A;  4GPL B;  1QJT A;  2ZFD A;  1A29 A;  5DKR A;  2FCE A;  3UNW A;  3NSL A;  3IQQ A;  3R72 A;  1XYD A;  2CXJ A;  2K60 A;  3TUY C;  1B47 A;  4M2O A;  1PRW A;  4C0J A;  3HX4 A;  1H8B A;  4YGE B;  1W9Z A;  3R1O A;  2LMV A;  3JTD C;  2LLS A;  1CDL A;  1YVL A;  1QV0 A;  2M3W A;  2OTG B;  5I2Q A;  1F55 A;  4U8D A;  1QWV A;  1SCV A;  3GK1 A;  3DYE A;  3PLF B;  3RZS A;  1KFU S;  1QXP A;  3VRN A;  5AER A;  2G2B A;  1IQ3 A;  1NIW A;  1NUB A;  3H4S E;  4MEW A;  1WLM A;  5I2L A;  4PDZ A;  1EL4 A;  4MZJ A;  4PE7 A;  3EVV A;  1FW4 A;  2NZ0 A;  4USL A;  3L47 A;  1C3Y A;  1ZFS A;  2I2R E;  2JXL A;  1B9A A;  3D76 A;  1UUR A;  1DJH A;  3OP0 A;  4PHN A;  1S5G Y;  1WRL A;  1JF2 A;  1Y1U A;  3O4Y A;  3I5H C;  2MBX A;  1BMO A;  3NHI A;  4Q04 A;  3S0D A;  1BOC A;  1QX7 A;  1YR5 A;  1CTR A;  2Y1M A;  3FWC A;  2BCA A;  1K8U A;  3S0E A;  1CM1 A;  5IBW A;  1UHJ A;  5FI7 A;  1KFX S;  1RFJ A;  3BUN B;  3FE9 A;  5AXI A;  1CMG A;  1AJ5 A;  3NGV A;  2R2I A;  3FE6 A;  4N1G A;  2LMT A;  1PVA A;  1BT6 A;  3VGO A;  2JT3 A;  3O6B A;  3PM2 A;  5FYX A;  3SIA A;  3BFA A;  3CDN A;  2KBI A;  2MJW B;  2ZN9 A;  1K96 A;  1ALV A;  3LK1 A;  2F2O A;  2HF5 A;  3NHT A;  2KAY A;  2NLN A;  3D77 A;  3JVT C;  4L9M A;  1ALW A;  1DJG A;  1Z4H A;  2M49 B;  2CTN A;  4DUQ A;  4INX A;  1L2O B;  2AAO A;  2Y4Q A;  1HT9 A;  5F6T A;  4JQ0 D;  3EK8 A;  1KSM A;  1SR6 B;  1NSH A;  3CZ2 A;  4HRH A;  1KQV A;  4BY5 A;  2BE4 A;  2D8N A;  1GGZ A;  2KSP A;  2NCO A;  1AJ4 A;  1TUJ A;  4MRX A;  1NPQ A;  3O2P A;  2TN4 A;  4NQG A;  1DQE A;  3IVT A;  2BE6 A;  2QAC A;  3SIB A;  3BUO B;  1SYM A;  3V2L A;  1BOD A;  4YGC B;  2JPO A;  1PSB A;  1DF0 A;  2ZRS A;  1B4C A;  1NYA A;  2ZNE A;  3BYA A;  4D1E A;  3CTN A;  3VRO A;  2OS8 B;  4OVN F;  2KGB C;  3D0Y B;  4GBA A;  1F4O A;  1WDC C;  2VRG A;  4JKT A;  1LXF C;  2B1U A;  1LIN A;  1KK7 Y;  1DTL A;  1IIO A;  1XK4 C;  3AAK A;  4CFQ A;  3C1V A;  3B88 A;  2H61 A;  1N2D A;  3PSR A;  4WRI A;  4JPZ B;  3ZNI A;  1MWN A;  3LL8 B;  4YI9 A;  2JUL A;  4OV2 