3MSEB

Crystal structure of c-terminal domain of pf110239.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
168
Chain Sequence
ISPNVLNNMKSYMKHSNIRNIIINIMAHELSVINNHIKYINELFYKLDTNHNGSLSHREIYTVLASVGIKKWDINRILQALDINDRGNITYTEFMAGCYRWKNITFLKAAFNKIDKDEDGYISKSDIVSLVHDKVLDNNDIDNFFLSVHSIINKISFQEFKDYMLSTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of C-terminal domain of PF110239
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Calcium-dependent protein kinase, putative
total genus 60
structure length 168
sequence length 179
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3mseB00
1XFUO 5AXIA 1JF2A 1CMGA 2WORA 1IKUA 3PN7B 1CFPA 3CTNA 3CZTX 4PE7A 4YGAA 2AMIA 5F6TA 1QX2A 2LHIA 2LVKA 3O6BA 5D69A 1JUOA 2L5XB 1TTXA 2CNPA 2LUXA 1CFDA 2L4HA 1F54A 1SNLA 3VRRA 1ZOTB 2KAXA 2LNKA 1KQMB 1KWOB 2EHBA 1OE9B 2KBIA 2MAZA 1BT6A 3VRPA 1QXPA 2M1KB 2L2EA 1XK4A 4GAOA 1DGUA 2BECA 4GGNA 4M2QA 1KSOA 2M7NA 1MXLC 1M45A 2ZFDA 3KHEA 1CLBA 3SIBA 4TNCA 1CM1A 1NX2A 1NYAA 2F2OA 1J55A 2PASA 1Y1XA 2EGDA 3CR5X 2JU0A 1LKJA 4NDCA 1K9KA 2MA2A 1BJFA 4PHKA 4ZCUA 1S36A 3IF7A 2FJUB 3DF0B 1JSAA 5DKRA 1S6CA 1CDPA 3TDZA 3PN7C 4OV2A 1K9PA 2OS8C 3BOWA 1B1GA 1AJ4A 2KAVA 2OS8B 4JPZB 3H4SE 2NXQA 4PHJA 1NCYA 4ORBB 3JVTC 1UURA 4GNKB 2KQYA 2AAOA 1KFUL 4JQ0D 4M2PA 5FYXA 1S26D 4MLWA 2H61C 3MSEB 4FQOA 3I5GB 1DF0B 1XFVO 2I18A 1SCVA 2ISDA 1BR1B 3OHMB 4ETOA 2M7LA 3SG3A 1MF8B 2KYCA 1TN4A 4F0ZB 4N1FA 3CGAA 3KF9A 1SBJA 2OTGB 3EKJA 1WRLA 2KHNA 2L50A 1KWOC 1UUSA 2KSPA 1XFYO 2A4JA 2LLUA 4PALA 1QVIY 2L4IA 2LE9B 1J1EA 1KK7Y 2HETA 1TIZA 3AAJA 3TDIA 5BPJA 4USLA 5GQQC 2B1UA 2Y4QA 2KI4B 2ZRSA 2LANA 1KK8C 1RECA 4HSZA 2BKIB 2LHLA 2OPOA 1XVJA 4CIDA 1QIVA 2F33A 3FWBA 1K2HA 4XJKB 3PALA 1IH0A 2LLTA 1KCYA 1DJXA 2LVIA 2KGRA 3EVRA 1SL9A 4GGFA 4YGBB 5AERA 2MHHA 4PE0A 1F71A 3EK8A 3DVKA 2KFFA 2MRDA 1FI5A 1M63B 2K7DA 5DKNA 3WHTB 2Y5IA 1XK4C 3DVMA 1OMRA 1WLZA 2K7CA 1NX3A 2CT9A 2JULA 1B47A 2SCPA 1ALWA 3EVVA 3GK4X 5ER5A 4C0JA 2MLFC 1YUSA 1CFFA 4NDDA 4MZLA 1EJ3A 1QJTA 1YUTA 2KGBC 3AAKA 5CSFA 3CR4X 5HLVA 1DJIA 1CDLA 4PHNA 2Y1NA 4YBHB 4AQIA 2GGZA 4N5XA 1KFUS 3VRNA 3EKHA 3SIAA 2JPTA 2KOTA 1XFWO 2BCBA 2Q4UA 2BL0B 4I5NB 2KAYA 3M0WA 2JZIA 2LMUA 3DD4A 3FIAA 3ZWHA 3WNXB 1PK0D 2JT0A 1LINA 1NX0A 2K7OA 2LP3A 1PSRA 1J7QA 1MR8A 2NLNA 3TDUA 1B4CA 4CFRA 4YRUA 1BF5A 2JOJA 2WOSA 3EK7A 5AANA 4Q04A 2NCOA 1TOPA 1NSHA 1DF0A 1QATA 1K95A 3PATA 3TS5C 1NIWA 1TNXA 2WCFA 1CDNA 3TS5B 2KBMA 1ZACA 1WDCB 4MVFA 3RLZA 1J7PA 5HYDA 5JOLA 3E3RA 1DJWA 1G33A 2LM5A 3FS7A 1D1OA 1C7WA 1QLSA 3OB1B 1KFXS 4PDZA 1GGWA 2L51A 1C07A 2CTNA 1MXEA 1NP8A 2G2BA 1A29A 2KDHA 3JTDC 4ZCVA 1R6PA 1YVLA 1IQ3A 1YUUA 1AJ5A 3PM8A 2I7AA 1SMGA 3PFVA 1B8RA 2FOTA 1WRZA 1DTLA 3PLFB 3CWGA 3DF0A 5AEQA 1EL4A 4HRHA 5JJGA 4MRYA 3BQ3A 4MZJA 2R2IA 3GOFA 4ORAB 4FTGA 3KEVA 1EXRA 1WLMA 5IBWA 2LAPA 1BU3A 1OQPA 4DRWA 3AKAA 5HKZA 2Y1MA 1MUXA 2JNFA 3AKBA 4R1EA 1PVAA 4YGCB 2WCEA 3O78A 1QS7A 4A4BA 1QVIZ 1A75A 1W7IB 1NPQA 5B8IB 1KK7Z 1Q80A 2F2PA 1UHJA 3VGOA 2M0RA 4GGFC 1XO5A 1EH2A 3NSKA 2JT8A 4PCWA 2LV7A 3SG4A 2F8PA 4D1EA 4GBAA 1V1GA 1SRAA 4XJKA 3I5IB 4MN0A 4C0LA 2ZN8A 1K9UA 3JVTB 2K2FA 2BBMA 4QJ4B 1YURA 1SPYA 1DMOA 2ZNEA 1IG5A 2O60A 3IQQA 4I5KA 4A4CA 1PSBA 1F4OA 1S6IA 3LK0A 3NSLA 1G4YR 1TCFA 1NCXA 5I8NA 5KU1A 2I94A 1SCMC 1AUIB 3SG6A 3ZNIA 3BOWB 3NSOA 4N1GA 2NCPA 2HQ8A 4JWQA 2F3YA 1Y6WA 1F8HA 1WDCC 1PULA 1ODBA 2RGIA 4UPGA 5I2QA 1CTRA 1QIWA 5K89A 3D0YB 3D0YA 2Q91A 4HREE 2JXCA 4E68A 4BY4A 5CSJA 2LMTA 2L0PA 4GPLB 1LA3A 4MEWA 1BOCA 1SL7A 1FW4A 1J7OA 1CB1A 4OKHA 1DT7B 2WNDA 2PALA 1SW8A 4XYNA 3HCMA 5DKQA 4C0KA 2LMVA 2M3WA 2OTGC 2H61A 2VRGA 2KYFA 1Y1UA 2HPSA 1KQVA 2K8MB 1ZFSA 2LP2A 1BLQA 1CMFA 3CR2A 3A8RA 2LUCA 3RM1A 1NCZA 3KO0A 3HX4A 1IRJA 2LC5A 2E6WA 1K94A 1EG3A 2BE6A 1ZUZA 1MQ1A 1LXFC 1A4PA 5HLOA 1BMOA 1JC2A 1QX5B 1MWNA 1SKTA 3LCPC 3O4YA 2WCBA 3F45A 1DJYA 2K2AA 1FF1A 1QV1A 1A75B 2IS9A 4OR9B 5CSNA 1SYMA 3CLNA 1OMVA 1BG1A 2FCEA 4ICBA 1C7VA 4M2OA 1IWQA 1IJ6A 1N65A 1OZSA 1RTP1 1Y0VH 3DVEA 1A2XA 1TNPA 2F3ZA 3SG2A 3NXAA 2PVBA 1WY9A 1RWYA 2DOQA 4WQ3A 2KFHA 3C1VA 4OCIA 1UHHA 1RK9A 1J7RA 1UHNA 1CDMA 1JFJA 1LA0A 1R2UA 2D8NA 5AFPA 3BUXB 1K8UA 2JT3A 1QX7A 1YTZC 2HQWA 4IL1A 3OB2B 2MJWB 3LL8B 3OX6A 4MRXA 3EVUA 3BUOB 5CSIA 4YI9A 2BBNA 1B7TY 1DJZA 1TCOB 4DIRA 2KI6C 3I5IC 3QRXA 3SJSA 1F70A 1ZMZA 2JXLA 1CKKA 5D7FA 3LK1A 2I2RE 3OX5A 3VROA 2M29A 3KPXA 1KQMC 3A4UB 3IQOA 2PSRA 1QLKA 1E8AA 1YX7A 2CBLA 1B9AA 1IQ5A 3TZ1A 1VRKA 4MSPA 5I2OA 1YRTB 2EC6C 2V53A 2MBXA 3SG7A 3BUNB 3D10A 4PHMA 1K90D 3TUYB 5KSZA 4GUKA 1CFCA 3WXAA 3NSIA 1L2OC 1LVCD 1NX1A 1JFKA 3BXKA 5I2LA 4DUQA 1B7TZ 1HT9A 1DJGA 1M46A 2ZKMX 3I5HB 1SK6D 1N2DA 2BKHB 4OVNF 2GV5A 3OP0A 4I5JA 4DCKA 2K7BA 1Y1AA 2KI4C 2KQ6A 1SL8A 3JTDB 2JC2A 1UHIA 1FPWA 3PSRA 4P5OE 3O2PA 1UHKA 1XA5A 4ORCB 2LVJA 2WC8A 1XFZO 2BCAA 1AP4A 1XFXO 3CS1A 1NUBA 1L7ZA 1G8IA 1B8LA 3BUWB 1YX8A 1K93D 2JQ6A 1U5IB 1TNWA 1OSAA 2BE4A 1U5IA 1WRKA 4NDBA 4NQGA 4CPVA 1AK8A 1GQMA 1OZOA 2JWWA 5CPVA 2KNEA 2M97A 4L9MA 1RROA 4QJ5B 3WHUB 1IGVA 2JTZA 1S5GZ 2PMYA 1DVIA 5J3XA 1BR4B 1QV0A 2LVVA 4YGEB 3I5GC 1YRUB 1OMDA 1YR5A 1NWDA 4I5LB 1AVSA 1KSMA 1QTXA 2ZRTA 1PALA 2KFGA 2K0JA 2CXJA 2LCPA 2O5GA 2JNXA 1IJ5A 4PE1A 1JF0A 1S6JA 2AUCA 2JRFA 1H8BA 2H2KA 1S3PA 1RFJA 2ZNDA 2FCDA 4AOMA 1SR6C 3I5FB 1L2OB 2QACA 1SCMB 2E30A 1M39A 1ALVA 1OOJA 2LLSA 1KFXL 2COLB 3I5FC 4CFQA 2CCMA 1DGVA 4DS7A 2K61A 3K21A 1KK8B 3FWCA 3I5HC 2M1UA 5HKYA 1QASA 2BCXA 4U8DA 2M9GA 4MBEA 2BL0C 1J1DA 1EG4A 4BY5A 1PVBA 1A03A 1CLLA 1JBAA 1UP5A 3BUMB 5G08A 5KTYA 2M49B 1S5GY 1X02A 1M31A 4HRGA 4MZKA 2PRUA 3ICBA 2M8UA 3GK2A 1PRWA 1K96A 5HKWA 2HF5A 1W7JB 1HQVA 4WRIA 1H4BA 1CNPA 5TNCA 1CLMA 3VRQA 5ER4X 4AQJA 1XYDA 1N0YA 1FBVA 1TNQA 1SY9A 1TRFA 4WQ2A 2SASA 3BYAA 3EK4A 1UWOA 4GFTA 1SR6B 2NZ0A 3TUYC 4QJ3B 1BODA 2QPTA 4YGDB 1YVHA 3GK1A 2ZN9A 1V1FA 2KI6D 2TN4A 1CM4A 1RJVA 4CLNA 1F55A 1GGZA 3DVJA 1AHRA 1DJHA 1JWDA 2G9BA 5PALA 2JTTA 2EC6B 3LLEA 1S1EA 3SG5A 1B8CA 1GJYA 4P2YB 2L98A 2GGMA 4YI8A 4PE4A 1F4QA 2MLEC 2P6BB 1FI6A 1MHOA
