3MSEB

Crystal structure of c-terminal domain of pf110239.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
168
Chain Sequence
ISPNVLNNMKSYMKHSNIRNIIINIMAHELSVINNHIKYINELFYKLDTNHNGSLSHREIYTVLASVGIKKWDINRILQALDINDRGNITYTEFMAGCYRWKNITFLKAAFNKIDKDEDGYISKSDIVSLVHDKVLDNNDIDNFFLSVHSIINKISFQEFKDYMLSTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protein kinase, putative
publication title Crystal structure of C-terminal domain of PF110239
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 60
structure length 168
sequence length 179
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3mseB00
1SMGA 1Y6WA 2B1UA 5KTYA 4E68A 1OSAA 1AVSA 4ZCUA 3SG2A 1NX0A 2KAYA 2BBNA 1PALA 2KFGA 3TS5C 1NP8A 4OV2A 4PE7A 1YURA 1C07A 3A8RA 3BUNB 1QIWA 2LMUA 5JJGA 1AJ5A 2K2FA 1YX7A 5ER4X 2KI4C 3GK1A 5HKYA 1XYDA 4PE1A 3DD4A 3OB2B 3EK8A 1A75A 2SCPA 1PSRA 2ZRTA 5CSIA 2NCOA 5BPJA 2GGMA 1K95A 1PK0D 1UHNA 1QVIZ 2L51A 2PMYA 1B8LA 1TTXA 3HCMA 4MSPA 2F2OA 2JXLA 1F71A 4A4CA 5K89A 1J1DA 2O5GA 3TDIA 2K7OA 1TNQA 2EC6C 1KFXS 1R2UA 3VRQA 2K8MB 2BCXA 2RGIA 3DVMA 1YRTB 3EVVA 4GAOA 1IH0A 1XFWO 2NXQA 4L9MA 4JPZB 2FCEA 1SCVA 1BMOA 1M45A 1ALVA 1IGVA 1VRKA 1JF0A 1Y1AA 2NLNA 1ALWA 3BXKA 1GGZA 5D69A 5DKNA 1S3PA 2M1UA 3WHUB 1CDNA 2Y1NA 1DJIA 4NDDA 5AXIA 5JOLA 4M2QA 1S36A 1A4PA 2L2EA 2M49B 2I2RE 2WC8A 2MAZA 1UP5A 1YUTA 1KQVA 1MQ1A 1LA3A 3I5FB 4CIDA 1GGWA 2LMTA 1ZACA 2Y1MA 1CTRA 2K7CA 1A2XA 1WRKA 2L4HA 1SCMB 3LCPC 1S6JA 1KK8B 1NCYA 2PRUA 3IQOA 1F4QA 3CTNA 3LL8B 2ISDA 2LAPA 4ORCB 4MBEA 1IWQA 5DKQA 3VROA 2E30A 4ZCVA 2ZN9A 1TOPA 4MEWA 1DGVA 1KQMB 1RTP1 1SK6D 2QACA 1SRAA 2KQYA 1B47A 4PCWA 1G33A 1UHKA 1NPQA 2KAVA 4ETOA 1YRUB 1NIWA 3LLEA 1QXPA 1B9AA 1B4CA 2JWWA 3NSOA 4YBHB 4ORBB 1J7PA 4PHNA 2AUCA 3H4SE 3D0YA 1ZUZA 1BOCA 2ZN8A 5D7FA 1BR1B 1RWYA 4QJ5B 3I5GB 4Q04A 1OZSA 4MZJA 3SG3A 1K94A 2F3ZA 4HSZA 1DGUA 2KBMA 3EVRA 1XO5A 1S5GY 1QS7A 3WHTB 1CFCA 1MHOA 3PATA 1XVJA 1XK4C 1CM4A 5I2LA 3RM1A 1OMDA 3GK4X 1B7TY 3FWCA 4A4BA 3KHEA 3SJSA 4AOMA 4OR9B 3OX5A 1QV1A 1X02A 2LE9B 4CLNA 2LVKA 2LVIA 2GV5A 3VRPA 5FYXA 2KGRA 3OHMB 1SL8A 1PULA 4U8DA 1UHJA 3DF0B 3I5FC 1A75B 1S6IA 1NWDA 4IL1A 1B1GA 1JWDA 1QLSA 1SCMC 2MLEC 4GNKB 2OS8B 1J7OA 1SYMA 1WLMA 3I5IB 2BKIB 3LK0A 1KK8C 1KSMA 2F33A 2HQWA 2JZIA 1WLZA 4JWQA 4PHKA 4YGBB 4NDCA 3BOWB 1UHHA 2AAOA 4GFTA 1H8BA 2PSRA 4PHJA 3E3RA 1ZMZA 1FI5A 1B8CA 1QIVA 4YGEB 1U5IA 1KQMC 1QX2A 3FS7A 1PRWA 1DF0A 1G4YR 3BYAA 1IJ5A 1TNPA 3FIAA 2KHNA 1BU3A 1UHIA 1SNLA 1H4BA 1RJVA 3BUOB 4DRWA 1CLLA 1M39A 1S5GZ 4F0ZB 2G2BA 4PE0A 1K8UA 1YVLA 1TCOB 2M97A 4FTGA 1GQMA 4OKHA 3GK2A 2R2IA 4WRIA 1OZOA 1B7TZ 2BBMA 1NX2A 3C1VA 3NSKA 4P5OE 1WY9A 4GUKA 4AQJA 1CNPA 3I5GC 1N65A 1CDLA 4N1FA 2BECA 5TNCA 5ER5A 2BCAA 1K93D 1CM1A 3PM8A 4I5NB 1XFZO 2JPTA 2M8UA 1G8IA 1XFUO 2WOSA 2LLSA 4YGDB 1EJ3A 2M1KB 1ODBA 4GPLB 2JQ6A 3TZ1A 4CFRA 2HQ8A 2E6WA 3EKHA 3O6BA 1KK7Y 1A03A 1B8RA 3CWGA 3SIBA 1JF2A 3IQQA 1MXEA 3PLFB 1S1EA 3WXAA 3BUXB 2KYFA 1HQVA 2P6BB 1C7WA 1DJZA 2JT8A 1EG3A 3CR4X 5F6TA 3OB1B 2Q4UA 3ZNIA 4QJ4B 4MZKA 4PDZA 1W7JB 5I2QA 4PHMA 4GGNA 2M7LA 1YVHA 3A4UB 1BLQA 1ZOTB 1CLMA 2OS8C 1QX7A 2ZNDA 2MBXA 1JUOA 3ZWHA 2OPOA 4YGAA 3I5IC 1CDPA 2CBLA 5IBWA 1DVIA 1TN4A 1QX5B 2M3WA 1IQ3A 2I94A 2H2KA 4FQOA 1M46A 2KSPA 2M0RA 2PASA 1IQ5A 3AKAA 2VRGA 2EGDA 1W7IB 1MWNA 1K2HA 2LANA 1CKKA 1OMVA 1KCYA 4GBAA 2MLFC 5HLVA 3CZTX 2CXJA 2MHHA 1CMFA 2L98A 4YRUA 2Q91A 2O60A 1NSHA 1AP4A 2WCBA 4TNCA 1F70A 3KEVA 4XJKB 1RFJA 1JFJA 3K21A 2K61A 2ZFDA 1PSBA 1KK7Z 3HX4A 2L5XB 2KGBC 3KO0A 4HRGA 3SG7A 1CB1A 2LP3A 1NUBA 2LV7A 3PN7B 1DJGA 4P2YB 2BE4A 1DTLA 2JNXA 2TN4A 2OTGB 1OOJA 2CNPA 3AKBA 1EH2A 1L2OB 1M31A 1WDCB 2NZ0A 3NSIA 2MRDA 3SG5A 4DS7A 1DJWA 2LVJA 5CSFA 1S6CA 1UURA 2LHLA 4DIRA 1CLBA 5I2OA 1F8HA 2BKHB 1M63B 5CPVA 4DUQA 3AAKA 4NQGA 2EHBA 1E8AA 2LM5A 1OMRA 2M29A 5PALA 1XFYO 5HYDA 1NX1A 1YX8A 3BUMB 4I5KA 1FBVA 1L7ZA 2LHIA 1JSAA 2F8PA 2D8NA 3TUYB 2Y4QA 3O78A 1LVCD 4CPVA 1JBAA 1Y1XA 2JC2A 2JTTA 1UWOA 3TDZA 2H61C 3VRRA 1SW8A 2KI6D 3TDUA 1YTZC 5J3XA 1TNXA 3FWBA 3KF9A 2Y5IA 2COLB 3JVTB 2A4JA 3SG4A 1KWOB 2L50A 2IS9A 3CS1A 1BG1A 1K90D 2WNDA 3F45A 1S26D 3MSEB 1SL7A 3NXAA 2ZNEA 2ZKMX 1IRJA 2CCMA 1QV0A 2KI6C 2K2AA 1NYAA 4WQ3A 4C0KA 5HLOA 1RK9A 1SKTA 1J55A 2LUXA 4YI9A 4MVFA 4GGFC 3VGOA 2HF5A 1SPYA 2LUCA 3WNXB 3DVEA 1LINA 2BL0B 1DMOA 3JTDB 4QJ3B 2FJUB 4PE4A 1AUIB 1N2DA 4R1EA 2L4IA 3IF7A 5CSJA 3PN7C 1Q80A 3I5HB 1CDMA 2M7NA 2OTGC 3LK1A 1ZFSA 3DF0A 1GJYA 3KPXA 1KFUL 1J7RA 2LVVA 1XFVO 2PVBA 4YGCB 1EL4A 2PALA 4I5LB 1L2OC 1WDCC 4DCKA 4HREE 1FI6A 1BODA 4M2OA 5G08A 4C0JA 5I8NA 3PALA 1DJYA 1FPWA 1J1EA 3BOWA 1BF5A 1CFPA 1SR6B 2ZRSA 1XA5A 1OQPA 2LLTA 4YI8A 1K96A 1EG4A 1YR5A 2JT0A 1K9KA 1QATA 1AHRA 4MRYA 2LMVA 4OCIA 3TUYC 1IJ6A 2KQ6A 2JU0A 3SG6A 1F54A 3PSRA 2KOTA 4NDBA 4ORAB 2L0PA 3AAJA 1BR4B 3SIAA 3CR5X 1Y0VH 2I7AA 3D0YB 3DVJA 3RLZA 1BJFA 4C0LA 1SY9A 2KFHA 4I5JA 1QJTA 1YUUA 1QLKA 4N5XA 4PALA 4USLA 1JFKA 2KNEA 3EK7A 2I18A 3JVTC 2JULA 1XFXO 3QRXA 3BQ3A 1KWOC 2F3YA 4M2PA 4MRXA 2V53A 3CGAA 1MF8B 1TNWA 2F2PA 2HETA 2SASA 3EKJA 3O2PA 1TRFA 1CFDA 2GGZA 1K9PA 4OVNF 3BUWB 5KU1A 1FW4A 1NCZA 1TIZA 1KSOA 3M0WA 1WRLA 5HKZA 2QPTA 2KFFA 4AQIA 3NSLA 4BY4A 1WRZA 2WORA 4D1EA 2FCDA 2MJWB 1XK4A 1CMGA 1MR8A 5AANA 1QTXA 1DJHA 2M9GA 1LXFC 3TS5B 3CR2A 1V1FA 2BL0C 4MN0A 1KFUS 1UUSA 2NCPA 3JTDC 2K0JA 2KAXA 1A29A 1OE9B 2KI4B 1AK8A 2JNFA 1D1OA 1LKJA 1DT7B 2LC5A 4CFQA 2LP2A 3I5HC 2LNKA 2WCFA 3OX6A 1C7VA 2BE6A 1IG5A 1PVBA 3EVUA 1PVAA 4BY5A 1DJXA 2H61A 2JTZA 2KBIA 2LCPA 1RROA 1F4OA 5GQQC 5HKWA 3O4YA 1U5IB 1BT6A 2EC6B 1QASA 1DF0B 2CTNA 4MZLA 1R6PA 1NCXA 4ICBA 4MLWA 5AEQA 1EXRA 2MA2A 1IKUA 2KDHA 3CLNA 1RECA 1MXLC 1SR6C 4JQ0D 4HRHA 2JXCA 2K7DA 1K9UA 2KYCA 3VRNA 3ICBA 1QVIY 2HPSA 1KFXL 5DKRA 2JRFA 1N0YA 1TCFA 4N1GA 1Y1UA 2FOTA 2G9BA 5AERA 1LA0A 4GGFA 5B8IB 1SBJA 1AJ4A 2LLUA 5KSZA 4XJKA 1FF1A 1NX3A 1JC2A 4XYNA 5CSNA 2CT9A 2BCBA 2JOJA 1CFFA 1J7QA 1MUXA 1YUSA 2AMIA 1F55A 4UPGA 3PFVA 2JT3A 5AFPA 2DOQA 3OP0A 3GOFA 1V1GA 3DVKA 1HT9A 2K7BA 2WCEA 3EK4A 1SL9A 3D10A 4WQ2A
