3MSEB

Crystal structure of c-terminal domain of pf110239.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
168
Chain Sequence
ISPNVLNNMKSYMKHSNIRNIIINIMAHELSVINNHIKYINELFYKLDTNHNGSLSHREIYTVLASVGIKKWDINRILQALDINDRGNITYTEFMAGCYRWKNITFLKAAFNKIDKDEDGYISKSDIVSLVHDKVLDNNDIDNFFLSVHSIINKISFQEFKDYMLSTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Calcium-dependent protein kinase, putative
publication title Crystal structure of C-terminal domain of PF110239
rcsb
source organism Plasmodium falciparum
total genus 60
structure length 168
sequence length 179
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3mseB00
2BBMA 1F71A 4YGCB 2BCAA 5JJGA 2KYFA 2JZIA 1BF5A 1EG4A 2CCMA 5CSFA 3BUOB 1XO5A 1BOCA 5AXIA 2O60A 1WLMA 4GUKA 5HKZA 2H2KA 4PE1A 1J7RA 1R2UA 2LLSA 5I2LA 4NDBA 2ZN9A 2I18A 1CTRA 3PN7B 1WRLA 1HQVA 2NCPA 1QV1A 1IH0A 1SRAA 3WHTB 4GGFA 1SKTA 1CDPA 1NP8A 1CFFA 1V1FA 1YUTA 1PSBA 1J7PA 2JT0A 1MXLC 1F54A 3I5GB 4N5XA 1NX1A 1F4QA 1B8LA 1J1DA 3OB1B 3VGOA 1N2DA 2GV5A 1K94A 1LINA 2LP2A 1NX3A 2JTTA 4PHKA 1DGVA 1AP4A 1SPYA 1PK0D 4TNCA 3I5FB 1N0YA 1JWDA 1S1EA 2PSRA 4AQJA 1BG1A 1OMRA 2JXCA 2LHLA 5CSIA 1UHJA 2LUCA 1TOPA 4CIDA 1SCMB 4OCIA 2JOJA 5IBWA 1DF0A 4CPVA 1SL9A 1YURA 2E30A 4Q04A 2H61A 1XFYO 3JTDB 5FYXA 2AUCA 3O78A 1RECA 2LVIA 2MBXA 1B8RA 1PALA 2KYCA 2LHIA 2WC8A 3FIAA 3NSOA 1L7ZA 1FBVA 3NSIA 5D69A 4I5KA 1MWNA 1SL8A 1MR8A 3CS1A 1EL4A 2NXQA 2KFGA 1OQPA 2M7LA 2G9BA 1YVLA 3D0YB 1AK8A 2PASA 3O2PA 3SIAA 2K7DA 1QJTA 1W7JB 4M2PA 1B9AA 5BPJA 2KSPA 4PHNA 2K61A 2F2OA 2LLUA 2Y1MA 2ZRSA 3IQQA 1CM1A 3D0YA 3DVMA 2F3ZA 3OP0A 1MXEA 1WRZA 4WRIA 3TS5B 1CDMA 4JWQA 2MJWB 1CDNA 2KAXA 2KBMA 2BKIB 1B1GA 1CFPA 3KPXA 1A29A 2LV7A 2LUXA 1RJVA 1C7WA 2KOTA 3AAJA 4GGNA 4IL1A 4ORCB 3EVVA 2PRUA 1N65A 1OE9B 4OKHA 4OV2A 1YRTB 2BL0C 3E3RA 3EKHA 2FJUB 3PALA 1DJIA 3OX5A 2CXJA 4L9MA 5I2QA 3I5HB 1FI5A 1AUIB 1LVCD 4UPGA 1KK8B 1Y6WA 1BR4B 1M45A 2Q91A 2KI4C 2KFFA 1J7QA 2FOTA 1JUOA 1TNWA 2KNEA 2M8UA 4MEWA 4C0LA 1TNXA 1DJYA 1Q80A 1F4OA 2E6WA 3BUNB 1CFDA 1QX5B 1B8CA 3LLEA 3TUYB 3OX6A 1CB1A 3GK4X 2KQYA 1B4CA 2FCDA 4NQGA 1UWOA 1JFKA 4ORAB 1UP5A 1TIZA 1DJZA 1TNPA 1CM4A 3TZ1A 4P2YB 3A8RA 2JTZA 1XFXO 3NSKA 1KQMB 1NUBA 3GK1A 3M0WA 4C0KA 1OMDA 1CMGA 3SG2A 4C0JA 1QLKA 2FCEA 3PSRA 1DT7B 3ICBA 3NSLA 1LA0A 2BBNA 2KI6D 4MN0A 4XJKB 2EC6B 2R2IA 5JOLA 1BT6A 1BJFA 5KU1A 1KWOB 1UURA 1SR6C 4PE7A 4OVNF 3VRQA 2WCEA 2KI6C 1NX2A 1DTLA 2ZKMX 3BYAA 2KAYA 4ICBA 1CKKA 4GPLB 1YX8A 1LA3A 2F33A 2M9GA 2CT9A 4HRGA 1K9PA 3EK4A 4GGFC 1GGZA 5DKQA 3BOWB 1E8AA 3K21A 4WQ2A 3A4UB 4YI8A 1NX0A 1CFCA 2CBLA 4MZJA 4YRUA 2GGZA 5G08A 1K95A 3BXKA 1BMOA 1IRJA 2CNPA 4DUQA 3SG4A 1KK7Z 1GJYA 1UHKA 1NYAA 1U5IB 3OHMB 4HSZA 2B1UA 4I5LB 1JFJA 1XVJA 1DJGA 1J7OA 4GNKB 1C7VA 4QJ5B 1G4YR 1OZSA 2BE4A 2KQ6A 3PATA 1K90D 2F3YA 1U5IA 2WOSA 3IF7A 2M1UA 1BLQA 1TCFA 2P6BB 2PALA 1KCYA 1UHNA 2H61C 3LCPC 1G8IA 4N1GA 1SCMC 3EK7A 1HT9A 2COLB 4HREE 5DKNA 3OB2B 3O4YA 4CFQA 4YGAA 2CTNA 2SASA 1TTXA 4I5NB 1KFUS 3CR4X 3BQ3A 4A4CA 1EJ3A 5PALA 3DD4A 2NZ0A 3RM1A 1J55A 2JNFA 2K7CA 2L50A 1WLZA 1UHHA 3SJSA 1G33A 1SK6D 2IS9A 5TNCA 1AVSA 2KFHA 1K9UA 1YRUB 4DCKA 2QACA 2V53A 1DVIA 1OZOA 2KGRA 3FWCA 1CLBA 2Y1NA 2JWWA 5K89A 1UHIA 4YBHB 1M39A 1TNQA 1IQ5A 1XK4A 1JF2A 1PRWA 1XFWO 2ZFDA 4MRYA 3VROA 2MHHA 2NLNA 1IJ6A 1S6IA 2K8MB 1FPWA 4ORBB 2L4IA 2MLFC 2JNXA 1JF0A 2LLTA 3ZNIA 1KFUL 3SG6A 1JC2A 4USLA 2L98A 2QPTA 4NDDA 1FW4A 5AERA 2OTGC 4GAOA 5I8NA 2OS8C 3JVTC 1EG3A 1KK8C 1L2OC 1SMGA 1S6JA 2KAVA 1XYDA 3KF9A 1WDCC 2K7BA 1SY9A 5AANA 3C1VA 1QASA 2BL0B 1VRKA 3SG5A 3AAKA 2JU0A 2HETA 4F0ZB 2LVKA 4DIRA 3CR5X 1QX2A 3WNXB 1NCXA 2ZRTA 3I5IC 1QXPA 1GGWA 2G2BA 2Q4UA 3DVEA 1IQ3A 4CLNA 1QIVA 1YUSA 3TDUA 2LMTA 1Y1AA 2KI4B 3EVUA 1H4BA 3LK0A 1PVBA 2LE9B 1V1GA 1WRKA 2KDHA 1XA5A 1YTZC 1F55A 3IQOA 4PHJA 1IGVA 5CPVA 1SYMA 3VRRA 2HQWA 3DVJA 1ZFSA 2K2AA 4PDZA 1S5GZ 2OPOA 3RLZA 1Y0VH 1XFZO 2JXLA 5KTYA 1NWDA 4I5JA 1RWYA 3H4SE 1AJ5A 1ODBA 2LVJA 1QV0A 3KO0A 1A4PA 1DJHA 1YX7A 2JT3A 1S3PA 5DKRA 5KSZA 1K93D 1B7TZ 3EKJA 3PLFB 2M49B 3TDZA 4XYNA 1KWOC 4PE0A 4XJKA 1DMOA 4DS7A 1CLLA 2M3WA 2ZN8A 1ALVA 1S36A 1AJ4A 1QATA 2HF5A 2LMUA 2JT8A 5CSJA 3PN7C 3TDIA 2L2EA 2ZNDA 1WY9A 4YI9A 1CNPA 2ISDA 4P5OE 1QS7A 2HQ8A 1K9KA 1SR6B 1MF8B 2M29A 1XFUO 3BOWA 1MUXA 4FQOA 1CLMA 2NCOA 4N1FA 4PCWA 1S6CA 1SW8A 3CR2A 2F2PA 1TCOB 1DJXA 4AOMA 3KEVA 1EXRA 3I5GC 1LXFC 1YUUA 1RK9A 3BUWB 5B8IB 3AKBA 1S26D 1FF1A 3BUMB 1YVHA 3I5FC 3KHEA 1Y1XA 2BKHB 2AAOA 4E68A 1S5GY 1NCYA 1IWQA 2VRGA 1BR1B 5D7FA 4R1EA 5J3XA 4CFRA 2A4JA 2M97A 1IKUA 2RGIA 1K8UA 4DRWA 2KBIA 1QVIZ 5CSNA 2GGMA 1D1OA 1M31A 4WQ3A 1K2HA 1DGUA 1NIWA 1PVAA 5HLVA 5AFPA 3JTDC 4D1EA 1B7TY 4YGDB 2WCFA 1OOJA 3BUXB 3LL8B 5HKYA 3FWBA 2Y5IA 3CZTX 1B47A 2LVVA 4MRXA 4MBEA 3PM8A 2LNKA 1SL7A 1XFVO 1DF0B 2SCPA 4GFTA 2M1KB 3AKAA 1M63B 1X02A 4U8DA 2DOQA 4NDCA 1KQVA 3EVRA 2F8PA 3QRXA 4ZCUA 4M2OA 1A03A 2WCBA 1ZMZA 1JBAA 1QTXA 3CGAA 2I7AA 4BY4A 2HPSA 1LKJA 2ZNEA 1KK7Y 4AQIA 1RTP1 2MA2A 4MLWA 1XK4C 1UUSA 3TS5C 2PVBA 1ALWA 1F70A 1Y1UA 2JPTA 2M7NA 3SG3A 1C07A 1NPQA 1MHOA 4QJ3B 2PMYA 5HYDA 4A4BA 1SBJA 4JQ0D 1BODA 1RROA 2BCBA 1RFJA 2I2RE 3O6BA 1ZACA 2L5XB 3D10A 1DJWA 2LANA 1K96A 1QVIY 1PSRA 2I94A 3SIBA 2LCPA 1TRFA 3WXAA 3I5HC 1KFXS 3VRPA 3CLNA 1PULA 4MSPA 3MSEB 1BU3A 5HKWA 1A2XA 4PHMA 2EHBA 2BCXA 1IJ5A 4MVFA 4BY5A 3NXAA 4PALA 1R6PA 2K2FA 5GQQC 1F8HA 3VRNA 2L0PA 3TUYC 3CTNA 2O5GA 3DF0B 2JC2A 2JQ6A 2OTGB 1TN4A 3LK1A 3EK8A 4JPZB 2OS8B 3JVTB 1ZUZA 1L2OB 2KGBC 1CDLA 3HCMA 4ZCVA 2WORA 3DF0A 1WDCB 2JULA 2TN4A 3DVKA 1QLSA 3CWGA 1FI6A 4ETOA 1NSHA 1OMVA 3GOFA 1H8BA 2K0JA 5I2OA 1KQMC 3SG7A 1A75B 1JSAA 5HLOA 1ZOTB 3I5IB 1GQMA 2BECA 2K7OA 1QIWA 1W7IB 1KFXL 2M0RA 3GK2A 1A75A 1MQ1A 4YGEB 3WHUB 4QJ4B 2LM5A 2Y4QA 2BE6A 1EH2A 4MZKA 5F6TA 1OSAA 2D8NA 4FTGA 2WNDA 1J1EA 5ER5A 5AEQA 2EC6C 4MZLA 1CMFA 1SNLA 1QX7A 4YGBB 2L4HA 2L51A 2MRDA 2MAZA 5ER4X 4HRHA 2EGDA 4M2QA 3FS7A 4GBAA 2MLEC 2LAPA 3PFVA 1SCVA 1KSOA 1AHRA 2LC5A 1KSMA 3HX4A 4OR9B 3F45A 2LMVA 1IG5A 1M46A 2AMIA 2JRFA 4PE4A 1YR5A 2KHNA 3ZWHA 1NCZA 2LP3A