chains in the Genus database with same CATH superfamily
1XFUO 5AXIA 2KLEA 3B86A 1JF2A 5EL2A 1CMGA 2WORA 3D76A 1IKUA 3PN7B 1CFPA 3CTNA 1IIOA 3CZTX 4PE7A 4YGAA 2AMIA 5F6TA 4F7FA 1QX2A 2LHIA 2LVKA 3O6BA 4JD9A 5D69A 1JUOA 2L5XB 1TTXA 2CNPA 2LUXA 3R1OA 1CFDA 1OOHA 2L4HA 1F54A 1SNLA 3VRRA 1ZOTB 2KAXA 2LNKA 1KQMB 1KWOB 2EHBA 1OE9B 2QEOA 2KBIA 3NHIA 2MAZA 1XFRA 1BT6A 3VRPA 2WCMA 1ORGA 1QXPA 2M1KB 2L2EA 1XK4A 4GAOA 1TUJA 1DGUA 2BECA 4GGNA 4M2QA 1KSOA 2M7NA 1MXLC 1M45A 2ZFDA 3KHEA 1CLBA 3SIBA 4TNCA 1CM1A 1NX2A 1NYAA 2F2OA 1J55A 2PASA 1Y1XA 2EGDA 3CR5X 2JU0A 1LKJA 4NDCA 1K9KA 2MA2A 1BJFA 2FJYA 2JPOA 4PHKA 4ZCUA 1S36A 3IF7A 2FJUB 3Q8IA 3DF0B 1JSAA 3CZ0A 5DKRA 1S6CA 1CDPA 3TDZA 3PN7C 3S0FA 4OV2A 1K9PA 2OS8C 3BOWA 1B1GA 1AJ4A 2KAVA 2OS8B 3PJIA 3H4SE 4JPZB 2NXQA 4PHJA 1NCYA 4ORBB 3JVTC 1UURA 4GNKB 2KQYA 2L2CA 2AAOA 1KFUL 4JQ0D 2WCLA 4M2PA 5FYXA 1S26D 4MLWA 2H61C 3MSEB 3UO9A 4FQOA 3I5GB 1DF0B 1XFVO 2I18A 1SCVA 2ISDA 1BR1B 3OHMB 4ETOA 2M7LA 3SG3A 1MF8B 3DZTA 2KYCA 3DYEA 1OOFA 1TN4A 4F0ZB 4N1FA 3CGAA 3KF9A 1SBJA 2OTGB 3EKJA 1WRLA 2KHNA 2L50A 1KWOC 1UUSA 2KSPA 1XFYO 2A4JA 5FI2A 2LLUA 4PALA 1QVIY 2L4IA 2LE9B 1J1EA 1KK7Y 2HETA 1TIZA 3FE8A 2BAPA 3AAJA 3TDIA 5BPJA 4USLA 5GQQC 2B1UA 2Y4QA 2KI4B 2ZRSA 2LANA 1KK8C 1RECA 3CABA 2BKIB 2LHLA 1TWOA 1XVJA 2GTEA 1QIVA 2F33A 2OPOA 4CIDA 3FWBA 1K2HA 4XJKB 3PALA 1IH0A 2LLTA 1KCYA 1DJXA 2LVIA 2KGRA 3EVRA 1SL9A 3DY9A 4GGFA 4YGBB 5AERA 2MHHA 4PE0A 1F71A 3EK8A 3DVKA 2KFFA 2MRDA 1FI5A 1M63B 2K7DA 3IVTA 5DKNA 3WHTB 2Y5IA 4QJ5B 3K1EA 1XK4C 3DVMA 1OMRA 1WLZA 2K7CA 1NX3A 2CT9A 2JULA 1B47A 2SCPA 1ALWA 3EVVA 3GK4X 5ER5A 4C0JA 2MLFC 1YUSA 1CFFA 4NDDA 4MZLA 3NHTA 1EJ3A 1QJTA 1YUTA 2KGBC 3AAKA 5CSFA 3EG5B 3CR4X 5HLVA 1DJIA 1CDLA 4PHNA 2Y1NA 4YBHB 2PQLA 4AQIA 2GGZA 1QWVA 4N5XA 1KFUS 3VRNA 3EKHA 1Z2CB 3SIAA 2JPTA 2KOTA 1XFWO 2BCBA 2Q4UA 2BL0B 4I5NB 2KAYA 3M0WA 4OZDA 1DC1A 1TUZA 2JZIA 2LMUA 3DD4A 3FIAA 3ZWHA 3WNXB 5D3OA 1PK0D 2JT0A 1LINA 1NX0A 2K7OA 2LP3A 1PSRA 1J7QA 1LS8A 1MR8A 2NLNA 3TDUA 1B4CA 4CFRA 4YRUA 1BF5A 3B87A 2WC5A 2JOJA 2KPHA 2WOSA 3EK7A 5AANA 4Q04A 2NCOA 1TOPA 1NSHA 1DF0A 1QATA 1K95A 3PATA 4INXA 3TS5C 1NIWA 1TNXA 2WCFA 1CDNA 3TS5B 2KBMA 1ZACA 1WDCB 4MVFA 3RLZA 1J7PA 5HYDA 5JOLA 3E3RA 1DJWA 1G33A 2LM5A 3FS7A 1D1OA 1C7WA 1QLSA 3OB1B 1KFXS 4PDZA 1GGWA 2L51A 1C07A 2CTNA 1MXEA 1NP8A 2G2BA 1A29A 2KDHA 3JTDC 4ZCVA 1R6PA 1YVLA 1IQ3A 1YUUA 1AJ5A 3PM8A 2I7AA 1SMGA 3PFVA 1B8RA 3D75A 2FOTA 1WRZA 1DTLA 3PLFB 3CWGA 3DF0A 5AEQA 1EL4A 4HRHA 5JJGA 4MRYA 3BQ3A 4MZJA 2R2IA 3GOFA 4ORAB 4FTGA 3KEVA 3S0EA 1EXRA 1WLMA 5IBWA 2LAPA 1BU3A 1OQPA 4DRWA 1C3YA 3AKAA 5HKZA 2Y1MA 1MUXA 2JNFA 3AKBA 4R1EA 1PVAA 4YGCB 2WCEA 3O78A 1QS7A 4A4BA 1QVIZ 1A75A 1W7IB 1NPQA 5B8IB 1KK7Z 1Q80A 2F2PA 2WC6A 1UHJA 3VGOA 2M0RA 3D77A 4GGFC 1XO5A 1EH2A 3NSKA 2JT8A 4PCWA 2LV7A 3SG4A 2F8PA 4D1EA 4GBAA 3DXLA 1V1GA 1SRAA 4XJKA 3I5IB 3OBVA 4MN0A 4C0LA 2ZN8A 1K9UA 3JVTB 2K2FA 2BBMA 4QJ4B 2H8VA 1YURA 1SPYA 1DMOA 2ZNEA 1IG5A 2O60A 3IQQA 4I5KA 4A4CA 1PSBA 1F4OA 1S6IA 3LK0A 3NSLA 2ERBA 1G4YR 1TCFA 1NCXA 5I8NA 5KU1A 2I94A 1SCMC 1AUIB 3SG6A 3ZNIA 3CDNA 3BOWB 3NSOA 1OOGA 4N1GA 5FI7A 2NCPA 2HQ8A 4JWQA 2F3YA 1Y6WA 2QEHA 1F8HA 1WDCC 1PULA 1ODBA 2RGIA 3PM2A 4UPGA 5I2QA 1CTRA 1QIWA 5K89A 3D0YB 3R1PA 3D0YA 2Q91A 4HREE 2JXCA 4E68A 4BY4A 5CSJA 2LMTA 2L0PA 1DEKA 4GPLB 1LA3A 4MEWA 1BOCA 3L4AA 5DICA 1SL7A 1FW4A 1J7OA 1CB1A 4OKHA 1DT7B 2WNDA 2PALA 1SW8A 3NGVA 4XYNA 3CZ1A 3HCMA 5DKQA 2LMVA 4C0KA 2M3WA 2OTGC 2H61A 2VRGA 2KYFA 1DQEA 1Y1UA 2HPSA 1KQVA 2K8MB 1ZFSA 2LP2A 1BLQA 1CMFA 3CR2A 3A8RA 2LUCA 4PT1A 1NCZA 3KO0A 3RM1A 3HX4A 1IRJA 2LC5A 2E6WA 1K94A 1EG3A 2BE6A 1ZUZA 1MQ1A 1LXFC 1A4PA 5HLOA 1BMOA 3L4LA 1JC2A 1QX5B 1MWNA 1SKTA 3LCPC 2K60A 2WCBA 3F45A 3O4YA 1DJYA 2K2AA 3BFBA 1FF1A 1QV1A 1A75B 2IS9A 4OR9B 5CSNA 1SYMA 3CLNA 1OMVA 1BG1A 2FCEA 3OGNA 4ICBA 1C7VA 4M2OA 1IWQA 1IJ6A 1N65A 1OZSA 1RTP1 1Y0VH 3DVEA 1A2XA 1TNPA 2F3ZA 3SG2A 3NXAA 2PVBA 1WY9A 1RWYA 2DOQA 5FI6A 4WQ3A 2KFHA 3C1VA 3CYZA 4OCIA 1UHHA 1RK9A 1J7RA 1UHNA 1GM0A 1CDMA 1JFJA 1LA0A 1R2UA 2D8NA 3S0DA 5AFPA 3BUXB 1K8UA 2JT3A 1QX7A 1YTZC 2HQWA 4IL1A 3OB2B 2MJWB 3LL8B 3OX6A 4MRXA 3EVUA 1OW4A 2P71A 3BUOB 5CSIA 4YI9A 2BBNA 1B7TY 2QEBA 1DJZA 3O4XA 1DELA 1TCOB 3SS5A 4FQTA 4DIRA 2KI6C 3I5IC 3QRXA 3SJSA 1F70A 1ZMZA 1W9ZA 2JXLA 5D7FA 1CKKA 3LK1A 3UNWA 2I2RE 3OX5A 3VROA 3BFHA 2M29A 3KPXA 1KQMC 3A4UB 3IQOA 2PSRA 1QLKA 1E8AA 1YX7A 3CZ2A 3S0AA 2CBLA 1B9AA 1IQ5A 3TZ1A 1VRKA 4MSPA 5I2OA 1YRTB 2EC6C 2V53A 2MBXA 3SG7A 3SS3A 3BUNB 3D10A 4PHMA 1K90D 4INWA 3L47A 3TUYB 5KSZA 3BJHA 4GUKA 1CFCA 3WXAA 3NSIA 1L2OC 1LVCD 1NX1A 1JFKA 3BXKA 5I2LA 4DUQA 1B7TZ 1HT9A 1DJGA 3B7AA 1M46A 2ZKMX 3I5HB 3R72A 1SK6D 1N2DA 2BKHB 2WCHA 4OVNF 2GV5A 3OP0A 4I5JA 4DCKA 2K7BA 1Y1AA 2KI4C 2KQ6A 1SL8A 3FE6A 3JTDB 2JC2A 1UHIA 3V2LA 3PSRA 1FPWA 4P5OE 3O2PA 1UHKA 1XA5A 4ORCB 2LVJA 