chains in the Genus database with same CATH superfamily
1SMGA 1Y6WA 2B1UA 5KTYA 4E68A 1OSAA 1AVSA 1LS8A 3L4LA 4ZCUA 1NX0A 3SG2A 2KAYA 2BBNA 3S0AA 1PALA 2KFGA 3TS5C 1NP8A 4OV2A 4PE7A 3CZ0A 1YURA 1C07A 1GM0A 3A8RA 3BUNB 1QIWA 2LMUA 5JJGA 1AJ5A 2K2FA 1OW4A 1YX7A 5ER4X 2KI4C 3GK1A 5HKYA 1XYDA 2BNXA 4PE1A 3DD4A 3OB2B 2YGUA 3EK8A 1A75A 2SCPA 1PSRA 2ZRTA 5CSIA 2NCOA 5BPJA 2GGMA 1K95A 1PK0D 1UHNA 1QVIZ 2L51A 2PMYA 1B8LA 1TTXA 3HCMA 4MSPA 2F2OA 5FI7A 2JXLA 1F71A 4A4CA 5K89A 1J1DA 2O5GA 3TDIA 2K7OA 1TNQA 1DQEA 2EC6C 1KFXS 1R2UA 2QEHA 2K8MB 2BCXA 2RGIA 3DVMA 1YRTB 3EVVA 4GAOA 1IH0A 1XFWO 2PYQA 2NXQA 4L9MA 4JPZB 2FCEA 1SCVA 1BMOA 1M45A 3L4AA 1ALVA 1IGVA 1VRKA 1Y1AA 1JF0A 2NLNA 1ALWA 3BXKA 3L47A 1GGZA 5D69A 5DKNA 1S3PA 2M1UA 3WHUB 1CDNA 2JPOA 2Y1NA 1DJIA 4NDDA 5AXIA 5JOLA 4M2QA 1S36A 1A4PA 2L2EA 2M49B 2I2RE 2WC8A 2MAZA 1UP5A 1YUTA 3VRQA 1KQVA 1MQ1A 3DY9A 1LA3A 2QEBA 3I5FB 4CIDA 3FE9A 1GGWA 2LMTA 1ZACA 2BAPA 2Y1MA 1CTRA 2K7CA 1A2XA 1WRKA 2L4HA 1SCMB 3LCPC 1S6JA 1KK8B 1NCYA 2PRUA 3IQOA 3NHIA 1F4QA 3CTNA 3LL8B 2ISDA 3D76A 2LAPA 4ORCB 4MBEA 1IWQA 5DKQA 3VROA 2E30A 4ZCVA 2ZN9A 1TOPA 4MEWA 1XFRA 1DGVA 1KQMB 1RTP1 1SK6D 2QACA 1SRAA 2KQYA 1B47A 4PCWA 1G33A 1UHKA 1NPQA 1T14A 2KAVA 4ETOA 1YRUB 1NIWA 1Z4HA 3LLEA 1QXPA 3BFAA 1B9AA 1B4CA 2JWWA 3NSOA 4YBHB 3NHTA 4ORBB 1J7PA 4PHNA 2AUCA 3H4SE 3D0YA 1ZUZA 1BOCA 2ZN8A 3CZ2A 1IIOA 5D7FA 1BR1B 1RWYA 4QJ5B 3I5GB 4Q04A 1OZSA 4MZJA 3BFHA 3SG3A 1K94A 2F3ZA 4HSZA 1DGUA 2KBMA 3EVRA 1XO5A 1S5GY 1QS7A 3WHTB 1CFCA 1MHOA 3PATA 1XVJA 1XK4C 1CM4A 3B87A 5I2LA 3RM1A 1OMDA 3GK4X 1B7TY 3FWCA 4A4BA 3KHEA 3SJSA 4AOMA 4OR9B 3OX5A 1QV1A 1X02A 3R1OA 2FJYA 2LE9B 4CLNA 2LVKA 2LVIA 3PJIA 2GV5A 3VRPA 5FYXA 2KGRA 3D77A 1SL8A 1PULA 3FE6A 3OHMB 4U8DA 3N7HA 1UHJA 3DF0B 3I5FC 1A75B 1S6IA 1NWDA 4IL1A 1B1GA 1JWDA 1QLSA 1SCMC 2MLEC 2WCMA 4GNKB 2OS8B 1J7OA 1SYMA 1WLMA 3I5IB 2BKIB 2WC6A 2L2CA 1KK8C 1KSMA 2F33A 2HQWA 2JZIA 1WLZA 4JWQA 4PHKA 4YGBB 4NDCA 3BOWB 1UHHA 2AAOA 2WCKA 2KLDA 4GFTA 2PSRA 1H8BA 4PHJA 3E3RA 1ZMZA 2GTEA 1FI5A 1B8CA 1QIVA 4YGEB 1U5IA 1KQMC 1QX2A 3FS7A 4JD9A 1PRWA 1DF0A 1G4YR 3BYAA 3LK0A 1IJ5A 1TNPA 3FIAA 2KHNA 1BU3A 1UHIA 1SNLA 1H4BA 1RJVA 3BUOB 4DRWA 1CLLA 1M39A 5I94A 1S5GZ 4F0ZB 2G2BA 3CYZA 4PE0A 1K8UA 1YVLA 1DELA 1TCOB 2M97A 4FTGA 1GQMA 4OKHA 3GK2A 2R2IA 4WRIA 1OZOA 1B7TZ 2BBMA 1NX2A 3C1VA 3NSKA 4P5OE 1WY9A 4GUKA 4AQJA 1CNPA 3I5GC 1N65A 1CDLA 4N1FA 2BECA 5TNCA 4KYNA 5ER5A 3DYEA 2BCAA 1K93D 1CM1A 3PM8A 4I5NB 1XFZO 2JPTA 2M8UA 1G8IA 2QEVA 1XFUO 2WOSA 3FE8A 2LLSA 3O4XA 1EJ3A 4YGDB 2M1KB 1ODBA 4GPLB 2JQ6A 1TUJA 3TZ1A 4CFRA 2HQ8A 2E6WA 3EKHA 3O6BA 4JKTA 1KK7Y 3BFBA 1A03A 1B8RA 3CWGA 3SIBA 3S0GA 1JF2A 3IQQA 1MXEA 3PLFB 1S1EA 3WXAA 3BUXB 2KYFA 1HQVA 1Z2CB 2P6BB 1C7WA 1DJZA 2JT8A 1EG3A 3CR4X 5F6TA 3OB1B 2Q4UA 3ZNIA 4QJ4B 4MZKA 4PDZA 1W7JB 5I2QA 4PHMA 4GGNA 2M7LA 1YVHA 3A4UB 2L5YA 2P70A 1BLQA 1ZOTB 1CLMA 1ORGA 1QX7A 2OS8C 2ZNDA 2MBXA 1JUOA 2P71A 2OPOA 3ZWHA 1C3YA 4YGAA 3I5IC 3R72A 1CDPA 3RZSA 2CBLA 5IBWA 1DVIA 2WCHA 1TN4A 1QX5B 2M3WA 1IQ3A 2I94A 2H2KA 4FQOA 1M46A 2KSPA 2M0RA 2PASA 1IQ5A 3AKAA 3DXLA 2VRGA 2EGDA 1W7IB 1MWNA 1K2HA 2LANA 1CKKA 1C3ZA 1OMVA 1KCYA 4GBAA 2MLFC 5HLVA 3CZTX 2CXJA 2MHHA 2WC5A 3IVTA 1CMFA 2L98A 3R1PA 4YRUA 2Q91A 2O60A 1NSHA 1AP4A 2WCBA 4TNCA 1F70A 3KEVA 4XJKB 1RFJA 3SS4A 1JFJA 3K21A 2K61A 2ZFDA 1PSBA 4INWA 3CABA 3NGVA 1KK7Z 3HX4A 2L5XB 2KGBC 2WCJA 3EG5B 3KO0A 4HRGA 3SG7A 1CB1A 2LP3A 1NUBA 2LV7A 3PN7B 1DJGA 4P2YB 2BE4A 1DTLA 2ERBA 2JNXA 2TN4A 3VB1A 2OTGB 1OOJA 2CNPA 3AKBA 3D78A 3R1VA 4F7FA 1EH2A 1L2OB 1M31A 1WDCB 2NZ0A 3NSIA 2MRDA 3SG5A 4DS7A 1DJWA 2LVJA 1TWOA 5CSFA 1S6CA 1UURA 2LHLA 4DIRA 1CLBA 5I2OA 1F8HA 2BKHB 2QDIA 1M63B 5CPVA 4DUQA 3AAKA 3S0FA 3B86A 4NQGA 2EHBA 1E8AA 2LM5A 1OMRA 2M29A 5PALA 1XFYO 5HYDA 1NX1A 1YX8A 3BUMB 4I5KA 1OOHA 1FBVA 1DEKA 1L7ZA 2LHIA 1JSAA 3SS5A 2F8PA 2D8NA 3TUYB 1DC1A 2Y4QA 3O78A 1LVCD 4CPVA 1SSEB 1JBAA 1Y1XA 2JC2A 2JTTA 1UWOA 3TDZA 2H61C 3VRRA 1SW8A 2KI6D 3TDUA 1YTZC 3S0BA 5J3XA 1TNXA 3FWBA 3KF9A 2Y5IA 2COLB 3JVTB 2A4JA 3D74A 3QMEA 1KWOB 2L50A 3SG4A 2IS9A 3CS1A 1BG1A 1K90D 3UO9A 2WNDA 3F45A 1S26D 3MSEB 1SL7A 3NXAA 3SS3A 2ZNEA 2ZKMX 1IRJA 2CCMA 1QV0A 2KI6C 2K2AA 1NYAA 4WQ3A 4C0KA 5HLOA 1RK9A 1SKTA 1J55A 2LUXA 4YI9A 4FQTA 4MVFA 3Q8IA 4GGFC 3VGOA 2HF5A 1SPYA 2LUCA 3WNXB 3DVEA 1LINA 2BL0B 1DMOA 3JTDB 3D73A 4QJ3B 2FJUB 4PE4A 1AUIB 1N2DA 1OOGA 4R1EA 2L4IA 3IF7A 5CSJA 3PN7C 1Q80A 3I5HB 1CDMA 2M7NA 2OTGC 3LK1A 1ZFSA 3DF0A 1GJYA 3KPXA 1KFUL 1J7RA 2LVVA 1XFVO 2PVBA 4YGCB 1EL4A 2PALA 4I5LB 1L2OC 3S0DA 1WDCC 3B88A 4DCKA 3D75A 4HREE 1FI6A 1BODA 4M2OA 5G08A 4C0JA 5I8NA 3PALA 1DJYA 3CDNA 1FPWA 2QEOA 1J1EA 3BOWA 1BF5A 1CFPA 1SR6B 2ZRSA 1XA5A 1OQPA 2LLTA 3OGNA 4YI8A 1K96A 1EG4A 1YR5A 2JT0A 1K9KA 1QATA 1AHRA 4MRYA 2LMVA 4OCIA 3TUYC 4OZDA 3BJHA 1IJ6A 2KQ6A 2JU0A 3SG6A 1F54A 3PSRA 2KOTA 