3MSEB

Crystal structure of c-terminal domain of pf110239.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
168
Chain Sequence
ISPNVLNNMKSYMKHSNIRNIIINIMAHELSVINNHIKYINELFYKLDTNHNGSLSHREIYTVLASVGIKKWDINRILQALDINDRGNITYTEFMAGCYRWKNITFLKAAFNKIDKDEDGYISKSDIVSLVHDKVLDNNDIDNFFLSVHSIINKISFQEFKDYMLSTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of C-terminal domain of PF110239
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Calcium-dependent protein kinase, putative
total genus 60
structure length 168
sequence length 179
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3mseB00
1C7WA 4DCKA 1QXPA 1YRUB 2CNPA 4JWQA 3DF0A 3KO0A 1F55A 1K9UA 3JTDB 1SYMA 5AXIA 3CWGA 4I5KA 1FF1A 4YGBB 1OSAA 1FI6A 1CTRA 2AAOA 1MR8A 1K2HA 4ORCB 3EKHA 4PCWA 4DS7A 1H4BA 1K90D 1NX3A 1TRFA 2BE4A 1MHOA 2LP2A 1NUBA 1DJHA 2Y1NA 1LXFC 1LA3A 4UPGA 3OX6A 1IQ3A 2M0RA 2OS8C 1RECA 4YGEB 4WRIA 2L50A 2M3WA 1S36A 2NXQA 1YX7A 4GGFC 3BUOB 3BUXB 3I5IB 4MBEA 2LP3A 1QLKA 3KF9A 1S5GY 1A75B 1N0YA 1A03A 4AQJA 1J7RA 1Q80A 5HKZA 1M46A 1AJ5A 3WXAA 3PLFB 2DOQA 2MHHA 4YGDB 1SCMC 2K7OA 3O4YA 4ORBB 1DF0B 2K8MB 2PMYA 3LCPC 5HLVA 2KFFA 1WLMA 3DVKA 1LA0A 2GGZA 3SG2A 1SNLA 1UP5A 2E6WA 1B1GA 4CIDA 1NCZA 2IS9A 1KCYA 4M2QA 2PASA 3PSRA 2P6BB 4CFRA 5JJGA 1TOPA 3I5GC 5F6TA 2M49B 1ZOTB 1DJWA 3M0WA 2KFGA 5HYDA 3DVEA 2KBMA 2Y1MA 2BCAA 5D7FA 5B8IB 3RM1A 2L98A 4AQIA 2TN4A 1PVBA 1DJZA 2FOTA 3GK4X 4MZJA 1S3PA 3DVMA 1S1EA 2K2AA 4QJ5B 3CS1A 3EK8A 1NP8A 1XFWO 2GGMA 1TTXA 2H61A 4QJ4B 5I2QA 3DF0B 4NDCA 2NCOA 5I8NA 4N1GA 1CKKA 2HF5A 3VROA 1DJXA 3LLEA 1F70A 1J1EA 3TUYC 1V1GA 5D69A 1K8UA 5AFPA 2BBMA 1MUXA 1TN4A 1M31A 4WQ2A 2FCDA 1KQMC 1KK7Z 1Y1UA 2FCEA 2L4IA 1F71A 1WDCB 2JT3A 5KU1A 2LHLA 1M39A 1CB1A 4I5NB 1UHKA 4MLWA 1QX2A 1TNXA 2G2BA 2LLSA 1Y6WA 4CLNA 2ISDA 1D1OA 3BQ3A 3OX5A 5TNCA 1F8HA 1PRWA 1SR6B 1K96A 2WCBA 2JT0A 3PFVA 4IL1A 4FTGA 4QJ3B 1PSRA 1QJTA 3FIAA 3QRXA 5FYXA 1Y1XA 2AMIA 2MBXA 1SL9A 2JNXA 2KGRA 2NZ0A 1KFXL 2OTGC 3O6BA 3VRQA 3LK1A 1QVIY 2BCBA 1L7ZA 3KHEA 4PE7A 1J55A 1WY9A 1EG3A 1QV0A 2BKIB 1SK6D 2LE9B 4OV2A 1K95A 2KI4C 2I2RE 2JQ6A 5ER4X 1H8BA 3SG4A 3PN7C 4F0ZB 2QACA 1AP4A 3BUMB 1FBVA 3KPXA 2JPTA 1PVAA 3I5FB 1YVHA 3BXKA 4YBHB 1NYAA 2ZFDA 4PALA 2LVKA 1LVCD 3EVVA 1B9AA 4N1FA 1CDMA 1QIVA 2LNKA 1ODBA 3PN7B 1TNPA 4E68A 5KSZA 3CLNA 3HX4A 3VGOA 1DGVA 3WHTB 4M2OA 1V1FA 1OMVA 4MN0A 1C7VA 2H61C 4OCIA 1OOJA 3CR4X 1B4CA 4AOMA 1EL4A 2I94A 2PSRA 4HRGA 1IJ5A 4R1EA 1F4OA 2JT8A 1BU3A 1U5IB 2A4JA 4CFQA 2CCMA 2PRUA 1JC2A 4YI8A 2ZRTA 2HQ8A 2LC5A 3OP0A 4MRXA 1SR6C 1SY9A 2ZNDA 4PHNA 1KFXS 3I5HB 2ZRSA 1JSAA 2K0JA 1BR4B 3HCMA 1IG5A 1YUUA 2I7AA 2KOTA 5CPVA 4GUKA 4PE0A 2BL0C 1IQ5A 2PALA 2ZNEA 2L4HA 3SIBA 2BBNA 1U5IA 1K94A 4YGCB 1C07A 4XJKA 1SKTA 4L9MA 2EHBA 2L51A 1ALWA 1TCOB 5AERA 3D10A 4DRWA 2BCXA 1J7PA 2LAPA 4MZLA 1IH0A 3DVJA 1QS7A 1B8CA 1QVIZ 2M8UA 3SG5A 1W7IB 3WNXB 1IJ6A 3ZWHA 1CMGA 4USLA 2LANA 3BUNB 3BYAA 3E3RA 3I5HC 3SG6A 1CFPA 2HETA 2SCPA 5BPJA 5DKNA 1RK9A 1RTP1 1IGVA 1S6CA 5DKQA 1UHJA 3AKBA 4GNKB 1G8IA 5K89A 1K93D 1XVJA 1UHNA 4TNCA 1HQVA 4NDBA 2WNDA 2JULA 1RFJA 2LLTA 1KQVA 2BL0B 1BMOA 2CBLA 1WRZA 2JNFA 1OQPA 4YI9A 3NSKA 2HPSA 1SBJA 1XO5A 2ZN8A 4PHKA 2Q4UA 2KSPA 2O60A 1YVLA 2LVJA 3EK4A 1JBAA 2JRFA 2ZKMX 3OHMB 1KSOA 1MQ1A 2F2OA 1NCYA 2LCPA 1Y0VH 1YX8A 5I2OA 1YR5A 2K7BA 2KQ6A 3I5FC 3FWCA 2MRDA 2LHIA 2CTNA 1MXEA 3BUWB 2M7NA 2KI6C 1JUOA 4GBAA 2CXJA 1FI5A 1DGUA 3GK1A 1GQMA 4OR9B 2KI4B 4ORAB 3VRPA 3JTDC 2KAYA 2JZIA 3I5IC 1MWNA 1QV1A 2FJUB 4BY5A 2MLFC 3ZNIA 4GGFA 1X02A 1KWOC 2OS8B 1XFZO 1QATA 4C0KA 4MEWA 4PHMA 4C0LA 1SL8A 1PULA 2OPOA 3H4SE 2KBIA 2MLEC 4XJKB 1B8LA 1QASA 1IWQA 2KHNA 4BY4A 1WDCC 2KAXA 3IQOA 4OKHA 2Y4QA 1JFKA 1MXLC 2CT9A 3C1VA 1XFXO 2LUXA 1IKUA 1QIWA 2OTGB 5CSFA 3VRNA 2H2KA 4A4CA 2K2FA 3NSIA 2WCFA 1JFJA 1NX2A 5AANA 2KDHA 1CDLA 4GPLB 1EG4A 3FWBA 1UWOA 1NSHA 2LLUA 2M97A 2Q91A 2WC8A 1DTLA 3SJSA 1BG1A 2EGDA 1M63B 3NSLA 4NQGA 1A2XA 1LINA 2KYCA 3TDZA 1KSMA 2K61A 3AKAA 1CMFA 3NSOA 1WRKA 4MRYA 1K9PA 1BF5A 1RROA 1S6IA 5CSNA 4M2PA 1FW4A 5JOLA 1AHRA 3FS7A 1SMGA 1KFUS 1W7JB 2JTZA 1E8AA 1CM1A 1SW8A 1UHIA 2LMUA 3MSEB 1XFVO 2BECA 1B7TZ 3CR2A 3OB1B 4I5LB 2LVIA 3SIAA 1HT9A 1BR1B 2K7CA 1OMDA 3PATA 3ICBA 1NX0A 4WQ3A 2SASA 5HKYA 2BE6A 1GJYA 4HSZA 3LL8B 1IRJA 1SCVA 1DMOA 1XK4A 1DVIA 1CDPA 1CLLA 4MZKA 3CR5X 4ETOA 1CM4A 4D1EA 1G4YR 3I5GB 1ZUZA 1FPWA 3SG3A 2KGBC 3CGAA 3WHUB 4P2YB 4U8DA 1CDNA 4YGAA 1DJGA 5IBWA 4MVFA 1G33A 1SCMB 4FQOA 1SL7A 1UHHA 2WORA 3NXAA 1OE9B 2F3YA 1QTXA 1OZSA 1JF0A 1ZMZA 3EKJA 4Q04A 4ZCVA 3CZTX 5HKWA 2VRGA 1LKJA 1PALA 2KQYA 2JTTA 3DD4A 3RLZA 2D8NA 1J7QA 1OZOA 1KFUL 1PSBA 2F8PA 2LMVA 1DT7B 1YRTB 1A29A 3IF7A 4NDDA 1AJ4A 2MAZA 1ZFSA 1TNQA 1XA5A 3CTNA 1YTZC 2Y5IA 2F33A 2JU0A 1TNWA 1XYDA 2PVBA 1CFFA 3TZ1A 1S5GZ 1S26D 3TDUA 1NX1A 4PE4A 3PM8A 1SRAA 1CLBA 2AUCA 2L5XB 5AEQA 1MF8B 4XYNA 2EC6B 1F54A 1N65A 1CLMA 1QLSA 3A8RA 4DIRA 2JXLA 1RWYA 3BOWA 2LM5A 1XFYO 1KQMB 2JWWA 4P5OE 1NWDA 1K9KA 1DJYA 4JQ0D 3O2PA 3TUYB 1RJVA 1KK7Y 4MSPA 2BKHB 2KNEA 1QX7A 2KFHA 2WCEA 2ZN9A 1YUSA 1XK4C 1A75A 1NPQA 1BLQA 3K21A 3EVRA 4OVNF 2KAVA 3IQQA 1PK0D 2LMTA 2RGIA 3D0YA 2JOJA 1SPYA 1KK8B 1S6JA 5J3XA 4I5JA 1Y1AA 3SG7A 2JC2A 3OB2B 2WOSA 1QX5B 5G08A 2B1UA 2COLB 2LVVA 3EVUA 1AUIB 1L2OC 3BOWB 1OMRA 4DUQA 4PHJA 1A4PA 2L0PA 3JVTC 5KTYA 2KYFA 1UUSA 3TS5C 2I18A 1BJFA 2M7LA 4YRUA 2F2PA 3AAJA 2GV5A 1WLZA 1CNPA 2NLNA 3A4UB 3TS5B 3LK0A 1ZACA 3GOFA 1EJ3A 3AAKA 1AK8A 4ZCUA 5HLOA 3D0YB 1VRKA 2F3ZA 4PE1A 2G9BA 1CFCA 1CFDA 1EH2A 3KEVA 1BOCA 2O5GA 2MA2A 4GAOA 5CSIA 4GGNA 5DKRA 3GK2A 1R2UA 2QPTA 1JF2A 1R6PA 2MJWB 3F45A 4HRHA 2M9GA 1WRLA 1EXRA 4HREE 4N5XA 1TCFA 1YURA 3TDIA 1DF0A 2L2EA 4CPVA 2M1UA 2R2IA 3JVTB 1B8RA 1J7OA 1YUTA 2KI6D 3VRRA 1BODA 1TIZA 2LUCA 2E30A 1J1DA 2LV7A 1L2OB 3EK7A 1BT6A 1NIWA 5I2LA 2JXCA 1DJIA 1B7TY 1M45A 2HQWA 5GQQC 3O78A 2M29A 4C0JA 2M1KB 5PALA 1GGZA 2V53A 1B47A 1F4QA 4GFTA 4A4BA 4ICBA 1KK8C 1GGWA 1N2DA 1UURA 3PALA 5ER5A 1NCXA 2NCPA 1JWDA 1XFUO 2K7DA 4JPZB 2EC6C 1AVSA 4PDZA 1ALVA 1KWOB 5CSJA