2WC8A 1XFZO 2BCAA 2YGUA 1AP4A 1XFXO 3CS1A 1NUBA 1L7ZA 1G8IA 1B8LA 3B88A 1T14A 1YX8A 3BUWB 4HSZA 1K93D 2JQ6A 1U5IB 1TNWA 1OSAA 4KYNA 2BE4A 1U5IA 1WRKA 4NDBA 4NQGA 4CPVA 3B6XA 3VB1A 1AK8A 3BFAA 1GQMA 5HL1A 1OZOA 2JWWA 5CPVA 2KNEA 2M97A 4L9MA 1RROA 3S0BA 3WHUB 1IGVA 2JTZA 1S5GZ 2PMYA 1DVIA 2PYQA 5J3XA 1BR4B 1QV0A 2LVVA 4YGEB 3I5GC 1YRUB 1OMDA 1YR5A 1NWDA 2QEVA 1AVSA 1KSMA 4I5LB 1QTXA 2ZRTA 1PALA 2KFGA 2K0JA 2CXJA 2LCPA 2O5GA 2JNXA 1IJ5A 4PE1A 3RZSA 1JF0A 1C3ZA 1S6JA 2AUCA 2JRFA 3R1VA 2H2KA 1H8BA 1S3PA 1RFJA 2ZNDA 3SS4A 2FCDA 4AOMA 1SR6C 3I5FB 1L2OB 1Z4HA 2QACA 1SCMB 2E30A 1M39A 1ALVA 1OOJA 2LLSA 1KFXL 2COLB 3I5FC 1OOIX 4CFQA 2CCMA 2WCJA 1DGVA 4DS7A 2K61A 3K21A 1KK8B 3FWCA 3I5HC 2M1UA 5HKYA 1QASA 2BCXA 4IJ7A 4U8DA 2M9GA 4MBEA 3QMEA 2BL0C 2KLDA 1J1DA 1EG4A 4BY5A 1PVBA 1A03A 1CLLA 1JBAA 1UP5A 3BUMB 5G08A 5KTYA 2M49B 2BNXA 1S5GY 1X02A 1M31A 4HRGA 4MZKA 2L5YA 2PRUA 3ICBA 3D74A 2M8UA 3GK2A 1PRWA 1K96A 5HKWA 1P28A 5I94A 1W7JB 1HQVA 2HF5A 4WRIA 1H4BA 1CNPA 5TNCA 1CLMA 3VRQA 5ER4X 4AQJA 1XYDA 2P70A 1N0YA 2QDIA 1FBVA 1TNQA 1SY9A 1TRFA 4WQ2A 2SASA 3BYAA 3EK4A 1UWOA 4GFTA 1SR6B 2NZ0A 3TUYC 4QJ3B 1SSEB 2QPTA 1BODA 4YGDB 3S0GA 1YVHA 3GK1A 2ZN9A 1V1FA 2KI6D 2TN4A 1CM4A 1RJVA 4CLNA 1F55A 2WCKA 3N7HA 1GGZA 3DVJA 1AHRA 1DJHA 1JWDA 2G9BA 5PALA 2JTTA 2EC6B 3LLEA 1S1EA 3SG5A 1B8CA 3FE9A 1GJYA 4JKTA 4P2YB 2L98A 2GGMA 3D73A 4YI8A 3D78A 4PE4A 1F4QA 2MLEC 2P6BB 1FI6A 1MHOA
chains in the Genus database with same CATH topology
1XFUO 5AXIA 1JF2A 1CMGA 2WORA 1IKUA 3PN7B 1CFPA 3CTNA 3CZTX 4PE7A 4YGAA 2AMIA 5F6TA 1QX2A 2LHIA 2LVKA 3O6BA 5D69A 1JUOA 2L5XB 1TTXA 2CNPA 2LUXA 1CFDA 2L4HA 1F54A 1SNLA 3VRRA 1ZOTB 2KAXA 2LNKA 1KQMB 1KWOB 2EHBA 1OE9B 2KBIA 2MAZA 1BT6A 3VRPA 1QXPA 2M1KB 2L2EA 1XK4A 4GAOA 1DGUA 2BECA 4GGNA 4M2QA 1KSOA 2M7NA 1MXLC 1M45A 2ZFDA 3KHEA 1CLBA 3SIBA 4TNCA 1CM1A 1NX2A 1NYAA 2F2OA 1J55A 2PASA 1Y1XA 2EGDA 3CR5X 2JU0A 1LKJA 4NDCA 1K9KA 2MA2A 1BJFA 4PHKA 4ZCUA 1S36A 3IF7A 2FJUB 3DF0B 1JSAA 5DKRA 1S6CA 1CDPA 3TDZA 3PN7C 4OV2A 1K9PA 2OS8C 3BOWA 1B1GA 1AJ4A 2KAVA 2OS8B 4JPZB 3H4SE 2NXQA 4PHJA 1NCYA 4ORBB 3JVTC 1UURA 4GNKB 2KQYA 2AAOA 1KFUL 4JQ0D 4M2PA 5FYXA 1S26D 4MLWA 2H61C 3MSEB 4FQOA 3I5GB 1DF0B 1XFVO 2I18A 1SCVA 2ISDA 1BR1B 3OHMB 4ETOA 2M7LA 3SG3A 1MF8B 2KYCA 1TN4A 4F0ZB 4N1FA 3CGAA 3KF9A 1SBJA 2OTGB 3EKJA 1WRLA 2KHNA 2L50A 1KWOC 1UUSA 2KSPA 1XFYO 2A4JA 2LLUA 4PALA 1QVIY 2L4IA 2LE9B 1J1EA 1KK7Y 2HETA 1TIZA 3AAJA 3TDIA 5BPJA 4USLA 5GQQC 2B1UA 2Y4QA 2KI4B 2ZRSA 2LANA 1KK8C 1RECA 4HSZA 2BKIB 2LHLA 2OPOA 1XVJA 4CIDA 1QIVA 2F33A 3FWBA 1K2HA 4XJKB 3PALA 1IH0A 2LLTA 1KCYA 1DJXA 2LVIA 2KGRA 3EVRA 1SL9A 4GGFA 4YGBB 5AERA 2MHHA 4PE0A 1F71A 3EK8A 3DVKA 2KFFA 2MRDA 1FI5A 1M63B 2K7DA 5DKNA 3WHTB 2Y5IA 1XK4C 3DVMA 1OMRA 1WLZA 2K7CA 1NX3A 2CT9A 2JULA 1B47A 2SCPA 1ALWA 3EVVA 3GK4X 5ER5A 4C0JA 2MLFC 1YUSA 1CFFA 4NDDA 4MZLA 1EJ3A 1QJTA 1YUTA 2KGBC 3AAKA 5CSFA 3CR4X 5HLVA 1DJIA 1CDLA 4PHNA 2Y1NA 4YBHB 4AQIA 2GGZA 4N5XA 1KFUS 3VRNA 3EKHA 3SIAA 2JPTA 2KOTA 1XFWO 2BCBA 2Q4UA 2BL0B 4I5NB 2KAYA 3M0WA 2JZIA 2LMUA 3DD4A 3FIAA 3ZWHA 3WNXB 1PK0D 2JT0A 1LINA 1NX0A 2K7OA 2LP3A 1PSRA 1J7QA 1MR8A 2NLNA 3TDUA 1B4CA 4CFRA 4YRUA 1BF5A 2JOJA 2WOSA 3EK7A 5AANA 4Q04A 2NCOA 1TOPA 1NSHA 1DF0A 1QATA 1K95A 3PATA 3TS5C 1NIWA 1TNXA 2WCFA 1CDNA 3TS5B 2KBMA 1ZACA 1WDCB 4MVFA 3RLZA 1J7PA 5HYDA 5JOLA 3E3RA 1DJWA 1G33A 2LM5A 3FS7A 1D1OA 1C7WA 1QLSA 3OB1B 1KFXS 4PDZA 1GGWA 2L51A 1C07A 2CTNA 1MXEA 1NP8A 2G2BA 1A29A 2KDHA 3JTDC 4ZCVA 1R6PA 1YVLA 1IQ3A 1YUUA 1AJ5A 3PM8A 2I7AA 1SMGA 3PFVA 1B8RA 2FOTA 1WRZA 1DTLA 3PLFB 3CWGA 3DF0A 5AEQA 1EL4A 4HRHA 5JJGA 4MRYA 3BQ3A 4MZJA 2R2IA 3GOFA 4ORAB 4FTGA 3KEVA 1EXRA 1WLMA 5IBWA 2LAPA 1BU3A 1OQPA 4DRWA 3AKAA 5HKZA 2Y1MA 1MUXA 2JNFA 3AKBA 4R1EA 1PVAA 4YGCB 2WCEA 3O78A 1QS7A 4A4BA 1QVIZ 1A75A 1W7IB 1NPQA 5B8IB 1KK7Z 1Q80A 2F2PA 1UHJA 3VGOA 2M0RA 4GGFC 1XO5A 1EH2A 3NSKA 2JT8A 4PCWA 2LV7A 3SG4A 2F8PA 4D1EA 4GBAA 1V1GA 1SRAA 4XJKA 3I5IB 4MN0A 4C0LA 2ZN8A 1K9UA 3JVTB 2K2FA 2BBMA 4QJ4B 1YURA 1SPYA 1DMOA 2ZNEA 1IG5A 2O60A 3IQQA 4I5KA 4A4CA 1PSBA 1F4OA 1S6IA 3LK0A 3NSLA 1G4YR 1TCFA 1NCXA 5I8NA 5KU1A 2I94A 1SCMC 1AUIB 3SG6A 3ZNIA 3BOWB 3NSOA 4N1GA 2NCPA 2HQ8A 4JWQA 2F3YA 1Y6WA 1F8HA 1WDCC 1PULA 1ODBA 2RGIA 4UPGA 5I2QA 1CTRA 1QIWA 5K89A 3D0YB 3D0YA 2Q91A 4HREE 2JXCA 4E68A 4BY4A 5CSJA 2LMTA 2L0PA 4GPLB 1LA3A 4MEWA 1BOCA 1SL7A 1FW4A 1J7OA 1CB1A 4OKHA 1DT7B 2WNDA 2PALA 1SW8A 4XYNA 3HCMA 5DKQA 4C0KA 2LMVA 2M3WA 2OTGC 2H61A 2VRGA 2KYFA 1Y1UA 2HPSA 1KQVA 2K8MB 1ZFSA 2LP2A 1BLQA 1CMFA 3CR2A 3A8RA 2LUCA 3RM1A 1NCZA 3KO0A 3HX4A 1IRJA 2LC5A 2E6WA 1K94A 1EG3A 2BE6A 1ZUZA 1MQ1A 1LXFC 1A4PA 5HLOA 1BMOA 1JC2A 1QX5B 1MWNA 1SKTA 3LCPC 3O4YA 2WCBA 3F45A 1DJYA 2K2AA 1FF1A 1QV1A 1A75B 2IS9A 4OR9B 5CSNA 1SYMA 3CLNA 1OMVA 1BG1A 2FCEA 4ICBA 1C7VA 4M2OA 1IWQA 1IJ6A 1N65A 1OZSA 1RTP1 1Y0VH 3DVEA 1A2XA 1TNPA 2F3ZA 3SG2A 3NXAA 2PVBA 1WY9A 1RWYA 2DOQA 4WQ3A 2KFHA 3C1VA 4OCIA 1UHHA 1RK9A 1J7RA 1UHNA 1CDMA 1JFJA 1LA0A 1R2UA 2D8NA 5AFPA 3BUXB 1K8UA 2JT3A 1QX7A 1YTZC 2HQWA 4IL1A 3OB2B 2MJWB 3LL8B 3OX6A 4MRXA 3EVUA 3BUOB 5CSIA 4YI9A 2BBNA 1B7TY 1DJZA 1TCOB 4DIRA 2KI6C 3I5IC 3QRXA 3SJSA 1F70A 1ZMZA 2JXLA 1CKKA 5D7FA 3LK1A 2I2RE 3OX5A 3VROA 2M29A 3KPXA 1KQMC 3A4UB 3IQOA 2PSRA 1QLKA 1E8AA 1YX7A 2CBLA 1B9AA 1IQ5A 3TZ1A 1VRKA 4MSPA 5I2OA 1YRTB 2EC6C 2V53A 2MBXA 3SG7A 3BUNB 3D10A 4PHMA 1K90D 3TUYB 5KSZA 4GUKA 1CFCA 3WXAA 3NSIA 1L2OC 