4NDBA 4ORAB 2L0PA 3AAJA 1BR4B 3SIAA 3CR5X 1Y0VH 2I7AA 3D0YB 2H8VA 3DVJA 1BJFA 3RLZA 4C0LA 1SY9A 2KFHA 4I5JA 1QJTA 1YUUA 1QLKA 4N5XA 4PALA 4USLA 1JFKA 2KNEA 3EK7A 2I18A 3JVTC 2JULA 1XFXO 3QRXA 3BQ3A 1KWOC 3B6XA 5DICA 2F3YA 4M2PA 4MRXA 2V53A 3CGAA 4PT1A 1MF8B 1TNWA 2F2PA 2HETA 2SASA 3EKJA 3O2PA 5D3OA 1TRFA 1CFDA 2GGZA 1K9PA 4OVNF 3BUWB 5KU1A 1FW4A 1NCZA 1TIZA 1KSOA 3M0WA 1WRLA 5HKZA 2QPTA 2KFFA 4AQIA 3NSLA 1OOIX 4BY4A 1WRZA 2WORA 4D1EA 2FCDA 2MJWB 1XK4A 1CMGA 3S0EA 1MR8A 5AANA 1P28A 1QTXA 1DJHA 2M9GA 1LXFC 3TS5B 3CR2A 1V1FA 2BL0C 4MN0A 1KFUS 1UUSA 3UNWA 2NCPA 3JTDC 2K0JA 2KAXA 1A29A 1OE9B 2KI4B 1AK8A 2JNFA 5EL2A 1D1OA 1LKJA 1DT7B 2LC5A 4CFQA 2LP2A 3I5HC 2LNKA 2WCFA 3OX6A 1C7VA 2BE6A 1IG5A 2K60A 1PVBA 3EVUA 1PVAA 4BY5A 2KPHA 1DJXA 3K1EA 2H61A 2JTZA 2KBIA 1QWVA 2LCPA 4INXA 1OOFA 1RROA 1F4OA 5GQQC 5HKWA 3O4YA 1U5IB 1BT6A 2EC6B 1QASA 1DF0B 2CTNA 4MZLA 1R6PA 1NCXA 4ICBA 4MLWA 5AEQA 1EXRA 2MA2A 1IKUA 2KDHA 3CLNA 1RECA 1MXLC 1SR6C 4JQ0D 3V2LA 4HRHA 2JXCA 2K7DA 1K9UA 1W9ZA 2KYCA 3VRNA 3ICBA 1QVIY 2HPSA 2WCLA 1KFXL 3CZ1A 2JRFA 1N0YA 3OBVA 1TCFA 5DKRA 4N1GA 1Y1UA 2FOTA 2G9BA 2PQLA 5AERA 1LA0A 4GGFA 4IJ7A 5B8IB 1SBJA 1AJ4A 2LLUA 2KLEA 5HL1A 5KSZA 3DZTA 4XJKA 1FF1A 1NX3A 1JC2A 5FI6A 5FI2A 4XYNA 5CSNA 2CT9A 2BCBA 2JOJA 1CFFA 1J7QA 1MUXA 3PM2A 1YUSA 2AMIA 1F55A 4UPGA 3PFVA 2JT3A 5AFPA 2DOQA 3OP0A 3GOFA 1V1GA 1TUZA 3DVKA 1HT9A 2K7BA 3B7AA 2WCEA 3EK4A 1SL9A 3D10A 4WQ2A
chains in the Genus database with same CATH topology
1SMGA 1Y6WA 2B1UA 5KTYA 4E68A 1OSAA 1AVSA 4ZCUA 3SG2A 1NX0A 2KAYA 2BBNA 1PALA 2KFGA 3TS5C 1NP8A 4OV2A 4PE7A 1YURA 1C07A 3A8RA 3BUNB 1QIWA 2LMUA 5JJGA 1AJ5A 2K2FA 1YX7A 5ER4X 2KI4C 3GK1A 5HKYA 1XYDA 4PE1A 3DD4A 3OB2B 3EK8A 1A75A 2SCPA 1PSRA 2ZRTA 5CSIA 2NCOA 5BPJA 2GGMA 1K95A 1PK0D 1UHNA 1QVIZ 2L51A 2PMYA 1B8LA 1TTXA 3HCMA 4MSPA 2F2OA 2JXLA 1F71A 4A4CA 5K89A 1J1DA 2O5GA 3TDIA 2K7OA 1TNQA 2EC6C 1KFXS 1R2UA 3VRQA 2K8MB 2BCXA 2RGIA 3DVMA 1YRTB 3EVVA 4GAOA 1IH0A 1XFWO 2NXQA 4L9MA 4JPZB 2FCEA 1SCVA 1BMOA 1M45A 1ALVA 1IGVA 1VRKA 1JF0A 1Y1AA 2NLNA 1ALWA 3BXKA 1GGZA 5D69A 5DKNA 1S3PA 2M1UA 3WHUB 1CDNA 2Y1NA 1DJIA 4NDDA 5AXIA 5JOLA 4M2QA 1S36A 1A4PA 2L2EA 2M49B 2I2RE 2WC8A 2MAZA 1UP5A 1YUTA 1KQVA 1MQ1A 1LA3A 3I5FB 4CIDA 1GGWA 2LMTA 1ZACA 2Y1MA 1CTRA 2K7CA 1A2XA 1WRKA 2L4HA 1SCMB 3LCPC 1S6JA 1KK8B 1NCYA 2PRUA 3IQOA 1F4QA 3CTNA 3LL8B 2ISDA 2LAPA 4ORCB 4MBEA 1IWQA 5DKQA 3VROA 2E30A 4ZCVA 2ZN9A 1TOPA 4MEWA 1DGVA 1KQMB 1RTP1 1SK6D 2QACA 1SRAA 2KQYA 1B47A 4PCWA 1G33A 1UHKA 1NPQA 2KAVA 4ETOA 1YRUB 1NIWA 3LLEA 1QXPA 1B9AA 1B4CA 2JWWA 3NSOA 4YBHB 4ORBB 1J7PA 4PHNA 2AUCA 3H4SE 3D0YA 1ZUZA 1BOCA 2ZN8A 5D7FA 1BR1B 1RWYA 4QJ5B 3I5GB 4Q04A 1OZSA 4MZJA 3SG3A 1K94A 2F3ZA 4HSZA 1DGUA 2KBMA 3EVRA 1XO5A 1S5GY 1QS7A 3WHTB 1CFCA 1MHOA 3PATA 1XVJA 1XK4C 1CM4A 5I2LA 3RM1A 1OMDA 3GK4X 1B7TY 3FWCA 4A4BA 3KHEA 3SJSA 4AOMA 4OR9B 3OX5A 1QV1A 1X02A 2LE9B 4CLNA 2LVKA 2LVIA 2GV5A 3VRPA 5FYXA 2KGRA 3OHMB 1SL8A 1PULA 4U8DA 1UHJA 3DF0B 3I5FC 1A75B 1S6IA 1NWDA 4IL1A 1B1GA 1JWDA 1QLSA 1SCMC 2MLEC 4GNKB 2OS8B 1J7OA 1SYMA 1WLMA 3I5IB 2BKIB 3LK0A 1KK8C 1KSMA 2F33A 2HQWA 2JZIA 1WLZA 4JWQA 4PHKA 4YGBB 4NDCA 3BOWB 1UHHA 2AAOA 4GFTA 1H8BA 2PSRA 4PHJA 3E3RA 1ZMZA 1FI5A 1B8CA 1QIVA 4YGEB 1U5IA 1KQMC 1QX2A 3FS7A 1PRWA 1DF0A 1G4YR 3BYAA 1IJ5A 1TNPA 3FIAA 2KHNA 1BU3A 1UHIA 1SNLA 1H4BA 1RJVA 3BUOB 4DRWA 1CLLA 1M39A 1S5GZ 4F0ZB 2G2BA 4PE0A 1K8UA 1YVLA 1TCOB 2M97A 4FTGA 1GQMA 4OKHA 3GK2A 2R2IA 4WRIA 1OZOA 1B7TZ 2BBMA 1NX2A 3C1VA 3NSKA 4P5OE 1WY9A 4GUKA 4AQJA 1CNPA 3I5GC 1N65A 1CDLA 4N1FA 2BECA 5TNCA 5ER5A 2BCAA 1K93D 1CM1A 3PM8A 4I5NB 1XFZO 2JPTA 2M8UA 1G8IA 1XFUO 2WOSA 2LLSA 4YGDB 1EJ3A 2M1KB 1ODBA 4GPLB 2JQ6A 3TZ1A 4CFRA 2HQ8A 2E6WA 3EKHA 3O6BA 1KK7Y 1A03A 1B8RA 3CWGA 3SIBA 1JF2A 3IQQA 1MXEA 3PLFB 1S1EA 3WXAA 3BUXB 2KYFA 1HQVA 2P6BB 1C7WA 1DJZA 2JT8A 1EG3A 3CR4X 5F6TA 3OB1B 2Q4UA 3ZNIA 4QJ4B 4MZKA 4PDZA 1W7JB 5I2QA 4PHMA 4GGNA 2M7LA 1YVHA 3A4UB 1BLQA 1ZOTB 1CLMA 2OS8C 1QX7A 2ZNDA 2MBXA 1JUOA 3ZWHA 2OPOA 4YGAA 3I5IC 1CDPA 2CBLA 5IBWA 1DVIA 1TN4A 1QX5B 2M3WA 1IQ3A 2I94A 2H2KA 4FQOA 1M46A 2KSPA 2M0RA 2PASA 1IQ5A 3AKAA 2VRGA 2EGDA 1W7IB 1MWNA 1K2HA 2LANA 1CKKA 1OMVA 1KCYA 4GBAA 2MLFC 5HLVA 3CZTX 2CXJA 2MHHA 1CMFA 2L98A 4YRUA 2Q91A 2O60A 1NSHA 1AP4A 2WCBA 4TNCA 1F70A 3KEVA 4XJKB 1RFJA 1JFJA 3K21A 2K61A 2ZFDA 1PSBA 1KK7Z 3HX4A 2L5XB 2KGBC 3KO0A 4HRGA 3SG7A 1CB1A 2LP3A 1NUBA 2LV7A 3PN7B 1DJGA 4P2YB 2BE4A 1DTLA 2JNXA 2TN4A 2OTGB 1OOJA 2CNPA 3AKBA 1EH2A 1L2OB 1M31A 1WDCB 2NZ0A 3NSIA 2MRDA 3SG5A 4DS7A 1DJWA 2LVJA 5CSFA 1S6CA 1UURA 2LHLA 4DIRA 1CLBA 5I2OA 1F8HA 2BKHB 1M63B 5CPVA 4DUQA 3AAKA 4NQGA 2EHBA 1E8AA 2LM5A 1OMRA 2M29A 5PALA 1XFYO 5HYDA 1NX1A 1YX8A 3BUMB 4I5KA 1FBVA 1L7ZA 2LHIA 1JSAA 2F8PA 2D8NA 3TUYB 2Y4QA 3O78A 1LVCD 4CPVA 1JBAA 1Y1XA 2JC2A 2JTTA 1UWOA 3TDZA 2H61C 3VRRA 1SW8A 2KI6D 3TDUA 1YTZC 5J3XA 1TNXA 3FWBA 3KF9A 2Y5IA 2COLB 3JVTB 2A4JA 3SG4A 1KWOB 2L50A 2IS9A 3CS1A 1BG1A 1K90D 2WNDA 3F45A 1S26D 3MSEB 1SL7A 3NXAA 2ZNEA 2ZKMX 1IRJA 2CCMA 1QV0A 2KI6C 2K2AA 1NYAA 4WQ3A 4C0KA 5HLOA 1RK9A 1SKTA 1J55A 2LUXA 4YI9A 4MVFA 4GGFC 3VGOA 2HF5A 1SPYA 2LUCA 3WNXB 3DVEA 1LINA 2BL0B 1DMOA 3JTDB 4QJ3B 2FJUB 4PE4A 1AUIB 1N2DA 4R1EA 2L4IA 3IF7A 5CSJA 3PN7C 1Q80A 3I5HB 1CDMA 2M7NA 2OTGC 3LK1A 1ZFSA 3DF0A 1GJYA 3KPXA 1KFUL 1J7RA 2LVVA 1XFVO 2PVBA 4YGCB 1EL4A 2PALA 4I5LB 1L2OC 1WDCC 4DCKA 4HREE 1FI6A 1BODA 4M2OA 5G08A 4C0JA 5I8NA 