chains in the Genus database with same CATH superfamily
2BBMA 1F71A 4YGCB 2BCAA 5JJGA 5DICA 5FI2A 2KYFA 2JZIA 3B87A 1BF5A 1EG4A 2CCMA 5CSFA 3BUOB 1XO5A 1BOCA 5AXIA 2O60A 1WLMA 4GUKA 5HKZA 2H2KA 4PE1A 3S0FA 1J7RA 1R2UA 2LLSA 5I2LA 3S0AA 4NDBA 2ZN9A 2I18A 1CTRA 3PN7B 5I94A 1WRLA 1HQVA 4F7FA 3NHIA 2NCPA 1QV1A 1IH0A 1SRAA 3WHTB 4GGFA 1SKTA 1CDPA 1NP8A 1CFFA 1V1FA 1Z2CB 1YUTA 1PSBA 1J7PA 2JT0A 1MXLC 1F54A 3I5GB 4N5XA 1NX1A 1F4QA 1B8LA 1J1DA 3OB1B 3VGOA 1N2DA 2GV5A 1K94A 1LINA 2LP2A 1NX3A 2JTTA 4PHKA 1DGVA 1AP4A 1SPYA 1PK0D 4TNCA 3I5FB 1N0YA 1JWDA 1S1EA 2PSRA 4AQJA 1BG1A 1OMRA 2JXCA 2LHLA 5CSIA 1UHJA 2LUCA 1TOPA 4CIDA 1SCMB 3QMEA 4OCIA 2JOJA 5IBWA 1DF0A 3NHTA 1SL9A 4CPVA 1YURA 2E30A 4Q04A 2H61A 1XFYO 3JTDB 5FYXA 2AUCA 3O78A 1RECA 2LVIA 2MBXA 1B8RA 1PALA 2KYCA 2LHIA 2WCHA 1TUJA 2WC8A 3FIAA 3NSOA 1L7ZA 1FBVA 3NSIA 3BFBA 4I5KA 5D69A 1MWNA 1SL8A 1MR8A 3CS1A 1EL4A 2NXQA 2KFGA 1OQPA 2M7LA 2G9BA 1YVLA 3D0YB 1AK8A 2PASA 3O2PA 3SIAA 3D77A 2K7DA 1QJTA 1W7JB 4M2PA 1B9AA 5BPJA 2KSPA 4PHNA 2K61A 2F2OA 2KPHA 2LLUA 2Y1MA 2ZRSA 1CM1A 3D0YA 3IQQA 3O4XA 3DYEA 3DVMA 3DY9A 3NGVA 2F3ZA 3OP0A 1MXEA 1WRZA 4WRIA 3TS5B 1CDMA 4JWQA 2MJWB 1CDNA 2KAXA 2KBMA 2BKIB 1B1GA 1OOGA 1CFPA 3KPXA 1A29A 2LV7A 2LUXA 1RJVA 1C7WA 2KOTA 3AAJA 4GGNA 4IL1A 4ORCB 3EVVA 2PRUA 1N65A 1OE9B 4OKHA 4OV2A 1YRTB 2BL0C 3E3RA 1DC1A 3EKHA 2FJUB 3PALA 1DJIA 3OX5A 2L5YA 2CXJA 4L9MA 5I2QA 3I5HB 3UNWA 1FI5A 1AUIB 1LVCD 4UPGA 1KK8B 2P70A 1Y6WA 1BR4B 1M45A 2Q91A 2KI4C 2KFFA 1J7QA 2FOTA 1JUOA 1TNWA 2KNEA 2M8UA 4MEWA 2BNXA 4C0LA 1TNXA 1DJYA 1Q80A 1F4OA 2E6WA 3BUNB 1CFDA 1QX5B 1B8CA 3LLEA 3SS5A 3TUYB 3OX6A 1CB1A 3GK4X 2KQYA 1B4CA 2FCDA 4NQGA 1UWOA 3EG5B 1JFKA 4ORAB 1UP5A 2WC6A 1TIZA 2FJYA 1DJZA 3CDNA 1TNPA 1CM4A 3TZ1A 4P2YB 1W9ZA 2K60A 3A8RA 2JTZA 1XFXO 3NSKA 1KQMB 1OOFA 3CZ2A 1NUBA 3GK1A 3M0WA 4C0KA 1OMDA 3R72A 1CMGA 1DELA 5FI6A 3SG2A 1QLKA 4C0JA 3S0GA 2FCEA 3PSRA 1DT7B 3ICBA 3NSLA 1LA0A 2BBNA 2KI6D 4MN0A 4XJKB 2EC6B 2R2IA 5JOLA 1BT6A 1BJFA 5KU1A 1KWOB 1UURA 1SR6C 4PE7A 4OVNF 3VRQA 2WCEA 2KI6C 1NX2A 1DTLA 2ZKMX 3BYAA 2KAYA 4ICBA 1CKKA 4GPLB 1YX8A 1LA3A 2F33A 2M9GA 2CT9A 2WCKA 4HRGA 1K9PA 3EK4A 1ORGA 1GGZA 4GGFC 5DKQA 3BOWB 1E8AA 3K21A 4WQ2A 3A4UB 4YI8A 1NX0A 1CFCA 2CBLA 4MZJA 4YRUA 2GGZA 5G08A 1K95A 2WC5A 3BXKA 1BMOA 1IRJA 2CNPA 1EH2A 4DUQA 3SG4A 2WCJA 1KK7Z 1GJYA 1UHKA 4JD9A 1NYAA 1U5IB 3OHMB 4HSZA 2B1UA 4I5LB 3B6XA 1JFJA 1XVJA 1DJGA 1J7OA 4GNKB 1C7VA 4QJ5B 1G4YR 1OZSA 2BE4A 2KQ6A 1DEKA 3PATA 1K90D 2F3YA 1U5IA 2PYQA 2WOSA 3IF7A 2M1UA 1BLQA 3BJHA 1TCFA 2P6BB 2PALA 1KCYA 1UHNA 2H61C 3LCPC 1G8IA 4N1GA 1SCMC 3EK7A 1HT9A 2COLB 3L4LA 4HREE 5DKNA 3OB2B 3K1EA 3O4YA 4CFQA 4YGAA 2CTNA 1Z4HA 2SASA 1TTXA 1XFRA 4I5NB 1KFUS 3CR4X 3BQ3A 4A4CA 1EJ3A 5PALA 3DD4A 2NZ0A 5EL2A 2QEOA 3RM1A 1J55A 2JNFA 3CYZA 2K7CA 2L50A 1OOHA 1WLZA 1UHHA 3SJSA 1G33A 1SK6D 2IS9A 5TNCA 1AVSA 2KFHA 1K9UA 2P71A 1YRUB 2H8VA 4DCKA 2QACA 2V53A 1DVIA 1OZOA 2KGRA 3FWCA 4PT1A 1CLBA 2Y1NA 2JWWA 3S0BA 5K89A 1UHIA 4YBHB 1M39A 1TNQA 1IQ5A 1XK4A 1JF2A 1PRWA 1XFWO 2ZFDA 4MRYA 3VROA 2MHHA 2NLNA 1IJ6A 1S6IA 2K8MB 2L2CA 1FPWA 4ORBB 2L4IA 2MLFC 3PJIA 2JNXA 1JF0A 3D74A 2LLTA 3ZNIA 1KFUL 3SG6A 1JC2A 4USLA 2BAPA 1TUZA 2L98A 2QPTA 1FW4A 4NDDA 5AERA 4INXA 2OTGC 3Q8IA 3RZSA 4GAOA 5I8NA 1T14A 2OS8C 3JVTC 1EG3A 1KK8C 1L2OC 1SMGA 1S6JA 2KAVA 1XYDA 3D78A 3B86A 1WDCC 2K7BA 1SY9A 5AANA 3C1VA 1QASA 2BL0B 1VRKA 3SG5A 3AAKA 2JU0A 2HETA 2JPOA 4F0ZB 2LVKA 4DIRA 3CR5X 1QX2A 3R1OA 3WNXB 1NCXA 1DQEA 2ZRTA 3I5IC 1QXPA 1GGWA 2G2BA 2Q4UA 3DVEA 3SS3A 1IQ3A 4CLNA 1QIVA 1YUSA 3BFHA 3TDUA 2LMTA 1Y1AA 2KI4B 3EVUA 4JKTA 3LK0A 1H4BA 1PVBA 2LE9B 1V1GA 1WRKA 2KDHA 1C3ZA 1XA5A 1YTZC 1F55A 3IQOA 4PHJA 1IGVA 5CPVA 1SYMA 3VRRA 2HQWA 3DVJA 1ZFSA 2K2AA 4PDZA 1S5GZ 2OPOA 3FE9A 1Y0VH 1XFZO 2JXLA 3RLZA 5KTYA 1NWDA 4I5JA 1RWYA 1SSEB 3H4SE 1AJ5A 1ODBA 2LVJA 1QV0A 3KO0A 1A4PA 1DJHA 1YX7A 2JT3A 1S3PA 5DKRA 5KSZA 1K93D 1B7TZ 3EKJA 3PLFB 2M49B 3R1VA 3TDZA 4XYNA 3FE8A 1KWOC 4PE0A 4XJKA 1DMOA 4DS7A 2KLDA 5FI7A 2QDIA 1CLLA 2M3WA 2ZN8A 1ALVA 1S36A 1AJ4A 1QATA 2HF5A 4IJ7A 2LMUA 1IIOA 2JT8A 5CSJA 2PQLA 3PN7C 3TDIA 2L2EA 2ZNDA 1WY9A 4YI9A 3S0DA 1CNPA 3FE6A 2ISDA 4P5OE 1QS7A 3VB1A 2HQ8A 1K9KA 1SR6B 1MF8B 2M29A 1XFUO 3BOWA 1MUXA 4FQOA 1CLMA 1QWVA 2NCOA 4N1FA 1S6CA 1SW8A 4PCWA 3S0EA 3CR2A 2F2PA 1TCOB 1DJXA 4AOMA 3KEVA 1EXRA 3I5GC 1LXFC 1YUUA 3B7AA 1RK9A 3V2LA 3BUWB 5B8IB 4KYNA 3AKBA 1S26D 4OZDA 1FF1A 3BUMB 1YVHA 3I5FC 3KHEA 1Y1XA 2BKHB 4FQTA 2AAOA 4E68A 1S5GY 1NCYA 1IWQA 2VRGA 1BR1B 5D7FA 4R1EA 5J3XA 4CFRA 2WCLA 2A4JA 2M97A 1IKUA 2RGIA 1K8UA 4DRWA 2KBIA 1QVIZ 5CSNA 2GGMA 1D1OA 1M31A 4WQ3A 1K2HA 1DGUA 1NIWA 1PVAA 5HLVA 5AFPA 3JTDC 4D1EA 1B7TY 4YGDB 2WCFA 1OOJA 3BUXB 3LL8B 4INWA 5HKYA 3FWBA 2Y5IA 2KLEA 3CZTX 1B47A 2LVVA 3B88A 4MBEA 4MRXA 3PM8A 2LNKA 1SL7A 1XFVO 1DF0B 2SCPA 4GFTA 