1LVCD 1NX1A 1JFKA 3BXKA 5I2LA 4DUQA 1B7TZ 1HT9A 1DJGA 1M46A 2ZKMX 3I5HB 1SK6D 1N2DA 2BKHB 4OVNF 2GV5A 3OP0A 4I5JA 4DCKA 2K7BA 1Y1AA 2KI4C 2KQ6A 1SL8A 3JTDB 2JC2A 1UHIA 1FPWA 3PSRA 4P5OE 3O2PA 1UHKA 1XA5A 4ORCB 2LVJA 2WC8A 1XFZO 2BCAA 1AP4A 1XFXO 3CS1A 1NUBA 1L7ZA 1G8IA 1B8LA 3BUWB 1YX8A 1K93D 2JQ6A 1U5IB 1TNWA 1OSAA 2BE4A 1U5IA 1WRKA 4NDBA 4NQGA 4CPVA 1AK8A 1GQMA 1OZOA 2JWWA 5CPVA 2KNEA 2M97A 4L9MA 1RROA 4QJ5B 3WHUB 1IGVA 2JTZA 1S5GZ 2PMYA 1DVIA 5J3XA 1BR4B 1QV0A 2LVVA 4YGEB 3I5GC 1YRUB 1OMDA 1YR5A 1NWDA 4I5LB 1AVSA 1KSMA 1QTXA 2ZRTA 1PALA 2KFGA 2K0JA 2CXJA 2LCPA 2O5GA 2JNXA 1IJ5A 4PE1A 1JF0A 1S6JA 2AUCA 2JRFA 1H8BA 2H2KA 1S3PA 1RFJA 2ZNDA 2FCDA 4AOMA 1SR6C 3I5FB 1L2OB 2QACA 1SCMB 2E30A 1M39A 1ALVA 1OOJA 2LLSA 1KFXL 2COLB 3I5FC 4CFQA 2CCMA 1DGVA 4DS7A 2K61A 3K21A 1KK8B 3FWCA 3I5HC 2M1UA 5HKYA 1QASA 2BCXA 4U8DA 2M9GA 4MBEA 2BL0C 1J1DA 1EG4A 4BY5A 1PVBA 1A03A 1CLLA 1JBAA 1UP5A 3BUMB 5G08A 5KTYA 2M49B 1S5GY 1X02A 1M31A 4HRGA 4MZKA 2PRUA 3ICBA 2M8UA 3GK2A 1PRWA 1K96A 5HKWA 2HF5A 1W7JB 1HQVA 4WRIA 1H4BA 1CNPA 5TNCA 1CLMA 3VRQA 5ER4X 4AQJA 1XYDA 1N0YA 1FBVA 1TNQA 1SY9A 1TRFA 4WQ2A 2SASA 3BYAA 3EK4A 1UWOA 4GFTA 1SR6B 2NZ0A 3TUYC 4QJ3B 1BODA 2QPTA 4YGDB 1YVHA 3GK1A 2ZN9A 1V1FA 2KI6D 2TN4A 1CM4A 1RJVA 4CLNA 1F55A 1GGZA 3DVJA 1AHRA 1DJHA 1JWDA 2G9BA 5PALA 2JTTA 2EC6B 3LLEA 1S1EA 3SG5A 1B8CA 1GJYA 4P2YB 2L98A 2GGMA 4YI8A 4PE4A 1F4QA 2MLEC 2P6BB 1FI6A 1MHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFU O;  5AXI A;  1JF2 A;  1CMG A;  2WOR A;  1IKU A;  3PN7 B;  1CFP A;  3CTN A;  3CZT X;  4PE7 A;  4YGA A;  2AMI A;  5F6T A;  1QX2 A;  2LHI A;  2LVK A;  3O6B A;  5D69 A;  1JUO A;  2L5X B;  1TTX A;  2CNP A;  2LUX A;  1CFD A;  2L4H A;  1F54 A;  1SNL A;  3VRR A;  1ZOT B;  2KAX A;  2LNK A;  1KQM B;  1KWO B;  2EHB A;  1OE9 B;  2KBI A;  2MAZ A;  1BT6 A;  3VRP A;  1QXP A;  2M1K B;  2L2E A;  1XK4 A;  4GAO A;  1DGU A;  2BEC A;  4GGN A;  4M2Q A;  1KSO A;  2M7N A;  1MXL C;  1M45 A;  2ZFD A;  3KHE A;  1CLB A;  3SIB A;  4TNC A;  1CM1 A;  1NX2 A;  1NYA A;  2F2O A;  1J55 A;  2PAS A;  1Y1X A;  2EGD A;  3CR5 X;  2JU0 A;  1LKJ A;  4NDC A;  1K9K A;  2MA2 A;  1BJF A;  4PHK A;  4ZCU A;  1S36 A;  3IF7 A;  2FJU B;  3DF0 B;  1JSA A;  5DKR A;  1S6C A;  1CDP A;  3TDZ A;  3PN7 C;  4OV2 A;  1K9P A;  2OS8 C;  3BOW A;  1B1G A;  1AJ4 A;  2KAV A;  2OS8 B;  4JPZ B;  3H4S E;  2NXQ A;  4PHJ A;  1NCY A;  4ORB B;  3JVT C;  1UUR A;  4GNK B;  2KQY A;  2AAO A;  1KFU L;  4JQ0 D;  4M2P A;  5FYX A;  1S26 D;  4MLW A;  2H61 C;  3MSE B;  4FQO A;  3I5G B;  1DF0 B;  1XFV O;  2I18 A;  1SCV A;  2ISD A;  1BR1 B;  3OHM B;  4ETO A;  2M7L A;  3SG3 A;  1MF8 B;  2KYC A;  1TN4 A;  4F0Z B;  4N1F A;  3CGA A;  3KF9 A;  1SBJ A;  2OTG B;  3EKJ A;  1WRL A;  2KHN A;  2L50 A;  1KWO C;  1UUS A;  2KSP A;  1XFY O;  2A4J A;  2LLU A;  4PAL A;  1QVI Y;  2L4I A;  2LE9 B;  1J1E A;  1KK7 Y;  2HET A;  1TIZ A;  3AAJ A;  3TDI A;  5BPJ A;  4USL A;  5GQQ C;  2B1U A;  2Y4Q A;  2KI4 B;  2ZRS A;  2LAN A;  1KK8 C;  1REC A;  4HSZ A;  2BKI B;  2LHL A;  2OPO A;  1XVJ A;  4CID A;  1QIV A;  2F33 A;  3FWB A;  1K2H A;  4XJK B;  3PAL A;  1IH0 A;  2LLT A;  1KCY A;  1DJX A;  2LVI A;  2KGR A;  3EVR A;  1SL9 A;  4GGF A;  4YGB B;  5AER A;  2MHH A;  4PE0 A;  1F71 A;  3EK8 A;  3DVK A;  2KFF A;  2MRD A;  1FI5 A;  1M63 B;  2K7D A;  5DKN A;  3WHT B;  2Y5I A;  1XK4 C;  3DVM A;  1OMR A;  1WLZ A;  2K7C A;  1NX3 A;  2CT9 A;  2JUL A;  1B47 A;  2SCP A;  1ALW A;  3EVV A;  3GK4 X;  5ER5 A;  4C0J A;  2MLF C;  1YUS A;  1CFF A;  4NDD A;  4MZL A;  1EJ3 A;  1QJT A;  1YUT A;  2KGB C;  3AAK A;  5CSF A;  3CR4 X;  5HLV A;  1DJI A;  1CDL A;  4PHN A;  2Y1N A;  4YBH B;  4AQI A;  2GGZ A;  4N5X A;  1KFU S;  3VRN A;  3EKH A;  3SIA A;  2JPT A;  2KOT A;  1XFW O;  2BCB A;  2Q4U A;  2BL0 B;  4I5N B;  2KAY A;  3M0W A;  2JZI A;  2LMU A;  3DD4 A;  3FIA A;  3ZWH A;  3WNX B;  1PK0 D;  2JT0 A;  1LIN A;  1NX0 A;  2K7O A;  2LP3 A;  1PSR A;  1J7Q A;  1MR8 A;  2NLN A;  3TDU A;  1B4C A;  4CFR A;  4YRU A;  1BF5 A;  2JOJ A;  2WOS A;  3EK7 A;  5AAN A;  4Q04 A;  2NCO A;  1TOP A;  1NSH A;  1DF0 A;  1QAT A;  1K95 A;  3PAT A;  3TS5 C;  1NIW A;  1TNX A;  2WCF A;  1CDN A;  3TS5 B;  2KBM A;  1ZAC A;  1WDC B;  4MVF A;  3RLZ A;  1J7P A;  5HYD A;  5JOL A;  3E3R A;  1DJW A;  1G33 A;  2LM5 A;  3FS7 A;  1D1O A;  1C7W A;  1QLS A;  3OB1 B;  1KFX S;  4PDZ A;  1GGW A;  2L51 A;  1C07 A;  2CTN A;  1MXE A;  1NP8 A;  2G2B A;  1A29 A;  2KDH A;  3JTD C;  4ZCV A;  1R6P A;  1YVL A;  1IQ3 A;  1YUU A;  1AJ5 A;  3PM8 A;  2I7A A;  1SMG A;  3PFV A;  1B8R A;  2FOT A;  1WRZ A;  1DTL A;  3PLF B;  3CWG A;  3DF0 A;  5AEQ A;  1EL4 A;  4HRH A;  5JJG A;  4MRY A;  3BQ3 A;  4MZJ A;  2R2I A;  3GOF A;  4ORA B;  4FTG A;  3KEV A;  1EXR A;  1WLM A;  5IBW A;  2LAP A;  1BU3 A;  1OQP A;  4DRW A;  3AKA A;  5HKZ A;  2Y1M A;  1MUX A;  2JNF A;  3AKB A;  4R1E A;  1PVA A;  4YGC B;  2WCE A;  3O78 A;  1QS7 A;  4A4B A;  1QVI Z;  1A75 A;  1W7I B;  1NPQ A;  5B8I B;  1KK7 Z;  1Q80 A;  2F2P A;  1UHJ A;  3VGO A;  2M0R A;  4GGF C;  1XO5 A;  1EH2 A;  3NSK A;  2JT8 A;  4PCW A;  2LV7 A;  3SG4 A;  2F8P A;  4D1E A;  4GBA A;  1V1G A;  1SRA A;  4XJK A;  3I5I B;  4MN0 A;  4C0L A;  2ZN8 A;  1K9U A;  3JVT B;  2K2F A;  2BBM A;  4QJ4 B;  1YUR A;  1SPY A;  1DMO A;  2ZNE A;  1IG5 A;  2O60 A;  3IQQ A;  4I5K A;  4A4C A;  1PSB A;  1F4O A;  1S6I A;  3LK0 A;  3NSL A;  1G4Y R;  1TCF