3PALA 1DJYA 1FPWA 1J1EA 3BOWA 1BF5A 1CFPA 1SR6B 2ZRSA 1XA5A 1OQPA 2LLTA 4YI8A 1K96A 1EG4A 1YR5A 2JT0A 1K9KA 1QATA 1AHRA 4MRYA 2LMVA 4OCIA 3TUYC 1IJ6A 2KQ6A 2JU0A 3SG6A 1F54A 3PSRA 2KOTA 4NDBA 4ORAB 2L0PA 3AAJA 1BR4B 3SIAA 3CR5X 1Y0VH 2I7AA 3D0YB 3DVJA 3RLZA 1BJFA 4C0LA 1SY9A 2KFHA 4I5JA 1QJTA 1YUUA 1QLKA 4N5XA 4PALA 4USLA 1JFKA 2KNEA 3EK7A 2I18A 3JVTC 2JULA 1XFXO 3QRXA 3BQ3A 1KWOC 2F3YA 4M2PA 4MRXA 2V53A 3CGAA 1MF8B 1TNWA 2F2PA 2HETA 2SASA 3EKJA 3O2PA 1TRFA 1CFDA 2GGZA 1K9PA 4OVNF 3BUWB 5KU1A 1FW4A 1NCZA 1TIZA 1KSOA 3M0WA 1WRLA 5HKZA 2QPTA 2KFFA 4AQIA 3NSLA 4BY4A 1WRZA 2WORA 4D1EA 2FCDA 2MJWB 1XK4A 1CMGA 1MR8A 5AANA 1QTXA 1DJHA 2M9GA 1LXFC 3TS5B 3CR2A 1V1FA 2BL0C 4MN0A 1KFUS 1UUSA 2NCPA 3JTDC 2K0JA 2KAXA 1A29A 1OE9B 2KI4B 1AK8A 2JNFA 1D1OA 1LKJA 1DT7B 2LC5A 4CFQA 2LP2A 3I5HC 2LNKA 2WCFA 3OX6A 1C7VA 2BE6A 1IG5A 1PVBA 3EVUA 1PVAA 4BY5A 1DJXA 2H61A 2JTZA 2KBIA 2LCPA 1RROA 1F4OA 5GQQC 5HKWA 3O4YA 1U5IB 1BT6A 2EC6B 1QASA 1DF0B 2CTNA 4MZLA 1R6PA 1NCXA 4ICBA 4MLWA 5AEQA 1EXRA 2MA2A 1IKUA 2KDHA 3CLNA 1RECA 1MXLC 1SR6C 4JQ0D 4HRHA 2JXCA 2K7DA 1K9UA 2KYCA 3VRNA 3ICBA 1QVIY 2HPSA 1KFXL 5DKRA 2JRFA 1N0YA 1TCFA 4N1GA 1Y1UA 2FOTA 2G9BA 5AERA 1LA0A 4GGFA 5B8IB 1SBJA 1AJ4A 2LLUA 5KSZA 4XJKA 1FF1A 1NX3A 1JC2A 4XYNA 5CSNA 2CT9A 2BCBA 2JOJA 1CFFA 1J7QA 1MUXA 1YUSA 2AMIA 1F55A 4UPGA 3PFVA 2JT3A 5AFPA 2DOQA 3OP0A 3GOFA 1V1GA 3DVKA 1HT9A 2K7BA 2WCEA 3EK4A 1SL9A 3D10A 4WQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMG A;  1Y6W A;  2B1U A;  5KTY A;  4E68 A;  1OSA A;  1AVS A;  4ZCU A;  3SG2 A;  1NX0 A;  2KAY A;  2BBN A;  1PAL A;  2KFG A;  3TS5 C;  1NP8 A;  4OV2 A;  4PE7 A;  1YUR A;  1C07 A;  3A8R A;  3BUN B;  1QIW A;  2LMU A;  5JJG A;  1AJ5 A;  2K2F A;  1YX7 A;  5ER4 X;  2KI4 C;  3GK1 A;  5HKY A;  1XYD A;  4PE1 A;  3DD4 A;  3OB2 B;  3EK8 A;  1A75 A;  2SCP A;  1PSR A;  2ZRT A;  5CSI A;  2NCO A;  5BPJ A;  2GGM A;  1K95 A;  1PK0 D;  1UHN A;  1QVI Z;  2L51 A;  2PMY A;  1B8L A;  1TTX A;  3HCM A;  4MSP A;  2F2O A;  2JXL A;  1F71 A;  4A4C A;  5K89 A;  1J1D A;  2O5G A;  3TDI A;  2K7O A;  1TNQ A;  2EC6 C;  1KFX S;  1R2U A;  3VRQ A;  2K8M B;  2BCX A;  2RGI A;  3DVM A;  1YRT B;  3EVV A;  4GAO A;  1IH0 A;  1XFW O;  2NXQ A;  4L9M A;  4JPZ B;  2FCE A;  1SCV A;  1BMO A;  1M45 A;  1ALV A;  1IGV A;  1VRK A;  1JF0 A;  1Y1A A;  2NLN A;  1ALW A;  3BXK A;  1GGZ A;  5D69 A;  5DKN A;  1S3P A;  2M1U A;  3WHU B;  1CDN A;  2Y1N A;  1DJI A;  4NDD A;  5AXI A;  5JOL A;  4M2Q A;  1S36 A;  1A4P A;  2L2E A;  2M49 B;  2I2R E;  2WC8 A;  2MAZ A;  1UP5 A;  1YUT A;  1KQV A;  1MQ1 A;  1LA3 A;  3I5F B;  4CID A;  1GGW A;  2LMT A;  1ZAC A;  2Y1M A;  1CTR A;  2K7C A;  1A2X A;  1WRK A;  2L4H A;  1SCM B;  3LCP C;  1S6J A;  1KK8 B;  1NCY A;  2PRU A;  3IQO A;  1F4Q A;  3CTN A;  3LL8 B;  2ISD A;  2LAP A;  4ORC B;  4MBE A;  1IWQ A;  5DKQ A;  3VRO A;  2E30 A;  4ZCV A;  2ZN9 A;  1TOP A;  4MEW A;  1DGV A;  1KQM B;  1RTP 1;  1SK6 D;  2QAC A;  1SRA A;  2KQY A;  1B47 A;  4PCW A;  1G33 A;  1UHK A;  1NPQ A;  2KAV A;  4ETO A;  1YRU B;  1NIW A;  3LLE A;  1QXP A;  1B9A A;  1B4C A;  2JWW A;  3NSO A;  4YBH B;  4ORB B;  1J7P A;  4PHN A;  2AUC A;  3H4S E;  3D0Y A;  1ZUZ A;  1BOC A;  2ZN8 A;  5D7F A;  1BR1 B;  1RWY A;  4QJ5 B;  3I5G B;  4Q04 A;  1OZS A;  4MZJ A;  3SG3 A;  1K94 A;  2F3Z A;  4HSZ A;  1DGU A;  2KBM A;  3EVR A;  1XO5 A;  1S5G Y;  1QS7 A;  3WHT B;  1CFC A;  1MHO A;  3PAT A;  1XVJ A;  1XK4 C;  1CM4 A;  5I2L A;  3RM1 A;  1OMD A;  3GK4 X;  1B7T Y;  3FWC A;  4A4B A;  3KHE A;  3SJS A;  4AOM A;  4OR9 B;  3OX5 A;  1QV1 A;  1X02 A;  2LE9 B;  4CLN A;  2LVK A;  2LVI A;  2GV5 A;  3VRP A;  5FYX A;  2KGR A;  3OHM B;  1SL8 A;  1PUL A;  4U8D A;  1UHJ A;  3DF0 B;  3I5F C;  1A75 B;  1S6I A;  1NWD A;  4IL1 A;  1B1G A;  1JWD A;  1QLS A;  1SCM C;  2MLE C;  4GNK B;  2OS8 B;  1J7O A;  1SYM A;  1WLM A;  3I5I B;  2BKI B;  3LK0 A;  1KK8 C;  1KSM A;  2F33 A;  2HQW A;  2JZI A;  1WLZ A;  4JWQ A;  4PHK A;  4YGB B;  4NDC A;  3BOW B;  1UHH A;  2AAO A;  4GFT A;  1H8B A;  2PSR A;  4PHJ A;  3E3R A;  1ZMZ A;  1FI5 A;  1B8C A;  1QIV A;  4YGE B;  1U5I A;  1KQM C;  1QX2 A;  3FS7 A;  1PRW A;  1DF0 A;  1G4Y R;  3BYA A;  1IJ5 A;  1TNP A;  3FIA A;  2KHN A;  1BU3 A;  1UHI A;  1SNL A;  1H4B A;  1RJV A;  3BUO B;  4DRW A;  1CLL A;  1M39 A;  1S5G Z;  4F0Z B;  2G2B A;  4PE0 A;  1K8U A;  1YVL A;  1TCO B;  2M97 A;  4FTG A;  1GQM A;  4OKH A;  3GK2 A;  2R2I A;  4WRI A;  1OZO A;  1B7T Z;  2BBM A;  1NX2 A;  3C1V A;  3NSK A;  4P5O E;  1WY9 A;  4GUK A;  4AQJ A;  1CNP A;  3I5G C;  1N65 A;  1CDL A;  4N1F A;  2BEC A;  5TNC A;  5ER5 A;  2BCA A;  1K93 D;  1CM1 A;  3PM8 A;  4I5N B;  1XFZ O;  2JPT A;  2M8U A;  1G8I A;  1XFU O;  2WOS A;  2LLS A;  4YGD B;  1EJ3 A;  2M1K B;  1ODB A;  4GPL B;  2JQ6 A;  3TZ1 A;  4CFR A;  2HQ8 A;  2E6W A;  3EKH A;  3O6B A;  1KK7 Y;  1A03 A;  1B8R A;  3CWG A;  3SIB A;  1JF2 A;  3IQQ A;  1MXE A;  3PLF B;  1S1E A;  3WXA A;  3BUX B;  2KYF A;  1HQV A;  2P6B B;  1C7W A;  1DJZ A;  2JT8 A;  1EG3 A;  3CR4 X;  5F6T A;  3OB1 B;  2Q4U A;  3ZNI A;  4QJ4 B;  4MZK A;  4PDZ A;  1W7J B;  5I2Q A;  4PHM A;  4GGN A;  2M7L A;  1YVH A;  3A4U B;  1BLQ A;  1ZOT B;  1CLM A;  2OS8 C;  1QX7 A;  2ZND A;  2MBX A;  1JUO A;  3ZWH A;  2OPO A;  4YGA A;  3I5I C;  1CDP A;  2CBL A;  5IBW A;  1DVI A;  1TN4 A;  1QX5 B;  2M3W A;  1IQ3 A;  2I94 A;  2H2K A;  4FQO A;  1M46 A;  2KSP A;  2M0R A;  