1LS8A 2M1KB 3AKAA 1M63B 1X02A 4U8DA 1P28A 2DOQA 4NDCA 1KQVA 3EVRA 2F8PA 3QRXA 4ZCUA 4M2OA 1A03A 2WCBA 1ZMZA 1JBAA 1QTXA 3DZTA 3CGAA 2I7AA 3KF9A 4BY4A 2HPSA 1LKJA 2ZNEA 3PM2A 1KK7Y 5D3OA 4AQIA 1RTP1 2MA2A 4MLWA 1XK4C 5HL1A 1OW4A 1UUSA 3TS5C 2PVBA 1ALWA 1F70A 1Y1UA 2JPTA 2M7NA 3SG3A 1C07A 1NPQA 1MHOA 4QJ3B 2PMYA 5HYDA 3D75A 4A4BA 1SBJA 4JQ0D 1BODA 1RROA 2BCBA 1RFJA 2I2RE 3O6BA 1ZACA 1C3YA 2L5XB 3D10A 1DJWA 2LANA 3OBVA 1K96A 1QVIY 1PSRA 2I94A 2QEVA 3SIBA 2LCPA 3D76A 1TRFA 3WXAA 3I5HC 1KFXS 3UO9A 3OGNA 3VRPA 3CLNA 3D73A 1PULA 4MSPA 3MSEB 1BU3A 5HKWA 1A2XA 4PHMA 2EHBA 2BCXA 2QEHA 1IJ5A 3L47A 4MVFA 4BY5A 3NXAA 4PALA 1R6PA 3DXLA 2K2FA 5GQQC 1F8HA 1OOIX 3VRNA 2L0PA 3TUYC 3CTNA 2O5GA 3DF0B 2JC2A 2JQ6A 3BFAA 2OTGB 1TN4A 3LK1A 3EK8A 4JPZB 2OS8B 2WCMA 3JVTB 1ZUZA 1L2OB 2KGBC 1CDLA 3HCMA 3N7HA 4ZCVA 2WORA 3DF0A 1WDCB 2JULA 2TN4A 3DVKA 1QLSA 3CWGA 1FI6A 4ETOA 1NSHA 1OMVA 1TWOA 3GOFA 1H8BA 2K0JA 3L4AA 5I2OA 1KQMC 2YGUA 3SG7A 1A75B 3CABA 1GM0A 1JSAA 5HLOA 1ZOTB 3I5IB 1GQMA 3R1PA 2BECA 2K7OA 1QIWA 1W7IB 1KFXL 2M0RA 3GK2A 1A75A 1MQ1A 4YGEB 3WHUB 4QJ4B 2LM5A 2Y4QA 2BE6A 3SS4A 4MZKA 5F6TA 1OSAA 2D8NA 4FTGA 2WNDA 1J1EA 5ER5A 5AEQA 2EC6C 4MZLA 1CMFA 1SNLA 1QX7A 4YGBB 2L4HA 2L51A 2MRDA 2ERBA 2MAZA 5ER4X 4HRHA 2GTEA 2EGDA 4M2QA 3FS7A 4GBAA 3IVTA 2MLEC 2LAPA 3PFVA 1SCVA 1KSOA 1AHRA 2LC5A 1KSMA 3HX4A 4OR9B 2QEBA 3F45A 2LMVA 1IG5A 1M46A 2AMIA 2JRFA 4PE4A 3CZ1A 1YR5A 2KHNA 3CZ0A 3ZWHA 1NCZA 2LP3A
chains in the Genus database with same CATH topology
2BBMA 1F71A 4YGCB 2BCAA 5JJGA 2KYFA 2JZIA 1BF5A 1EG4A 2CCMA 5CSFA 3BUOB 1XO5A 1BOCA 5AXIA 2O60A 1WLMA 4GUKA 5HKZA 2H2KA 4PE1A 1J7RA 1R2UA 2LLSA 5I2LA 4NDBA 2ZN9A 2I18A 1CTRA 3PN7B 1WRLA 1HQVA 2NCPA 1QV1A 1IH0A 1SRAA 3WHTB 4GGFA 1SKTA 1CDPA 1NP8A 1CFFA 1V1FA 1YUTA 1PSBA 1J7PA 2JT0A 1MXLC 1F54A 3I5GB 4N5XA 1NX1A 1F4QA 1B8LA 1J1DA 3OB1B 3VGOA 1N2DA 2GV5A 1K94A 1LINA 2LP2A 1NX3A 2JTTA 4PHKA 1DGVA 1AP4A 1SPYA 1PK0D 4TNCA 3I5FB 1N0YA 1JWDA 1S1EA 2PSRA 4AQJA 1BG1A 1OMRA 2JXCA 2LHLA 5CSIA 1UHJA 2LUCA 1TOPA 4CIDA 1SCMB 4OCIA 2JOJA 5IBWA 1DF0A 4CPVA 1SL9A 1YURA 2E30A 4Q04A 2H61A 1XFYO 3JTDB 5FYXA 2AUCA 3O78A 1RECA 2LVIA 2MBXA 1B8RA 1PALA 2KYCA 2LHIA 2WC8A 3FIAA 3NSOA 1L7ZA 1FBVA 3NSIA 5D69A 4I5KA 1MWNA 1SL8A 1MR8A 3CS1A 1EL4A 2NXQA 2KFGA 1OQPA 2M7LA 2G9BA 1YVLA 3D0YB 1AK8A 2PASA 3O2PA 3SIAA 2K7DA 1QJTA 1W7JB 4M2PA 1B9AA 5BPJA 2KSPA 4PHNA 2K61A 2F2OA 2LLUA 2Y1MA 2ZRSA 3IQQA 1CM1A 3D0YA 3DVMA 2F3ZA 3OP0A 1MXEA 1WRZA 4WRIA 3TS5B 1CDMA 4JWQA 2MJWB 1CDNA 2KAXA 2KBMA 2BKIB 1B1GA 1CFPA 3KPXA 1A29A 2LV7A 2LUXA 1RJVA 1C7WA 2KOTA 3AAJA 4GGNA 4IL1A 4ORCB 3EVVA 2PRUA 1N65A 1OE9B 4OKHA 4OV2A 1YRTB 2BL0C 3E3RA 3EKHA 2FJUB 3PALA 1DJIA 3OX5A 2CXJA 4L9MA 5I2QA 3I5HB 1FI5A 1AUIB 1LVCD 4UPGA 1KK8B 1Y6WA 1BR4B 1M45A 2Q91A 2KI4C 2KFFA 1J7QA 2FOTA 1JUOA 1TNWA 2KNEA 2M8UA 4MEWA 4C0LA 1TNXA 1DJYA 1Q80A 1F4OA 2E6WA 3BUNB 1CFDA 1QX5B 1B8CA 3LLEA 3TUYB 3OX6A 1CB1A 3GK4X 2KQYA 1B4CA 2FCDA 4NQGA 1UWOA 1JFKA 4ORAB 1UP5A 1TIZA 1DJZA 1TNPA 1CM4A 3TZ1A 4P2YB 3A8RA 2JTZA 1XFXO 3NSKA 1KQMB 1NUBA 3GK1A 3M0WA 4C0KA 1OMDA 1CMGA 3SG2A 4C0JA 1QLKA 2FCEA 3PSRA 1DT7B 3ICBA 3NSLA 1LA0A 2BBNA 2KI6D 4MN0A 4XJKB 2EC6B 2R2IA 5JOLA 1BT6A 1BJFA 5KU1A 1KWOB 1UURA 1SR6C 4PE7A 4OVNF 3VRQA 2WCEA 2KI6C 1NX2A 1DTLA 2ZKMX 3BYAA 2KAYA 4ICBA 1CKKA 4GPLB 1YX8A 1LA3A 2F33A 2M9GA 2CT9A 4HRGA 1K9PA 3EK4A 4GGFC 1GGZA 5DKQA 3BOWB 1E8AA 3K21A 4WQ2A 3A4UB 4YI8A 1NX0A 1CFCA 2CBLA 4MZJA 4YRUA 2GGZA 5G08A 1K95A 3BXKA 1BMOA 1IRJA 2CNPA 4DUQA 3SG4A 1KK7Z 1GJYA 1UHKA 1NYAA 1U5IB 3OHMB 4HSZA 2B1UA 4I5LB 1JFJA 1XVJA 1DJGA 1J7OA 4GNKB 1C7VA 4QJ5B 1G4YR 1OZSA 2BE4A 2KQ6A 3PATA 1K90D 2F3YA 1U5IA 2WOSA 3IF7A 2M1UA 1BLQA 1TCFA 2P6BB 2PALA 1KCYA 1UHNA 2H61C 3LCPC 1G8IA 4N1GA 1SCMC 3EK7A 1HT9A 2COLB 4HREE 5DKNA 3OB2B 3O4YA 4CFQA 4YGAA 2CTNA 2SASA 1TTXA 4I5NB 1KFUS 3CR4X 3BQ3A 4A4CA 1EJ3A 5PALA 3DD4A 2NZ0A 3RM1A 1J55A 2JNFA 2K7CA 2L50A 1WLZA 1UHHA 3SJSA 1G33A 1SK6D 2IS9A 5TNCA 1AVSA 2KFHA 1K9UA 1YRUB 4DCKA 2QACA 2V53A 1DVIA 1OZOA 2KGRA 3FWCA 1CLBA 2Y1NA 2JWWA 5K89A 1UHIA 4YBHB 1M39A 1TNQA 1IQ5A 1XK4A 1JF2A 1PRWA 1XFWO 2ZFDA 4MRYA 3VROA 2MHHA 2NLNA 1IJ6A 1S6IA 2K8MB 1FPWA 4ORBB 2L4IA 2MLFC 2JNXA 1JF0A 2LLTA 3ZNIA 1KFUL 3SG6A 1JC2A 4USLA 2L98A 2QPTA 4NDDA 1FW4A 5AERA 2OTGC 4GAOA 5I8NA 2OS8C 3JVTC 1EG3A 1KK8C 1L2OC 1SMGA 1S6JA 2KAVA 1XYDA 3KF9A 1WDCC 2K7BA 1SY9A 5AANA 3C1VA 1QASA 2BL0B 1VRKA 3SG5A 3AAKA 2JU0A 2HETA 4F0ZB 2LVKA 4DIRA 3CR5X 1QX2A 3WNXB 1NCXA 2ZRTA 3I5IC 1QXPA 1GGWA 2G2BA 2Q4UA 3DVEA 1IQ3A 4CLNA 1QIVA 1YUSA 3TDUA 2LMTA 1Y1AA 2KI4B 3EVUA 1H4BA 3LK0A 1PVBA 2LE9B 1V1GA 1WRKA 2KDHA 1XA5A 1YTZC 1F55A 3IQOA 4PHJA 1IGVA 5CPVA 1SYMA 3VRRA 2HQWA 3DVJA 1ZFSA 2K2AA 4PDZA 1S5GZ 2OPOA 3RLZA 1Y0VH 1XFZO 2JXLA 5KTYA 1NWDA 4I5JA 1RWYA 3H4SE 1AJ5A 1ODBA 2LVJA 1QV0A 3KO0A 1A4PA 1DJHA 1YX7A 2JT3A 1S3PA 5DKRA 5KSZA 1K93D 1B7TZ 3EKJA 3PLFB 2M49B 3TDZA 4XYNA 1KWOC 4PE0A 4XJKA 1DMOA 4DS7A 1CLLA 2M3WA 2ZN8A 1ALVA 1S36A 1AJ4A 1QATA 2HF5A 2LMUA 2JT8A 5CSJA 3PN7C 3TDIA 2L2EA 2ZNDA 1WY9A 4YI9A 1CNPA 2ISDA 4P5OE 1QS7A 2HQ8A 1K9KA 1SR6B 1MF8B 2M29A 1XFUO 3BOWA 1MUXA 4FQOA 1CLMA 2NCOA 4N1FA 4PCWA 1S6CA 1SW8A 3CR2A 2F2PA 1TCOB 1DJXA 4AOMA 3KEVA 1EXRA 3I5GC 1LXFC 1YUUA 1RK9A 3BUWB 5B8IB 3AKBA 1S26D 1FF1A 3BUMB 1YVHA 3I5FC 3KHEA 1Y1XA 2BKHB 2AAOA 4E68A 1S5GY 1NCYA 1IWQA 2VRGA 1BR1B 5D7FA 4R1EA 5J3XA 4CFRA 2A4JA 2M97A 1IKUA 2RGIA 1K8UA 4DRWA 2KBIA 1QVIZ 