A;  1NCX A;  5I8N A;  5KU1 A;  2I94 A;  1SCM C;  1AUI B;  3SG6 A;  3ZNI A;  3BOW B;  3NSO A;  4N1G A;  2NCP A;  2HQ8 A;  4JWQ A;  2F3Y A;  1Y6W A;  1F8H A;  1WDC C;  1PUL A;  1ODB A;  2RGI A;  4UPG A;  5I2Q A;  1CTR A;  1QIW A;  5K89 A;  3D0Y B;  3D0Y A;  2Q91 A;  4HRE E;  2JXC A;  4E68 A;  4BY4 A;  5CSJ A;  2LMT A;  2L0P A;  4GPL B;  1LA3 A;  4MEW A;  1BOC A;  1SL7 A;  1FW4 A;  1J7O A;  1CB1 A;  4OKH A;  1DT7 B;  2WND A;  2PAL A;  1SW8 A;  4XYN A;  3HCM A;  5DKQ A;  4C0K A;  2LMV A;  2M3W A;  2OTG C;  2H61 A;  2VRG A;  2KYF A;  1Y1U A;  2HPS A;  1KQV A;  2K8M B;  1ZFS A;  2LP2 A;  1BLQ A;  1CMF A;  3CR2 A;  3A8R A;  2LUC A;  3RM1 A;  1NCZ A;  3KO0 A;  3HX4 A;  1IRJ A;  2LC5 A;  2E6W A;  1K94 A;  1EG3 A;  2BE6 A;  1ZUZ A;  1MQ1 A;  1LXF C;  1A4P A;  5HLO A;  1BMO A;  1JC2 A;  1QX5 B;  1MWN A;  1SKT A;  3LCP C;  3O4Y A;  2WCB A;  3F45 A;  1DJY A;  2K2A A;  1FF1 A;  1QV1 A;  1A75 B;  2IS9 A;  4OR9 B;  5CSN A;  1SYM A;  3CLN A;  1OMV A;  1BG1 A;  2FCE A;  4ICB A;  1C7V A;  4M2O A;  1IWQ A;  1IJ6 A;  1N65 A;  1OZS A;  1RTP 1;  1Y0V H;  3DVE A;  1A2X A;  1TNP A;  2F3Z A;  3SG2 A;  3NXA A;  2PVB A;  1WY9 A;  1RWY A;  2DOQ A;  4WQ3 A;  2KFH A;  3C1V A;  4OCI A;  1UHH A;  1RK9 A;  1J7R A;  1UHN A;  1CDM A;  1JFJ A;  1LA0 A;  1R2U A;  2D8N A;  5AFP A;  3BUX B;  1K8U A;  2JT3 A;  1QX7 A;  1YTZ C;  2HQW A;  4IL1 A;  3OB2 B;  2MJW B;  3LL8 B;  3OX6 A;  4MRX A;  3EVU A;  3BUO B;  5CSI A;  4YI9 A;  2BBN A;  1B7T Y;  1DJZ A;  1TCO B;  4DIR A;  2KI6 C;  3I5I C;  3QRX A;  3SJS A;  1F70 A;  1ZMZ A;  2JXL A;  1CKK A;  5D7F A;  3LK1 A;  2I2R E;  3OX5 A;  3VRO A;  2M29 A;  3KPX A;  1KQM C;  3A4U B;  3IQO A;  2PSR A;  1QLK A;  1E8A A;  1YX7 A;  2CBL A;  1B9A A;  1IQ5 A;  3TZ1 A;  1VRK A;  4MSP A;  5I2O A;  1YRT B;  2EC6 C;  2V53 A;  2MBX A;  3SG7 A;  3BUN B;  3D10 A;  4PHM A;  1K90 D;  3TUY B;  5KSZ A;  4GUK A;  1CFC A;  3WXA A;  3NSI A;  1L2O C;  1LVC D;  1NX1 A;  1JFK A;  3BXK A;  5I2L A;  4DUQ A;  1B7T Z;  1HT9 A;  1DJG A;  1M46 A;  2ZKM X;  3I5H B;  1SK6 D;  1N2D A;  2BKH B;  4OVN F;  2GV5 A;  3OP0 A;  4I5J A;  4DCK A;  2K7B A;  1Y1A A;  2KI4 C;  2KQ6 A;  1SL8 A;  3JTD B;  2JC2 A;  1UHI A;  1FPW A;  3PSR A;  4P5O E;  3O2P A;  1UHK A;  1XA5 A;  4ORC B;  2LVJ A;  2WC8 A;  1XFZ O;  2BCA A;  1AP4 A;  1XFX O;  3CS1 A;  1NUB A;  1L7Z A;  1G8I A;  1B8L A;  3BUW B;  1YX8 A;  1K93 D;  2JQ6 A;  1U5I B;  1TNW A;  1OSA A;  2BE4 A;  1U5I A;  1WRK A;  4NDB A;  4NQG A;  4CPV A;  1AK8 A;  1GQM A;  1OZO A;  2JWW A;  5CPV A;  2KNE A;  2M97 A;  4L9M A;  1RRO A;  4QJ5 B;  3WHU B;  1IGV A;  2JTZ A;  1S5G Z;  2PMY A;  1DVI A;  5J3X A;  1BR4 B;  1QV0 A;  2LVV A;  4YGE B;  3I5G C;  1YRU B;  1OMD A;  1YR5 A;  1NWD A;  4I5L B;  1AVS A;  1KSM A;  1QTX A;  2ZRT A;  1PAL A;  2KFG A;  2K0J A;  2CXJ A;  2LCP A;  2O5G A;  2JNX A;  1IJ5 A;  4PE1 A;  1JF0 A;  1S6J A;  2AUC A;  2JRF A;  1H8B A;  2H2K A;  1S3P A;  1RFJ A;  2ZND A;  2FCD A;  4AOM A;  1SR6 C;  3I5F B;  1L2O B;  2QAC A;  1SCM B;  2E30 A;  1M39 A;  1ALV A;  1OOJ A;  2LLS A;  1KFX L;  2COL B;  3I5F C;  4CFQ A;  2CCM A;  1DGV A;  4DS7 A;  2K61 A;  3K21 A;  1KK8 B;  3FWC A;  3I5H C;  2M1U A;  5HKY A;  1QAS A;  2BCX A;  4U8D A;  2M9G A;  4MBE A;  2BL0 C;  1J1D A;  1EG4 A;  4BY5 A;  1PVB A;  1A03 A;  1CLL A;  1JBA A;  1UP5 A;  3BUM B;  5G08 A;  5KTY A;  2M49 B;  1S5G Y;  1X02 A;  1M31 A;  4HRG A;  4MZK A;  2PRU A;  3ICB A;  2M8U A;  3GK2 A;  1PRW A;  1K96 A;  5HKW A;  2HF5 A;  1W7J B;  1HQV A;  4WRI A;  1H4B A;  1CNP A;  5TNC A;  1CLM A;  3VRQ A;  5ER4 X;  4AQJ A;  1XYD A;  1N0Y A;  1FBV A;  1TNQ A;  1SY9 A;  1TRF A;  4WQ2 A;  2SAS A;  3BYA A;  3EK4 A;  1UWO A;  4GFT A;  1SR6 B;  2NZ0 A;  3TUY C;  4QJ3 B;  1BOD A;  2QPT A;  4YGD B;  1YVH A;  3GK1 A;  2ZN9 A;  1V1F A;  2KI6 D;  2TN4 A;  1CM4 A;  1RJV A;  4CLN A;  1F55 A;  1GGZ A;  3DVJ A;  1AHR A;  1DJH A;  1JWD A;  2G9B A;  5PAL A;  2JTT A;  2EC6 B;  3LLE A;  1S1E A;  3SG5 A;  1B8C A;  1GJY A;  4P2Y B;  2L98 A;  2GGM A;  4YI8 A;  4PE4 A;  1F4Q A;  2MLE C;  2P6B B;  1FI6 A;  1MHO A; 
#chains in the Genus database with same CATH topology
 1XFU O;  5AXI A;  2KLE A;  3B86 A;  1JF2 A;  5EL2 A;  1CMG A;  2WOR A;  3D76 A;  1IKU A;  3PN7 B;  1CFP A;  3CTN A;  1IIO A;  3CZT X;  4PE7 A;  4YGA A;  2AMI A;  5F6T A;  4F7F A;  1QX2 A;  2LHI A;  2LVK A;  3O6B A;  4JD9 A;  5D69 A;  1JUO A;  2L5X B;  1TTX A;  2CNP A;  2LUX A;  3R1O A;  1CFD A;  1OOH A;  2L4H A;  1F54 A;  1SNL A;  3VRR A;  1ZOT B;  2KAX A;  2LNK A;  1KQM B;  1KWO B;  2EHB A;  1OE9 B;  2QEO A;  2KBI A;  3NHI A;  2MAZ A;  1XFR A;  1BT6 A;  3VRP A;  2WCM A;  1ORG A;  1QXP A;  2M1K B;  2L2E A;  1XK4 A;  4GAO A;  1TUJ A;  1DGU A;  2BEC A;  4GGN A;  4M2Q A;  1KSO A;  2M7N A;  1MXL C;  1M45 A;  2ZFD A;  3KHE A;  1CLB A;  3SIB A;  4TNC A;  1CM1 A;  1NX2 A;  1NYA A;  2F2O A;  1J55 A;  2PAS A;  1Y1X A;  2EGD A;  3CR5 X;  2JU0 A;  1LKJ A;  4NDC A;  1K9K A;  2MA2 A;  1BJF A;  2FJY A;  2JPO A;  4PHK A;  4ZCU A;  1S36 A;  3IF7 A;  2FJU B;  3Q8I A;  3DF0 B;  1JSA A;  3CZ0 A;  5DKR A;  1S6C A;  1CDP A;  3TDZ A;  3PN7 C;  3S0F A;  4OV2 A;  1K9P A;  2OS8 C;  3BOW A;  1B1G A;  1AJ4 A;  2KAV A;  2OS8 B;  3PJI A;  3H4S E;  4JPZ B;  2NXQ A;  4PHJ A;  1NCY A;  4ORB B;  3JVT C;  1UUR A;  4GNK B;  2KQY A;  2L2C A;  2AAO A;  1KFU L;  4JQ0 D;  2WCL A;  4M2P A;  5FYX A;  