2PAS A;  1IQ5 A;  3AKA A;  2VRG A;  2EGD A;  1W7I B;  1MWN A;  1K2H A;  2LAN A;  1CKK A;  1OMV A;  1KCY A;  4GBA A;  2MLF C;  5HLV A;  3CZT X;  2CXJ A;  2MHH A;  1CMF A;  2L98 A;  4YRU A;  2Q91 A;  2O60 A;  1NSH A;  1AP4 A;  2WCB A;  4TNC A;  1F70 A;  3KEV A;  4XJK B;  1RFJ A;  1JFJ A;  3K21 A;  2K61 A;  2ZFD A;  1PSB A;  1KK7 Z;  3HX4 A;  2L5X B;  2KGB C;  3KO0 A;  4HRG A;  3SG7 A;  1CB1 A;  2LP3 A;  1NUB A;  2LV7 A;  3PN7 B;  1DJG A;  4P2Y B;  2BE4 A;  1DTL A;  2JNX A;  2TN4 A;  2OTG B;  1OOJ A;  2CNP A;  3AKB A;  1EH2 A;  1L2O B;  1M31 A;  1WDC B;  2NZ0 A;  3NSI A;  2MRD A;  3SG5 A;  4DS7 A;  1DJW A;  2LVJ A;  5CSF A;  1S6C A;  1UUR A;  2LHL A;  4DIR A;  1CLB A;  5I2O A;  1F8H A;  2BKH B;  1M63 B;  5CPV A;  4DUQ A;  3AAK A;  4NQG A;  2EHB A;  1E8A A;  2LM5 A;  1OMR A;  2M29 A;  5PAL A;  1XFY O;  5HYD A;  1NX1 A;  1YX8 A;  3BUM B;  4I5K A;  1FBV A;  1L7Z A;  2LHI A;  1JSA A;  2F8P A;  2D8N A;  3TUY B;  2Y4Q A;  3O78 A;  1LVC D;  4CPV A;  1JBA A;  1Y1X A;  2JC2 A;  2JTT A;  1UWO A;  3TDZ A;  2H61 C;  3VRR A;  1SW8 A;  2KI6 D;  3TDU A;  1YTZ C;  5J3X A;  1TNX A;  3FWB A;  3KF9 A;  2Y5I A;  2COL B;  3JVT B;  2A4J A;  3SG4 A;  1KWO B;  2L50 A;  2IS9 A;  3CS1 A;  1BG1 A;  1K90 D;  2WND A;  3F45 A;  1S26 D;  3MSE B;  1SL7 A;  3NXA A;  2ZNE A;  2ZKM X;  1IRJ A;  2CCM A;  1QV0 A;  2KI6 C;  2K2A A;  1NYA A;  4WQ3 A;  4C0K A;  5HLO A;  1RK9 A;  1SKT A;  1J55 A;  2LUX A;  4YI9 A;  4MVF A;  4GGF C;  3VGO A;  2HF5 A;  1SPY A;  2LUC A;  3WNX B;  3DVE A;  1LIN A;  2BL0 B;  1DMO A;  3JTD B;  4QJ3 B;  2FJU B;  4PE4 A;  1AUI B;  1N2D A;  4R1E A;  2L4I A;  3IF7 A;  5CSJ A;  3PN7 C;  1Q80 A;  3I5H B;  1CDM A;  2M7N A;  2OTG C;  3LK1 A;  1ZFS A;  3DF0 A;  1GJY A;  3KPX A;  1KFU L;  1J7R A;  2LVV A;  1XFV O;  2PVB A;  4YGC B;  1EL4 A;  2PAL A;  4I5L B;  1L2O C;  1WDC C;  4DCK A;  4HRE E;  1FI6 A;  1BOD A;  4M2O A;  5G08 A;  4C0J A;  5I8N A;  3PAL A;  1DJY A;  1FPW A;  1J1E A;  3BOW A;  1BF5 A;  1CFP A;  1SR6 B;  2ZRS A;  1XA5 A;  1OQP A;  2LLT A;  4YI8 A;  1K96 A;  1EG4 A;  1YR5 A;  2JT0 A;  1K9K A;  1QAT A;  1AHR A;  4MRY A;  2LMV A;  4OCI A;  3TUY C;  1IJ6 A;  2KQ6 A;  2JU0 A;  3SG6 A;  1F54 A;  3PSR A;  2KOT A;  4NDB A;  4ORA B;  2L0P A;  3AAJ A;  1BR4 B;  3SIA A;  3CR5 X;  1Y0V H;  2I7A A;  3D0Y B;  3DVJ A;  3RLZ A;  1BJF A;  4C0L A;  1SY9 A;  2KFH A;  4I5J A;  1QJT A;  1YUU A;  1QLK A;  4N5X A;  4PAL A;  4USL A;  1JFK A;  2KNE A;  3EK7 A;  2I18 A;  3JVT C;  2JUL A;  1XFX O;  3QRX A;  3BQ3 A;  1KWO C;  2F3Y A;  4M2P A;  4MRX A;  2V53 A;  3CGA A;  1MF8 B;  1TNW A;  2F2P A;  2HET A;  2SAS A;  3EKJ A;  3O2P A;  1TRF A;  1CFD A;  2GGZ A;  1K9P A;  4OVN F;  3BUW B;  5KU1 A;  1FW4 A;  1NCZ A;  1TIZ A;  1KSO A;  3M0W A;  1WRL A;  5HKZ A;  2QPT A;  2KFF A;  4AQI A;  3NSL A;  4BY4 A;  1WRZ A;  2WOR A;  4D1E A;  2FCD A;  2MJW B;  1XK4 A;  1CMG A;  1MR8 A;  5AAN A;  1QTX A;  1DJH A;  2M9G A;  1LXF C;  3TS5 B;  3CR2 A;  1V1F A;  2BL0 C;  4MN0 A;  1KFU S;  1UUS A;  2NCP A;  3JTD C;  2K0J A;  2KAX A;  1A29 A;  1OE9 B;  2KI4 B;  1AK8 A;  2JNF A;  1D1O A;  1LKJ A;  1DT7 B;  2LC5 A;  4CFQ A;  2LP2 A;  3I5H C;  2LNK A;  2WCF A;  3OX6 A;  1C7V A;  2BE6 A;  1IG5 A;  1PVB A;  3EVU A;  1PVA A;  4BY5 A;  1DJX A;  2H61 A;  2JTZ A;  2KBI A;  2LCP A;  1RRO A;  1F4O A;  5GQQ C;  5HKW A;  3O4Y A;  1U5I B;  1BT6 A;  2EC6 B;  1QAS A;  1DF0 B;  2CTN A;  4MZL A;  1R6P A;  1NCX A;  4ICB A;  4MLW A;  5AEQ A;  1EXR A;  2MA2 A;  1IKU A;  2KDH A;  3CLN A;  1REC A;  1MXL C;  1SR6 C;  4JQ0 D;  4HRH A;  2JXC A;  2K7D A;  1K9U A;  2KYC A;  3VRN A;  3ICB A;  1QVI Y;  2HPS A;  1KFX L;  5DKR A;  2JRF A;  1N0Y A;  1TCF A;  4N1G A;  1Y1U A;  2FOT A;  2G9B A;  5AER A;  1LA0 A;  4GGF A;  5B8I B;  1SBJ A;  1AJ4 A;  2LLU A;  5KSZ A;  4XJK A;  1FF1 A;  1NX3 A;  1JC2 A;  4XYN A;  5CSN A;  2CT9 A;  2BCB A;  2JOJ A;  1CFF A;  1J7Q A;  1MUX A;  1YUS A;  2AMI A;  1F55 A;  4UPG A;  3PFV A;  2JT3 A;  5AFP A;  2DOQ A;  3OP0 A;  3GOF A;  1V1G A;  3DVK A;  1HT9 A;  2K7B A;  2WCE A;  3EK4 A;  1SL9 A;  3D10 A;  4WQ2 A; 
#chains in the Genus database with same CATH topology
 1SMG A;  1Y6W A;  2B1U A;  5KTY A;  4E68 A;  1OSA A;  1AVS A;  1LS8 A;  3L4L A;  4ZCU A;  1NX0 A;  3SG2 A;  2KAY A;  2BBN A;  3S0A A;  1PAL A;  2KFG A;  3TS5 C;  1NP8 A;  4OV2 A;  4PE7 A;  3CZ0 A;  1YUR A;  1C07 A;  1GM0 A;  3A8R A;  3BUN B;  1QIW A;  2LMU A;  5JJG A;  1AJ5 A;  2K2F A;  1OW4 A;  1YX7 A;  5ER4 X;  2KI4 C;  3GK1 A;  5HKY A;  1XYD A;  2BNX A;  4PE1 A;  3DD4 A;  3OB2 B;  2YGU A;  3EK8 A;  1A75 A;  2SCP A;  1PSR A;  2ZRT A;  5CSI A;  2NCO A;  5BPJ A;  2GGM A;  1K95 A;  1PK0 D;  1UHN A;  1QVI Z;  2L51 A;  2PMY A;  1B8L A;  1TTX A;  3HCM A;  4MSP A;  2F2O A;  5FI7 A;  2JXL A;  1F71 A;  4A4C A;  5K89 A;  1J1D A;  2O5G A;  3TDI A;  2K7O A;  1TNQ A;  1DQE A;  2EC6 C;  1KFX S;  1R2U A;  2QEH A;  2K8M B;  2BCX A;  2RGI A;  3DVM A;  1YRT B;  3EVV A;  4GAO A;  1IH0 A;  1XFW O;  2PYQ A;  2NXQ A;  4L9M A;  4JPZ B;  2FCE A;  1SCV A;  1BMO A;  1M45 A;  3L4A A;  1ALV A;  1IGV A;  1VRK A;  1Y1A A;  1JF0 A;  2NLN A;  1ALW A;  3BXK A;  3L47 A;  1GGZ A;  5D69 A;  5DKN A;  1S3P A;  2M1U A;  3WHU B;  1CDN A;  2JPO A;  2Y1N A;  1DJI A;  4NDD A;  5AXI A;  5JOL A;  4M2Q A;  1S36 A;  1A4P A;  2L2E A;  2M49 B;  2I2R E;  2WC8 A;  2MAZ A;  1UP5 A;  1YUT A;  3VRQ A;  1KQV A;  