5CSNA 2GGMA 1D1OA 1M31A 4WQ3A 1K2HA 1DGUA 1NIWA 1PVAA 5HLVA 5AFPA 3JTDC 4D1EA 1B7TY 4YGDB 2WCFA 1OOJA 3BUXB 3LL8B 5HKYA 3FWBA 2Y5IA 3CZTX 1B47A 2LVVA 4MRXA 4MBEA 3PM8A 2LNKA 1SL7A 1XFVO 1DF0B 2SCPA 4GFTA 2M1KB 3AKAA 1M63B 1X02A 4U8DA 2DOQA 4NDCA 1KQVA 3EVRA 2F8PA 3QRXA 4ZCUA 4M2OA 1A03A 2WCBA 1ZMZA 1JBAA 1QTXA 3CGAA 2I7AA 4BY4A 2HPSA 1LKJA 2ZNEA 1KK7Y 4AQIA 1RTP1 2MA2A 4MLWA 1XK4C 1UUSA 3TS5C 2PVBA 1ALWA 1F70A 1Y1UA 2JPTA 2M7NA 3SG3A 1C07A 1NPQA 1MHOA 4QJ3B 2PMYA 5HYDA 4A4BA 1SBJA 4JQ0D 1BODA 1RROA 2BCBA 1RFJA 2I2RE 3O6BA 1ZACA 2L5XB 3D10A 1DJWA 2LANA 1K96A 1QVIY 1PSRA 2I94A 3SIBA 2LCPA 1TRFA 3WXAA 3I5HC 1KFXS 3VRPA 3CLNA 1PULA 4MSPA 3MSEB 1BU3A 5HKWA 1A2XA 4PHMA 2EHBA 2BCXA 1IJ5A 4MVFA 4BY5A 3NXAA 4PALA 1R6PA 2K2FA 5GQQC 1F8HA 3VRNA 2L0PA 3TUYC 3CTNA 2O5GA 3DF0B 2JC2A 2JQ6A 2OTGB 1TN4A 3LK1A 3EK8A 4JPZB 2OS8B 3JVTB 1ZUZA 1L2OB 2KGBC 1CDLA 3HCMA 4ZCVA 2WORA 3DF0A 1WDCB 2JULA 2TN4A 3DVKA 1QLSA 3CWGA 1FI6A 4ETOA 1NSHA 1OMVA 3GOFA 1H8BA 2K0JA 5I2OA 1KQMC 3SG7A 1A75B 1JSAA 5HLOA 1ZOTB 3I5IB 1GQMA 2BECA 2K7OA 1QIWA 1W7IB 1KFXL 2M0RA 3GK2A 1A75A 1MQ1A 4YGEB 3WHUB 4QJ4B 2LM5A 2Y4QA 2BE6A 1EH2A 4MZKA 5F6TA 1OSAA 2D8NA 4FTGA 2WNDA 1J1EA 5ER5A 5AEQA 2EC6C 4MZLA 1CMFA 1SNLA 1QX7A 4YGBB 2L4HA 2L51A 2MRDA 2MAZA 5ER4X 4HRHA 2EGDA 4M2QA 3FS7A 4GBAA 2MLEC 2LAPA 3PFVA 1SCVA 1KSOA 1AHRA 2LC5A 1KSMA 3HX4A 4OR9B 3F45A 2LMVA 1IG5A 1M46A 2AMIA 2JRFA 4PE4A 1YR5A 2KHNA 3ZWHA 1NCZA 2LP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBM A;  1F71 A;  4YGC B;  2BCA A;  5JJG A;  2KYF A;  2JZI A;  1BF5 A;  1EG4 A;  2CCM A;  5CSF A;  3BUO B;  1XO5 A;  1BOC A;  5AXI A;  2O60 A;  1WLM A;  4GUK A;  5HKZ A;  2H2K A;  4PE1 A;  1J7R A;  1R2U A;  2LLS A;  5I2L A;  4NDB A;  2ZN9 A;  2I18 A;  1CTR A;  3PN7 B;  1WRL A;  1HQV A;  2NCP A;  1QV1 A;  1IH0 A;  1SRA A;  3WHT B;  4GGF A;  1SKT A;  1CDP A;  1NP8 A;  1CFF A;  1V1F A;  1YUT A;  1PSB A;  1J7P A;  2JT0 A;  1MXL C;  1F54 A;  3I5G B;  4N5X A;  1NX1 A;  1F4Q A;  1B8L A;  1J1D A;  3OB1 B;  3VGO A;  1N2D A;  2GV5 A;  1K94 A;  1LIN A;  2LP2 A;  1NX3 A;  2JTT A;  4PHK A;  1DGV A;  1AP4 A;  1SPY A;  1PK0 D;  4TNC A;  3I5F B;  1N0Y A;  1JWD A;  1S1E A;  2PSR A;  4AQJ A;  1BG1 A;  1OMR A;  2JXC A;  2LHL A;  5CSI A;  1UHJ A;  2LUC A;  1TOP A;  4CID A;  1SCM B;  4OCI A;  2JOJ A;  5IBW A;  1DF0 A;  4CPV A;  1SL9 A;  1YUR A;  2E30 A;  4Q04 A;  2H61 A;  1XFY O;  3JTD B;  5FYX A;  2AUC A;  3O78 A;  1REC A;  2LVI A;  2MBX A;  1B8R A;  1PAL A;  2KYC A;  2LHI A;  2WC8 A;  3FIA A;  3NSO A;  1L7Z A;  1FBV A;  3NSI A;  5D69 A;  4I5K A;  1MWN A;  1SL8 A;  1MR8 A;  3CS1 A;  1EL4 A;  2NXQ A;  2KFG A;  1OQP A;  2M7L A;  2G9B A;  1YVL A;  3D0Y B;  1AK8 A;  2PAS A;  3O2P A;  3SIA A;  2K7D A;  1QJT A;  1W7J B;  4M2P A;  1B9A A;  5BPJ A;  2KSP A;  4PHN A;  2K61 A;  2F2O A;  2LLU A;  2Y1M A;  2ZRS A;  3IQQ A;  1CM1 A;  3D0Y A;  3DVM A;  2F3Z A;  3OP0 A;  1MXE A;  1WRZ A;  4WRI A;  3TS5 B;  1CDM A;  4JWQ A;  2MJW B;  1CDN A;  2KAX A;  2KBM A;  2BKI B;  1B1G A;  1CFP A;  3KPX A;  1A29 A;  2LV7 A;  2LUX A;  1RJV A;  1C7W A;  2KOT A;  3AAJ A;  4GGN A;  4IL1 A;  4ORC B;  3EVV A;  2PRU A;  1N65 A;  1OE9 B;  4OKH A;  4OV2 A;  1YRT B;  2BL0 C;  3E3R A;  3EKH A;  2FJU B;  3PAL A;  1DJI A;  3OX5 A;  2CXJ A;  4L9M A;  5I2Q A;  3I5H B;  1FI5 A;  1AUI B;  1LVC D;  4UPG A;  1KK8 B;  1Y6W A;  1BR4 B;  1M45 A;  2Q91 A;  2KI4 C;  2KFF A;  1J7Q A;  2FOT A;  1JUO A;  1TNW A;  2KNE A;  2M8U A;  4MEW A;  4C0L A;  1TNX A;  1DJY A;  1Q80 A;  1F4O A;  2E6W A;  3BUN B;  1CFD A;  1QX5 B;  1B8C A;  3LLE A;  3TUY B;  3OX6 A;  1CB1 A;  3GK4 X;  2KQY A;  1B4C A;  2FCD A;  4NQG A;  1UWO A;  1JFK A;  4ORA B;  1UP5 A;  1TIZ A;  1DJZ A;  1TNP A;  1CM4 A;  3TZ1 A;  4P2Y B;  3A8R A;  2JTZ A;  1XFX O;  3NSK A;  1KQM B;  1NUB A;  3GK1 A;  3M0W A;  4C0K A;  1OMD A;  1CMG A;  3SG2 A;  4C0J A;  1QLK A;  2FCE A;  3PSR A;  1DT7 B;  3ICB A;  3NSL A;  1LA0 A;  2BBN A;  2KI6 D;  4MN0 A;  4XJK B;  2EC6 B;  2R2I A;  5JOL A;  1BT6 A;  1BJF A;  5KU1 A;  1KWO B;  1UUR A;  1SR6 C;  4PE7 A;  4OVN F;  3VRQ A;  2WCE A;  2KI6 C;  1NX2 A;  1DTL A;  2ZKM X;  3BYA A;  2KAY A;  4ICB A;  1CKK A;  4GPL B;  1YX8 A;  1LA3 A;  2F33 A;  2M9G A;  2CT9 A;  4HRG A;  1K9P A;  3EK4 A;  4GGF C;  1GGZ A;  5DKQ A;  3BOW B;  1E8A A;  3K21 A;  4WQ2 A;  3A4U B;  4YI8 A;  1NX0 A;  1CFC A;  2CBL A;  4MZJ A;  4YRU A;  2GGZ A;  5G08 A;  1K95 A;  3BXK A;  1BMO A;  1IRJ A;  2CNP A;  4DUQ A;  3SG4 A;  1KK7 Z;  1GJY A;  1UHK A;  1NYA A;  1U5I B;  3OHM B;  4HSZ A;  2B1U A;  4I5L B;  1JFJ A;  1XVJ A;  1DJG A;  1J7O A;  4GNK B;  1C7V A;  4QJ5 B;  1G4Y R;  1OZS A;  2BE4 A;  2KQ6 A;  3PAT A;  1K90 D;  2F3Y A;  1U5I A;  2WOS A;  3IF7 A;  2M1U A;  1BLQ A;  1TCF A;  2P6B B;  2PAL A;  1KCY A;  1UHN A;  2H61 C;  3LCP C;  1G8I A;  4N1G A;  1SCM C;  3EK7 A;  1HT9 A;  2COL B;  4HRE E;  5DKN A;  3OB2 B;  3O4Y A;  4CFQ A;  4YGA A;  2CTN A;  2SAS A;  1TTX A;  4I5N B;  1KFU S;  3CR4 X;  3BQ3 A;  4A4C A;  1EJ3 A;  5PAL A;  3DD4 A;  2NZ0 A;  3RM1 A;  1J55 A;  2JNF A;  2K7C A;  2L50 A;  1WLZ A;  1UHH A;  3SJS A;  1G33 A;  1SK6 D;  2IS9 A;  5TNC A;  1AVS A;  2KFH A;  1K9U A;  1YRU B;  4DCK A;  2QAC A;  2V53 A;  1DVI A;  1OZO A;  2KGR A;  3FWC A;  1CLB A;  2Y1N A;  2JWW A;  5K89 A;  1UHI A;  4YBH B;  1M39 A;  1TNQ A;  1IQ5 A;  1XK4 A;  1JF2 A;  1PRW A;  1XFW O;  2ZFD A;  