1S26 D;  4MLW A;  2H61 C;  3MSE B;  3UO9 A;  4FQO A;  3I5G B;  1DF0 B;  1XFV O;  2I18 A;  1SCV A;  2ISD A;  1BR1 B;  3OHM B;  4ETO A;  2M7L A;  3SG3 A;  1MF8 B;  3DZT A;  2KYC A;  3DYE A;  1OOF A;  1TN4 A;  4F0Z B;  4N1F A;  3CGA A;  3KF9 A;  1SBJ A;  2OTG B;  3EKJ A;  1WRL A;  2KHN A;  2L50 A;  1KWO C;  1UUS A;  2KSP A;  1XFY O;  2A4J A;  5FI2 A;  2LLU A;  4PAL A;  1QVI Y;  2L4I A;  2LE9 B;  1J1E A;  1KK7 Y;  2HET A;  1TIZ A;  3FE8 A;  2BAP A;  3AAJ A;  3TDI A;  5BPJ A;  4USL A;  5GQQ C;  2B1U A;  2Y4Q A;  2KI4 B;  2ZRS A;  2LAN A;  1KK8 C;  1REC A;  3CAB A;  2BKI B;  2LHL A;  1TWO A;  1XVJ A;  2GTE A;  1QIV A;  2F33 A;  2OPO A;  4CID A;  3FWB A;  1K2H A;  4XJK B;  3PAL A;  1IH0 A;  2LLT A;  1KCY A;  1DJX A;  2LVI A;  2KGR A;  3EVR A;  1SL9 A;  3DY9 A;  4GGF A;  4YGB B;  5AER A;  2MHH A;  4PE0 A;  1F71 A;  3EK8 A;  3DVK A;  2KFF A;  2MRD A;  1FI5 A;  1M63 B;  2K7D A;  3IVT A;  5DKN A;  3WHT B;  2Y5I A;  4QJ5 B;  3K1E A;  1XK4 C;  3DVM A;  1OMR A;  1WLZ A;  2K7C A;  1NX3 A;  2CT9 A;  2JUL A;  1B47 A;  2SCP A;  1ALW A;  3EVV A;  3GK4 X;  5ER5 A;  4C0J A;  2MLF C;  1YUS A;  1CFF A;  4NDD A;  4MZL A;  3NHT A;  1EJ3 A;  1QJT A;  1YUT A;  2KGB C;  3AAK A;  5CSF A;  3EG5 B;  3CR4 X;  5HLV A;  1DJI A;  1CDL A;  4PHN A;  2Y1N A;  4YBH B;  2PQL A;  4AQI A;  2GGZ A;  1QWV A;  4N5X A;  1KFU S;  3VRN A;  3EKH A;  1Z2C B;  3SIA A;  2JPT A;  2KOT A;  1XFW O;  2BCB A;  2Q4U A;  2BL0 B;  4I5N B;  2KAY A;  3M0W A;  4OZD A;  1DC1 A;  1TUZ A;  2JZI A;  2LMU A;  3DD4 A;  3FIA A;  3ZWH A;  3WNX B;  5D3O A;  1PK0 D;  2JT0 A;  1LIN A;  1NX0 A;  2K7O A;  2LP3 A;  1PSR A;  1J7Q A;  1LS8 A;  1MR8 A;  2NLN A;  3TDU A;  1B4C A;  4CFR A;  4YRU A;  1BF5 A;  3B87 A;  2WC5 A;  2JOJ A;  2KPH A;  2WOS A;  3EK7 A;  5AAN A;  4Q04 A;  2NCO A;  1TOP A;  1NSH A;  1DF0 A;  1QAT A;  1K95 A;  3PAT A;  4INX A;  3TS5 C;  1NIW A;  1TNX A;  2WCF A;  1CDN A;  3TS5 B;  2KBM A;  1ZAC A;  1WDC B;  4MVF A;  3RLZ A;  1J7P A;  5HYD A;  5JOL A;  3E3R A;  1DJW A;  1G33 A;  2LM5 A;  3FS7 A;  1D1O A;  1C7W A;  1QLS A;  3OB1 B;  1KFX S;  4PDZ A;  1GGW A;  2L51 A;  1C07 A;  2CTN A;  1MXE A;  1NP8 A;  2G2B A;  1A29 A;  2KDH A;  3JTD C;  4ZCV A;  1R6P A;  1YVL A;  1IQ3 A;  1YUU A;  1AJ5 A;  3PM8 A;  2I7A A;  1SMG A;  3PFV A;  1B8R A;  3D75 A;  2FOT A;  1WRZ A;  1DTL A;  3PLF B;  3CWG A;  3DF0 A;  5AEQ A;  1EL4 A;  4HRH A;  5JJG A;  4MRY A;  3BQ3 A;  4MZJ A;  2R2I A;  3GOF A;  4ORA B;  4FTG A;  3KEV A;  3S0E A;  1EXR A;  1WLM A;  5IBW A;  2LAP A;  1BU3 A;  1OQP A;  4DRW A;  1C3Y A;  3AKA A;  5HKZ A;  2Y1M A;  1MUX A;  2JNF A;  3AKB A;  4R1E A;  1PVA A;  4YGC B;  2WCE A;  3O78 A;  1QS7 A;  4A4B A;  1QVI Z;  1A75 A;  1W7I B;  1NPQ A;  5B8I B;  1KK7 Z;  1Q80 A;  2F2P A;  2WC6 A;  1UHJ A;  3VGO A;  2M0R A;  3D77 A;  4GGF C;  1XO5 A;  1EH2 A;  3NSK A;  2JT8 A;  4PCW A;  2LV7 A;  3SG4 A;  2F8P A;  4D1E A;  4GBA A;  3DXL A;  1V1G A;  1SRA A;  4XJK A;  3I5I B;  3OBV A;  4MN0 A;  4C0L A;  2ZN8 A;  1K9U A;  3JVT B;  2K2F A;  2BBM A;  4QJ4 B;  2H8V A;  1YUR A;  1SPY A;  1DMO A;  2ZNE A;  1IG5 A;  2O60 A;  3IQQ A;  4I5K A;  4A4C A;  1PSB A;  1F4O A;  1S6I A;  3LK0 A;  3NSL A;  2ERB A;  1G4Y R;  1TCF A;  1NCX A;  5I8N A;  5KU1 A;  2I94 A;  1SCM C;  1AUI B;  3SG6 A;  3ZNI A;  3CDN A;  3BOW B;  3NSO A;  1OOG A;  4N1G A;  5FI7 A;  2NCP A;  2HQ8 A;  4JWQ A;  2F3Y A;  1Y6W A;  2QEH A;  1F8H A;  1WDC C;  1PUL A;  1ODB A;  2RGI A;  3PM2 A;  4UPG A;  5I2Q A;  1CTR A;  1QIW A;  5K89 A;  3D0Y B;  3R1P A;  3D0Y A;  2Q91 A;  4HRE E;  2JXC A;  4E68 A;  4BY4 A;  5CSJ A;  2LMT A;  2L0P A;  1DEK A;  4GPL B;  1LA3 A;  4MEW A;  1BOC A;  3L4A A;  5DIC A;  1SL7 A;  1FW4 A;  1J7O A;  1CB1 A;  4OKH A;  1DT7 B;  2WND A;  2PAL A;  1SW8 A;  3NGV A;  4XYN A;  3CZ1 A;  3HCM A;  5DKQ A;  2LMV A;  4C0K A;  2M3W A;  2OTG C;  2H61 A;  2VRG A;  2KYF A;  1DQE A;  1Y1U A;  2HPS A;  1KQV A;  2K8M B;  1ZFS A;  2LP2 A;  1BLQ A;  1CMF A;  3CR2 A;  3A8R A;  2LUC A;  4PT1 A;  1NCZ A;  3KO0 A;  3RM1 A;  3HX4 A;  1IRJ A;  2LC5 A;  2E6W A;  1K94 A;  1EG3 A;  2BE6 A;  1ZUZ A;  1MQ1 A;  1LXF C;  1A4P A;  5HLO A;  1BMO A;  3L4L A;  1JC2 A;  1QX5 B;  1MWN A;  1SKT A;  3LCP C;  2K60 A;  2WCB A;  3F45 A;  3O4Y A;  1DJY A;  2K2A A;  3BFB A;  1FF1 A;  1QV1 A;  1A75 B;  2IS9 A;  4OR9 B;  5CSN A;  1SYM A;  3CLN A;  1OMV A;  1BG1 A;  2FCE A;  3OGN A;  4ICB A;  1C7V A;  4M2O A;  1IWQ A;  1IJ6 A;  1N65 A;  1OZS A;  1RTP 1;  1Y0V H;  3DVE A;  1A2X A;  1TNP A;  2F3Z A;  3SG2 A;  3NXA A;  2PVB A;  1WY9 A;  1RWY A;  2DOQ A;  5FI6 A;  4WQ3 A;  2KFH A;  3C1V A;  3CYZ A;  4OCI A;  1UHH A;  1RK9 A;  1J7R A;  1UHN A;  1GM0 A;  1CDM A;  1JFJ A;  1LA0 A;  1R2U A;  2D8N A;  3S0D A;  5AFP A;  3BUX B;  1K8U A;  2JT3 A;  1QX7 A;  1YTZ C;  2HQW A;  4IL1 A;  3OB2 B;  2MJW B;  3LL8 B;  3OX6 A;  4MRX A;  3EVU A;  1OW4 A;  2P71 A;  3BUO B;  5CSI A;  4YI9 A;  2BBN A;  1B7T Y;  2QEB A;  1DJZ A;  3O4X A;  1DEL A;  1TCO B;  3SS5 A;  4FQT A;  4DIR A;  2KI6 C;  3I5I C;  3QRX A;  3SJS A;  1F70 A;  1ZMZ A;  1W9Z A;  2JXL A;  5D7F A;  1CKK A;  3LK1 A;  3UNW A;  2I2R E;  3OX5 A;  3VRO A;  3BFH A;  2M29 A;  3KPX A;  1KQM C;  3A4U B;  3IQO A;  2PSR A;  1QLK A;  1E8A A;  1YX7 A;  3CZ2 A;  3S0A A;  2CBL A;  1B9A A;  1IQ5 A;  3TZ1 A;  1VRK A;  4MSP A;  5I2O A;  1YRT B;  2EC6 C;  2V53 A;  2MBX A;  3SG7 A;  3SS3 A;  