1MQ1 A;  3DY9 A;  1LA3 A;  2QEB A;  3I5F B;  4CID A;  3FE9 A;  1GGW A;  2LMT A;  1ZAC A;  2BAP A;  2Y1M A;  1CTR A;  2K7C A;  1A2X A;  1WRK A;  2L4H A;  1SCM B;  3LCP C;  1S6J A;  1KK8 B;  1NCY A;  2PRU A;  3IQO A;  3NHI A;  1F4Q A;  3CTN A;  3LL8 B;  2ISD A;  3D76 A;  2LAP A;  4ORC B;  4MBE A;  1IWQ A;  5DKQ A;  3VRO A;  2E30 A;  4ZCV A;  2ZN9 A;  1TOP A;  4MEW A;  1XFR A;  1DGV A;  1KQM B;  1RTP 1;  1SK6 D;  2QAC A;  1SRA A;  2KQY A;  1B47 A;  4PCW A;  1G33 A;  1UHK A;  1NPQ A;  1T14 A;  2KAV A;  4ETO A;  1YRU B;  1NIW A;  1Z4H A;  3LLE A;  1QXP A;  3BFA A;  1B9A A;  1B4C A;  2JWW A;  3NSO A;  4YBH B;  3NHT A;  4ORB B;  1J7P A;  4PHN A;  2AUC A;  3H4S E;  3D0Y A;  1ZUZ A;  1BOC A;  2ZN8 A;  3CZ2 A;  1IIO A;  5D7F A;  1BR1 B;  1RWY A;  4QJ5 B;  3I5G B;  4Q04 A;  1OZS A;  4MZJ A;  3BFH A;  3SG3 A;  1K94 A;  2F3Z A;  4HSZ A;  1DGU A;  2KBM A;  3EVR A;  1XO5 A;  1S5G Y;  1QS7 A;  3WHT B;  1CFC A;  1MHO A;  3PAT A;  1XVJ A;  1XK4 C;  1CM4 A;  3B87 A;  5I2L A;  3RM1 A;  1OMD A;  3GK4 X;  1B7T Y;  3FWC A;  4A4B A;  3KHE A;  3SJS A;  4AOM A;  4OR9 B;  3OX5 A;  1QV1 A;  1X02 A;  3R1O A;  2FJY A;  2LE9 B;  4CLN A;  2LVK A;  2LVI A;  3PJI A;  2GV5 A;  3VRP A;  5FYX A;  2KGR A;  3D77 A;  1SL8 A;  1PUL A;  3FE6 A;  3OHM B;  4U8D A;  3N7H A;  1UHJ A;  3DF0 B;  3I5F C;  1A75 B;  1S6I A;  1NWD A;  4IL1 A;  1B1G A;  1JWD A;  1QLS A;  1SCM C;  2MLE C;  2WCM A;  4GNK B;  2OS8 B;  1J7O A;  1SYM A;  1WLM A;  3I5I B;  2BKI B;  2WC6 A;  2L2C A;  1KK8 C;  1KSM A;  2F33 A;  2HQW A;  2JZI A;  1WLZ A;  4JWQ A;  4PHK A;  4YGB B;  4NDC A;  3BOW B;  1UHH A;  2AAO A;  2WCK A;  2KLD A;  4GFT A;  2PSR A;  1H8B A;  4PHJ A;  3E3R A;  1ZMZ A;  2GTE A;  1FI5 A;  1B8C A;  1QIV A;  4YGE B;  1U5I A;  1KQM C;  1QX2 A;  3FS7 A;  4JD9 A;  1PRW A;  1DF0 A;  1G4Y R;  3BYA A;  3LK0 A;  1IJ5 A;  1TNP A;  3FIA A;  2KHN A;  1BU3 A;  1UHI A;  1SNL A;  1H4B A;  1RJV A;  3BUO B;  4DRW A;  1CLL A;  1M39 A;  5I94 A;  1S5G Z;  4F0Z B;  2G2B A;  3CYZ A;  4PE0 A;  1K8U A;  1YVL A;  1DEL A;  1TCO B;  2M97 A;  4FTG A;  1GQM A;  4OKH A;  3GK2 A;  2R2I A;  4WRI A;  1OZO A;  1B7T Z;  2BBM A;  1NX2 A;  3C1V A;  3NSK A;  4P5O E;  1WY9 A;  4GUK A;  4AQJ A;  1CNP A;  3I5G C;  1N65 A;  1CDL A;  4N1F A;  2BEC A;  5TNC A;  4KYN A;  5ER5 A;  3DYE A;  2BCA A;  1K93 D;  1CM1 A;  3PM8 A;  4I5N B;  1XFZ O;  2JPT A;  2M8U A;  1G8I A;  2QEV A;  1XFU O;  2WOS A;  3FE8 A;  2LLS A;  3O4X A;  1EJ3 A;  4YGD B;  2M1K B;  1ODB A;  4GPL B;  2JQ6 A;  1TUJ A;  3TZ1 A;  4CFR A;  2HQ8 A;  2E6W A;  3EKH A;  3O6B A;  4JKT A;  1KK7 Y;  3BFB A;  1A03 A;  1B8R A;  3CWG A;  3SIB A;  3S0G A;  1JF2 A;  3IQQ A;  1MXE A;  3PLF B;  1S1E A;  3WXA A;  3BUX B;  2KYF A;  1HQV A;  1Z2C B;  2P6B B;  1C7W A;  1DJZ A;  2JT8 A;  1EG3 A;  3CR4 X;  5F6T A;  3OB1 B;  2Q4U A;  3ZNI A;  4QJ4 B;  4MZK A;  4PDZ A;  1W7J B;  5I2Q A;  4PHM A;  4GGN A;  2M7L A;  1YVH A;  3A4U B;  2L5Y A;  2P70 A;  1BLQ A;  1ZOT B;  1CLM A;  1ORG A;  1QX7 A;  2OS8 C;  2ZND A;  2MBX A;  1JUO A;  2P71 A;  2OPO A;  3ZWH A;  1C3Y A;  4YGA A;  3I5I C;  3R72 A;  1CDP A;  3RZS A;  2CBL A;  5IBW A;  1DVI A;  2WCH A;  1TN4 A;  1QX5 B;  2M3W A;  1IQ3 A;  2I94 A;  2H2K A;  4FQO A;  1M46 A;  2KSP A;  2M0R A;  2PAS A;  1IQ5 A;  3AKA A;  3DXL A;  2VRG A;  2EGD A;  1W7I B;  1MWN A;  1K2H A;  2LAN A;  1CKK A;  1C3Z A;  1OMV A;  1KCY A;  4GBA A;  2MLF C;  5HLV A;  3CZT X;  2CXJ A;  2MHH A;  2WC5 A;  3IVT A;  1CMF A;  2L98 A;  3R1P A;  4YRU A;  2Q91 A;  2O60 A;  1NSH A;  1AP4 A;  2WCB A;  4TNC A;  1F70 A;  3KEV A;  4XJK B;  1RFJ A;  3SS4 A;  1JFJ A;  3K21 A;  2K61 A;  2ZFD A;  1PSB A;  4INW A;  3CAB A;  3NGV A;  1KK7 Z;  3HX4 A;  2L5X B;  2KGB C;  2WCJ A;  3EG5 B;  3KO0 A;  4HRG A;  3SG7 A;  1CB1 A;  2LP3 A;  1NUB A;  2LV7 A;  3PN7 B;  1DJG A;  4P2Y B;  2BE4 A;  1DTL A;  2ERB A;  2JNX A;  2TN4 A;  3VB1 A;  2OTG B;  1OOJ A;  2CNP A;  3AKB A;  3D78 A;  3R1V A;  4F7F A;  1EH2 A;  1L2O B;  1M31 A;  1WDC B;  2NZ0 A;  3NSI A;  2MRD A;  3SG5 A;  4DS7 A;  1DJW A;  2LVJ A;  1TWO A;  5CSF A;  1S6C A;  1UUR A;  2LHL A;  4DIR A;  1CLB A;  5I2O A;  1F8H A;  2BKH B;  2QDI A;  1M63 B;  5CPV A;  4DUQ A;  3AAK A;  3S0F A;  3B86 A;  4NQG A;  2EHB A;  1E8A A;  2LM5 A;  1OMR A;  2M29 A;  5PAL A;  1XFY O;  5HYD A;  1NX1 A;  1YX8 A;  3BUM B;  4I5K A;  1OOH A;  1FBV A;  1DEK A;  1L7Z A;  2LHI A;  1JSA A;  3SS5 A;  2F8P A;  2D8N A;  3TUY B;  1DC1 A;  2Y4Q A;  3O78 A;  1LVC D;  4CPV A;  1SSE B;  1JBA A;  1Y1X A;  2JC2 A;  2JTT A;  1UWO A;  3TDZ A;  2H61 C;  3VRR A;  1SW8 A;  2KI6 D;  3TDU A;  1YTZ C;  3S0B A;  5J3X A;  1TNX A;  3FWB A;  3KF9 A;  2Y5I A;  2COL B;  3JVT B;  2A4J A;  3D74 A;  3QME A;  1KWO B;  2L50 A;  3SG4 A;  2IS9 A;  3CS1 A;  1BG1 A;  1K90 D;  3UO9 A;  2WND A;  3F45 A;  1S26 D;  3MSE B;  1SL7 A;  3NXA A;  3SS3 A;  2ZNE A;  2ZKM X;  1IRJ A;  2CCM A;  1QV0 A;  2KI6 C;  2K2A A;  1NYA A;  4WQ3 A;  4C0K A;  5HLO A;  1RK9 A;  1SKT A;  1J55 A;  2LUX A;  4YI9 A;  4FQT A;  4MVF A;  3Q8I A;  4GGF C;  3VGO A;  2HF5 A;  1SPY A;  2LUC A;  3WNX B;  3DVE A;  1LIN A;  2BL0 B;  1DMO A;  3JTD B;  3D73 A;  4QJ3 B;  2FJU B;  4PE4 A;  1AUI B;  1N2D A;  1OOG A;  4R1E A;  2L4I A;  3IF7 A;  5CSJ A;  3PN7 C;  1Q80 A;  3I5H B;  1CDM A;  2M7N A;  2OTG C;  3LK1 A;  1ZFS A;  3DF0 A;  1GJY A;  3KPX A;  1KFU L;  1J7R A;  2LVV A;  1XFV