A;  2WCF A;  2HQW A;  3GK2 A;  5BPJ A;  3CR4 X;  3I5I C;  3D78 A;  4C0L A;  1JFJ A;  1C07 A;  1SK6 D;  1GQM A;  3DZT A;  4XJK B;  1T14 A;  3BOW A;  1IJ6 A;  3DY9 A;  1KWO C;  1JSA A;  2BKH B;  4NDD A;  2F3Z A;  1NCZ A;  4HSZ A;  1A75 B;  5I94 A;  2KFF A;  2V53 A;  1CDM A;  2L51 A;  3CR5 X;  3DD4 A;  3DF0 B;  3O4X A;  1DJI A;  4MRY A;  1NX2 A;  1K9U A;  3SG5 A;  2WCE A;  3S0A A;  2CCM A;  2M97 A;  3PFV A;  1BR1 B;  4ICB A;  3D74 A;  2HPS A;  1W7I B;  3QRX A;  3L4A A;  2WC6 A;  1MF8 B;  2F33 A;  3CR2 A;  2KLD A;  2JPT A;  4PHJ A;  2MAZ A;  1TIZ A;  1KSO A;  1LS8 A;  1YTZ C;  1YX7 A;  3DVE A;  2P71 A;  4GGN A;  3B6X A;  3BJH A;  2LUX A;  3AAJ A;  1J1D A;  1OZS A;  2LLU A;  1XVJ A;  1WRZ A;  2M1U A;  3JTD B;  3PJI A;  1WLZ A;  3SG6 A;  2OTG C;  1J7O A;  2M7N A;  2EHB A;  1S6C A;  2WOR A;  4JWQ A;  4NDB A;  2KQ6 A;  5D69 A;  5DKN A;  4PCW A;  3SG3 A;  1DVI A;  2LAP A;  5JJG A;  2Y5I A;  4ORB B;  2FOT A;  1SCM C;  2JOJ A;  3EKJ A;  5JOL A;  1AK8 A;  4TNC A;  4PE4 A;  1DMO A;  1J7R A;  4PHM A;  2KPH A;  2KI6 C;  2FJU B;  1LVC D;  2GTE A;  4FTG A;  1KCY A;  5CSN A;  5EL2 A;  4AOM A;  4DS7 A;  4MZL A;  3WNX B;  2F8P A;  4YBH B;  4ZCU A;  2BNX A;  1XFZ O;  5DKQ A;  3CYZ A;  4ETO A;  1J1E A;  1QS7 A;  1UHH A;  1E8A A;  2LAN A;  2LNK A;  3BQ3 A;  4OR9 B;  1S26 D;  1YUT A;  1Y0V H;  2AUC A;  4M2P A;  2QEB A;  4N1F A;  4UPG A;  3HCM A;  2QEV A;  4PE1 A;  2JU0 A;  3DXL A;  4BY4 A;  2NCP A;  1SR6 C;  1W7J B;  1PSR A;  1IQ5 A;  2K2A A;  4INW A;  1M39 A;  2WC8 A;  3BUW B;  2JZI A;  4M2Q A;  2KBM A;  1Y1A A;  1V1G A;  2Q91 A;  3AKA A;  3LLE A;  2WC5 A;  1U5I A;  3CAB A;  2O60 A;  3SG2 A;  1B8L A;  4WQ3 A;  1EG4 A;  2LLT A;  2KLE A;  5CSF A;  2EC6 C;  1CDN A;  3ZWH A;  1XFW O;  3WHU B;  4A4C A;  2K7O A;  5FI6 A;  4PHK A;  3PN7 C;  2AMI A;  2HET A;  1Z2C B;  2IS9 A;  1OE9 B;  1OOH A;  2BCX A;  2BL0 C;  1AUI B;  3TS5 C;  3S0F A;  1QV1 A;  4MLW A;  2MLE C;  3I5G B;  4XYN A;  1TUZ A;  2LCP A;  1PVB A;  3B86 A;  4R1E A;  1SY9 A;  