4MRY A;  3VRO A;  2MHH A;  2NLN A;  1IJ6 A;  1S6I A;  2K8M B;  1FPW A;  4ORB B;  2L4I A;  2MLF C;  2JNX A;  1JF0 A;  2LLT A;  3ZNI A;  1KFU L;  3SG6 A;  1JC2 A;  4USL A;  2L98 A;  2QPT A;  4NDD A;  1FW4 A;  5AER A;  2OTG C;  4GAO A;  5I8N A;  2OS8 C;  3JVT C;  1EG3 A;  1KK8 C;  1L2O C;  1SMG A;  1S6J A;  2KAV A;  1XYD A;  3KF9 A;  1WDC C;  2K7B A;  1SY9 A;  5AAN A;  3C1V A;  1QAS A;  2BL0 B;  1VRK A;  3SG5 A;  3AAK A;  2JU0 A;  2HET A;  4F0Z B;  2LVK A;  4DIR A;  3CR5 X;  1QX2 A;  3WNX B;  1NCX A;  2ZRT A;  3I5I C;  1QXP A;  1GGW A;  2G2B A;  2Q4U A;  3DVE A;  1IQ3 A;  4CLN A;  1QIV A;  1YUS A;  3TDU A;  2LMT A;  1Y1A A;  2KI4 B;  3EVU A;  1H4B A;  3LK0 A;  1PVB A;  2LE9 B;  1V1G A;  1WRK A;  2KDH A;  1XA5 A;  1YTZ C;  1F55 A;  3IQO A;  4PHJ A;  1IGV A;  5CPV A;  1SYM A;  3VRR A;  2HQW A;  3DVJ A;  1ZFS A;  2K2A A;  4PDZ A;  1S5G Z;  2OPO A;  3RLZ A;  1Y0V H;  1XFZ O;  2JXL A;  5KTY A;  1NWD A;  4I5J A;  1RWY A;  3H4S E;  1AJ5 A;  1ODB A;  2LVJ A;  1QV0 A;  3KO0 A;  1A4P A;  1DJH A;  1YX7 A;  2JT3 A;  1S3P A;  5DKR A;  5KSZ A;  1K93 D;  1B7T Z;  3EKJ A;  3PLF B;  2M49 B;  3TDZ A;  4XYN A;  1KWO C;  4PE0 A;  4XJK A;  1DMO A;  4DS7 A;  1CLL A;  2M3W A;  2ZN8 A;  1ALV A;  1S36 A;  1AJ4 A;  1QAT A;  2HF5 A;  2LMU A;  2JT8 A;  5CSJ A;  3PN7 C;  3TDI A;  2L2E A;  2ZND A;  1WY9 A;  4YI9 A;  1CNP A;  2ISD A;  4P5O E;  1QS7 A;  2HQ8 A;  1K9K A;  1SR6 B;  1MF8 B;  2M29 A;  1XFU O;  3BOW A;  1MUX A;  4FQO A;  1CLM A;  2NCO A;  4N1F A;  4PCW A;  1S6C A;  1SW8 A;  3CR2 A;  2F2P A;  1TCO B;  1DJX A;  4AOM A;  3KEV A;  1EXR A;  3I5G C;  1LXF C;  1YUU A;  1RK9 A;  3BUW B;  5B8I B;  3AKB A;  1S26 D;  1FF1 A;  3BUM B;  1YVH A;  3I5F C;  3KHE A;  1Y1X A;  2BKH B;  2AAO A;  4E68 A;  1S5G Y;  1NCY A;  1IWQ A;  2VRG A;  1BR1 B;  5D7F A;  4R1E A;  5J3X A;  4CFR A;  2A4J A;  2M97 A;  1IKU A;  2RGI A;  1K8U A;  4DRW A;  2KBI A;  1QVI Z;  5CSN A;  2GGM A;  1D1O A;  1M31 A;  4WQ3 A;  1K2H A;  1DGU A;  1NIW A;  1PVA A;  5HLV A;  5AFP A;  3JTD C;  4D1E A;  1B7T Y;  4YGD B;  2WCF A;  1OOJ A;  3BUX B;  3LL8 B;  5HKY A;  3FWB A;  2Y5I A;  3CZT X;  1B47 A;  2LVV A;  4MRX A;  4MBE A;  3PM8 A;  2LNK A;  1SL7 A;  1XFV O;  1DF0 B;  2SCP A;  4GFT A;  2M1K B;  3AKA A;  1M63 B;  1X02 A;  4U8D A;  2DOQ A;  4NDC A;  1KQV A;  3EVR A;  2F8P A;  3QRX A;  4ZCU A;  4M2O A;  1A03 A;  2WCB A;  1ZMZ A;  1JBA A;  1QTX A;  3CGA A;  2I7A A;  4BY4 A;  2HPS A;  1LKJ A;  2ZNE A;  1KK7 Y;  4AQI A;  1RTP 1;  2MA2 A;  4MLW A;  1XK4 C;  1UUS A;  3TS5 C;  2PVB A;  1ALW A;  1F70 A;  1Y1U A;  2JPT A;  2M7N A;  3SG3 A;  1C07 A;  1NPQ A;  1MHO A;  4QJ3 B;  2PMY A;  5HYD A;  4A4B A;  1SBJ A;  4JQ0 D;  1BOD A;  1RRO A;  2BCB A;  1RFJ A;  2I2R E;  3O6B A;  1ZAC A;  2L5X B;  3D10 A;  1DJW A;  2LAN A;  1K96 A;  1QVI Y;  1PSR A;  2I94 A;  3SIB A;  2LCP A;  1TRF A;  3WXA A;  3I5H C;  1KFX S;  3VRP A;  3CLN A;  1PUL A;  4MSP A;  3MSE B;  1BU3 A;  5HKW A;  1A2X A;  4PHM A;  2EHB A;  2BCX A;  1IJ5 A;  4MVF A;  4BY5 A;  3NXA A;  4PAL A;  1R6P A;  2K2F A;  5GQQ C;  1F8H A;  3VRN A;  2L0P A;  3TUY C;  3CTN A;  2O5G A;  3DF0 B;  2JC2 A;  2JQ6 A;  2OTG B;  1TN4 A;  3LK1 A;  3EK8 A;  4JPZ B;  2OS8 B;  3JVT B;  1ZUZ A;  1L2O B;  2KGB C;  1CDL A;  3HCM A;  4ZCV A;  2WOR A;  3DF0 A;  1WDC B;  2JUL A;  2TN4 A;  3DVK A;  1QLS A;  3CWG A;  1FI6 A;  4ETO A;  1NSH A;  1OMV A;  3GOF A;  1H8B A;  2K0J A;  5I2O A;  1KQM C;  3SG7 A;  1A75 B;  1JSA A;  5HLO A;  1ZOT B;  3I5I B;  1GQM A;  2BEC A;  2K7O A;  1QIW A;  1W7I B;  1KFX L;  2M0R A;  3GK2 A;  1A75 A;  1MQ1 A;  4YGE B;  3WHU B;  4QJ4 B;  2LM5 A;  2Y4Q A;  2BE6 A;  1EH2 A;  4MZK A;  5F6T A;  1OSA A;  2D8N A;  4FTG A;  2WND A;  1J1E A;  5ER5 A;  5AEQ A;  2EC6 C;  4MZL A;  1CMF A;  1SNL A;  1QX7 A;  4YGB B;  2L4H A;  2L51 A;  2MRD A;  2MAZ A;  5ER4 X;  4HRH A;  2EGD A;  4M2Q A;  3FS7 A;  4GBA A;  2MLE C;  2LAP A;  3PFV A;  1SCV A;  1KSO A;  1AHR A;  2LC5 A;  1KSM A;  3HX4 A;  4OR9 B;  3F45 A;  2LMV A;  1IG5 A;  1M46 A;  2AMI A;  2JRF A;  4PE4 A;  1YR5 A;  2KHN A;  3ZWH A;  1NCZ A;  2LP3 A; 
#chains in the Genus database with same CATH topology
 2BBM A;  1F71 A;  4YGC B;  2BCA A;  5JJG A;  5DIC A;  5FI2 A;  2KYF A;  2JZI A;  3B87 A;  1BF5 A;  1EG4 A;  2CCM A;  5CSF A;  3BUO B;  1XO5 A;  1BOC A;  5AXI A;  2O60 A;  1WLM A;  4GUK A;  5HKZ A;  2H2K A;  4PE1 A;  3S0F A;  1J7R A;  1R2U A;  2LLS A;  5I2L A;  3S0A A;  4NDB A;  2ZN9 A;  2I18 A;  1CTR A;  3PN7 B;  5I94 A;  1WRL A;  1HQV A;  4F7F A;  3NHI A;  2NCP A;  1QV1 A;  1IH0 A;  1SRA A;  3WHT B;  4GGF A;  1SKT A;  1CDP A;  1NP8 A;  1CFF A;  1V1F A;  1Z2C B;  1YUT A;  1PSB A;  1J7P A;  2JT0 A;  1MXL C;  1F54 A;  3I5G B;  4N5X A;  1NX1 A;  1F4Q A;  1B8L A;  1J1D A;  3OB1 B;  3VGO A;  1N2D A;  2GV5 A;  1K94 A;  1LIN A;  2LP2 A;  1NX3 A;  2JTT A;  4PHK A;  1DGV A;  1AP4 A;  1SPY A;  1PK0 D;  4TNC A;  3I5F B;  1N0Y A;  1JWD A;  1S1E A;  2PSR A;  4AQJ A;  1BG1 A;  1OMR A;  2JXC A;  2LHL A;  5CSI A;  1UHJ A;  2LUC A;  1TOP A;  4CID A;  1SCM B;  3QME A;  4OCI A;  2JOJ A;  5IBW A;  1DF0 A;  3NHT A;  1SL9 A;  4CPV A;  1YUR A;  2E30 A;  4Q04 A;  2H61 A;  1XFY O;  3JTD B;  5FYX A;  2AUC A;  3O78 A;  1REC A;  2LVI A;  2MBX A;  1B8R A;  1PAL A;  2KYC A;  2LHI A;  2WCH A;  1TUJ A;  2WC8 A;  3FIA A;  3NSO A;  1L7Z A;  1FBV A;  3NSI A;  3BFB A;  4I5K A;  5D69 A;  