O;  2PVB A;  4YGC B;  1EL4 A;  2PAL A;  4I5L B;  1L2O C;  3S0D A;  1WDC C;  3B88 A;  4DCK A;  3D75 A;  4HRE E;  1FI6 A;  1BOD A;  4M2O A;  5G08 A;  4C0J A;  5I8N A;  3PAL A;  1DJY A;  3CDN A;  1FPW A;  2QEO A;  1J1E A;  3BOW A;  1BF5 A;  1CFP A;  1SR6 B;  2ZRS A;  1XA5 A;  1OQP A;  2LLT A;  3OGN A;  4YI8 A;  1K96 A;  1EG4 A;  1YR5 A;  2JT0 A;  1K9K A;  1QAT A;  1AHR A;  4MRY A;  2LMV A;  4OCI A;  3TUY C;  4OZD A;  3BJH A;  1IJ6 A;  2KQ6 A;  2JU0 A;  3SG6 A;  1F54 A;  3PSR A;  2KOT A;  4NDB A;  4ORA B;  2L0P A;  3AAJ A;  1BR4 B;  3SIA A;  3CR5 X;  1Y0V H;  2I7A A;  3D0Y B;  2H8V A;  3DVJ A;  1BJF A;  3RLZ A;  4C0L A;  1SY9 A;  2KFH A;  4I5J A;  1QJT A;  1YUU A;  1QLK A;  4N5X A;  4PAL A;  4USL A;  1JFK A;  2KNE A;  3EK7 A;  2I18 A;  3JVT C;  2JUL A;  1XFX O;  3QRX A;  3BQ3 A;  1KWO C;  3B6X A;  5DIC A;  2F3Y A;  4M2P A;  4MRX A;  2V53 A;  3CGA A;  4PT1 A;  1MF8 B;  1TNW A;  2F2P A;  2HET A;  2SAS A;  3EKJ A;  3O2P A;  5D3O A;  1TRF A;  1CFD A;  2GGZ A;  1K9P A;  4OVN F;  3BUW B;  5KU1 A;  1FW4 A;  1NCZ A;  1TIZ A;  1KSO A;  3M0W A;  1WRL A;  5HKZ A;  2QPT A;  2KFF A;  4AQI A;  3NSL A;  1OOI X;  4BY4 A;  1WRZ A;  2WOR A;  4D1E A;  2FCD A;  2MJW B;  1XK4 A;  1CMG A;  3S0E A;  1MR8 A;  5AAN A;  1P28 A;  1QTX A;  1DJH A;  2M9G A;  1LXF C;  3TS5 B;  3CR2 A;  1V1F A;  2BL0 C;  4MN0 A;  1KFU S;  1UUS A;  3UNW A;  2NCP A;  3JTD C;  2K0J A;  2KAX A;  1A29 A;  1OE9 B;  2KI4 B;  1AK8 A;  2JNF A;  5EL2 A;  1D1O A;  1LKJ A;  1DT7 B;  2LC5 A;  4CFQ A;  2LP2 A;  3I5H C;  2LNK A;  2WCF A;  3OX6 A;  1C7V A;  2BE6 A;  1IG5 A;  2K60 A;  1PVB A;  3EVU A;  1PVA A;  4BY5 A;  2KPH A;  1DJX A;  3K1E A;  2H61 A;  2JTZ A;  2KBI A;  1QWV A;  2LCP A;  4INX A;  1OOF A;  1RRO A;  1F4O A;  5GQQ C;  5HKW A;  3O4Y A;  1U5I B;  1BT6 A;  2EC6 B;  1QAS A;  1DF0 B;  2CTN A;  4MZL A;  1R6P A;  1NCX A;  4ICB A;  4MLW A;  5AEQ A;  1EXR A;  2MA2 A;  1IKU A;  2KDH A;  3CLN A;  1REC A;  1MXL C;  1SR6 C;  4JQ0 D;  3V2L A;  4HRH A;  2JXC A;  2K7D A;  1K9U A;  1W9Z A;  2KYC A;  3VRN A;  3ICB A;  1QVI Y;  2HPS A;  2WCL A;  1KFX L;  3CZ1 A;  2JRF A;  1N0Y A;  3OBV A;  1TCF A;  5DKR A;  4N1G A;  1Y1U A;  2FOT A;  2G9B A;  2PQL A;  5AER A;  1LA0 A;  4GGF A;  4IJ7 A;  5B8I B;  1SBJ A;  1AJ4 A;  2LLU A;  2KLE A;  5HL1 A;  5KSZ A;  3DZT A;  4XJK A;  1FF1 A;  1NX3 A;  1JC2 A;  5FI6 A;  5FI2 A;  4XYN A;  5CSN A;  2CT9 A;  2BCB A;  2JOJ A;  1CFF A;  1J7Q A;  1MUX A;  3PM2 A;  1YUS A;  2AMI A;  1F55 A;  4UPG A;  3PFV A;  2JT3 A;  5AFP A;  2DOQ A;  3OP0 A;  3GOF A;  1V1G A;  1TUZ A;  3DVK A;  1HT9 A;  2K7B A;  3B7A A;  2WCE A;  3EK4 A;  1SL9 A;  3D10 A;  4WQ2 A; 
#chains in the Genus database with same CATH homology
 1SMG A;  1Y6W A;  2B1U A;  5KTY A;  4E68 A;  1OSA A;  1AVS A;  4ZCU A;  3SG2 A;  1NX0 A;  2KAY A;  2BBN A;  1PAL A;  2KFG A;  3TS5 C;  1NP8 A;  4OV2 A;  4PE7 A;  1YUR A;  1C07 A;  3A8R A;  3BUN B;  1QIW A;  2LMU A;  5JJG A;  1AJ5 A;  2K2F A;  1YX7 A;  5ER4 X;  2KI4 C;  3GK1 A;  5HKY A;  1XYD A;  4PE1 A;  3DD4 A;  3OB2 B;  3EK8 A;  1A75 A;  2SCP A;  1PSR A;  2ZRT A;  5CSI A;  2NCO A;  5BPJ A;  2GGM A;  1K95 A;  1PK0 D;  1UHN A;  1QVI Z;  2L51 A;  2PMY A;  1B8L A;  1TTX A;  3HCM A;  4MSP A;  2F2O A;  2JXL A;  1F71 A;  4A4C A;  5K89 A;  1J1D A;  2O5G A;  3TDI A;  2K7O A;  1TNQ A;  2EC6 C;  1KFX S;  1R2U A;  3VRQ A;  2K8M B;  2BCX A;  2RGI A;  3DVM A;  1YRT B;  3EVV A;  4GAO A;  1IH0 A;  1XFW O;  2NXQ A;  4L9M A;  4JPZ B;  2FCE A;  1SCV A;  1BMO A;  1M45 A;  1ALV A;  1IGV A;  1VRK A;  1JF0 A;  1Y1A A;  2NLN A;  1ALW A;  3BXK A;  1GGZ A;  5D69 A;  5DKN A;  1S3P A;  2M1U A;  3WHU B;  1CDN A;  2Y1N A;  1DJI A;  4NDD A;  5AXI A;  5JOL A;  4M2Q A;  1S36 A;  1A4P A;  2L2E A;  2M49 B;  2I2R E;  2WC8 A;  2MAZ A;  1UP5 A;  1YUT A;  1KQV A;  1MQ1 A;  1LA3 A;  3I5F B;  4CID A;  1GGW A;  2LMT A;  1ZAC A;  2Y1M A;  1CTR A;  2K7C A;  1A2X A;  1WRK A;  2L4H A;  1SCM B;  3LCP C;  1S6J A;  1KK8 B;  1NCY A;  2PRU A;  3IQO A;  1F4Q A;  3CTN A;  3LL8 B;  2ISD A;  2LAP A;  4ORC B;  4MBE A;  1IWQ A;  5DKQ A;  3VRO A;  2E30 A;  4ZCV A;  2ZN9 A;  1TOP A;  4MEW A;  1DGV A;  1KQM B;  1RTP 1;  1SK6 D;  2QAC A;  1SRA A;  2KQY A;  1B47 A;  4PCW A;  1G33 A;  1UHK A;  1NPQ A;  2KAV A;  4ETO A;  1YRU B;  1NIW A;  3LLE A;  1QXP A;  1B9A A;  1B4C A;  2JWW A;  3NSO A;  4YBH B;  4ORB B;  1J7P A;  4PHN A;  2AUC A;  3H4S E;  3D0Y A;  1ZUZ A;  1BOC A;  2ZN8 A;  5D7F A;  1BR1 B;  1RWY A;  4QJ5 B;  3I5G B;  4Q04 A;  1OZS A;  4MZJ A;  3SG3 A;  1K94 A;  2F3Z A;  4HSZ A;  1DGU A;  2KBM A;  3EVR A;  1XO5 A;  1S5G Y;  1QS7 A;  3WHT B;  1CFC A;  1MHO A;  3PAT A;  1XVJ A;  1XK4 C;  1CM4 A;  5I2L A;  3RM1 A;  1OMD A;  3GK4 X;  1B7T Y;  3FWC A;  4A4B A;  3KHE A;  3SJS A;  4AOM A;  4OR9 B;  3OX5 A;  1QV1 A;  1X02 A;  2LE9 B;  4CLN A;  2LVK A;  2LVI A;  2GV5 A;  3VRP A;  5FYX A;  2KGR A;  3OHM B;  1SL8 A;  1PUL A;  4U8D A;  1UHJ A;  3DF0 B;  3I5F C;  1A75 B;  1S6I A;  1NWD A;  4IL1 A;  1B1G A;  1JWD A;  1QLS A;  1SCM C;  2MLE C;  4GNK B;  2OS8 B;  1J7O A;  1SYM A;  1WLM A;  3I5I B;  2BKI B;  3LK0 A;  1KK8 C;  1KSM A;  2F33 A;  2HQW A;  2JZI A;  1WLZ A;  4JWQ A;  4PHK A;  4YGB B;  4NDC A;  3BOW B;  1UHH A;  2AAO A;  4GFT A;  1H8B A;  2PSR A;  4PHJ A;  3E3R A;  1ZMZ A;  1FI5 A;  1B8C A;  1QIV A;  4YGE B;  1U5I A;  1KQM C;  1QX2 A;  3FS7 A;  1PRW A;  1DF0 