2O5G A;  1KFX L;  1CMF A;  3TDI A;  1OW4 A;  1GGW A;  2JXC A;  1ZAC A;  3OBV A;  4IJ7 A;  1Q80 A;  2KYF A;  3D75 A;  1TNX A;  1TRF A;  5PAL A;  2L4H A;  1K9P A;  2GGM A;  1OSA A;  2MA2 A;  1LKJ A;  2BL0 B;  1FF1 A;  3TS5 B;  3SS4 A;  3EVU A;  3I5G C;  1BU3 A;  1UHK A;  4AQJ A;  2JWW A;  1V1F A;  5HL1 A;  2JTT A;  2L0P A;  2L5Y A;  2M8U A;  1KWO B;  3IF7 A;  1XK4 A;  1K95 A;  2H61 C;  1YUU A;  4QJ5 B;  5HKY A;  1PK0 D;  3TZ1 A;  2ERB A;  1NX3 A;  1OOF A;  1XFU O;  3PAT A;  4A4B A;  1CNP A;  1XA5 A;  1WDC B;  3DVK A;  1SRA A;  3NSI A;  2ZN8 A;  2BEC A;  1IWQ A;  3CGA A;  1FBV A;  3NSK A;  1JFK A;  3IQO A;  3I5F C;  3VRP A;  1AP4 A;  1KQM C;  3CZ1 A;  4YI8 A;  4P5O E;  3M0W A;  2E30 A;  4OCI A;  5CSI A;  2LHI A;  1BJF A;  1B7T Y;  2G9B A;  4CID A;  2PQL A;  1C7W A;  1K9K A;  1SBJ A;  1YRU B;  2QEH A;  1S6J A;  2L2C A;  4GFT A;  4JD9 A;  3EK7 A;  1F54 A;  5DIC A;  1A4P A;  2M7L A;  1CB1 A;  1ZMZ A;  5AAN A;  3I5F B;  2KGR A;  1GJY A;  2K61 A;  5CPV A;  1A2X A;  1BF5 A;  3TUY B;  2CT9 A;  1SL9 A;  2MHH A;  3SJS A;  1M46 A;  2KI4 C;  2P70 A;  1RRO A;  1CFF A;  1CLB A;  1DGU A;  2BBM A;  3A4U B;  2JC2 A;  3WXA A;  2BCB A;  1OMR A;  4PAL A;  1REC A;  4P2Y B;  4C0K A;  2ZND A;  1OZO A;  1RJV A;  3OX5 A;  2PAL A;  4FQT A;  2I7A A;  4I5L B;  3UO9 A;  1EXR A;  2JNF A;  2K7D A;  2LHL A;  3EVR A;  1G33 A;  2LMU A;  1XFV O;  3EKH A;  4E68 A;  1F71 A;  1ORG A;  1H4B A;  1NWD A;  1SL8 A;  1IRJ A;  2LVJ A;  2LV7 A;  4N5X A;  2JT8 A;  1ZOT B;  4F0Z B;  1C7V A;  1HQV A;  1DJX A;  1BLQ A;  3OHM B;  5AEQ A;  3A8R A;  4MZK A;  2A4J A;  3PAL A;  4QJ4 B;  3KEV A;  1DJZ A;  1MXE A;  1NP8 A;  2LP2 A;  1TWO A;  2WCB A;  3OB1 B;  2PMY A;  1OOG A;  4OKH A;  1TNQ A;  5GQQ C;  1R2U A;  1SW8 A;  1VRK A;  1SCM B;  1WY9 A;  1YUS A;  2WCH A;  1DJW A;  4DCK A;  4HRG A;  2WCL A;  3F45 A;  3N7H A;  2EC6 B;  3D73 A;  5ER4 X;  2Q4U A;  4YGA A;  1ZUZ A;  2FJY A;  2KNE A;  1MQ1 A;  2L2E A;  3DVM A;  4CFR A;  3EG5 B;  1B8C A;  3BFH A;  1XO5 A;  1MHO A;  1Y1X A;  5B8I B; 