1MWN A;  1SL8 A;  1MR8 A;  3CS1 A;  1EL4 A;  2NXQ A;  2KFG A;  1OQP A;  2M7L A;  2G9B A;  1YVL A;  3D0Y B;  1AK8 A;  2PAS A;  3O2P A;  3SIA A;  3D77 A;  2K7D A;  1QJT A;  1W7J B;  4M2P A;  1B9A A;  5BPJ A;  2KSP A;  4PHN A;  2K61 A;  2F2O A;  2KPH A;  2LLU A;  2Y1M A;  2ZRS A;  1CM1 A;  3D0Y A;  3IQQ A;  3O4X A;  3DYE A;  3DVM A;  3DY9 A;  3NGV A;  2F3Z A;  3OP0 A;  1MXE A;  1WRZ A;  4WRI A;  3TS5 B;  1CDM A;  4JWQ A;  2MJW B;  1CDN A;  2KAX A;  2KBM A;  2BKI B;  1B1G A;  1OOG A;  1CFP A;  3KPX A;  1A29 A;  2LV7 A;  2LUX A;  1RJV A;  1C7W A;  2KOT A;  3AAJ A;  4GGN A;  4IL1 A;  4ORC B;  3EVV A;  2PRU A;  1N65 A;  1OE9 B;  4OKH A;  4OV2 A;  1YRT B;  2BL0 C;  3E3R A;  1DC1 A;  3EKH A;  2FJU B;  3PAL A;  1DJI A;  3OX5 A;  2L5Y A;  2CXJ A;  4L9M A;  5I2Q A;  3I5H B;  3UNW A;  1FI5 A;  1AUI B;  1LVC D;  4UPG A;  1KK8 B;  2P70 A;  1Y6W A;  1BR4 B;  1M45 A;  2Q91 A;  2KI4 C;  2KFF A;  1J7Q A;  2FOT A;  1JUO A;  1TNW A;  2KNE A;  2M8U A;  4MEW A;  2BNX A;  4C0L A;  1TNX A;  1DJY A;  1Q80 A;  1F4O A;  2E6W A;  3BUN B;  1CFD A;  1QX5 B;  1B8C A;  3LLE A;  3SS5 A;  3TUY B;  3OX6 A;  1CB1 A;  3GK4 X;  2KQY A;  1B4C A;  2FCD A;  4NQG A;  1UWO A;  3EG5 B;  1JFK A;  4ORA B;  1UP5 A;  2WC6 A;  1TIZ A;  2FJY A;  1DJZ A;  3CDN A;  1TNP A;  1CM4 A;  3TZ1 A;  4P2Y B;  1W9Z A;  2K60 A;  3A8R A;  2JTZ A;  1XFX O;  3NSK A;  1KQM B;  1OOF A;  3CZ2 A;  1NUB A;  3GK1 A;  3M0W A;  4C0K A;  1OMD A;  3R72 A;  1CMG A;  1DEL A;  5FI6 A;  3SG2 A;  1QLK A;  4C0J A;  3S0G A;  2FCE A;  3PSR A;  1DT7 B;  3ICB A;  3NSL A;  1LA0 A;  2BBN A;  2KI6 D;  4MN0 A;  4XJK B;  2EC6 B;  2R2I A;  5JOL A;  1BT6 A;  1BJF A;  5KU1 A;  1KWO B;  1UUR A;  1SR6 C;  4PE7 A;  4OVN F;  3VRQ A;  2WCE A;  2KI6 C;  1NX2 A;  1DTL A;  2ZKM X;  3BYA A;  2KAY A;  4ICB A;  1CKK A;  4GPL B;  1YX8 A;  1LA3 A;  2F33 A;  2M9G A;  2CT9 A;  2WCK A;  4HRG A;  1K9P A;  3EK4 A;  1ORG A;  1GGZ A;  4GGF C;  5DKQ A;  3BOW B;  1E8A A;  3K21 A;  4WQ2 A;  3A4U B;  4YI8 A;  1NX0 A;  1CFC A;  2CBL A;  4MZJ A;  4YRU A;  2GGZ A;  5G08 A;  1K95 A;  2WC5 A;  3BXK A;  1BMO A;  1IRJ A;  2CNP A;  1EH2 A;  4DUQ A;  3SG4 A;  2WCJ A;  1KK7 Z;  1GJY A;  1UHK A;  4JD9 A;  1NYA A;  1U5I B;  3OHM B;  4HSZ A;  2B1U A;  4I5L B;  3B6X A;  1JFJ A;  1XVJ A;  1DJG A;  1J7O A;  4GNK B;  1C7V A;  4QJ5 B;  1G4Y R;  1OZS A;  2BE4 A;  2KQ6 A;  1DEK A;  3PAT A;  1K90 D;  2F3Y A;  1U5I A;  2PYQ A;  2WOS A;  3IF7 A;  2M1U A;  1BLQ A;  3BJH A;  1TCF A;  2P6B B;  2PAL A;  1KCY A;  1UHN A;  2H61 C;  3LCP C;  1G8I A;  4N1G A;  1SCM C;  3EK7 A;  1HT9 A;  2COL B;  3L4L A;  4HRE E;  5DKN A;  3OB2 B;  3K1E A;  3O4Y A;  4CFQ A;  4YGA A;  2CTN A;  1Z4H A;  2SAS A;  1TTX A;  1XFR A;  4I5N B;  1KFU S;  3CR4 X;  3BQ3 A;  4A4C A;  1EJ3 A;  5PAL A;  3DD4 A;  2NZ0 A;  5EL2 A;  2QEO A;  3RM1 A;  1J55 A;  2JNF A;  3CYZ A;  2K7C A;  2L50 A;  1OOH A;  1WLZ A;  1UHH A;  3SJS A;  1G33 A;  1SK6 D;  2IS9 A;  5TNC A;  1AVS A;  2KFH A;  1K9U A;  2P71 A;  1YRU B;  2H8V A;  4DCK A;  2QAC A;  2V53 A;  1DVI A;  1OZO A;  2KGR A;  3FWC A;  4PT1 A;  1CLB A;  2Y1N A;  2JWW A;  3S0B A;  5K89 A;  1UHI A;  4YBH B;  1M39 A;  1TNQ A;  1IQ5 A;  1XK4 A;  1JF2 A;  1PRW A;  1XFW O;  2ZFD A;  4MRY A;  3VRO A;  2MHH A;  2NLN A;  1IJ6 A;  1S6I A;  2K8M B;  2L2C A;  1FPW A;  4ORB B;  2L4I A;  2MLF C;  3PJI A;  2JNX A;  1JF0 A;  3D74 A;  2LLT A;  3ZNI A;  1KFU L;  3SG6 A;  1JC2 A;  4USL A;  2BAP A;  1TUZ A;  2L98 A;  2QPT A;  1FW4 A;  4NDD A;  5AER A;  4INX A;  2OTG C;  3Q8I A;  3RZS A;  4GAO A;  5I8N A;  1T14 A;  2OS8 C;  3JVT C;  1EG3 A;  1KK8 C;  1L2O C;  1SMG A;  1S6J A;  2KAV A;  1XYD A;  3D78 A;  3B86 A;  1WDC C;  2K7B A;  1SY9 A;  5AAN A;  3C1V A;  1QAS A;  2BL0 B;  1VRK A;  3SG5 A;  3AAK A;  2JU0 A;  2HET A;  2JPO A;  4F0Z B;  2LVK A;  4DIR A;  3CR5 X;  1QX2 A;  3R1O A;  3WNX B;  1NCX A;  1DQE A;  2ZRT A;  3I5I C;  1QXP A;  1GGW A;  2G2B A;  2Q4U A;  3DVE A;  3SS3 A;  1IQ3 A;  4CLN A;  1QIV A;  1YUS A;  3BFH A;  3TDU A;  2LMT A;  1Y1A A;  2KI4 B;  3EVU A;  4JKT A;  3LK0 A;  1H4B A;  1PVB A;  2LE9 B;  1V1G A;  1WRK A;  2KDH A;  1C3Z A;  1XA5 A;  1YTZ C;  1F55 A;  3IQO A;  4PHJ A;  1IGV A;  5CPV A;  1SYM A;  3VRR A;  2HQW A;  3DVJ A;  1ZFS A;  2K2A A;  4PDZ A;  1S5G Z;  2OPO A;  3FE9 A;  1Y0V H;  1XFZ O;  2JXL A;  3RLZ A;  5KTY A;  1NWD A;  4I5J A;  1RWY A;  1SSE B;  3H4S E;  1AJ5 A;  1ODB A;  2LVJ A;  1QV0 A;  3KO0 A;  1A4P A;  1DJH A;  1YX7 A;  2JT3 A;  1S3P A;  5DKR A;  5KSZ A;  1K93 D;  1B7T Z;  3EKJ A;  3PLF B;  2M49 B;  3R1V A;  3TDZ A;  4XYN A;  3FE8 A;  1KWO C;  4PE0 A;  4XJK A;  1DMO A;  4DS7 A;  2KLD A;  5FI7 A;  2QDI A;  1CLL A;  2M3W A;  2ZN8 A;  1ALV A;  1S36 A;  1AJ4 A;  1QAT A;  2HF5 A;  4IJ7 A;  2LMU A;  1IIO A;  2JT8 A;  5CSJ A;  2PQL A;  3PN7 C;  3TDI A;  2L2E A;  2ZND A;  1WY9 A;  4YI9 A;  3S0D A;  1CNP A;  3FE6 A;  2ISD A;  4P5O E;  1QS7 A;  3VB1 A;  2HQ8 A;  1K9K A;  1SR6 B;  1MF8 B;  2M29 A;  1XFU O;  3BOW A;  1MUX A;  4FQO A;  1CLM A;  1QWV A;  2NCO A;  4N1F A;  1S6C A;  1SW8 A;  4PCW A;  3S0E A;  3CR2 A;  2F2P A;  1TCO B;  1DJX A;  4AOM A;  3KEV A;  1EXR A;  3I5G C;  1LXF C;  1YUU A;  3B7A A;  1RK9 A;  3V2L A;  3BUW B;  5B8I B;  4KYN A;  3AKB A;  1S26 D;  4OZD A;  1FF1 A;  3BUM B;  1YVH A;  3I5F C;  3KHE A;  1Y1X A;  2BKH B;  4FQT A;  2AAO A;  4E68 A;  1S5G Y;  1NCY A;  1IWQ A;  