A;  1G4Y R;  3BYA A;  1IJ5 A;  1TNP A;  3FIA A;  2KHN A;  1BU3 A;  1UHI A;  1SNL A;  1H4B A;  1RJV A;  3BUO B;  4DRW A;  1CLL A;  1M39 A;  1S5G Z;  4F0Z B;  2G2B A;  4PE0 A;  1K8U A;  1YVL A;  1TCO B;  2M97 A;  4FTG A;  1GQM A;  4OKH A;  3GK2 A;  2R2I A;  4WRI A;  1OZO A;  1B7T Z;  2BBM A;  1NX2 A;  3C1V A;  3NSK A;  4P5O E;  1WY9 A;  4GUK A;  4AQJ A;  1CNP A;  3I5G C;  1N65 A;  1CDL A;  4N1F A;  2BEC A;  5TNC A;  5ER5 A;  2BCA A;  1K93 D;  1CM1 A;  3PM8 A;  4I5N B;  1XFZ O;  2JPT A;  2M8U A;  1G8I A;  1XFU O;  2WOS A;  2LLS A;  4YGD B;  1EJ3 A;  2M1K B;  1ODB A;  4GPL B;  2JQ6 A;  3TZ1 A;  4CFR A;  2HQ8 A;  2E6W A;  3EKH A;  3O6B A;  1KK7 Y;  1A03 A;  1B8R A;  3CWG A;  3SIB A;  1JF2 A;  3IQQ A;  1MXE A;  3PLF B;  1S1E A;  3WXA A;  3BUX B;  2KYF A;  1HQV A;  2P6B B;  1C7W A;  1DJZ A;  2JT8 A;  1EG3 A;  3CR4 X;  5F6T A;  3OB1 B;  2Q4U A;  3ZNI A;  4QJ4 B;  4MZK A;  4PDZ A;  1W7J B;  5I2Q A;  4PHM A;  4GGN A;  2M7L A;  1YVH A;  3A4U B;  1BLQ A;  1ZOT B;  1CLM A;  2OS8 C;  1QX7 A;  2ZND A;  2MBX A;  1JUO A;  3ZWH A;  2OPO A;  4YGA A;  3I5I C;  1CDP A;  2CBL A;  5IBW A;  1DVI A;  1TN4 A;  1QX5 B;  2M3W A;  1IQ3 A;  2I94 A;  2H2K A;  4FQO A;  1M46 A;  2KSP A;  2M0R A;  2PAS A;  1IQ5 A;  3AKA A;  2VRG A;  2EGD A;  1W7I B;  1MWN A;  1K2H A;  2LAN A;  1CKK A;  1OMV A;  1KCY A;  4GBA A;  2MLF C;  5HLV A;  3CZT X;  2CXJ A;  2MHH A;  1CMF A;  2L98 A;  4YRU A;  2Q91 A;  2O60 A;  1NSH A;  1AP4 A;  2WCB A;  4TNC A;  1F70 A;  3KEV A;  4XJK B;  1RFJ A;  1JFJ A;  3K21 A;  2K61 A;  2ZFD A;  1PSB A;  1KK7 Z;  3HX4 A;  2L5X B;  2KGB C;  3KO0 A;  4HRG A;  3SG7 A;  1CB1 A;  2LP3 A;  1NUB A;  2LV7 A;  3PN7 B;  1DJG A;  4P2Y B;  2BE4 A;  1DTL A;  2JNX A;  2TN4 A;  2OTG B;  1OOJ A;  2CNP A;  3AKB A;  1EH2 A;  1L2O B;  1M31 A;  1WDC B;  2NZ0 A;  3NSI A;  2MRD A;  3SG5 A;  4DS7 A;  1DJW A;  2LVJ A;  5CSF A;  1S6C A;  1UUR A;  2LHL A;  4DIR A;  1CLB A;  5I2O A;  1F8H A;  2BKH B;  1M63 B;  5CPV A;  4DUQ A;  3AAK A;  4NQG A;  2EHB A;  1E8A A;  2LM5 A;  1OMR A;  2M29 A;  5PAL A;  1XFY O;  5HYD A;  1NX1 A;  1YX8 A;  3BUM B;  4I5K A;  1FBV A;  1L7Z A;  2LHI A;  1JSA A;  2F8P A;  2D8N A;  3TUY B;  2Y4Q A;  3O78 A;  1LVC D;  4CPV A;  1JBA A;  1Y1X A;  2JC2 A;  2JTT A;  1UWO A;  3TDZ A;  2H61 C;  3VRR A;  1SW8 A;  2KI6 D;  3TDU A;  1YTZ C;  5J3X A;  1TNX A;  3FWB A;  3KF9 A;  2Y5I A;  2COL B;  3JVT B;  2A4J A;  3SG4 A;  1KWO B;  2L50 A;  2IS9 A;  3CS1 A;  1BG1 A;  1K90 D;  2WND A;  3F45 A;  1S26 D;  3MSE B;  1SL7 A;  3NXA A;  2ZNE A;  2ZKM X;  1IRJ A;  2CCM A;  1QV0 A;  2KI6 C;  2K2A A;  1NYA A;  4WQ3 A;  4C0K A;  5HLO A;  1RK9 A;  1SKT A;  1J55 A;  2LUX A;  4YI9 A;  4MVF A;  4GGF C;  3VGO A;  2HF5 A;  1SPY A;  2LUC A;  3WNX B;  3DVE A;  1LIN A;  2BL0 B;  1DMO A;  3JTD B;  4QJ3 B;  2FJU B;  4PE4 A;  1AUI B;  1N2D A;  4R1E A;  2L4I A;  3IF7 A;  5CSJ A;  3PN7 C;  1Q80 A;  3I5H B;  1CDM A;  2M7N A;  2OTG C;  3LK1 A;  1ZFS A;  3DF0 A;  1GJY A;  3KPX A;  1KFU L;  1J7R A;  2LVV A;  1XFV O;  2PVB A;  4YGC B;  1EL4 A;  2PAL A;  4I5L B;  1L2O C;  1WDC C;  4DCK A;  4HRE E;  1FI6 A;  1BOD A;  4M2O A;  5G08 A;  4C0J A;  5I8N A;  3PAL A;  1DJY A;  1FPW A;  1J1E A;  3BOW A;  1BF5 A;  1CFP A;  1SR6 B;  2ZRS A;  1XA5 A;  1OQP A;  2LLT A;  4YI8 A;  1K96 A;  1EG4 A;  1YR5 A;  2JT0 A;  1K9K A;  1QAT A;  1AHR A;  4MRY A;  2LMV A;  4OCI A;  3TUY C;  1IJ6 A;  2KQ6 A;  2JU0 A;  3SG6 A;  1F54 A;  3PSR A;  2KOT A;  4NDB A;  4ORA B;  2L0P A;  3AAJ A;  1BR4 B;  3SIA A;  3CR5 X;  1Y0V H;  2I7A A;  3D0Y B;  3DVJ A;  3RLZ A;  1BJF A;  4C0L A;  1SY9 A;  2KFH A;  4I5J A;  1QJT A;  1YUU A;  1QLK A;  4N5X A;  4PAL A;  4USL A;  1JFK A;  2KNE A;  3EK7 A;  2I18 A;  3JVT C;  2JUL A;  1XFX O;  3QRX A;  3BQ3 A;  1KWO C;  2F3Y A;  4M2P A;  4MRX A;  2V53 A;  3CGA A;  1MF8 B;  1TNW A;  2F2P A;  2HET A;  2SAS A;  3EKJ A;  3O2P A;  1TRF A;  1CFD A;  2GGZ A;  1K9P A;  4OVN F;  3BUW B;  5KU1 A;  1FW4 A;  1NCZ A;  1TIZ A;  1KSO A;  3M0W A;  1WRL A;  5HKZ A;  2QPT A;  2KFF A;  4AQI A;  3NSL A;  4BY4 A;  1WRZ A;  2WOR A;  4D1E A;  2FCD A;  2MJW B;  1XK4 A;  1CMG A;  1MR8 A;  5AAN A;  1QTX A;  1DJH A;  2M9G A;  1LXF C;  3TS5 B;  3CR2 A;  1V1F A;  2BL0 C;  4MN0 A;  1KFU S;  1UUS A;  2NCP A;  3JTD C;  2K0J A;  2KAX A;  1A29 A;  1OE9 B;  2KI4 B;  1AK8 A;  2JNF A;  1D1O A;  1LKJ A;  1DT7 B;  2LC5 A;  4CFQ A;  2LP2 A;  3I5H C;  2LNK A;  2WCF A;  3OX6 A;  1C7V A;  2BE6 A;  1IG5 A;  1PVB A;  3EVU A;  1PVA A;  4BY5 A;  1DJX A;  2H61 A;  2JTZ A;  2KBI A;  2LCP A;  1RRO A;  1F4O A;  5GQQ C;  5HKW A;  3O4Y A;  1U5I B;  1BT6 A;  2EC6 B;  1QAS A;  1DF0 B;  2CTN A;  4MZL A;  1R6P A;  1NCX A;  4ICB A;  4MLW A;  5AEQ A;  1EXR A;  2MA2 A;  1IKU A;  2KDH A;  3CLN A;  1REC A;  1MXL C;  1SR6 C;  4JQ0 D;  4HRH A;  2JXC A;  2K7D A;  1K9U A;  2KYC A;  3VRN A;  3ICB A;  1QVI Y;  2HPS A;  1KFX L;  5DKR A;  2JRF A;  1N0Y A;  1TCF A;  4N1G A;  1Y1U A;  2FOT A;  2G9B A;  5AER A;  1LA0 A;  4GGF A;  5B8I B;  1SBJ A;  1AJ4 A;  2LLU A;  5KSZ A;  4XJK A;  1FF1 A;  1NX3 A;  1JC2 A;  4XYN A;  5CSN A;  2CT9 A;  2BCB A;  2JOJ A;  1CFF A;  1J7Q A;  1MUX A;  1YUS A;  2AMI A;  1F55 A;  4UPG A;  3PFV A;  2JT3 A;  5AFP A;  2DOQ A;  3OP0 A;  3GOF A;  1V1G A;  3DVK A;  1HT9 A;  2K7B A;  2WCE A;  3EK4 A;  1SL9 A;  3D10 A;  4WQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...