chains in the Genus database with same CATH superfamily
1C7WA 4DCKA 1QXPA 4F7FA 1YRUB 2CNPA 4JWQA 3DF0A 3KO0A 1F55A 1K9UA 3JTDB 1SYMA 3R72A 5AXIA 3CWGA 4I5KA 1FF1A 4YGBB 1OSAA 3B88A 3DZTA 3N7HA 1FI6A 1CTRA 2AAOA 1MR8A 1OOFA 1K2HA 4ORCB 3EKHA 4PCWA 4DS7A 1H4BA 1K90D 1NX3A 1TRFA 2BE4A 1MHOA 2LP2A 3S0FA 1NUBA 1DJHA 2WCLA 2Y1NA 1LXFC 1LA3A 4UPGA 3OX6A 1IQ3A 2QEOA 2M0RA 2OS8C 1RECA 4YGEB 4WRIA 2L50A 2M3WA 1S36A 2NXQA 1YX7A 4GGFC 3BUOB 3BUXB 3I5IB 4MBEA 2LP3A 1QLKA 3KF9A 1S5GY 1A75B 1N0YA 1GM0A 1A03A 4AQJA 1J7RA 1Q80A 5HKZA 1M46A 1AJ5A 3WXAA 3PLFB 3B86A 2DOQA 2MHHA 3FE6A 4YGDB 1SCMC 2L5YA 2K7OA 3O4YA 4ORBB 1DF0B 2K8MB 2PMYA 3LCPC 5HLVA 4FQTA 2KFFA 1WLMA 3DVKA 1LA0A 2GGZA 3SG2A 3R1PA 1SNLA 1UP5A 2E6WA 4INWA 1B1GA 4CIDA 1NCZA 2IS9A 1KCYA 4M2QA 2PASA 3PSRA 2P6BB 4CFRA 5JJGA 1TOPA 3I5GC 5F6TA 2M49B 1ZOTB 1DJWA 3M0WA 2KFGA 5HYDA 3DVEA 2KBMA 2Y1MA 2BCAA 5D7FA 5B8IB 3RM1A 2L98A 3PM2A 3SS3A 4AQIA 2TN4A 1PVBA 1DJZA 2FOTA 3GK4X 4MZJA 1S3PA 3DVMA 1S1EA 2K2AA 4QJ5B 3FE9A 3CS1A 3EK8A 1XFRA 1NP8A 1XFWO 2GGMA 1TTXA 2H61A 4QJ4B 5I2QA 3DF0B 4NDCA 2NCOA 5I8NA 4N1GA 1CKKA 2HF5A 3D76A 3VROA 1DJXA 3LLEA 1F70A 1J1EA 3TUYC 1V1GA 5D69A 2WC5A 1K8UA 5AFPA 2BBMA 1MUXA 1TN4A 1M31A 4WQ2A 2FCDA 1ORGA 1KQMC 1KK7Z 1Y1UA 2FCEA 2L4IA 1F71A 1WDCB 2JT3A 5KU1A 2LHLA 1M39A 1CB1A 4I5NB 1UHKA 3DYEA 3S0EA 4MLWA 1QX2A 1TNXA 2G2BA 2LLSA 1Y6WA 4CLNA 2ISDA 1D1OA 3BQ3A 3OX5A 5TNCA 3SS4A 1F8HA 1PRWA 1SR6B 1K96A 2WCBA 2JT0A 3NGVA 3PFVA 4FTGA 4IL1A 4QJ3B 1PSRA 1QJTA 3BFHA 3FIAA 3QRXA 5FYXA 1Y1XA 2AMIA 2MBXA 1SL9A 2JNXA 2KGRA 1DELA 2NZ0A 1KFXL 2OTGC 4C0JA 3O6BA 3VRQA 3LK1A 1QVIY 2BCBA 1L7ZA 3UNWA 3KHEA 4PE7A 1J55A 1WY9A 1EG3A 1QV0A 2BKIB 1SK6D 2LE9B 3K1EA 1K95A 1OOIX 2KI4C 4OV2A 3B6XA 2I2RE 2JQ6A 3S0BA 5ER4X 1H8BA 3SG4A 3PN7C 4F0ZB 2QACA 1AP4A 3BUMB 1FBVA 3KPXA 2JPTA 4PT1A 1PVAA 3I5FB 5DICA 1YVHA 3BXKA 4YBHB 1NYAA 2QEVA 2ZFDA 2QDIA 4PALA 2LVKA 1LVCD 3EVVA 1B9AA 4N1FA 1CDMA 1QIVA 2LNKA 1ODBA 3PN7B 1TNPA 4E68A 5KSZA 3CLNA 3B87A 3HX4A 3VGOA 1DGVA 3WHTB 4M2OA 1V1FA 1OMVA 4MN0A 1C7VA 3CDNA 2ERBA 2H61C 4OCIA 1OOJA 1QWVA 3CR4X 1B4CA 4AOMA 1EL4A 2I94A 2PSRA 4HRGA 1IJ5A 4R1EA 1F4OA 2JT8A 1BU3A 1U5IB 2A4JA 4CFQA 2CCMA 1Z2CB 2PRUA 1JC2A 4YI8A 2ZRTA 2HQ8A 2LC5A 3OP0A 4MRXA 1SR6C 1SY9A 2ZNDA 4PHNA 1KFXS 3DY9A 3I5HB 2ZRSA 1JSAA 2K0JA 1BR4B 3HCMA 1IG5A 1YUUA 2I7AA 2KOTA 5CPVA 4GUKA 4PE0A 2BL0C 1IQ5A 2PALA 2ZNEA 2L4HA 3SIBA 2BBNA 1U5IA 1K94A 4YGCB 1C07A 4XJKA 1SKTA 4L9MA 2EHBA 2L51A 2WCJA 3S0GA 1ALWA 1TCOB 5AERA 3D10A 4DRWA 2BCXA 3D77A 1J7PA 2LAPA 4MZLA 1IH0A 3DVJA 1QS7A 1B8CA 1QVIZ 2M8UA 3SG5A 1W7IB 3WNXB 1IJ6A 4JKTA 3ZWHA 2FJYA 2LANA 3BUNB 3BYAA 3E3RA 3I5HC 4USLA 3SG6A 1CFPA 2KLDA 2HETA 2SCPA 5BPJA 5DKNA 1RK9A 1RTP1 2H8VA 3PJIA 1IGVA 1S6CA 5DKQA 1UHJA 3AKBA 4GNKB 1G8IA 5K89A 1K93D 1XVJA 2GTEA 1UHNA 2KLEA 4TNCA 1HQVA 4NDBA 2WNDA 2JULA 1RFJA 2LLTA 1KQVA 2BL0B 1BMOA 2CBLA 1WRZA 4IJ7A 2JNFA 1OQPA 4YI9A 3NSKA 2HPSA 1SBJA 1XO5A 2ZN8A 5HL1A 4PHKA 2Q4UA 3Q8IA 2KSPA 2O60A 1YVLA 2LVJA 3EK4A 1JBAA 2JRFA 3NHTA 3OGNA 2ZKMX 3OHMB 1KSOA 3VB1A 1MQ1A 2F2OA 1NCYA 2LCPA 1Y0VH 1YX8A 5I2OA 1YR5A 2K7BA 1SSEB 2KQ6A 3FWCA 3I5FC 2MRDA 2LHIA 2CTNA 1MXEA 3BUWB 2M7NA 2KI6C 5I94A 1TUJA 1JUOA 4GBAA 2CXJA 1FI5A 1DGUA 3GK1A 1GQMA 4OR9B 2KI4B 4ORAB 3VRPA 1TUZA 3JTDC 2KAYA 2JZIA 3I5IC 1MWNA 1QV1A 3NHIA 2FJUB 3B7AA 4BY5A 2MLFC 2WC6A 3ZNIA 4GGFA 1X02A 2WCMA 3CZ2A 1KWOC 3L4AA 2OS8B 1XFZO 1QATA 4C0KA 4INXA 4MEWA 4PHMA 4C0LA 1SL8A 1PULA 2OPOA 2P70A 3H4SE 2KBIA 2MLEC 4XJKB 1B8LA 1QASA 1IWQA 2KHNA 4BY4A 1WDCC 2KAXA 2L2CA 2QEBA 3BJHA 3IQOA 3CZ0A 4OKHA 2Y4QA 3UO9A 1JFKA 1MXLC 2CT9A 3C1VA 1XFXO 2LUXA 1IKUA 3IVTA 1QIWA 2OTGB 5CSFA 3VRNA 2H2KA 4A4CA 2K2FA 3NSIA 2WCFA 1JFJA 1NX2A 3CZ1A 3R1OA 5AANA 2KDHA 1CDLA 4GPLB 1EG4A 3FWBA 1UWOA 1NSHA 2LLUA 2M97A 2Q91A 2WC8A 1DTLA 3SJSA 1BG1A 2EGDA 3V2LA 1M63B 3NSLA 2QEHA 3D74A 1A2XA 4NQGA 1LINA 2KYCA 3TDZA 1KSMA 2K61A 3AKAA 1CMFA 3NSOA 1WRKA 4MRYA 1K9PA 1BF5A 1RROA 1S6IA 5CSNA 4M2PA 1FW4A 5JOLA 1AHRA 3FS7A 1SMGA 1KFUS 1W7JB 2JTZA 1E8AA 1CM1A 1SW8A 1UHIA 2LMUA 3MSEB 1XFVO 2BECA 1B7TZ 3CR2A 3OB1B 4I5LB 2LVIA 3SIAA 1HT9A 1BR1B 2K7CA 1OMDA 3PATA 3ICBA 1NX0A 4JD9A 4WQ3A 3S0DA 2SASA 5EL2A 5HKYA 2BE6A 1GJYA 4HSZA 3LL8B 1IRJA 1SCVA 1DMOA 1P28A 1XK4A 1DVIA 1CDPA 1CLLA 4MZKA 3CR5X 4ETOA 1LS8A 1CM4A 4D1EA 1G4YR 1TWOA 3I5GB 1ZUZA 1FPWA 1T14A 3SG3A 2KGBC 3CGAA 3QMEA 3WHUB 1DEKA 4P2YB 4U8DA 1CDNA 4KYNA 4YGAA 1DJGA 3L47A 5IBWA 4MVFA 5D3OA 1G33A 3DXLA 1SCMB 4FQOA 1SL7A 1UHHA 2WORA 3NXAA 1OE9B 2F3YA 1QTXA 3BFBA 1OZSA 1JF0A 1ZMZA 3EKJA 4Q04A 4ZCVA 3CZTX 5HKWA 2WCHA 2VRGA 1LKJA 1PALA 2KQYA 2JTTA 2PYQA 3DD4A 3RLZA 2D8NA 1J7QA 1OZOA 1KFUL 1PSBA 2F8PA 2LMVA 1DT7B 1YRTB 1A29A 2WCKA 3IF7A 4NDDA 1DC1A 2P71A 1AJ4A 2MAZA 1ZFSA 1TNQA 1XA5A 3CTNA 1YTZC 2Y5IA 2F33A 2JU0A 1TNWA 1XYDA 2PVBA 1CFFA 3TZ1A 1S5GZ 1S26D 3TDUA 1NX1A 