#chains in the Genus database with same CATH homology
 4MSP A;  3FS7 A;  3KO0 A;  3MSE B;  2RGI A;  1AVS A;  1M63 B;  1N0Y A;  3LCP C;  1AHR A;  2M1K B;  1K90 D;  1BR4 B;  1QAS A;  1MR8 A;  1MUX A;  1RK9 A;  2KFH A;  2PVB A;  1UWO A;  3JVT B;  5KU1 A;  4IL1 A;  5TNC A;  1U5I B;  1TCF A;  2OS8 C;  1QIV A;  3D0Y A;  1IKU A;  1QX5 B;  4GGF A;  5CSJ A;  4CPV A;  5KTY A;  1KK8 C;  2LM5 A;  2COL B;  1OMD A;  5HLV A;  2KAX A;  1JF0 A;  4ORC B;  2DOQ A;  1TNP A;  1IJ5 A;  2K2F A;  1PUL A;  1SPY A;  1DT7 B;  1NX0 A;  3PN7 B;  2GGZ A;  4NDC A;  4FQO A;  2PSR A;  1YVH A;  1EG3 A;  3I5I B;  1J55 A;  1JC2 A;  2GV5 A;  3FWB A;  3E3R A;  1CFC A;  5ER5 A;  3BOW B;  1KK8 B;  5KSZ A;  2MLF C;  3TDU A;  2LP3 A;  2F3Y A;  3GOF A;  3KPX A;  3DF0 A;  3VRQ A;  4I5J A;  5HLO A;  2LE9 B;  2L50 A;  1NCY A;  3LK0 A;  2E6W A;  1XFY O;  1B8R A;  2MRD A;  1YX8 A;  4CLN A;  1F70 A;  2LVI A;  4ZCV A;  1TN4 A;  2KFG A;  1JWD A;  4MVF A;  1OOJ A;  2M9G A;  3RM1 A;  1Y6W A;  1CFD A;  2KI4 B;  1KK7 Z;  3GK4 X;  4I5N B;  3D10 A;  2PRU A;  5G08 A;  2K7C A;  1D1O A;  2KDH A;  1CLM A;  2Y1N A;  5I8N A;  1J7Q A;  5HKZ A;  1JUO A;  2F2P A;  1CM4 A;  1QLS A;  1A75 A;  4YGD B;  1G4Y R;  1TCO B;  3I5H B;  1FI6 A;  1K93 D;  1NX1 A;  3BUM B;  1K94 A;  1JBA A;  1SMG A;  4WQ2 A;  2I18 A;  2ZKM X;  4AQI A;  2CNP A;  4YRU A;  4QJ3 B;  1QLK A;  2LVV A;  2SAS A;  1TTX A;  2BBN A;  2NXQ A;  4DRW A;  1ODB A;  3AKB A;  1LA3 A;  1SNL A;  1QIW A;  5D7F A;  1TNW A;  1RWY A;  3CS1 A;  1R6P A;  2OPO A;  4GAO A;  2M0R A;  3OX6 A;  3VRR A;  5K89 A;  1N65 A;  3CZT X;  1QVI Y;  1S6I A;  2L5X B;  1RTP 1;  1QVI Z;  2L4I A;  4ORA B;  3NXA A;  3K21 A;  5AFP A;  1B7T Z;  2JT0 A;  3DVJ A;  4GUK A;  1A03 A;  5J3X A;  2P6B B;  3BUX B;  2L98 A;  4PE0 A;  2ISD A;  1QTX A;  3KHE A;  2HQ8 A;  1S1E A;  1WRK A;  2LUC A;  1OMV A;  4GNK B;  4MN0 A;  2K8M B;  3SG7 A;  2LVK A;  3FIA A;  1M45 A;  5I2O A;  4YGB B;  2KQY A;  1S36 A;  4DIR A;  3KF9 A;  3RLZ A;  2JRF A;  1OQP