3PJIA

Crystal structure of agamobp22a at 1.7 angstrom in the open status for ligand binding.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
134
structure length
119
Chain Sequence
NESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNELWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Anopheles gambiae Odorant-binding Protein AgamOBP22a and Complexes with Bound Odorants
rcsb
molecule keywords Odorant binding protein (AGAP010409-PA)
molecule tags Transport protein
source organism Anopheles gambiae
total genus 45
structure length 119
sequence length 134
ec nomenclature
pdb deposition date 2010-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3pjiA00
2WCLA 2WCMA 1T14A 1OOHA 3D73A 2WCJA 2QEOA 3DYEA 3CDNA 3BFAA 3OGNA 3VB1A 3L47A 2L2CA 3FE9A 1P28A 3S0AA 4OZDA 3B7AA 5DICA 3L4LA 2H8VA 3D74A 3S0EA 5EL2A 3CZ1A 2WCHA 3N7HA 3RZSA 4PT1A 3D78A 1TWOA 1OOGA 1ORGA 3BFBA 1C3YA 3NHTA 3CYZA 4JD9A 3R1PA 3V2LA 3S0DA 3BFHA 2GTEA 3DXLA 2JPOA 2P71A 1OOIX 3S0GA 2ERBA 3CZ0A 3FE6A 3S0BA 1OW4A 1OOFA 2PQLA 2WCKA 4INXA 3FE8A 1QWVA 3DZTA 2QEHA 3D76A 4INWA 3S0FA 1C3ZA 2WC5A 3NGVA 3L4AA 4F7FA 2FJYA 3CZ2A 3R1VA 4FQTA 2KPHA 3QMEA 3PJIA 3R72A 3B87A 3DY9A 3NHIA 2QEVA 2QDIA 2QEBA 2WC6A 3BJHA 1DQEA 1TUJA 3B86A 1LS8A 1GM0A 3B6XA 3K1EA 3D75A 3B88A 3CABA 1XFRA 2P70A 3R1OA 3D77A 3Q8IA
chains in the Genus database with same CATH superfamily
5I2OA 2KI4B 1XFVO 2MHHA 2JQ6A 1DEKA 1ALWA 2JXCA 4N5XA 3MSEB 2HETA 1TOPA 4QJ4B 2WCJA 5CPVA 1QX2A 1ZACA 1B9AA 2ZN9A 1YTZC 4DUQA 1S36A 2KSPA 3OGNA 3L47A 3SJSA 3GOFA 3VB1A 1MQ1A 2KQYA 1EG3A 4ORAB 1ZOTB 3FE9A 1KSMA 2AUCA 2LLTA 2M29A 2H2KA 1TCOB 1B7TY 3B7AA 1QASA 1CLBA 3CS1A 2H8VA 1S1EA 1QLSA 3CR5X 1OZSA 1BJFA 3S0EA 4DCKA 3N7HA 3SG7A 2JZIA 1SW8A 3D78A 4FTGA 2JXLA 1DJXA 3BFBA 1C3YA 4PE1A 4A4CA 4ZCVA 4JD9A 3F45A 1DJYA 2M1UA 2K0JA 4OR9B 2OS8B 2WCFA 1HT9A 3DF0A 4C0LA 1UHIA 1S26D 3JTDC 3BOWA 1ODBA 3DXLA 3ZWHA 1MXEA 4F0ZB 3HCMA 2HQ8A 1CM1A 1B1GA 3OX5A 1L2OC 1RWYA 3DF0B 4C0JA 3SG5A 3DD4A 1PK0D 3I5GC 3IF7A 1A29A 3BUWB 3FE6A 1KFXS 1OZOA 1QS7A 2BAPA 1XO5A 2LUCA 3D0YA 2OTGC 2ZN8A 3RLZA 1C7WA 1DVIA 3VGOA 2E6WA 4BY5A 5AERA 2K7DA 3NSLA 3UNWA 3BUXB 3D0YB 5I94A 1MHOA 1SCMB 1CKKA 2JT0A 1S6CA 2MA2A 1NYAA 4GFTA 1DELA 4I5LB 3I5FC 3NSIA 1SL7A 1SKTA 1YVHA 1GGWA 2LLSA 1JWDA 1SR6B 1W7IB 3L4AA 3LL8B 2M8UA 4GGFC 1JFJA 3OBVA 3CZTX 4NDCA 2BCXA 2WCEA 4WQ2A 1CDMA 3I5IB 1IIOA 4MRYA 3GK2A 1A75A 3JVTB 4E68A 2O5GA 2SCPA 1K90D 3A4UB 1MXLC 3BUNB 5HYDA 2H61C 3EVRA 5ER5A 1XYDA 2WCBA 1J7QA 1Z4HA 