1CMGA 4PE4A 3PM8A 1DQEA 1SRAA 1CLBA 2AUCA 2L5XB 5AEQA 1MF8B 4XYNA 2EC6B 3SS5A 1F54A 1N65A 4OZDA 1CLMA 1QLSA 3A8RA 4DIRA 2JXLA 1RWYA 3BOWA 2LM5A 1XFYO 1KQMB 2JWWA 4P5OE 1NWDA 1K9KA 3D75A 1DJYA 4JQ0D 3O2PA 3TUYB 1RJVA 1KK7Y 4MSPA 2BKHB 2KNEA 1QX7A 2KFHA 2WCEA 1OOHA 2ZN9A 1YUSA 1XK4C 1A75A 1NPQA 3R1VA 1BLQA 3K21A 3EVRA 4OVNF 2KAVA 1C3YA 3IQQA 5FI2A 1PK0D 2LMTA 2RGIA 3BFAA 2JOJA 3D0YA 1SPYA 3FE8A 1KK8B 1S6JA 5J3XA 4I5JA 1Y1AA 3SG7A 2JC2A 3OB2B 2WOSA 1QX5B 5G08A 2B1UA 1OOGA 2COLB 3OBVA 2LVVA 3EVUA 1AUIB 1L2OC 3BOWB 1OMRA 4DUQA 3RZSA 4PHJA 1A4PA 2L0PA 3JVTC 5KTYA 2KYFA 1UUSA 2YGUA 3TS5C 2I18A 1BJFA 2M7LA 4YRUA 2PQLA 2F2PA 3AAJA 2GV5A 1WLZA 1CNPA 2NLNA 3A4UB 2KPHA 3TS5B 3LK0A 1ZACA 3GOFA 1EJ3A 3AAKA 1AK8A 4ZCUA 5HLOA 3D0YB 2BNXA 1VRKA 2F3ZA 4PE1A 2G9BA 1CFCA 1CFDA 1EH2A 3KEVA 1BOCA 2O5GA 2MA2A 4GAOA 5CSIA 3CABA 4GGNA 5DKRA 3GK2A 1R2UA 1Z4HA 2QPTA 1JF2A 1R6PA 2MJWB 3F45A 4HRHA 2M9GA 1W9ZA 1WRLA 1EXRA 1OW4A 3O4XA 4HREE 4N5XA 1TCFA 3S0AA 1YURA 3TDIA 1DF0A 2L2EA 4CPVA 2M1UA 2R2IA 3JVTB 1B8RA 1J7OA 1YUTA 2KI6D 3VRRA 1BODA 1TIZA 2LUCA 2E30A 3L4LA 1J1DA 2LV7A 1L2OB 3EK7A 1BT6A 1NIWA 3D78A 2JXCA 5I2LA 1DJIA 1B7TY 1M45A 2HQWA 5GQQC 3O78A 2K60A 2M29A 2M1KB 5PALA 1GGZA 2V53A 1B47A 1F4QA 4GFTA 2BAPA 4A4BA 1IIOA 4ICBA 1KK8C 1GGWA 5FI7A 1N2DA 1UURA 3PALA 5ER5A 3EG5B 1NCXA 2NCPA 3CYZA 1XFUO 1JWDA 2K7DA 4JPZB 2EC6C 1C3ZA 2JPOA 1AVSA 4PDZA 3D73A 5FI6A 1ALVA 1KWOB 5CSJA
chains in the Genus database with same CATH topology
1C7WA 4DCKA 1QXPA 1YRUB 2CNPA 4JWQA 3DF0A 3KO0A 1F55A 1K9UA 3JTDB 1SYMA 5AXIA 3CWGA 4I5KA 1FF1A 4YGBB 1OSAA 1FI6A 1CTRA 2AAOA 1MR8A 1K2HA 4ORCB 3EKHA 4PCWA 4DS7A 1H4BA 1K90D 1NX3A 1TRFA 2BE4A 1MHOA 2LP2A 1NUBA 1DJHA 2Y1NA 1LXFC 1LA3A 4UPGA 3OX6A 1IQ3A 2M0RA 2OS8C 1RECA 4YGEB 4WRIA 2L50A 2M3WA 1S36A 2NXQA 1YX7A 4GGFC 3BUOB 3BUXB 3I5IB 4MBEA 2LP3A 1QLKA 3KF9A 1S5GY 1A75B 1N0YA 1A03A 4AQJA 1J7RA 1Q80A 5HKZA 1M46A 1AJ5A 3WXAA 3PLFB 2DOQA 2MHHA 4YGDB 1SCMC 2K7OA 3O4YA 4ORBB 1DF0B 2K8MB 2PMYA 3LCPC 5HLVA 2KFFA 1WLMA 3DVKA 1LA0A 2GGZA 3SG2A 1SNLA 1UP5A 2E6WA 1B1GA 4CIDA 1NCZA 2IS9A 1KCYA 4M2QA 2PASA 3PSRA 2P6BB 4CFRA 5JJGA 1TOPA 3I5GC 5F6TA 2M49B 1ZOTB 1DJWA 3M0WA 2KFGA 5HYDA 3DVEA 2KBMA 2Y1MA 2BCAA 5D7FA 5B8IB 3RM1A 2L98A 4AQIA 2TN4A 1PVBA 1DJZA 2FOTA 3GK4X 4MZJA 1S3PA 3DVMA 1S1EA 2K2AA 4QJ5B 3CS1A 3EK8A 1NP8A 1XFWO 2GGMA 1TTXA 2H61A 4QJ4B 5I2QA 3DF0B 4NDCA 2NCOA 5I8NA 4N1GA 1CKKA 2HF5A 3VROA 1DJXA 3LLEA 1F70A 1J1EA 3TUYC 1V1GA 5D69A 1K8UA 5AFPA 2BBMA 1MUXA 1TN4A 1M31A 4WQ2A 2FCDA 1KQMC 1KK7Z 1Y1UA 2FCEA 2L4IA 1F71A 1WDCB 2JT3A 5KU1A 2LHLA 1M39A 1CB1A 4I5NB 1UHKA 4MLWA 1QX2A 1TNXA 2G2BA 2LLSA 1Y6WA 4CLNA 2ISDA 1D1OA 3BQ3A 3OX5A 5TNCA 1F8HA 1PRWA 1SR6B 1K96A 2WCBA 2JT0A 3PFVA 4IL1A 4FTGA 4QJ3B 1PSRA 1QJTA 3FIAA 3QRXA 5FYXA 1Y1XA 2AMIA 2MBXA 1SL9A 2JNXA 2KGRA 2NZ0A 1KFXL 2OTGC 3O6BA 3VRQA 3LK1A 1QVIY 2BCBA 1L7ZA 3KHEA 4PE7A 1J55A 1WY9A 1EG3A 1QV0A 2BKIB 1SK6D 2LE9B 4OV2A 1K95A 2KI4C 2I2RE 2JQ6A 5ER4X 1H8BA 3SG4A 3PN7C 4F0ZB 2QACA 1AP4A 3BUMB 1FBVA 3KPXA 2JPTA 1PVAA 3I5FB 1YVHA 3BXKA 4YBHB 1NYAA 2ZFDA 4PALA 2LVKA 1LVCD 3EVVA 1B9AA 4N1FA 1CDMA 1QIVA 2LNKA 1ODBA 3PN7B 1TNPA 4E68A 5KSZA 3CLNA 3HX4A 3VGOA 1DGVA 3WHTB 4M2OA 1V1FA 1OMVA 4MN0A 1C7VA 2H61C 4OCIA 1OOJA 3CR4X 1B4CA 4AOMA 1EL4A 2I94A 2PSRA 4HRGA 1IJ5A 4R1EA 1F4OA 2JT8A 1BU3A 1U5IB 2A4JA 4CFQA 2CCMA 2PRUA 1JC2A 4YI8A 2ZRTA 2HQ8A 2LC5A 3OP0A 4MRXA 1SR6C 1SY9A 2ZNDA 4PHNA 1KFXS 3I5HB 2ZRSA 1JSAA 2K0JA 1BR4B 3HCMA 1IG5A 1YUUA 2I7AA 2KOTA 5CPVA 4GUKA 4PE0A 2BL0C 1IQ5A 2PALA 2ZNEA 2L4HA 3SIBA 2BBNA 1U5IA 1K94A 4YGCB 1C07A 4XJKA 1SKTA 4L9MA 2EHBA 2L51A 1ALWA 1TCOB 5AERA 3D10A 4DRWA 2BCXA 1J7PA 2LAPA 4MZLA 1IH0A 3DVJA 1QS7A 1B8CA 1QVIZ 2M8UA 3SG5A 1W7IB 3WNXB 1IJ6A 3ZWHA 1CMGA 4USLA 2LANA 3BUNB 3BYAA 3E3RA 3I5HC 3SG6A 1CFPA 2HETA 2SCPA 5BPJA 5DKNA 1RK9A 1RTP1 1IGVA 1S6CA 5DKQA 1UHJA 3AKBA 4GNKB 1G8IA 5K89A 1K93D 1XVJA 1UHNA 4TNCA 1HQVA 4NDBA 2WNDA 2JULA 1RFJA 2LLTA 1KQVA 2BL0B 1BMOA 2CBLA 1WRZA 2JNFA 1OQPA 4YI9A 3NSKA 2HPSA 1SBJA 1XO5A 2ZN8A 4PHKA 2Q4UA 2KSPA 2O60A 1YVLA 2LVJA 3EK4A 1JBAA 2JRFA 2ZKMX 3OHMB 1KSOA 1MQ1A 2F2OA 1NCYA 2LCPA 1Y0VH 1YX8A 5I2OA 1YR5A 2K7BA 2KQ6A 3I5FC 3FWCA 2MRDA 2LHIA 2CTNA 1MXEA 3BUWB 2M7NA 2KI6C 1JUOA 4GBAA 2CXJA 1FI5A 1DGUA 3GK1A 1GQMA 4OR9B 2KI4B 4ORAB 3VRPA 3JTDC 2KAYA 2JZIA 3I5IC 1MWNA 1QV1A 2FJUB 4BY5A 2MLFC 3ZNIA 4GGFA 1X02A 1KWOC 2OS8B 1XFZO 1QATA 4C0KA 4MEWA 4PHMA 4C0LA 1SL8A 1PULA 2OPOA 3H4SE 2KBIA 2MLEC 4XJKB 1B8LA 1QASA 1IWQA 2KHNA 4BY4A 1WDCC 2KAXA 3IQOA 4OKHA 2Y4QA 1JFKA 1MXLC 2CT9A 3C1VA 1XFXO 2LUXA 1IKUA 1QIWA 2OTGB 5CSFA 3VRNA 2H2KA 4A4CA 2K2FA 3NSIA 2WCFA 1JFJA 1NX2A 5AANA 2KDHA 1CDLA 4GPLB 1EG4A 3FWBA 1UWOA 1NSHA 2LLUA 2M97A 2Q91A 2WC8A 1DTLA 3SJSA 1BG1A 2EGDA 1M63B 3NSLA 4NQGA 1A2XA 1LINA 2KYCA 3TDZA 1KSMA 2K61A 3AKAA 1CMFA 3NSOA 1WRKA 4MRYA 1K9PA 1BF5A 1RROA 1S6IA 5CSNA 4M2PA 1FW4A 5JOLA 1AHRA 3FS7A 1SMGA 1KFUS 1W7JB 2JTZA 1E8AA 1CM1A 1SW8A 1UHIA 2LMUA 3MSEB 1XFVO 2BECA 1B7TZ 3CR2A 3OB1B 4I5LB 2LVIA 3SIAA 1HT9A 1BR1B 2K7CA 1OMDA 3PATA 3ICBA 1NX0A 4WQ3A 2SASA 5HKYA 2BE6A 1GJYA 4HSZA 3LL8B 1IRJA 1SCVA 1DMOA 1XK4A 1DVIA 1CDPA 1CLLA 4MZKA 3CR5X 4ETOA 1CM4A 4D1EA 1G4YR 3I5GB 1ZUZA 1FPWA 3SG3A 2KGBC 3CGAA 3WHUB 4P2YB 4U8DA 1CDNA 4YGAA 1DJGA 5IBWA 4MVFA 1G33A 1SCMB 4FQOA 1SL7A 1UHHA 2WORA 3NXAA 1OE9B 2F3YA 1QTXA 1OZSA 1JF0A 1ZMZA 3EKJA 4Q04A 4ZCVA 3CZTX 5HKWA 2VRGA 1LKJA 1PALA 