3BUN B;  3D10 A;  4PHM A;  1K90 D;  4INW A;  3L47 A;  3TUY B;  5KSZ A;  3BJH A;  4GUK A;  1CFC A;  3WXA A;  3NSI A;  1L2O C;  1LVC D;  1NX1 A;  1JFK A;  3BXK A;  5I2L A;  4DUQ A;  1B7T Z;  1HT9 A;  1DJG A;  3B7A A;  1M46 A;  2ZKM X;  3I5H B;  3R72 A;  1SK6 D;  1N2D A;  2BKH B;  2WCH A;  4OVN F;  2GV5 A;  3OP0 A;  4I5J A;  4DCK A;  2K7B A;  1Y1A A;  2KI4 C;  2KQ6 A;  1SL8 A;  3FE6 A;  3JTD B;  2JC2 A;  1UHI A;  3V2L A;  3PSR A;  1FPW A;  4P5O E;  3O2P A;  1UHK A;  1XA5 A;  4ORC B;  2LVJ A;  2WC8 A;  1XFZ O;  2BCA A;  2YGU A;  1AP4 A;  1XFX O;  3CS1 A;  1NUB A;  1L7Z A;  1G8I A;  1B8L A;  3B88 A;  1T14 A;  1YX8 A;  3BUW B;  4HSZ A;  1K93 D;  2JQ6 A;  1U5I B;  1TNW A;  1OSA A;  4KYN A;  2BE4 A;  1U5I A;  1WRK A;  4NDB A;  4NQG A;  4CPV A;  3B6X A;  3VB1 A;  1AK8 A;  3BFA A;  1GQM A;  5HL1 A;  1OZO A;  2JWW A;  5CPV A;  2KNE A;  2M97 A;  4L9M A;  1RRO A;  3S0B A;  3WHU B;  1IGV A;  2JTZ A;  1S5G Z;  2PMY A;  1DVI A;  2PYQ A;  5J3X A;  1BR4 B;  1QV0 A;  2LVV A;  4YGE B;  3I5G C;  1YRU B;  1OMD A;  1YR5 A;  1NWD A;  2QEV A;  1AVS A;  1KSM A;  4I5L B;  1QTX A;  2ZRT A;  1PAL A;  2KFG A;  2K0J A;  2CXJ A;  2LCP A;  2O5G A;  2JNX A;  1IJ5 A;  4PE1 A;  3RZS A;  1JF0 A;  1C3Z A;  1S6J A;  2AUC A;  2JRF A;  3R1V A;  2H2K A;  1H8B A;  1S3P A;  1RFJ A;  2ZND A;  3SS4 A;  2FCD A;  4AOM A;  1SR6 C;  3I5F B;  1L2O B;  1Z4H A;  2QAC A;  1SCM B;  2E30 A;  1M39 A;  1ALV A;  1OOJ A;  2LLS A;  1KFX L;  2COL B;  3I5F C;  1OOI X;  4CFQ A;  2CCM A;  2WCJ A;  1DGV A;  4DS7 A;  2K61 A;  3K21 A;  1KK8 B;  3FWC A;  3I5H C;  2M1U A;  5HKY A;  1QAS A;  2BCX A;  4IJ7 A;  4U8D A;  2M9G A;  4MBE A;  3QME A;  2BL0 C;  2KLD A;  1J1D A;  1EG4 A;  4BY5 A;  1PVB A;  1A03 A;  1CLL A;  1JBA A;  1UP5 A;  3BUM B;  5G08 A;  5KTY A;  2M49 B;  2BNX A;  1S5G Y;  1X02 A;  1M31 A;  4HRG A;  4MZK A;  2L5Y A;  2PRU A;  3ICB A;  3D74 A;  2M8U A;  3GK2 A;  1PRW A;  1K96 A;  5HKW A;  1P28 A;  5I94 A;  1W7J B;  1HQV A;  2HF5 A;  4WRI A;  1H4B A;  1CNP A;  5TNC A;  1CLM A;  3VRQ A;  5ER4 X;  4AQJ A;  1XYD A;  2P70 A;  1N0Y A;  2QDI A;  1FBV A;  1TNQ A;  1SY9 A;  1TRF A;  4WQ2 A;  2SAS A;  3BYA A;  3EK4 A;  1UWO A;  4GFT A;  1SR6 B;  2NZ0 A;  3TUY C;  4QJ3 B;  1SSE B;  2QPT A;  1BOD A;  4YGD B;  3S0G A;  1YVH A;  3GK1 A;  2ZN9 A;  1V1F A;  2KI6 D;  2TN4 A;  1CM4 A;  1RJV A;  4CLN A;  1F55 A;  2WCK A;  3N7H A;  1GGZ A;  3DVJ A;  1AHR A;  1DJH A;  1JWD A;  2G9B A;  5PAL A;  2JTT A;  2EC6 B;  3LLE A;  1S1E A;  3SG5 A;  1B8C A;  3FE9 A;  1GJY A;  4JKT A;  4P2Y B;  2L98 A;  2GGM A;  3D73 A;  4YI8 A;  3D78 A;  4PE4 A;  1F4Q A;  2MLE C;  2P6B B;  1FI6 A;  1MHO A; 
#chains in the Genus database with same CATH homology
 1XFU O;  5AXI A;  1JF2 A;  1CMG A;  2WOR A;  1IKU A;  3PN7 B;  1CFP A;  3CTN A;  3CZT X;  4PE7 A;  4YGA A;  2AMI A;  5F6T A;  1QX2 A;  2LHI A;  2LVK A;  3O6B A;  5D69 A;  1JUO A;  2L5X B;  1TTX A;  2CNP A;  2LUX A;  1CFD A;  2L4H A;  1F54 A;  1SNL A;  3VRR A;  1ZOT B;  2KAX A;  2LNK A;  1KQM B;  1KWO B;  2EHB A;  1OE9 B;  2KBI A;  2MAZ A;  1BT6 A;  3VRP A;  1QXP A;  2M1K B;  2L2E A;  1XK4 A;  4GAO A;  1DGU A;  2BEC A;  4GGN A;  4M2Q A;  1KSO A;  2M7N A;  1MXL C;  1M45 A;  2ZFD A;  3KHE A;  1CLB A;  3SIB A;  4TNC A;  1CM1 A;  1NX2 A;  1NYA A;  2F2O A;  1J55 A;  2PAS A;  1Y1X A;  2EGD A;  3CR5 X;  2JU0 A;  1LKJ A;  4NDC A;  1K9K A;  2MA2 A;  1BJF A;  4PHK A;  4ZCU A;  1S36 A;  3IF7 A;  2FJU B;  3DF0 B;  1JSA A;  5DKR A;  1S6C A;  1CDP A;  3TDZ A;  3PN7 C;  4OV2 A;  1K9P A;  2OS8 C;  3BOW A;  1B1G A;  1AJ4 A;  2KAV A;  2OS8 B;  4JPZ B;  3H4S E;  2NXQ A;  4PHJ A;  1NCY A;  4ORB B;  3JVT C;  1UUR A;  4GNK B;  2KQY A;  2AAO A;  1KFU L;  4JQ0 D;  4M2P A;  5FYX A;  1S26 D;  4MLW A;  2H61 C;  3MSE B;  4FQO A;  3I5G B;  1DF0 B;  1XFV O;  2I18 A;  1SCV A;  2ISD A;  1BR1 B;  3OHM B;  4ETO A;  2M7L A;  3SG3 A;  1MF8 B;  2KYC A;  1TN4 A;  4F0Z B;  4N1F A;  3CGA A;  3KF9 A;  1SBJ A;  2OTG B;  3EKJ A;  1WRL A;  2KHN A;  2L50 A;  1KWO C;  1UUS A;  2KSP A;  1XFY O;  2A4J A;  2LLU A;  4PAL A;  1QVI Y;  2L4I A;  2LE9 B;  1J1E A;  1KK7 Y;  2HET A;  1TIZ A;  3AAJ A;  3TDI A;  5BPJ A;  4USL A;  5GQQ C;  2B1U A;  2Y4Q A;  2KI4 B;  2ZRS A;  2LAN A;  1KK8 C;  1REC A;  4HSZ A;  2BKI B;  2LHL A;  2OPO A;  1XVJ A;  4CID A;  1QIV A;  2F33 A;  3FWB A;  1K2H A;  4XJK B;  3PAL A;  1IH0 A;  2LLT A;  1KCY A;  1DJX A;  2LVI A;  2KGR A;  3EVR A;  1SL9 A;  4GGF A;  4YGB B;  5AER A;  2MHH A;  4PE0 A;  1F71 A;  3EK8 A;  3DVK A;  2KFF A;  2MRD A;  1FI5 A;  1M63 B;  2K7D A;  5DKN A;  3WHT B;  2Y5I A;  1XK4 C;  3DVM A;  1OMR A;  1WLZ A;  2K7C A;  1NX3 A;  2CT9 A;  2JUL A;  1B47 A;  2SCP A;  1ALW A;  3EVV A;  3GK4 X;  5ER5 A;  4C0J A;  2MLF C;  1YUS A;  1CFF A;  4NDD A;  4MZL A;  1EJ3 A;  1QJT A;  1YUT A;  2KGB C;  3AAK A;  5CSF A;  3CR4 X;  5HLV A;  1DJI A;  1CDL A;  4PHN A;  2Y1N A;  4YBH B;  4AQI A;  2GGZ A;  4N5X A;  1KFU S;  3VRN A;  3EKH A;  3SIA A;  2JPT A;  2KOT A;  1XFW O;  2BCB A;  2Q4U A;  2BL0 B;  4I5N B;  2KAY A;  3M0W A;  2JZI A;  2LMU A;  3DD4 A;  3FIA A;  3ZWH A;  3WNX B;  1PK0 D;  2JT0 A;  1LIN A;  1NX0 A;  2K7O A;  2LP3 A;  1PSR A;  1J7Q A;  1MR8 A;  2NLN A;  3TDU A;  1B4C A;  4CFR A;  4YRU A;  1BF5 A;  2JOJ A;  2WOS A;  3EK7 A;  5AAN A;  4Q04 A;  2NCO A;  1TOP A;  1NSH A;  1DF0 A;  1QAT A;  1K95 A;  3PAT A;  3TS5 C;  1NIW