A;  1MXL C;  2WOS A;  2I94 A;  3EK4 A;  1M31 A;  1L7Z A;  2KHN A;  1YRT B;  5HYD A;  5HKW A;  1SKT A;  1DGV A;  3CLN A;  1IG5 A;  1J7P A;  1DF0 B;  1LA0 A;  3BXK A;  1PAL A;  2ZRT A;  1F8H A;  4GGF C;  1BG1 A;  2K7B A;  4I5K A;  1SL7 A;  1L2O C;  1UP5 A;  2KOT A;  1UUS A;  1G8I A;  3NSO A;  1F4Q A;  3O78 A;  1IH0 A;  2PAS A;  2BKI B;  3ICB A;  3TDZ A;  1NCX A;  1UHI A;  1K2H A;  1CKK A;  1TOP A;  2LC5 A;  4MBE A;  2EGD A;  1B1G A;  1S3P A;  4XJK A;  1EH2 A;  2M29 A;  3SG4 A;  2JTZ A;  2WND A;  3PM8 A;  3WHT B;  1CFP A;  2JNX A;  1QAT A;  2CBL A;  1CLL A;  1KQM B;  1DJY A;  1IGV A;  2H2K A;  2QPT A;  3CWG A;  1QX2 A;  1FI5 A;  1X02 A;  2FCD A;  1UHN A;  2SCP A;  1YUR A;  2JQ6 A;  1EJ3 A;  2K0J A;  2KAV A;  2KYC A;  1S5G Z;  3OB2 B;  1FPW A;  1CDP A;  1KFU L;  2KI6 D;  4HRE E;  1XFX O;  4GPL B;  1QJT A;  2ZFD A;  1A29 A;  5DKR A;  2FCE A;  3NSL A;  3IQQ A;  1XYD A;  2CXJ A;  3TUY C;  1B47 A;  4M2O A;  1PRW A;  4C0J A;  3HX4 A;  1H8B A;  4YGE B;  2LMV A;  3JTD C;  2LLS A;  1CDL A;  1YVL A;  1QV0 A;  2M3W A;  2OTG B;  5I2Q A;  1F55 A;  4U8D A;  1SCV A;  3GK1 A;  3PLF B;  1KFU S;  1QXP A;  3VRN A;  5AER A;  2G2B A;  1IQ3 A;  1NIW A;  1NUB A;  3H4S E;  4MEW A;  1WLM A;  5I2L A;  4PDZ A;  1EL4 A;  4MZJ A;  4PE7 A;  3EVV A;  1FW4 A;  2NZ0 A;  4USL A;  1ZFS A;  2I2R E;  2JXL A;  1B9A A;  4PHN A;  1UUR A;  1DJH A;  3OP0 A;  1S5G Y;  1WRL A;  1JF2 A;  1Y1U A;  3O4Y A;  3I5H C;  2MBX A;  1BMO A;  4Q04 A;  1BOC A;  1QX7 A;  1YR5 A;  1CTR A;  2Y1M A;  3FWC A;  2BCA A;  1K8U A;  5IBW A;  1CM1 A;  1UHJ A;  1KFX S;  1RFJ A;  3BUN B;  5AXI A;  1CMG A;  1AJ5 A;  2R2I A;  4N1G A;  2LMT A;  1PVA A;  1BT6 A;  3VGO A;  2JT3 A;  3O6B A;  5FYX A;  3SIA A;  2KBI A;  2MJW B;  2ZN9 A;  1K96 A;  1ALV A;  3LK1 A;  2F2O A;  2HF5 A;  2KAY A;  2NLN A;  3JVT C;  4L9M A;  1ALW A;  1DJG A;  2M49 B;  2CTN A;  1L2O B;  2AAO A;  2Y4Q A;  1HT9 A;  5F6T A;  4JQ0 D;  3EK8 A;  1KSM A;  1SR6 B;  1NSH A;  1KQV A;  4HRH A;  4BY5 A;  2BE4 A;  2D8N A;  