2KQYA 2JTTA 3DD4A 3RLZA 2D8NA 1J7QA 1OZOA 1KFUL 1PSBA 2F8PA 2LMVA 1DT7B 1YRTB 1A29A 3IF7A 4NDDA 1AJ4A 2MAZA 1ZFSA 1TNQA 1XA5A 3CTNA 1YTZC 2Y5IA 2F33A 2JU0A 1TNWA 1XYDA 2PVBA 1CFFA 3TZ1A 1S5GZ 1S26D 3TDUA 1NX1A 4PE4A 3PM8A 1SRAA 1CLBA 2AUCA 2L5XB 5AEQA 1MF8B 4XYNA 2EC6B 1F54A 1N65A 1CLMA 1QLSA 3A8RA 4DIRA 2JXLA 1RWYA 3BOWA 2LM5A 1XFYO 1KQMB 2JWWA 4P5OE 1NWDA 1K9KA 1DJYA 4JQ0D 3O2PA 3TUYB 1RJVA 1KK7Y 4MSPA 2BKHB 2KNEA 1QX7A 2KFHA 2WCEA 2ZN9A 1YUSA 1XK4C 1A75A 1NPQA 1BLQA 3K21A 3EVRA 4OVNF 2KAVA 3IQQA 1PK0D 2LMTA 2RGIA 3D0YA 2JOJA 1SPYA 1KK8B 1S6JA 5J3XA 4I5JA 1Y1AA 3SG7A 2JC2A 3OB2B 2WOSA 1QX5B 5G08A 2B1UA 2COLB 2LVVA 3EVUA 1AUIB 1L2OC 3BOWB 1OMRA 4DUQA 4PHJA 1A4PA 2L0PA 3JVTC 5KTYA 2KYFA 1UUSA 3TS5C 2I18A 1BJFA 2M7LA 4YRUA 2F2PA 3AAJA 2GV5A 1WLZA 1CNPA 2NLNA 3A4UB 3TS5B 3LK0A 1ZACA 3GOFA 1EJ3A 3AAKA 1AK8A 4ZCUA 5HLOA 3D0YB 1VRKA 2F3ZA 4PE1A 2G9BA 1CFCA 1CFDA 1EH2A 3KEVA 1BOCA 2O5GA 2MA2A 4GAOA 5CSIA 4GGNA 5DKRA 3GK2A 1R2UA 2QPTA 1JF2A 1R6PA 2MJWB 3F45A 4HRHA 2M9GA 1WRLA 1EXRA 4HREE 4N5XA 1TCFA 1YURA 3TDIA 1DF0A 2L2EA 4CPVA 2M1UA 2R2IA 3JVTB 1B8RA 1J7OA 1YUTA 2KI6D 3VRRA 1BODA 1TIZA 2LUCA 2E30A 1J1DA 2LV7A 1L2OB 3EK7A 1BT6A 1NIWA 5I2LA 2JXCA 1DJIA 1B7TY 1M45A 2HQWA 5GQQC 3O78A 2M29A 4C0JA 2M1KB 5PALA 1GGZA 2V53A 1B47A 1F4QA 4GFTA 4A4BA 4ICBA 1KK8C 1GGWA 1N2DA 1UURA 3PALA 5ER5A 1NCXA 2NCPA 1JWDA 1XFUO 2K7DA 4JPZB 2EC6C 1AVSA 4PDZA 1ALVA 1KWOB 5CSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7W A;  4DCK A;  1QXP A;  1YRU B;  2CNP A;  4JWQ A;  3DF0 A;  3KO0 A;  1F55 A;  1K9U A;  3JTD B;  1SYM A;  5AXI A;  3CWG A;  4I5K A;  1FF1 A;  4YGB B;  1OSA A;  1FI6 A;  1CTR A;  2AAO A;  1MR8 A;  1K2H A;  4ORC B;  3EKH A;  4PCW A;  4DS7 A;  1H4B A;  1K90 D;  1NX3 A;  1TRF A;  2BE4 A;  1MHO A;  2LP2 A;  1NUB A;  1DJH A;  2Y1N A;  1LXF C;  1LA3 A;  4UPG A;  3OX6 A;  1IQ3 A;  2M0R A;  2OS8 C;  1REC A;  4YGE B;  4WRI A;  2L50 A;  2M3W A;  1S36 A;  2NXQ A;  1YX7 A;  4GGF C;  3BUO B;  3BUX B;  3I5I B;  4MBE A;  2LP3 A;  1QLK A;  3KF9 A;  1S5G Y;  1A75 B;  1N0Y A;  1A03 A;  4AQJ A;  1J7R A;  1Q80 A;  5HKZ A;  1M46 A;  1AJ5 A;  3WXA A;  3PLF B;  2DOQ A;  2MHH A;  4YGD B;  1SCM C;  2K7O A;  3O4Y A;  4ORB B;  1DF0 B;  2K8M B;  2PMY A;  3LCP C;  5HLV A;  2KFF A;  1WLM A;  3DVK A;  1LA0 A;  2GGZ A;  3SG2 A;  1SNL A;  1UP5 A;  2E6W A;  1B1G A;  4CID A;  1NCZ A;  2IS9 A;  1KCY A;  4M2Q A;  2PAS A;  3PSR A;  2P6B B;  4CFR A;  5JJG A;  1TOP A;  3I5G C;  5F6T A;  2M49 B;  1ZOT B;  1DJW A;  3M0W A;  2KFG A;  5HYD A;  3DVE A;  2KBM A;  2Y1M A;  2BCA A;  5D7F A;  5B8I B;  3RM1 A;  2L98 A;  4AQI A;  2TN4 A;  1PVB A;  1DJZ A;  2FOT A;  3GK4 X;  4MZJ A;  1S3P A;  3DVM A;  1S1E A;  2K2A A;  4QJ5 B;  3CS1 A;  3EK8 A;  1NP8 A;  1XFW O;  2GGM A;  1TTX A;  2H61 A;  4QJ4 B;  5I2Q A;  3DF0 B;  4NDC A;  2NCO A;  5I8N A;  4N1G A;  1CKK A;  2HF5 A;  3VRO A;  1DJX A;  3LLE A;  1F70 A;  1J1E A;  3TUY C;  1V1G A;  5D69 A;  1K8U A;  5AFP A;  2BBM A;  1MUX A;  1TN4 A;  1M31 A;  4WQ2 A;  2FCD A;  1KQM C;  1KK7 Z;  1Y1U A;  2FCE A;  2L4I A;  1F71 A;  1WDC B;  2JT3 A;  5KU1 A;  2LHL A;  1M39 A;  1CB1 A;  4I5N B;  1UHK A;  4MLW A;  1QX2 A;  1TNX A;  2G2B A;  2LLS A;  1Y6W A;  4CLN A;  2ISD A;  1D1O A;  3BQ3 A;  3OX5 A;  5TNC A;  1F8H A;  1PRW A;  1SR6 B;  1K96 A;  2WCB A;  2JT0 A;  3PFV A;  4IL1 A;  4FTG A;  4QJ3 B;  1PSR A;  1QJT A;  3FIA A;  3QRX A;  5FYX A;  1Y1X A;  2AMI A;  2MBX A;  1SL9 A;  2JNX A;  2KGR A;  2NZ0 A;  1KFX L;  2OTG C;  3O6B A;  3VRQ A;  3LK1 A;  1QVI Y;  2BCB A;  1L7Z A;  3KHE A;  4PE7 A;  1J55 A;  1WY9 A;  1EG3 A;  1QV0 A;  2BKI B;  1SK6 D;  2LE9 B;  4OV2 A;  1K95 A;  2KI4 C;  2I2R E;  2JQ6 A;  5ER4 X;  1H8B A;  3SG4 A;  3PN7 C;  4F0Z B;  2QAC A;  1AP4 A;  3BUM B;  1FBV A;  3KPX A;  2JPT A;  1PVA A;  3I5F B;  1YVH A;  3BXK A;  4YBH B;  1NYA A;  2ZFD A;  4PAL A;  2LVK A;  1LVC D;  3EVV A;  1B9A A;  4N1F A;  1CDM A;  1QIV A;  2LNK A;  1ODB A;  3PN7 B;  1TNP A;  4E68 A;  5KSZ A;  3CLN A;  3HX4 A;  3VGO A;  1DGV A;  3WHT B;  4M2O A;  1V1F A;  1OMV A;  4MN0 A;  1C7V A;  2H61 C;  4OCI A;  1OOJ A;  3CR4 X;  1B4C A;  4AOM A;  1EL4 A;  2I94 A;  2PSR A;  4HRG A;  1IJ5 A;  4R1E A;  1F4O A;  2JT8 A;  1BU3 A;  1U5I B;  2A4J A;  4CFQ A;  2CCM A;  2PRU A;  1JC2 A;  4YI8 A;  2ZRT A;  2HQ8 A;  2LC5 A;  3OP0 A;  4MRX A;  1SR6 C;  1SY9 A;  2ZND A;  4PHN A;  1KFX S;  3I5H B;  2ZRS A;  1JSA A;  2K0J A;  1BR4 B;  3HCM A;  1IG5 A;  1YUU A;  2I7A A;  2KOT A;  5CPV A;  4GUK A;  4PE0 A;  2BL0 C;  1IQ5 A;  2PAL A;  2ZNE A;  2L4H A;  3SIB A;  2BBN A;  1U5I A;  1K94 A;  4YGC B;  1C07 A;  4XJK A;  1SKT A;  4L9M A;  2EHB A;  2L51 A;  1ALW A;  1TCO B;  5AER A;  3D10 A;  4DRW A;  2BCX A;  1J7P A;  2LAP A;  4MZL A;  1IH0 A;  3DVJ A;  1QS7 A;  1B8C A;  1QVI Z;  2M8U A;  3SG5 A;  1W7I B;  3WNX B;  1IJ6 A;  3ZWH A;  1CMG A;  4USL A;  2LAN A;  3BUN B;  3BYA A;  3E3R A;  3I5H C;  3SG6 A;  1CFP A;  2HET A;  2SCP A;  5BPJ A;  5DKN A;  1RK9 A;  1RTP 1;  1IGV A;  1S6C A;  5DKQ A;  1UHJ A;  3AKB A;  4GNK B;  1G8I A;  5K89 A;  1K93 D;  1XVJ A;  1UHN A;  4TNC A;  1HQV A;  4NDB A;  2WND A;  2JUL A;  1RFJ A;  2LLT A;  1KQV A;  2BL0 B;  1BMO A;  2CBL A;  1WRZ A;  2JNF A;  1OQP A;  4YI9 A;  3NSK A;  2HPS A;  1SBJ A;  1XO5 A;  2ZN8 A;  4PHK A;  2Q4U A;  2KSP A;  2O60 A;  1YVL A;  2LVJ A;  3EK4 A;  1JBA A;  2JRF A;  2ZKM X;  3OHM