2VRG A;  1BR1 B;  5D7F A;  4R1E A;  5J3X A;  4CFR A;  2WCL A;  2A4J A;  2M97 A;  1IKU A;  2RGI A;  1K8U A;  4DRW A;  2KBI A;  1QVI Z;  5CSN A;  2GGM A;  1D1O A;  1M31 A;  4WQ3 A;  1K2H A;  1DGU A;  1NIW A;  1PVA A;  5HLV A;  5AFP A;  3JTD C;  4D1E A;  1B7T Y;  4YGD B;  2WCF A;  1OOJ A;  3BUX B;  3LL8 B;  4INW A;  5HKY A;  3FWB A;  2Y5I A;  2KLE A;  3CZT X;  1B47 A;  2LVV A;  3B88 A;  4MBE A;  4MRX A;  3PM8 A;  2LNK A;  1SL7 A;  1XFV O;  1DF0 B;  2SCP A;  4GFT A;  1LS8 A;  2M1K B;  3AKA A;  1M63 B;  1X02 A;  4U8D A;  1P28 A;  2DOQ A;  4NDC A;  1KQV A;  3EVR A;  2F8P A;  3QRX A;  4ZCU A;  4M2O A;  1A03 A;  2WCB A;  1ZMZ A;  1JBA A;  1QTX A;  3DZT A;  3CGA A;  2I7A A;  3KF9 A;  4BY4 A;  2HPS A;  1LKJ A;  2ZNE A;  3PM2 A;  1KK7 Y;  5D3O A;  4AQI A;  1RTP 1;  2MA2 A;  4MLW A;  1XK4 C;  5HL1 A;  1OW4 A;  1UUS A;  3TS5 C;  2PVB A;  1ALW A;  1F70 A;  1Y1U A;  2JPT A;  2M7N A;  3SG3 A;  1C07 A;  1NPQ A;  1MHO A;  4QJ3 B;  2PMY A;  5HYD A;  3D75 A;  4A4B A;  1SBJ A;  4JQ0 D;  1BOD A;  1RRO A;  2BCB A;  1RFJ A;  2I2R E;  3O6B A;  1ZAC A;  1C3Y A;  2L5X B;  3D10 A;  1DJW A;  2LAN A;  3OBV A;  1K96 A;  1QVI Y;  1PSR A;  2I94 A;  2QEV A;  3SIB A;  2LCP A;  3D76 A;  1TRF A;  3WXA A;  3I5H C;  1KFX S;  3UO9 A;  3OGN A;  3VRP A;  3CLN A;  3D73 A;  1PUL A;  4MSP A;  3MSE B;  1BU3 A;  5HKW A;  1A2X A;  4PHM A;  2EHB A;  2BCX A;  2QEH A;  1IJ5 A;  3L47 A;  4MVF A;  4BY5 A;  3NXA A;  4PAL A;  1R6P A;  3DXL A;  2K2F A;  5GQQ C;  1F8H A;  1OOI X;  3VRN A;  2L0P A;  3TUY C;  3CTN A;  2O5G A;  3DF0 B;  2JC2 A;  2JQ6 A;  3BFA A;  2OTG B;  1TN4 A;  3LK1 A;  3EK8 A;  4JPZ B;  2OS8 B;  2WCM A;  3JVT B;  1ZUZ A;  1L2O B;  2KGB C;  1CDL A;  3HCM A;  3N7H A;  4ZCV A;  2WOR A;  3DF0 A;  1WDC B;  2JUL A;  2TN4 A;  3DVK A;  1QLS A;  3CWG A;  1FI6 A;  4ETO A;  1NSH A;  1OMV A;  1TWO A;  3GOF A;  1H8B A;  2K0J A;  3L4A A;  5I2O A;  1KQM C;  2YGU A;  3SG7 A;  1A75 B;  3CAB A;  1GM0 A;  1JSA A;  5HLO A;  1ZOT B;  3I5I B;  1GQM A;  3R1P A;  2BEC A;  2K7O A;  1QIW A;  1W7I B;  1KFX L;  2M0R A;  3GK2 A;  1A75 A;  1MQ1 A;  4YGE B;  3WHU B;  4QJ4 B;  2LM5 A;  2Y4Q A;  2BE6 A;  3SS4 A;  4MZK A;  5F6T A;  1OSA A;  2D8N A;  4FTG A;  2WND A;  1J1E A;  5ER5 A;  5AEQ A;  2EC6 C;  4MZL A;  1CMF A;  1SNL A;  1QX7 A;  4YGB B;  2L4H A;  2L51 A;  2MRD A;  2ERB A;  2MAZ A;  5ER4 X;  4HRH A;  2GTE A;  2EGD A;  4M2Q A;  3FS7 A;  4GBA A;  3IVT A;  2MLE C;  2LAP A;  3PFV A;  1SCV A;  1KSO A;  1AHR A;  2LC5 A;  1KSM A;  3HX4 A;  4OR9 B;  2QEB A;  3F45 A;  2LMV A;  1IG5 A;  1M46 A;  2AMI A;  2JRF A;  4PE4 A;  3CZ1 A;  1YR5 A;  2KHN A;  3CZ0 A;  3ZWH A;  1NCZ A;  2LP3 A; 
#chains in the Genus database with same CATH homology
 2BBM A;  1F71 A;  4YGC B;  2BCA A;  5JJG A;  2KYF A;  2JZI A;  1BF5 A;  1EG4 A;  2CCM A;  5CSF A;  3BUO B;  1XO5 A;  1BOC A;  5AXI A;  2O60 A;  1WLM A;  4GUK A;  5HKZ A;  2H2K A;  4PE1 A;  1J7R A;  1R2U A;  2LLS A;  5I2L A;  4NDB A;  2ZN9 A;  2I18 A;  1CTR A;  3PN7 B;  1WRL A;  1HQV A;  2NCP A;  1QV1 A;  1IH0 A;  1SRA A;  3WHT B;  4GGF A;  1SKT A;  1CDP A;  1NP8 A;  1CFF A;  1V1F A;  1YUT A;  1PSB A;  1J7P A;  2JT0 A;  1MXL C;  1F54 A;  3I5G B;  4N5X A;  1NX1 A;  1F4Q A;  1B8L A;  1J1D A;  3OB1 B;  3VGO A;  1N2D A;  2GV5 A;  1K94 A;  1LIN A;  2LP2 A;  1NX3 A;  2JTT A;  4PHK A;  1DGV A;  1AP4 A;  1SPY A;  1PK0 D;  4TNC A;  3I5F B;  1N0Y A;  1JWD A;  1S1E A;  2PSR A;  4AQJ A;  1BG1 A;  1OMR A;  2JXC A;  2LHL A;  5CSI A;  1UHJ A;  2LUC A;  1TOP A;  4CID A;  1SCM B;  4OCI A;  2JOJ A;  5IBW A;  1DF0 A;  4CPV A;  1SL9 A;  1YUR A;  2E30 A;  4Q04 A;  2H61 A;  1XFY O;  3JTD B;  5FYX A;  2AUC A;  3O78 A;  1REC A;  2LVI A;  2MBX A;  1B8R A;  1PAL A;  2KYC A;  2LHI A;  2WC8 A;  3FIA A;  3NSO A;  1L7Z A;  1FBV A;  3NSI A;  5D69 A;  4I5K A;  1MWN A;  1SL8 A;  1MR8 A;  3CS1 A;  1EL4 A;  2NXQ A;  2KFG A;  1OQP A;  2M7L A;  2G9B A;  1YVL A;  3D0Y B;  1AK8 A;  2PAS A;  3O2P A;  3SIA A;  2K7D A;  1QJT A;  1W7J B;  4M2P A;  1B9A A;  5BPJ A;  2KSP A;  4PHN A;  2K61 A;  2F2O A;  2LLU A;  2Y1M A;  2ZRS A;  3IQQ A;  1CM1 A;  3D0Y A;  3DVM A;  2F3Z A;  3OP0 A;  1MXE A;  1WRZ A;  4WRI A;  3TS5 B;  1CDM A;  4JWQ A;  2MJW B;  1CDN A;  2KAX A;  2KBM A;  2BKI B;  1B1G A;  1CFP A;  3KPX A;  1A29 A;  2LV7 A;  2LUX A;  1RJV A;  1C7W A;  2KOT A;  3AAJ A;  4GGN A;  4IL1 A;  4ORC B;  3EVV A;  2PRU A;  1N65 A;  1OE9 B;  4OKH A;  4OV2 A;  1YRT B;  2BL0 C;  3E3R A;  3EKH A;  2FJU B;  3PAL A;  1DJI A;  3OX5 A;  2CXJ A;  4L9M A;  5I2Q A;  3I5H B;  1FI5 A;  1AUI B;  1LVC D;  4UPG A;  1KK8 B;  1Y6W A;  1BR4 B;  1M45 A;  2Q91 A;  2KI4 C;  2KFF A;  1J7Q A;  2FOT A;  1JUO A;  1TNW A;  2KNE A;  2M8U A;  4MEW A;  4C0L A;  1TNX A;  1DJY A;  1Q80 A;  1F4O A;  2E6W A;  3BUN B;  1CFD A;  1QX5 B;  1B8C A;  3LLE A;  3TUY B;  3OX6 A;  1CB1 A;  3GK4 X;  2KQY A;  1B4C A;  2FCD A;  4NQG A;  1UWO A;  1JFK A;  4ORA B;  1UP5 A;  1TIZ A;  1DJZ A;  1TNP A;  1CM4 A;  3TZ1 A;  4P2Y B;  3A8R A;  2JTZ A;  1XFX O;  3NSK A;  1KQM B;  1NUB A;  3GK1 A;  3M0W A;  4C0K A;  1OMD A;  1CMG A;  3SG2 A;  4C0J A;  1QLK A;  2FCE A;  3PSR A;  1DT7 B;  3ICB A;  3NSL A;  1LA0 A;  2BBN A;  2KI6 D;  4MN0 A;  4XJK B;  2EC6 B;  2R2I A;  5JOL A;  1BT6 A;  1BJF A;  5KU1 A;  1KWO B;  1UUR A;  1SR6 C;  4PE7 A;  4OVN F;  3VRQ A;  2WCE A;  2KI6 C;  1NX2 A;  1DTL A;  2ZKM X;  3BYA A;  2KAY