1GGZ A;  2KSP A;  2NCO A;  1AJ4 A;  4MRX A;  1NPQ A;  3O2P A;  2TN4 A;  4NQG A;  2BE6 A;  2QAC A;  3SIB A;  3BUO B;  1SYM A;  1BOD A;  4YGC B;  1PSB A;  1DF0 A;  2ZRS A;  1B4C A;  1NYA A;  2ZNE A;  3BYA A;  4D1E A;  3CTN A;  3VRO A;  2OS8 B;  4OVN F;  2KGB C;  3D0Y B;  4GBA A;  1F4O A;  1WDC C;  2VRG A;  1LXF C;  2B1U A;  1LIN A;  1KK7 Y;  1DTL A;  1XK4 C;  3AAK A;  4CFQ A;  3C1V A;  2H61 A;  1N2D A;  3PSR A;  4WRI A;  4JPZ B;  3ZNI A;  1MWN A;  3LL8 B;  4YI9 A;  2JUL A;  4OV2 A;  2WCF A;  2HQW A;  3GK2 A;  5BPJ A;  3CR4 X;  3I5I C;  4C0L A;  1JFJ A;  1C07 A;  1SK6 D;  1GQM A;  4XJK B;  3BOW A;  1IJ6 A;  1JSA A;  1KWO C;  2BKH B;  4NDD A;  2F3Z A;  1NCZ A;  4HSZ A;  1A75 B;  2KFF A;  2V53 A;  1CDM A;  2L51 A;  3CR5 X;  3DD4 A;  3DF0 B;  1DJI A;  4MRY A;  1NX2 A;  1K9U A;  3SG5 A;  2WCE A;  2CCM A;  2M97 A;  3PFV A;  1BR1 B;  4ICB A;  2HPS A;  1W7I B;  3QRX A;  1MF8 B;  2F33 A;  3CR2 A;  2JPT A;  4PHJ A;  2MAZ A;  1TIZ A;  1KSO A;  1YTZ C;  1YX7 A;  3DVE A;  4GGN A;  2LUX A;  3AAJ A;  1J1D A;  1OZS A;  2LLU A;  1XVJ A;  1WRZ A;  2M1U A;  3JTD B;  3SG6 A;  1WLZ A;  2OTG C;  1J7O A;  2M7N A;  2EHB A;  1S6C A;  2WOR A;  4JWQ A;  4NDB A;  2KQ6 A;  5D69 A;  5DKN A;  4PCW A;  3SG3 A;  1DVI A;  2LAP A;  5JJG A;  2Y5I A;  4ORB B;  2FOT A;  1SCM C;  2JOJ A;  3EKJ A;  5JOL A;  1AK8 A;  4TNC A;  4PE4 A;  1DMO A;  1J7R A;  4PHM A;  2KI6 C;  2FJU B;  1LVC D;  4FTG A;  1KCY A;  5CSN A;  4AOM A;  4DS7 A;  4MZL A;  3WNX B;  2F8P A;  4YBH B;  4ZCU A;  1XFZ O;  5DKQ A;  4ETO A;  1J1E A;  1QS7 A;  1UHH A;  1E8A A;  2LAN A;  2LNK A;  3BQ3 A;  4OR9 B;  1S26 D;  1YUT A;  1Y0V H;  2AUC A;  4M2P A;  4N1F A;  4UPG A;  3HCM A;  4PE1 A;  2JU0 A;  4BY4 A;  2NCP A;  1SR6 C;  1W7J B;  1PSR A;  1IQ5 A;  2K2A A;  1M39 A;  2WC8 A;  3BUW B;  2JZI A;  4M2Q A;  2KBM A;  1Y1A A;  1V1G A;  2Q91 A;  3AKA A;  3LLE A;  1U5I A;  2O60 A;  3SG2 A;  1B8L A;  4WQ3 A;  1EG4 A;  2LLT A;  5CSF A;  2EC6 C;  1CDN A;  3ZWH A;  1XFW O;  3WHU B;  4A4C A;  2K7O A;  