B;  1KSO A;  1MQ1 A;  2F2O A;  1NCY A;  2LCP A;  1Y0V H;  1YX8 A;  5I2O A;  1YR5 A;  2K7B A;  2KQ6 A;  3I5F C;  3FWC A;  2MRD A;  2LHI A;  2CTN A;  1MXE A;  3BUW B;  2M7N A;  2KI6 C;  1JUO A;  4GBA A;  2CXJ A;  1FI5 A;  1DGU A;  3GK1 A;  1GQM A;  4OR9 B;  2KI4 B;  4ORA B;  3VRP A;  3JTD C;  2KAY A;  2JZI A;  3I5I C;  1MWN A;  1QV1 A;  2FJU B;  4BY5 A;  2MLF C;  3ZNI A;  4GGF A;  1X02 A;  1KWO C;  2OS8 B;  1XFZ O;  1QAT A;  4C0K A;  4MEW A;  4PHM A;  4C0L A;  1SL8 A;  1PUL A;  2OPO A;  3H4S E;  2KBI A;  2MLE C;  4XJK B;  1B8L A;  1QAS A;  1IWQ A;  2KHN A;  4BY4 A;  1WDC C;  2KAX A;  3IQO A;  4OKH A;  2Y4Q A;  1JFK A;  1MXL C;  2CT9 A;  3C1V A;  1XFX O;  2LUX A;  1IKU A;  1QIW A;  2OTG B;  5CSF A;  3VRN A;  2H2K A;  4A4C A;  2K2F A;  3NSI A;  2WCF A;  1JFJ A;  1NX2 A;  5AAN A;  2KDH A;  1CDL A;  4GPL B;  1EG4 A;  3FWB A;  1UWO A;  1NSH A;  2LLU A;  2M97 A;  2Q91 A;  2WC8 A;  1DTL A;  3SJS A;  1BG1 A;  2EGD A;  1M63 B;  3NSL A;  4NQG A;  1A2X A;  1LIN A;  2KYC A;  3TDZ A;  1KSM A;  2K61 A;  3AKA A;  1CMF A;  3NSO A;  1WRK A;  4MRY A;  1K9P A;  1BF5 A;  1RRO A;  1S6I A;  5CSN A;  4M2P A;  1FW4 A;  5JOL A;  1AHR A;  3FS7 A;  1SMG A;  1KFU S;  1W7J B;  2JTZ A;  1E8A A;  1CM1 A;  1SW8 A;  1UHI A;  2LMU A;  3MSE B;  1XFV O;  2BEC A;  1B7T Z;  3CR2 A;  3OB1 B;  4I5L B;  2LVI A;  3SIA A;  1HT9 A;  1BR1 B;  2K7C A;  1OMD A;  3PAT A;  3ICB A;  1NX0 A;  4WQ3 A;  2SAS A;  5HKY A;  2BE6 A;  1GJY A;  4HSZ A;  3LL8 B;  1IRJ A;  1SCV A;  1DMO A;  1XK4 A;  1DVI A;  1CDP A;  1CLL A;  4MZK A;  3CR5 X;  4ETO A;  1CM4 A;  4D1E A;  1G4Y R;  3I5G B;  1ZUZ A;  1FPW A;  3SG3 A;  2KGB C;  3CGA A;  3WHU B;  4P2Y B;  4U8D A;  1CDN A;  4YGA A;  1DJG A;  5IBW A;  4MVF A;  1G33 A;  1SCM B;  4FQO A;  1SL7 A;  1UHH A;  2WOR A;  3NXA A;  1OE9 B;  2F3Y A;  1QTX A;  1OZS A;  1JF0 A;  1ZMZ A;  3EKJ A;  4Q04 A;  4ZCV A;  3CZT X;  5HKW A;  2VRG A;  1LKJ A;  1PAL A;  2KQY A;  2JTT A;  3DD4 A;  3RLZ A;  2D8N A;  1J7Q A;  1OZO A;  1KFU L;  1PSB A;  2F8P A;  2LMV A;  1DT7 B;  1YRT B;  1A29 A;  3IF7 A;  4NDD A;  1AJ4 A;  2MAZ A;  1ZFS A;  1TNQ A;  1XA5 A;  3CTN A;  1YTZ C;  2Y5I A;  2F33 A;  2JU0 A;  1TNW A;  1XYD A;  2PVB A;  1CFF A;  3TZ1 A;  1S5G Z;  1S26 D;  3TDU A;  1NX1 A;  4PE4 A;  3PM8 A;  1SRA A;  1CLB A;  2AUC A;  2L5X B;  5AEQ A;  1MF8 B;  4XYN A;  2EC6 B;  1F54 A;  1N65 A;  1CLM A;  1QLS A;  3A8R A;  4DIR A;  2JXL A;  1RWY A;  3BOW A;  2LM5 A;  1XFY O;  1KQM B;  2JWW A;  4P5O E;  1NWD A;  1K9K A;  1DJY A;  4JQ0 D;  3O2P A;  3TUY B;  1RJV A;  1KK7 Y;  4MSP A;  2BKH B;  2KNE A;  1QX7 A;  2KFH A;  2WCE A;  2ZN9 A;  1YUS A;  1XK4 C;  1A75 A;  1NPQ A;  1BLQ A;  3K21 A;  3EVR A;  4OVN F;  2KAV A;  3IQQ A;  1PK0 D;  2LMT A;  2RGI A;  3D0Y A;  2JOJ A;  1SPY A;  1KK8 B;  1S6J A;  5J3X A;  4I5J A;  1Y1A A;  3SG7 A;  2JC2 A;  3OB2 B;  2WOS A;  1QX5 B;  5G08 A;  2B1U A;  2COL B;  2LVV A;  3EVU A;  1AUI B;  1L2O C;  3BOW B;  1OMR A;  4DUQ A;  4PHJ A;  1A4P A;  2L0P A;  3JVT C;  5KTY A;  2KYF A;  1UUS A;  3TS5 C;  2I18 A;  1BJF A;  2M7L A;  4YRU A;  2F2P A;  3AAJ A;  2GV5 A;  1WLZ A;  1CNP A;  2NLN A;  3A4U B;  3TS5 B;  3LK0 A;  1ZAC A;  3GOF A;  1EJ3 A;  3AAK A;  1AK8 A;  4ZCU A;  5HLO A;  3D0Y B;  1VRK A;  2F3Z A;  4PE1 A;  2G9B A;  1CFC A;  1CFD A;  1EH2 A;  3KEV A;  1BOC A;  2O5G A;  2MA2 A;  4GAO A;  5CSI A;  4GGN A;  5DKR A;  3GK2 A;  1R2U A;  2QPT A;  1JF2 A;  1R6P A;  2MJW B;  3F45 A;  4HRH A;  2M9G A;  1WRL A;  1EXR A;  4HRE E;  4N5X A;  1TCF A;  1YUR A;  3TDI A;  1DF0 A;  2L2E A;  4CPV A;  2M1U A;  2R2I A;  3JVT B;  1B8R A;  1J7O A;  1YUT A;  2KI6 D;  3VRR A;  1BOD A;  1TIZ A;  2LUC A;  2E30 A;  1J1D A;  2LV7 A;  1L2O B;  3EK7 A;  1BT6 A;  1NIW A;  5I2L A;  2JXC A;  1DJI A;  1B7T Y;  1M45 A;  2HQW A;  5GQQ C;  3O78 A;  2M29 A;  4C0J A;  2M1K B;  5PAL A;  1GGZ A;  2V53 A;  1B47 A;  1F4Q A;  4GFT A;  4A4B A;  4ICB A;  1KK8 C;  1GGW A;  1N2D A;  1UUR A;  3PAL A;  5ER5 A;  1NCX A;  2NCP A;  1JWD A;  1XFU O;  2K7D A;  4JPZ B;  2EC6 C;  1AVS A;  4PDZ A;  1ALV A;  1KWO B;  5CSJ A; 
#chains in the Genus database with same CATH topology
 1C7W A;  4DCK A;  1QXP A;  4F7F A;  1YRU B;  2CNP A;  4JWQ A;  3DF0 A;  3KO0 A;  1F55 A;  1K9U A;  3JTD B;  1SYM A;  3R72 A;  5AXI A;  3CWG A;  4I5K A;  1FF1 A;  4YGB B;  1OSA A;  3B88 A;  3DZT A;  3N7H A;  1FI6 A;  1CTR A;  2AAO A;  1MR8 A;  1OOF A;  1K2H A;  4ORC B;  3EKH A;  4PCW A;  4DS7 A;  1H4B A;  1K90 D;  1NX3 A;  1TRF A;  2BE4 A;  1MHO A;  2LP2 A;  3S0F A;  1NUB A;  1DJH A;  2WCL A;  2Y1N A;  1LXF C;  1LA3 A;  4UPG A;  3OX6 A;  1IQ3 A;  2QEO A;  2M0R A;  2OS8 C;  1REC A;  4YGE B;  4WRI A;  2L50 A;  2M3W A;  1S36 A;  2NXQ A;  1YX7 A;  4GGF C;  3BUO B;  3BUX B;  3I5I B;  4MBE A;  2LP3 A;  1QLK A;  3KF9 A;  1S5G Y;  1A75 B;  1N0Y A;  1GM0 A;  1A03 A;  4AQJ A;  1J7R A;  1Q80 A;  5HKZ A;  1M46 A;  1AJ5 A;  3WXA A;  3PLF B;  3B86 A;  2DOQ A;  2MHH A;  3FE6 A;  4YGD B;  1SCM C;  2L5Y A;  2K7O A;  3O4Y A;  4ORB B;  1DF0 B;  2K8M B;  2PMY A;  3LCP C;  5HLV A;  4FQT A;  2KFF A;  1WLM A;  3DVK A;  1LA0 A;  2GGZ A;  3SG2 A;  3R1P A;  1SNL A;  1UP5 A;  2E6W A;  4INW A;  1B1G A;  4CID A;  1NCZ A;  2IS9 A;  1KCY A;  4M2Q A;  2PAS A;  3PSR A;  2P6B B;  4CFR A;  5JJG A;  1TOP A;  3I5G C;  5F6T A;  2M49 B;  1ZOT B;  1DJW A;  3M0W A;  2KFG A;  5HYD A;  3DVE A;  2KBM A;  