A;  1TNX A;  2WCF A;  1CDN A;  3TS5 B;  2KBM A;  1ZAC A;  1WDC B;  4MVF A;  3RLZ A;  1J7P A;  5HYD A;  5JOL A;  3E3R A;  1DJW A;  1G33 A;  2LM5 A;  3FS7 A;  1D1O A;  1C7W A;  1QLS A;  3OB1 B;  1KFX S;  4PDZ A;  1GGW A;  2L51 A;  1C07 A;  2CTN A;  1MXE A;  1NP8 A;  2G2B A;  1A29 A;  2KDH A;  3JTD C;  4ZCV A;  1R6P A;  1YVL A;  1IQ3 A;  1YUU A;  1AJ5 A;  3PM8 A;  2I7A A;  1SMG A;  3PFV A;  1B8R A;  2FOT A;  1WRZ A;  1DTL A;  3PLF B;  3CWG A;  3DF0 A;  5AEQ A;  1EL4 A;  4HRH A;  5JJG A;  4MRY A;  3BQ3 A;  4MZJ A;  2R2I A;  3GOF A;  4ORA B;  4FTG A;  3KEV A;  1EXR A;  1WLM A;  5IBW A;  2LAP A;  1BU3 A;  1OQP A;  4DRW A;  3AKA A;  5HKZ A;  2Y1M A;  1MUX A;  2JNF A;  3AKB A;  4R1E A;  1PVA A;  4YGC B;  2WCE A;  3O78 A;  1QS7 A;  4A4B A;  1QVI Z;  1A75 A;  1W7I B;  1NPQ A;  5B8I B;  1KK7 Z;  1Q80 A;  2F2P A;  1UHJ A;  3VGO A;  2M0R A;  4GGF C;  1XO5 A;  1EH2 A;  3NSK A;  2JT8 A;  4PCW A;  2LV7 A;  3SG4 A;  2F8P A;  4D1E A;  4GBA A;  1V1G A;  1SRA A;  4XJK A;  3I5I B;  4MN0 A;  4C0L A;  2ZN8 A;  1K9U A;  3JVT B;  2K2F A;  2BBM A;  4QJ4 B;  1YUR A;  1SPY A;  1DMO A;  2ZNE A;  1IG5 A;  2O60 A;  3IQQ A;  4I5K A;  4A4C A;  1PSB A;  1F4O A;  1S6I A;  3LK0 A;  3NSL A;  1G4Y R;  1TCF A;  1NCX A;  5I8N A;  5KU1 A;  2I94 A;  1SCM C;  1AUI B;  3SG6 A;  3ZNI A;  3BOW B;  3NSO A;  4N1G A;  2NCP A;  2HQ8 A;  4JWQ A;  2F3Y A;  1Y6W A;  1F8H A;  1WDC C;  1PUL A;  1ODB A;  2RGI A;  4UPG A;  5I2Q A;  1CTR A;  1QIW A;  5K89 A;  3D0Y B;  3D0Y A;  2Q91 A;  4HRE E;  2JXC A;  4E68 A;  4BY4 A;  5CSJ A;  2LMT A;  2L0P A;  4GPL B;  1LA3 A;  4MEW A;  1BOC A;  1SL7 A;  1FW4 A;  1J7O A;  1CB1 A;  4OKH A;  1DT7 B;  2WND A;  2PAL A;  1SW8 A;  4XYN A;  3HCM A;  5DKQ A;  4C0K A;  2LMV A;  2M3W A;  2OTG C;  2H61 A;  2VRG A;  2KYF A;  1Y1U A;  2HPS A;  1KQV A;  2K8M B;  1ZFS A;  2LP2 A;  1BLQ A;  1CMF A;  3CR2 A;  3A8R A;  2LUC A;  3RM1 A;  1NCZ A;  3KO0 A;  3HX4 A;  1IRJ A;  2LC5 A;  2E6W A;  1K94 A;  1EG3 A;  2BE6 A;  1ZUZ A;  1MQ1 A;  1LXF C;  1A4P A;  5HLO A;  1BMO A;  1JC2 A;  1QX5 B;  1MWN A;  1SKT A;  3LCP C;  3O4Y A;  2WCB A;  3F45 A;  1DJY A;  2K2A A;  1FF1 A;  1QV1 A;  1A75 B;  2IS9 A;  4OR9 B;  5CSN A;  1SYM A;  3CLN A;  1OMV A;  1BG1 A;  2FCE A;  4ICB A;  1C7V A;  4M2O A;  1IWQ A;  1IJ6 A;  1N65 A;  1OZS A;  1RTP 1;  1Y0V H;  3DVE A;  1A2X A;  1TNP A;  2F3Z A;  3SG2 A;  3NXA A;  2PVB A;  1WY9 A;  1RWY A;  2DOQ A;  4WQ3 A;  2KFH A;  3C1V A;  4OCI A;  1UHH A;  1RK9 A;  1J7R A;  1UHN A;  1CDM A;  1JFJ A;  1LA0 A;  1R2U A;  2D8N A;  5AFP A;  3BUX B;  1K8U A;  2JT3 A;  1QX7 A;  1YTZ C;  2HQW A;  4IL1 A;  3OB2 B;  2MJW B;  3LL8 B;  3OX6 A;  4MRX A;  3EVU A;  3BUO B;  5CSI A;  4YI9 A;  2BBN A;  1B7T Y;  1DJZ A;  1TCO B;  4DIR A;  2KI6 C;  3I5I C;  3QRX A;  3SJS A;  1F70 A;  1ZMZ A;  2JXL A;  1CKK A;  5D7F A;  3LK1 A;  2I2R E;  3OX5 A;  3VRO A;  2M29 A;  3KPX A;  1KQM C;  3A4U B;  3IQO A;  2PSR A;  1QLK A;  1E8A A;  1YX7 A;  2CBL A;  1B9A A;  1IQ5 A;  3TZ1 A;  1VRK A;  4MSP A;  5I2O A;  1YRT B;  2EC6 C;  2V53 A;  2MBX A;  3SG7 A;  3BUN B;  3D10 A;  4PHM A;  1K90 D;  3TUY B;  5KSZ A;  4GUK A;  1CFC A;  3WXA A;  3NSI A;  1L2O C;  1LVC D;  1NX1 A;  1JFK A;  3BXK A;  5I2L A;  4DUQ A;  1B7T Z;  1HT9 A;  1DJG A;  1M46 A;  2ZKM X;  3I5H B;  1SK6 D;  1N2D A;  2BKH B;  4OVN F;  2GV5 A;  3OP0 A;  4I5J A;  4DCK A;  2K7B A;  1Y1A A;  2KI4 C;  2KQ6 A;  1SL8 A;  3JTD B;  2JC2 A;  1UHI A;  1FPW A;  3PSR A;  4P5O E;  3O2P A;  1UHK A;  1XA5 A;  4ORC B;  2LVJ A;  2WC8 A;  1XFZ O;  2BCA A;  1AP4 A;  1XFX O;  3CS1 A;  1NUB A;  1L7Z A;  1G8I A;  1B8L A;  3BUW B;  1YX8 A;  1K93 D;  2JQ6 A;  1U5I B;  1TNW A;  1OSA A;  2BE4 A;  1U5I A;  1WRK A;  4NDB A;  4NQG A;  4CPV A;  1AK8 A;  1GQM A;  1OZO A;  2JWW A;  5CPV A;  2KNE A;  2M97 A;  4L9M A;  1RRO A;  4QJ5 B;  3WHU B;  1IGV A;  2JTZ A;  1S5G Z;  2PMY A;  1DVI A;  5J3X A;  1BR4 B;  1QV0 A;  2LVV A;  4YGE B;  3I5G C;  1YRU B;  1OMD A;  1YR5 A;  1NWD A;  4I5L B;  1AVS A;  1KSM A;  1QTX A;  2ZRT A;  1PAL A;  2KFG A;  2K0J A;  2CXJ A;  2LCP A;  2O5G A;  2JNX A;  1IJ5 A;  4PE1 A;  1JF0 A;  1S6J A;  2AUC A;  2JRF A;  1H8B A;  2H2K A;  1S3P A;  1RFJ A;  2ZND A;  2FCD A;  4AOM A;  1SR6 C;  3I5F B;  1L2O B;  2QAC A;  1SCM B;  2E30 A;  1M39 A;  1ALV A;  1OOJ A;  2LLS A;  1KFX L;  2COL B;  3I5F C;  4CFQ A;  2CCM A;  1DGV A;  4DS7 A;  2K61 A;  3K21 A;  1KK8 B;  3FWC A;  3I5H C;  2M1U A;  5HKY A;  1QAS A;  2BCX A;  4U8D A;  2M9G A;  4MBE A;  2BL0 C;  1J1D A;  1EG4 A;  4BY5 A;  1PVB A;  1A03 A;  1CLL A;  1JBA A;  1UP5 A;  3BUM B;  5G08 A;  5KTY A;  2M49 B;  1S5G Y;  1X02 A;  1M31 A;  4HRG A;  4MZK A;  2PRU A;  3ICB A;  2M8U A;  3GK2 A;  1PRW A;  1K96 A;  5HKW A;  2HF5 A;  1W7J B;  1HQV A;  4WRI A;  1H4B A;  1CNP A;  5TNC A;  1CLM A;  3VRQ A;  5ER4 X;  4AQJ A;  1XYD A;  1N0Y A;  1FBV A;  1TNQ A;  1SY9 A;  1TRF A;  4WQ2 A;  2SAS A;  3BYA A;  3EK4 A;  1UWO A;  4GFT A;  1SR6 B;  2NZ0 A;  3TUY C;  4QJ3 B;  1BOD A;  2QPT A;  4YGD B;  1YVH A;  3GK1 A;  2ZN9 A;  1V1F A;  2KI6 D;  2TN4 A;  1CM4 A;  1RJV A;  4CLN A;  1F55 A;  1GGZ A;  3DVJ A;  1AHR A;  1DJH A;  1JWD A;  2G9B A;  5PAL A;  2JTT A;  2EC6 B;  3LLE A;  1S1E A;  3SG5 A;  1B8C A;  1GJY A;  4P2Y B;  2L98 A;  2GGM A;  4YI8 A;  4PE4 A;  1F4Q A;  2MLE C;  2P6B B;  1FI6 A;  1MHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...