4PHK A;  3PN7 C;  2AMI A;  2HET A;  2IS9 A;  1OE9 B;  2BCX A;  2BL0 C;  1AUI B;  3TS5 C;  1QV1 A;  4MLW A;  2MLE C;  3I5G B;  4XYN A;  2LCP A;  1PVB A;  4R1E A;  1SY9 A;  2O5G A;  1KFX L;  1CMF A;  3TDI A;  1GGW A;  2JXC A;  1ZAC A;  1Q80 A;  2KYF A;  5PAL A;  1TNX A;  1TRF A;  2L4H A;  1K9P A;  2GGM A;  1OSA A;  2MA2 A;  1LKJ A;  2BL0 B;  1FF1 A;  3TS5 B;  3EVU A;  3I5G C;  1BU3 A;  1UHK A;  4AQJ A;  2JWW A;  1V1F A;  2JTT A;  2L0P A;  2M8U A;  1KWO B;  3IF7 A;  1XK4 A;  1K95 A;  2H61 C;  1YUU A;  4QJ5 B;  5HKY A;  1PK0 D;  3TZ1 A;  1NX3 A;  1XFU O;  3PAT A;  4A4B A;  1CNP A;  1XA5 A;  1WDC B;  3DVK A;  1SRA A;  3NSI A;  2ZN8 A;  2BEC A;  1IWQ A;  3CGA A;  1FBV A;  3NSK A;  1JFK A;  3IQO A;  3I5F C;  3VRP A;  1AP4 A;  1KQM C;  4YI8 A;  4P5O E;  3M0W A;  2E30 A;  4OCI A;  5CSI A;  2LHI A;  1BJF A;  1B7T Y;  2G9B A;  4CID A;  1C7W A;  1K9K A;  1SBJ A;  1YRU B;  1S6J A;  4GFT A;  3EK7 A;  1F54 A;  1A4P A;  2M7L A;  1CB1 A;  1ZMZ A;  5AAN A;  3I5F B;  2KGR A;  1GJY A;  2K61 A;  5CPV A;  1A2X A;  1BF5 A;  3TUY B;  2CT9 A;  1SL9 A;  2MHH A;  3SJS A;  1M46 A;  2KI4 C;  1CFF A;  1RRO A;  1CLB A;  1DGU A;  2BBM A;  3A4U B;  2JC2 A;  3WXA A;  2BCB A;  1OMR A;  4PAL A;  1REC A;  4P2Y B;  4C0K A;  2ZND A;  1OZO A;  1RJV A;  3OX5 A;  2PAL A;  2I7A A;  4I5L B;  1EXR A;  2JNF A;  2K7D A;  2LHL A;  3EVR A;  1G33 A;  2LMU A;  1XFV O;  3EKH A;  4E68 A;  1F71 A;  1H4B A;  1NWD A;  1SL8 A;  1IRJ A;  2LVJ A;  2LV7 A;  4N5X A;  2JT8 A;  1ZOT B;  4F0Z B;  1C7V A;  1HQV A;  1DJX A;  1BLQ A;  3OHM B;  5AEQ A;  3A8R A;  4MZK A;  2A4J A;  3PAL A;  4QJ4 B;  3KEV A;  1DJZ A;  1MXE A;  1NP8 A;  2LP2 A;  2WCB A;  3OB1 B;  4DUQ A;  2PMY A;  4OKH A;  1TNQ A;  5GQQ C;  1R2U A;  1SW8 A;  1VRK A;  1SCM B;  1WY9 A;  1YUS A;  4DCK A;  1DJW A;  4HRG A;  3F45 A;  2EC6 B;  5ER4 X;  2Q4U A;  4YGA A;  1ZUZ A;  2L2E A;  2KNE A;  1MQ1 A;  3DVM A;  4CFR A;  1B8C A;  1XO5 A;  1MHO A;  1Y1X A;  5B8I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...