2Y1M A;  2BCA A;  5D7F A;  5B8I B;  3RM1 A;  2L98 A;  3PM2 A;  3SS3 A;  4AQI A;  2TN4 A;  1PVB A;  1DJZ A;  2FOT A;  3GK4 X;  4MZJ A;  1S3P A;  3DVM A;  1S1E A;  2K2A A;  4QJ5 B;  3FE9 A;  3CS1 A;  3EK8 A;  1XFR A;  1NP8 A;  1XFW O;  2GGM A;  1TTX A;  2H61 A;  4QJ4 B;  5I2Q A;  3DF0 B;  4NDC A;  2NCO A;  5I8N A;  4N1G A;  1CKK A;  2HF5 A;  3D76 A;  3VRO A;  1DJX A;  3LLE A;  1F70 A;  1J1E A;  3TUY C;  1V1G A;  5D69 A;  2WC5 A;  1K8U A;  5AFP A;  2BBM A;  1MUX A;  1TN4 A;  1M31 A;  4WQ2 A;  2FCD A;  1ORG A;  1KQM C;  1KK7 Z;  1Y1U A;  2FCE A;  2L4I A;  1F71 A;  1WDC B;  2JT3 A;  5KU1 A;  2LHL A;  1M39 A;  1CB1 A;  4I5N B;  1UHK A;  3DYE A;  3S0E A;  4MLW A;  1QX2 A;  1TNX A;  2G2B A;  2LLS A;  1Y6W A;  4CLN A;  2ISD A;  1D1O A;  3BQ3 A;  3OX5 A;  5TNC A;  3SS4 A;  1F8H A;  1PRW A;  1SR6 B;  1K96 A;  2WCB A;  2JT0 A;  3NGV A;  3PFV A;  4FTG A;  4IL1 A;  4QJ3 B;  1PSR A;  1QJT A;  3BFH A;  3FIA A;  3QRX A;  5FYX A;  1Y1X A;  2AMI A;  2MBX A;  1SL9 A;  2JNX A;  2KGR A;  1DEL A;  2NZ0 A;  1KFX L;  2OTG C;  4C0J A;  3O6B A;  3VRQ A;  3LK1 A;  1QVI Y;  2BCB A;  1L7Z A;  3UNW A;  3KHE A;  4PE7 A;  1J55 A;  1WY9 A;  1EG3 A;  1QV0 A;  2BKI B;  1SK6 D;  2LE9 B;  3K1E A;  1K95 A;  1OOI X;  2KI4 C;  4OV2 A;  3B6X A;  2I2R E;  2JQ6 A;  3S0B A;  5ER4 X;  1H8B A;  3SG4 A;  3PN7 C;  4F0Z B;  2QAC A;  1AP4 A;  3BUM B;  1FBV A;  3KPX A;  2JPT A;  4PT1 A;  1PVA A;  3I5F B;  5DIC A;  1YVH A;  3BXK A;  4YBH B;  1NYA A;  2QEV A;  2ZFD A;  2QDI A;  4PAL A;  2LVK A;  1LVC D;  3EVV A;  1B9A A;  4N1F A;  1CDM A;  1QIV A;  2LNK A;  1ODB A;  3PN7 B;  1TNP A;  4E68 A;  5KSZ A;  3CLN A;  3B87 A;  3HX4 A;  3VGO A;  1DGV A;  3WHT B;  4M2O A;  1V1F A;  1OMV A;  4MN0 A;  1C7V A;  3CDN A;  2ERB A;  2H61 C;  4OCI A;  1OOJ A;  1QWV A;  3CR4 X;  1B4C A;  4AOM A;  1EL4 A;  2I94 A;  2PSR A;  4HRG A;  1IJ5 A;  4R1E A;  1F4O A;  2JT8 A;  1BU3 A;  1U5I B;  2A4J A;  4CFQ A;  2CCM A;  1Z2C B;  2PRU A;  1JC2 A;  4YI8 A;  2ZRT A;  2HQ8 A;  2LC5 A;  3OP0 A;  4MRX A;  1SR6 C;  1SY9 A;  2ZND A;  4PHN A;  1KFX S;  3DY9 A;  3I5H B;  2ZRS A;  1JSA A;  2K0J A;  1BR4 B;  3HCM A;  1IG5 A;  1YUU A;  2I7A A;  2KOT A;  5CPV A;  4GUK A;  4PE0 A;  2BL0 C;  1IQ5 A;  2PAL A;  2ZNE A;  2L4H A;  3SIB A;  2BBN A;  1U5I A;  1K94 A;  4YGC B;  1C07 A;  4XJK A;  1SKT A;  4L9M A;  2EHB A;  2L51 A;  2WCJ A;  3S0G A;  1ALW A;  1TCO B;  5AER A;  3D10 A;  4DRW A;  2BCX A;  3D77 A;  1J7P A;  2LAP A;  4MZL A;  1IH0 A;  3DVJ A;  1QS7 A;  1B8C A;  1QVI Z;  2M8U A;  3SG5 A;  1W7I B;  3WNX B;  1IJ6 A;  4JKT A;  3ZWH A;  2FJY A;  2LAN A;  3BUN B;  3BYA A;  3E3R A;  3I5H C;  4USL A;  3SG6 A;  1CFP A;  2KLD A;  2HET A;  2SCP A;  5BPJ A;  5DKN A;  1RK9 A;  1RTP 1;  2H8V A;  3PJI A;  1IGV A;  1S6C A;  5DKQ A;  1UHJ A;  3AKB A;  4GNK B;  1G8I A;  5K89 A;  1K93 D;  1XVJ A;  2GTE A;  1UHN A;  2KLE A;  4TNC A;  1HQV A;  4NDB A;  2WND A;  2JUL A;  1RFJ A;  2LLT A;  1KQV A;  2BL0 B;  1BMO A;  2CBL A;  1WRZ A;  4IJ7 A;  2JNF A;  1OQP A;  4YI9 A;  3NSK A;  2HPS A;  1SBJ A;  1XO5 A;  2ZN8 A;  5HL1 A;  4PHK A;  2Q4U A;  3Q8I A;  2KSP A;  2O60 A;  1YVL A;  2LVJ A;  3EK4 A;  1JBA A;  2JRF A;  3NHT A;  3OGN A;  2ZKM X;  3OHM B;  1KSO A;  3VB1 A;  1MQ1 A;  2F2O A;  1NCY A;  2LCP A;  1Y0V H;  1YX8 A;  5I2O A;  1YR5 A;  2K7B A;  1SSE B;  2KQ6 A;  3FWC A;  3I5F C;  2MRD A;  2LHI A;  2CTN A;  1MXE A;  3BUW B;  2M7N A;  2KI6 C;  5I94 A;  1TUJ A;  1JUO A;  4GBA A;  2CXJ A;  1FI5 A;  1DGU A;  3GK1 A;  1GQM A;  4OR9 B;  2KI4 B;  4ORA B;  3VRP A;  1TUZ A;  3JTD C;  2KAY A;  2JZI A;  3I5I C;  1MWN A;  1QV1 A;  3NHI A;  2FJU B;  3B7A A;  4BY5 A;  2MLF C;  2WC6 A;  3ZNI A;  4GGF A;  1X02 A;  2WCM A;  3CZ2 A;  1KWO C;  3L4A A;  2OS8 B;  1XFZ O;  1QAT A;  4C0K A;  4INX A;  4MEW A;  4PHM A;  4C0L A;  1SL8 A;  1PUL A;  2OPO A;  2P70 A;  3H4S E;  2KBI A;  2MLE C;  4XJK B;  1B8L A;  1QAS A;  1IWQ A;  2KHN A;  4BY4 A;  1WDC C;  2KAX A;  2L2C A;  2QEB A;  3BJH A;  3IQO A;  3CZ0 A;  4OKH A;  2Y4Q A;  3UO9 A;  1JFK A;  1MXL C;  2CT9 A;  3C1V A;  1XFX O;  2LUX A;  1IKU A;  3IVT A;  1QIW A;  2OTG B;  5CSF A;  3VRN A;  2H2K A;  4A4C A;  2K2F A;  3NSI A;  2WCF A;  1JFJ A;  1NX2 A;  3CZ1 A;  3R1O A;  5AAN A;  2KDH A;  1CDL A;  4GPL B;  1EG4 A;  3FWB A;  1UWO A;  1NSH A;  2LLU A;  2M97 A;  2Q91 A;  2WC8 A;  1DTL A;  3SJS A;  1BG1 A;  2EGD A;  3V2L A;  1M63 B;  3NSL A;  2QEH A;  3D74 A;  1A2X A;  4NQG A;  1LIN A;  2KYC A;  3TDZ A;  1KSM A;  2K61 A;  3AKA A;  1CMF A;  3NSO A;  1WRK A;  4MRY A;  1K9P A;  1BF5 A;  1RRO A;  1S6I A;  5CSN A;  4M2P A;  1FW4 A;  5JOL A;  1AHR A;  3FS7 A;  1SMG A;  1KFU S;  1W7J B;  2JTZ A;  1E8A A;  1CM1 A;  1SW8 A;  1UHI A;  2LMU A;  3MSE B;  1XFV O;  2BEC A;  1B7T Z;  3CR2 A;  3OB1 B;  4I5L B;  2LVI A;  3SIA A;  1HT9 A;  1BR1 B;  2K7C A;  1OMD A;  3PAT A;  3ICB A;  1NX0 A;  4JD9 A;  4WQ3 A;  3S0D A;  2SAS A;  5EL2 A;  5HKY A;  2BE6 A;  1GJY A;  4HSZ A;  3LL8 B;  1IRJ A;  1SCV A;  1DMO A;  1P28 A;  1XK4 A;  1DVI A;  1CDP A;  1CLL A;  4MZK A;  3CR5 X;  4ETO A;  1LS8 A;  1CM4 A;  4D1E A;  1G4Y R;  1TWO A;  3I5G B;  1ZUZ A;  1FPW A;  1T14 A;  3SG3 A;  2KGB C;  3CGA A;  3QME A;  3WHU B;  1DEK A;  4P2Y B;  4U8D A;  1CDN A;  4KYN A;  4YGA A;  1DJG A;  3L47 A;  5IBW A;  4MVF A;  5D3O A;  1G33 A;  3DXL A;  1SCM B;  4FQO A;  1SL7 A;  1UHH A;  2WOR A;  3NXA A;  