A;  4ICB A;  1CKK A;  4GPL B;  1YX8 A;  1LA3 A;  2F33 A;  2M9G A;  2CT9 A;  4HRG A;  1K9P A;  3EK4 A;  4GGF C;  1GGZ A;  5DKQ A;  3BOW B;  1E8A A;  3K21 A;  4WQ2 A;  3A4U B;  4YI8 A;  1NX0 A;  1CFC A;  2CBL A;  4MZJ A;  4YRU A;  2GGZ A;  5G08 A;  1K95 A;  3BXK A;  1BMO A;  1IRJ A;  2CNP A;  4DUQ A;  3SG4 A;  1KK7 Z;  1GJY A;  1UHK A;  1NYA A;  1U5I B;  3OHM B;  4HSZ A;  2B1U A;  4I5L B;  1JFJ A;  1XVJ A;  1DJG A;  1J7O A;  4GNK B;  1C7V A;  4QJ5 B;  1G4Y R;  1OZS A;  2BE4 A;  2KQ6 A;  3PAT A;  1K90 D;  2F3Y A;  1U5I A;  2WOS A;  3IF7 A;  2M1U A;  1BLQ A;  1TCF A;  2P6B B;  2PAL A;  1KCY A;  1UHN A;  2H61 C;  3LCP C;  1G8I A;  4N1G A;  1SCM C;  3EK7 A;  1HT9 A;  2COL B;  4HRE E;  5DKN A;  3OB2 B;  3O4Y A;  4CFQ A;  4YGA A;  2CTN A;  2SAS A;  1TTX A;  4I5N B;  1KFU S;  3CR4 X;  3BQ3 A;  4A4C A;  1EJ3 A;  5PAL A;  3DD4 A;  2NZ0 A;  3RM1 A;  1J55 A;  2JNF A;  2K7C A;  2L50 A;  1WLZ A;  1UHH A;  3SJS A;  1G33 A;  1SK6 D;  2IS9 A;  5TNC A;  1AVS A;  2KFH A;  1K9U A;  1YRU B;  4DCK A;  2QAC A;  2V53 A;  1DVI A;  1OZO A;  2KGR A;  3FWC A;  1CLB A;  2Y1N A;  2JWW A;  5K89 A;  1UHI A;  4YBH B;  1M39 A;  1TNQ A;  1IQ5 A;  1XK4 A;  1JF2 A;  1PRW A;  1XFW O;  2ZFD A;  4MRY A;  3VRO A;  2MHH A;  2NLN A;  1IJ6 A;  1S6I A;  2K8M B;  1FPW A;  4ORB B;  2L4I A;  2MLF C;  2JNX A;  1JF0 A;  2LLT A;  3ZNI A;  1KFU L;  3SG6 A;  1JC2 A;  4USL A;  2L98 A;  2QPT A;  4NDD A;  1FW4 A;  5AER A;  2OTG C;  4GAO A;  5I8N A;  2OS8 C;  3JVT C;  1EG3 A;  1KK8 C;  1L2O C;  1SMG A;  1S6J A;  2KAV A;  1XYD A;  3KF9 A;  1WDC C;  2K7B A;  1SY9 A;  5AAN A;  3C1V A;  1QAS A;  2BL0 B;  1VRK A;  3SG5 A;  3AAK A;  2JU0 A;  2HET A;  4F0Z B;  2LVK A;  4DIR A;  3CR5 X;  1QX2 A;  3WNX B;  1NCX A;  2ZRT A;  3I5I C;  1QXP A;  1GGW A;  2G2B A;  2Q4U A;  3DVE A;  1IQ3 A;  4CLN A;  1QIV A;  1YUS A;  3TDU A;  2LMT A;  1Y1A A;  2KI4 B;  3EVU A;  1H4B A;  3LK0 A;  1PVB A;  2LE9 B;  1V1G A;  1WRK A;  2KDH A;  1XA5 A;  1YTZ C;  1F55 A;  3IQO A;  4PHJ A;  1IGV A;  5CPV A;  1SYM A;  3VRR A;  2HQW A;  3DVJ A;  1ZFS A;  2K2A A;  4PDZ A;  1S5G Z;  2OPO A;  3RLZ A;  1Y0V H;  1XFZ O;  2JXL A;  5KTY A;  1NWD A;  4I5J A;  1RWY A;  3H4S E;  1AJ5 A;  1ODB A;  2LVJ A;  1QV0 A;  3KO0 A;  1A4P A;  1DJH A;  1YX7 A;  2JT3 A;  1S3P A;  5DKR A;  5KSZ A;  1K93 D;  1B7T Z;  3EKJ A;  3PLF B;  2M49 B;  3TDZ A;  4XYN A;  1KWO C;  4PE0 A;  4XJK A;  1DMO A;  4DS7 A;  1CLL A;  2M3W A;  2ZN8 A;  1ALV A;  1S36 A;  1AJ4 A;  1QAT A;  2HF5 A;  2LMU A;  2JT8 A;  5CSJ A;  3PN7 C;  3TDI A;  2L2E A;  2ZND A;  1WY9 A;  4YI9 A;  1CNP A;  2ISD A;  4P5O E;  1QS7 A;  2HQ8 A;  1K9K A;  1SR6 B;  1MF8 B;  2M29 A;  1XFU O;  3BOW A;  1MUX A;  4FQO A;  1CLM A;  2NCO A;  4N1F A;  4PCW A;  1S6C A;  1SW8 A;  3CR2 A;  2F2P A;  1TCO B;  1DJX A;  4AOM A;  3KEV A;  1EXR A;  3I5G C;  1LXF C;  1YUU A;  1RK9 A;  3BUW B;  5B8I B;  3AKB A;  1S26 D;  1FF1 A;  3BUM B;  1YVH A;  3I5F C;  3KHE A;  1Y1X A;  2BKH B;  2AAO A;  4E68 A;  1S5G Y;  1NCY A;  1IWQ A;  2VRG A;  1BR1 B;  5D7F A;  4R1E A;  5J3X A;  4CFR A;  2A4J A;  2M97 A;  1IKU A;  2RGI A;  1K8U A;  4DRW A;  2KBI A;  1QVI Z;  5CSN A;  2GGM A;  1D1O A;  1M31 A;  4WQ3 A;  1K2H A;  1DGU A;  1NIW A;  1PVA A;  5HLV A;  5AFP A;  3JTD C;  4D1E A;  1B7T Y;  4YGD B;  2WCF A;  1OOJ A;  3BUX B;  3LL8 B;  5HKY A;  3FWB A;  2Y5I A;  3CZT X;  1B47 A;  2LVV A;  4MRX A;  4MBE A;  3PM8 A;  2LNK A;  1SL7 A;  1XFV O;  1DF0 B;  2SCP A;  4GFT A;  2M1K B;  3AKA A;  1M63 B;  1X02 A;  4U8D A;  2DOQ A;  4NDC A;  1KQV A;  3EVR A;  2F8P A;  3QRX A;  4ZCU A;  4M2O A;  1A03 A;  2WCB A;  1ZMZ A;  1JBA A;  1QTX A;  3CGA A;  2I7A A;  4BY4 A;  2HPS A;  1LKJ A;  2ZNE A;  1KK7 Y;  4AQI A;  1RTP 1;  2MA2 A;  4MLW A;  1XK4 C;  1UUS A;  3TS5 C;  2PVB A;  1ALW A;  1F70 A;  1Y1U A;  2JPT A;  2M7N A;  3SG3 A;  1C07 A;  1NPQ A;  1MHO A;  4QJ3 B;  2PMY A;  5HYD A;  4A4B A;  1SBJ A;  4JQ0 D;  1BOD A;  1RRO A;  2BCB A;  1RFJ A;  2I2R E;  3O6B A;  1ZAC A;  2L5X B;  3D10 A;  1DJW A;  2LAN A;  1K96 A;  1QVI Y;  1PSR A;  2I94 A;  3SIB A;  2LCP A;  1TRF A;  3WXA A;  3I5H C;  1KFX S;  3VRP A;  3CLN A;  1PUL A;  4MSP A;  3MSE B;  1BU3 A;  5HKW A;  1A2X A;  4PHM A;  2EHB A;  2BCX A;  1IJ5 A;  4MVF A;  4BY5 A;  3NXA A;  4PAL A;  1R6P A;  2K2F A;  5GQQ C;  1F8H A;  3VRN A;  2L0P A;  3TUY C;  3CTN A;  2O5G A;  3DF0 B;  2JC2 A;  2JQ6 A;  2OTG B;  1TN4 A;  3LK1 A;  3EK8 A;  4JPZ B;  2OS8 B;  3JVT B;  1ZUZ A;  1L2O B;  2KGB C;  1CDL A;  3HCM A;  4ZCV A;  2WOR A;  3DF0 A;  1WDC B;  2JUL A;  2TN4 A;  3DVK A;  1QLS A;  3CWG A;  1FI6 A;  4ETO A;  1NSH A;  1OMV A;  3GOF A;  1H8B A;  2K0J A;  5I2O A;  1KQM C;  3SG7 A;  1A75 B;  1JSA A;  5HLO A;  1ZOT B;  3I5I B;  1GQM A;  2BEC A;  2K7O A;  1QIW A;  1W7I B;  1KFX L;  2M0R A;  3GK2 A;  1A75 A;  1MQ1 A;  4YGE B;  3WHU B;  4QJ4 B;  2LM5 A;  2Y4Q A;  2BE6 A;  1EH2 A;  4MZK A;  5F6T A;  1OSA A;  2D8N A;  4FTG A;  2WND A;  1J1E A;  5ER5 A;  5AEQ A;  2EC6 C;  4MZL A;  1CMF A;  1SNL A;  1QX7 A;  4YGB B;  2L4H A;  2L51 A;  2MRD A;  2MAZ A;  5ER4 X;  4HRH A;  2EGD A;  4M2Q A;  3FS7 A;  4GBA A;  2MLE C;  2LAP A;  3PFV A;  1SCV A;  1KSO A;  1AHR A;  2LC5 A;  1KSM A;  3HX4 A;  4OR9 B;  3F45 A;  2LMV A;  1IG5 A;  1M46 A;  2AMI A;  2JRF A;  4PE4 A;  1YR5 A;  2KHN A;  3ZWH A;  1NCZ A;  2LP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...