1OE9 B;  2F3Y A;  1QTX A;  3BFB A;  1OZS A;  1JF0 A;  1ZMZ A;  3EKJ A;  4Q04 A;  4ZCV A;  3CZT X;  5HKW A;  2WCH A;  2VRG A;  1LKJ A;  1PAL A;  2KQY A;  2JTT A;  2PYQ A;  3DD4 A;  3RLZ A;  2D8N A;  1J7Q A;  1OZO A;  1KFU L;  1PSB A;  2F8P A;  2LMV A;  1DT7 B;  1YRT B;  1A29 A;  2WCK A;  3IF7 A;  4NDD A;  1DC1 A;  2P71 A;  1AJ4 A;  2MAZ A;  1ZFS A;  1TNQ A;  1XA5 A;  3CTN A;  1YTZ C;  2Y5I A;  2F33 A;  2JU0 A;  1TNW A;  1XYD A;  2PVB A;  1CFF A;  3TZ1 A;  1S5G Z;  1S26 D;  3TDU A;  1NX1 A;  1CMG A;  4PE4 A;  3PM8 A;  1DQE A;  1SRA A;  1CLB A;  2AUC A;  2L5X B;  5AEQ A;  1MF8 B;  4XYN A;  2EC6 B;  3SS5 A;  1F54 A;  1N65 A;  4OZD A;  1CLM A;  1QLS A;  3A8R A;  4DIR A;  2JXL A;  1RWY A;  3BOW A;  2LM5 A;  1XFY O;  1KQM B;  2JWW A;  4P5O E;  1NWD A;  1K9K A;  3D75 A;  1DJY A;  4JQ0 D;  3O2P A;  3TUY B;  1RJV A;  1KK7 Y;  4MSP A;  2BKH B;  2KNE A;  1QX7 A;  2KFH A;  2WCE A;  1OOH A;  2ZN9 A;  1YUS A;  1XK4 C;  1A75 A;  1NPQ A;  3R1V A;  1BLQ A;  3K21 A;  3EVR A;  4OVN F;  2KAV A;  1C3Y A;  3IQQ A;  5FI2 A;  1PK0 D;  2LMT A;  2RGI A;  3BFA A;  2JOJ A;  3D0Y A;  1SPY A;  3FE8 A;  1KK8 B;  1S6J A;  5J3X A;  4I5J A;  1Y1A A;  3SG7 A;  2JC2 A;  3OB2 B;  2WOS A;  1QX5 B;  5G08 A;  2B1U A;  1OOG A;  2COL B;  3OBV A;  2LVV A;  3EVU A;  1AUI B;  1L2O C;  3BOW B;  1OMR A;  4DUQ A;  3RZS A;  4PHJ A;  1A4P A;  2L0P A;  3JVT C;  5KTY A;  2KYF A;  1UUS A;  2YGU A;  3TS5 C;  2I18 A;  1BJF A;  2M7L A;  4YRU A;  2PQL A;  2F2P A;  3AAJ A;  2GV5 A;  1WLZ A;  1CNP A;  2NLN A;  3A4U B;  2KPH A;  3TS5 B;  3LK0 A;  1ZAC A;  3GOF A;  1EJ3 A;  3AAK A;  1AK8 A;  4ZCU A;  5HLO A;  3D0Y B;  2BNX A;  1VRK A;  2F3Z A;  4PE1 A;  2G9B A;  1CFC A;  1CFD A;  1EH2 A;  3KEV A;  1BOC A;  2O5G A;  2MA2 A;  4GAO A;  5CSI A;  3CAB A;  4GGN A;  5DKR A;  3GK2 A;  1R2U A;  1Z4H A;  2QPT A;  1JF2 A;  1R6P A;  2MJW B;  3F45 A;  4HRH A;  2M9G A;  1W9Z A;  1WRL A;  1EXR A;  1OW4 A;  3O4X A;  4HRE E;  4N5X A;  1TCF A;  3S0A A;  1YUR A;  3TDI A;  1DF0 A;  2L2E A;  4CPV A;  2M1U A;  2R2I A;  3JVT B;  1B8R A;  1J7O A;  1YUT A;  2KI6 D;  3VRR A;  1BOD A;  1TIZ A;  2LUC A;  2E30 A;  3L4L A;  1J1D A;  2LV7 A;  1L2O B;  3EK7 A;  1BT6 A;  1NIW A;  3D78 A;  2JXC A;  5I2L A;  1DJI A;  1B7T Y;  1M45 A;  2HQW A;  5GQQ C;  3O78 A;  2K60 A;  2M29 A;  2M1K B;  5PAL A;  1GGZ A;  2V53 A;  1B47 A;  1F4Q A;  4GFT A;  2BAP A;  4A4B A;  1IIO A;  4ICB A;  1KK8 C;  1GGW A;  5FI7 A;  1N2D A;  1UUR A;  3PAL A;  5ER5 A;  3EG5 B;  1NCX A;  2NCP A;  3CYZ A;  1XFU O;  1JWD A;  2K7D A;  4JPZ B;  2EC6 C;  1C3Z A;  2JPO A;  1AVS A;  4PDZ A;  3D73 A;  5FI6 A;  1ALV A;  1KWO B;  5CSJ A; 
#chains in the Genus database with same CATH homology
 1C7W A;  4DCK A;  1QXP A;  1YRU B;  2CNP A;  4JWQ A;  3DF0 A;  3KO0 A;  1F55 A;  1K9U A;  3JTD B;  1SYM A;  5AXI A;  3CWG A;  4I5K A;  1FF1 A;  4YGB B;  1OSA A;  1FI6 A;  1CTR A;  2AAO A;  1MR8 A;  1K2H A;  4ORC B;  3EKH A;  4PCW A;  4DS7 A;  1H4B A;  1K90 D;  1NX3 A;  1TRF A;  2BE4 A;  1MHO A;  2LP2 A;  1NUB A;  1DJH A;  2Y1N A;  1LXF C;  1LA3 A;  4UPG A;  3OX6 A;  1IQ3 A;  2M0R A;  2OS8 C;  1REC A;  4YGE B;  4WRI A;  2L50 A;  2M3W A;  1S36 A;  2NXQ A;  1YX7 A;  4GGF C;  3BUO B;  3BUX B;  3I5I B;  4MBE A;  2LP3 A;  1QLK A;  3KF9 A;  1S5G Y;  1A75 B;  1N0Y A;  1A03 A;  4AQJ A;  1J7R A;  1Q80 A;  5HKZ A;  1M46 A;  1AJ5 A;  3WXA A;  3PLF B;  2DOQ A;  2MHH A;  4YGD B;  1SCM C;  2K7O A;  3O4Y A;  4ORB B;  1DF0 B;  2K8M B;  2PMY A;  3LCP C;  5HLV A;  2KFF A;  1WLM A;  3DVK A;  1LA0 A;  2GGZ A;  3SG2 A;  1SNL A;  1UP5 A;  2E6W A;  1B1G A;  4CID A;  1NCZ A;  2IS9 A;  1KCY A;  4M2Q A;  2PAS A;  3PSR A;  2P6B B;  4CFR A;  5JJG A;  1TOP A;  3I5G C;  5F6T A;  2M49 B;  1ZOT B;  1DJW A;  3M0W A;  2KFG A;  5HYD A;  3DVE A;  2KBM A;  2Y1M A;  2BCA A;  5D7F A;  5B8I B;  3RM1 A;  2L98 A;  4AQI A;  2TN4 A;  1PVB A;  1DJZ A;  2FOT A;  3GK4 X;  4MZJ A;  1S3P A;  3DVM A;  1S1E A;  2K2A A;  4QJ5 B;  3CS1 A;  3EK8 A;  1NP8 A;  1XFW O;  2GGM A;  1TTX A;  2H61 A;  4QJ4 B;  5I2Q A;  3DF0 B;  4NDC A;  2NCO A;  5I8N A;  4N1G A;  1CKK A;  2HF5 A;  3VRO A;  1DJX A;  3LLE A;  1F70 A;  1J1E A;  3TUY C;  1V1G A;  5D69 A;  1K8U A;  5AFP A;  2BBM A;  1MUX A;  1TN4 A;  1M31 A;  4WQ2 A;  2FCD A;  1KQM C;  1KK7 Z;  1Y1U A;  2FCE A;  2L4I A;  1F71 A;  1WDC B;  2JT3 A;  5KU1 A;  2LHL A;  1M39 A;  1CB1 A;  4I5N B;  1UHK A;  4MLW A;  1QX2 A;  1TNX A;  2G2B A;  2LLS A;  1Y6W A;  4CLN A;  2ISD A;  1D1O A;  3BQ3 A;  3OX5 A;  5TNC A;  1F8H A;  1PRW A;  1SR6 B;  1K96 A;  2WCB A;  2JT0 A;  3PFV A;  4IL1 A;  4FTG A;  4QJ3 B;  1PSR A;  1QJT A;  3FIA A;  3QRX A;  5FYX A;  1Y1X A;  2AMI A;  2MBX A;  1SL9 A;  2JNX A;  2KGR A;  2NZ0 A;  1KFX L;  2OTG C;  3O6B A;  3VRQ A;  3LK1 A;  1QVI Y;  2BCB A;  1L7Z A;  3KHE A;  4PE7 A;  1J55 A;  1WY9 A;  1EG3 A;  1QV0 A;  2BKI B;  1SK6 D;  2LE9 B;  4OV2 A;  1K95 A;  2KI4 C;  2I2R E;  2JQ6 A;  5ER4 X;  1H8B A;  3SG4 A;  3PN7 C;  4F0Z B;  2QAC A;  1AP4 A;  3BUM B;  1FBV A;  3KPX A;  2JPT A;  1PVA A;  3I5F B;  1YVH A;  3BXK A;  4YBH B;  1NYA A;  2ZFD A;  4PAL A;  2LVK A;  1LVC D;  3EVV A;  1B9A A;  4N1F A;  1CDM A;  1QIV A;  2LNK A;  1ODB A;  3PN7 B;  1TNP A;  4E68 A;  5KSZ A;  3CLN A;  3HX4 A;  3VGO A;  1DGV A;  3WHT B;  4M2O A;  1V1F A;  1OMV A;  4MN0 A;  1C7V A;  2H61 C;  4OCI A;  1OOJ A;  3CR4 X;  1B4C A;  4AOM A;  1EL4 A;  2I94 A;  2PSR A;  4HRG A;  1IJ5 A;  4R1E A;  1F4O A;  2JT8 A;  1BU3 A;  1U5I B;  2A4J A;  4CFQ A;  2CCM A;  2PRU A;  1JC2 A;  4YI8 A;  2ZRT A;  2HQ8 A;  2LC5 A;  3OP0 A;  4MRX A;  1SR6 C;  1SY9 A;  2ZND A;  4PHN A;  1KFX S;  3I5H B;  2ZRS A;  1JSA A;  2K0J A;  1BR4 B;  3HCM A;  1IG5 A;  1YUU A;  2I7A A;  2KOT A;  5CPV A;  4GUK A;  4PE0 A;  2BL0 C;  1IQ5 A;  2PAL A;  2ZNE A;  2L4H A;  3SIB A;  2BBN A;  1U5I A;  1K94 A;  4YGC B;  1C07 A;  4XJK A;  1SKT A;  4L9M A;  2EHB A;  2L51 A;  1ALW A;  1TCO B;  5AER A;  3D10 A;  4DRW A;  2BCX A;  1J7P A;  2LAP A;  4MZL A;  1IH0 A;  3DVJ A;  1QS7 A;  1B8C A;  1QVI Z;  2M8U A;  3SG5 A;  1W7I B;  3WNX B;  1IJ6 A;  3ZWH A;  1CMG A;  4USL A;  2LAN A;  3BUN B;  3BYA A;  3E3R A;  3I5H C;  3SG6 A;  1CFP A;  2HET A;  2SCP A;  5BPJ A;  5DKN A;  1RK9 A;  1RTP 1;  1IGV A;  1S6C A;  5DKQ A;  1UHJ A;  3AKB A;  4GNK B;  1G8I A;  5K89 A;  1K93 D;  1XVJ A;  1UHN A;  4TNC A;  1HQV A;  4NDB A;  2WND A;  2JUL A;  1RFJ A;  2LLT A;  1KQV A;  2BL0 B;  1BMO A;  2CBL A;  1WRZ A;  2JNF A;  1OQP A;  4YI9 A;  3NSK A;  2HPS A;  1SBJ A;  1XO5 A;  2ZN8 A;  4PHK A;  2Q4U A;  2KSP A;  2O60 A;  1YVL A;  2LVJ A;  3EK4 A;  1JBA A;  2JRF A;  2ZKM X;  3OHM B;  1KSO A;  1MQ1 A;  2F2O A;  1NCY A;  2LCP A;  1Y0V H;  1YX8 A;  5I2O A;  1YR5 A;  2K7B A;  2KQ6 A;  3I5F C;  3FWC A;  2MRD A;  2LHI A;  2CTN A;  1MXE A;  3BUW B;  2M7N A;  2KI6 C;  1JUO A;  4GBA A;  2CXJ A;  1FI5 A;  1DGU A;  3GK1 A;  1GQM A;  4OR9 B;  2KI4 B;  4ORA B;  3VRP A;  3JTD C;  2KAY A;  2JZI A;  3I5I C;  1MWN A;  1QV1 A;  2FJU B;  4BY5 A;  2MLF C;  3ZNI A;  4GGF A;  1X02 A;  1KWO C;  2OS8 B;  1XFZ O;  1QAT A;  4C0K A;  4MEW A;  4PHM A;  4C0L A;  1SL8 A;  1PUL A;  2OPO A;  3H4S E;  2KBI A;  2MLE C;  4XJK B;  1B8L A;  1QAS A;  1IWQ A;  2KHN A;  4BY4 A;  1WDC C;  2KAX A;  3IQO A;  4OKH A;  2Y4Q A;  1JFK A;  1MXL C;  2CT9 A;  3C1V A;  1XFX O;  2LUX A;  1IKU A;  1QIW A;  2OTG B;  5CSF A;  3VRN A;  2H2K A;  4A4C A;  2K2F A;  3NSI A;  2WCF A;  1JFJ A;  1NX2 A;  5AAN A;  2KDH A;  1CDL A;  4GPL B;  1EG4 A;  3FWB A;  1UWO A;  1NSH A;  2LLU A;  2M97 A;  2Q91 A;  2WC8 A;  1DTL A;  3SJS A;  1BG1 A;  2EGD A;  1M63 B;  3NSL A;  4NQG A;  1A2X A;  1LIN A;  2KYC A;  3TDZ A;  1KSM A;  2K61 A;  3AKA A;  1CMF A;  3NSO A;  1WRK A;  4MRY A;  1K9P A;  1BF5 A;  1RRO A;  1S6I A;  5CSN A;  4M2P A;  1FW4 A;  5JOL A;  1AHR A;  3FS7 A;  1SMG A;  1KFU S;  1W7J B;  2JTZ A;  1E8A A;  1CM1 A;  1SW8 A;  1UHI A;  2LMU A;  3MSE B;  1XFV O;  2BEC A;  1B7T Z;  3CR2 A;  3OB1 B;  4I5L B;  2LVI A;  3SIA A;  1HT9 A;  1BR1 B;  2K7C A;  1OMD A;  3PAT A;  3ICB A;  1NX0 A;  4WQ3 A;  2SAS A;  5HKY A;  2BE6 A;  1GJY A;  4HSZ A;  3LL8 B;  1IRJ A;  1SCV A;  1DMO A;  1XK4 A;  1DVI A;  1CDP A;  1CLL A;  4MZK A;  3CR5 X;  4ETO A;  1CM4 A;  4D1E A;  1G4Y R;  3I5G B;  1ZUZ A;  1FPW A;  3SG3 A;  2KGB C;  3CGA A;  3WHU B;  4P2Y B;  4U8D A;  1CDN A;  4YGA A;  1DJG A;  5IBW A;  4MVF A;  1G33 A;  1SCM B;  4FQO A;  1SL7 A;  1UHH A;  2WOR A;  3NXA A;  1OE9 B;  2F3Y A;  1QTX A;  1OZS A;  1JF0 A;  1ZMZ A;  3EKJ A;  4Q04 A;  4ZCV A;  3CZT X;  5HKW A;  2VRG A;  1LKJ A;  1PAL A;  2KQY A;  2JTT A;  3DD4 A;  3RLZ A;  2D8N A;  1J7Q A;  1OZO A;  1KFU L;  1PSB A;  2F8P A;  2LMV A;  1DT7 B;  1YRT B;  1A29 A;  3IF7 A;  4NDD A;  1AJ4 A;  2MAZ A;  1ZFS A;  1TNQ A;  1XA5 A;  3CTN A;  1YTZ C;  2Y5I A;  2F33 A;  2JU0 A;  1TNW A;  1XYD A;  2PVB A;  1CFF A;  3TZ1 A;  1S5G Z;  1S26 D;  3TDU A;  1NX1 A;  4PE4 A;  3PM8 A;  1SRA A;  1CLB A;  2AUC A;  2L5X B;  5AEQ A;  1MF8 B;  4XYN A;  2EC6 B;  1F54 A;  1N65 A;  1CLM A;  1QLS A;  3A8R A;  4DIR A;  2JXL A;  1RWY A;  3BOW A;  2LM5 A;  1XFY O;  1KQM B;  2JWW A;  4P5O E;  1NWD A;  1K9K A;  1DJY A;  4JQ0 D;  3O2P A;  3TUY B;  1RJV A;  1KK7 Y;  4MSP A;  2BKH B;  2KNE A;  1QX7 A;  2KFH A;  2WCE A;  2ZN9 A;  1YUS A;  1XK4 C;  1A75 A;  1NPQ A;  1BLQ A;  3K21 A;  3EVR A;  4OVN F;  2KAV A;  3IQQ A;  1PK0 D;  2LMT A;  2RGI A;  3D0Y A;  2JOJ A;  1SPY A;  1KK8 B;  1S6J A;  5J3X A;  4I5J A;  1Y1A A;  3SG7 A;  2JC2 A;  3OB2 B;  2WOS A;  1QX5 B;  5G08 A;  2B1U A;  2COL B;  2LVV A;  3EVU A;  1AUI B;  1L2O C;  3BOW B;  1OMR A;  4DUQ A;  4PHJ A;  1A4P A;  2L0P A;  3JVT C;  5KTY A;  2KYF A;  1UUS A;  3TS5 C;  2I18 A;  1BJF A;  2M7L A;  4YRU A;  2F2P A;  3AAJ A;  2GV5 A;  1WLZ A;  1CNP A;  2NLN A;  3A4U B;  3TS5 B;  3LK0 A;  1ZAC A;  3GOF A;  1EJ3 A;  3AAK A;  1AK8 A;  4ZCU A;  5HLO A;  3D0Y B;  1VRK A;  2F3Z A;  4PE1 A;  2G9B A;  1CFC A;  1CFD A;  1EH2 A;  3KEV A;  1BOC A;  2O5G A;  2MA2 A;  4GAO A;  5CSI A;  4GGN A;  5DKR A;  3GK2 A;  1R2U A;  2QPT A;  1JF2 A;  1R6P A;  2MJW B;  3F45 A;  4HRH A;  2M9G A;  1WRL A;  1EXR A;  4HRE E;  4N5X A;  1TCF A;  1YUR A;  3TDI A;  1DF0 A;  2L2E A;  4CPV A;  2M1U A;  2R2I A;  3JVT B;  1B8R A;  1J7O A;  1YUT A;  2KI6 D;  3VRR A;  1BOD A;  1TIZ A;  2LUC A;  2E30 A;  1J1D A;  2LV7 A;  1L2O B;  3EK7 A;  1BT6 A;  1NIW A;  5I2L A;  2JXC A;  1DJI A;  1B7T Y;  1M45 A;  2HQW A;  5GQQ C;  3O78 A;  2M29 A;  4C0J A;  2M1K B;  5PAL A;  1GGZ A;  2V53 A;  1B47 A;  1F4Q A;  4GFT A;  4A4B A;  4ICB A;  1KK8 C;  1GGW A;  1N2D A;  1UUR A;  3PAL A;  5ER5 A;  1NCX A;  2NCP A;  1JWD A;  1XFU O;  2K7D A;  4JPZ B;  2EC6 C;  1AVS A;  4PDZ A;  1ALV A;  1KWO B;  5CSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...