3B87A 1UHKA 3IQQA 2A4JA 1EH2A 1F70A 2MLEC 1KCYA 3DY9A 1CFDA 5FI2A 2JNXA 2JTZA 1A75B 3O6BA 5I8NA 3SS5A 1IH0A 1EG4A 2QDIA 1KFUL 1HQVA 1Y6WA 2ZRSA 4JQ0D 2QEBA 4DRWA 2ZFDA 1X02A 3TZ1A 3LK0A 1BG1A 2KFFA 1WDCC 1XFYO 3DVMA 3KEVA 4HRHA 5JJGA 2BCAA 1DQEA 3B86A 3PFVA 2SASA 4GNKB 1UHNA 1YR5A 1NIWA 2KFHA 4ICBA 4I5KA 5I2LA 2KQ6A 2LLUA 1FI6A 1DC1A 3D75A 1QIWA 1XFRA 1KK7Z 2P70A 5FI7A 2M7NA 3R1OA 2Q4UA 2L5YA 2Q91A 3PSRA 1H4BA 3D77A 1CNPA 1L7ZA 4AQJA 1QVIY 1OOHA 3FS7A 4YGEB 4D1EA 4HREE 2KOTA 1K9UA 2L50A 2NLNA 2M0RA 2Y4QA 3KO0A 1NX1A 4M2QA 4NDDA 1BODA 1KWOC 2JWWA 3CDNA 3KHEA 5DKNA 2BKIB 2KGBC 1MR8A 2P6BB 2ZKMX 3D10A 1P28A 2LNKA 3L4LA 1YUUA 1OMRA 2LVJA 2LHLA 2NCOA 2RGIA 1UP5A 3NXAA 1NCYA 4WQ3A 2DOQA 2CNPA 4MN0A 1ZFSA 1RJVA 1FW4A 1TWOA 1SMGA 5ER4X 3VRPA 1ORGA 1S6IA 2I18A 1K8UA 3NHTA 4IJ7A 3SG2A 4PHJA 3WHTB 2K60A 1LINA 2ZNDA 4KYNA 5IBWA 1E8AA 1KFXL 2I7AA 1RFJA 1NX2A 4BY4A 4PALA 3VRNA 1WLMA 4FQOA 1AJ4A 3LLEA 4YRUA 1IWQA 4CIDA 2BNXA 2KI4C 1W7JB 3EK4A 4P5OE 3GK4X 3QRXA 4YGAA 3VRRA 2EC6C 2LMTA 5GQQC 2K8MB 5KTYA 4XJKA 1A4PA 1CLMA 1DT7B 2WOSA 2JTTA 3HX4A 3I5HB 1OW4A 2PQLA 3OHMB 5CSIA 3ICBA 1PULA 1NX0A 1IQ5A 1PSBA 1SSEB 2MAZA 4CPVA 2WCKA 2KYCA 4PE7A 4XJKB 3TS5B 1WRLA 1DMOA 3SG6A 2LMVA 4YI9A 1QWVA 1S5GZ 2JT3A 4PE0A 2KLEA 3PN7B 1QJTA 4MZLA 1J7PA 2Y5IA 1BLQA 1TN4A 1IQ3A 3GK1A 2BKHB 4CFQA 3D76A 4INWA 4MZJA 2LAPA 2LC5A 1LKJA 3CR2A 1CLLA 1YURA 1C3ZA 2ZRTA 1CM4A 1BU3A 1J55A 1M46A 2LM5A 2LVVA 3NGVA 3SS4A 2K2FA 1F8HA 4PHKA 1CDPA 1OE9B 4JPZB 2OS8C 4F7FA 1PRWA 1AP4A 1RROA 1K94A 2L51A 3EKJA 1IGVA 2CCMA 1B4CA 3JTDB 1BMOA 4FQTA 4PHNA 2KLDA 2KPHA 2HF5A 1Y0VH 2KAVA 3PJIA 3A8RA 4M2PA 4QJ3B 5D7FA 1PVBA 2M3WA 1AK8A 1F55A 1JF2A 4C0KA 1JBAA 3EKHA 2V53A 2QEVA 1BR4B 1QLKA 2LMUA 3CGAA 1GJYA 2D8NA 1R6PA 1XK4A 2KYFA 5AANA 1LA0A 3EVUA 4HRGA 2F3ZA 1SCMC 1G8IA 2LVKA 1S3PA 1UURA 1V1GA 4AQIA 5JOLA 3B6XA 3O4XA 2LANA 5AEQA 3VRQA 1OMDA 3B88A 2BECA 3CABA 1NP8A 2MLFC 4OVNF 2PRUA 4CLNA 3I5FB 3S0FA 3Q8IA 1TTXA 1Q80A 1RECA 2LV7A 1SR6C 2LP3A 1XK4C 2WCLA 2WCMA 2KNEA 4P2YB 3D73A 2EGDA 1DJWA 1TNXA 4L9MA 1KK7Y 2Y1MA 4GAOA 3TDIA 3I5IC 1FPWA 1XA5A 3FIAA 1XFWO 2KI6D 4PHMA 3JVTC 5BPJA 1NUBA 3OP0A 3CR4X 2ISDA 4R1EA 1SL9A 2BE4A 1B8LA 2PALA 1J1EA 1BF5A 1AHRA 3KPXA 2Y1NA 3BQ3A 1OSAA 4OZDA 1QV1A 3RM1A 1FI5A 5DICA 3TDUA 3D74A 1CTRA 2LE9B 1MUXA 2AMIA 4MEWA 4UPGA 1C07A 2NZ0A 5PALA 4CFRA 1YUTA 1M39A 3SG3A 2YGUA 2M7LA 4M2OA 1LVCD 1CMFA 2LHIA 2NCPA 1M63B 3S0DA 1B8CA 1OOJA 1TUZA 2BBMA 4GUKA 1FF1A 2BL0B 4JKTA 3BFHA 1SYMA 2EHBA 3OB1B 1NPQA 1K9KA 3OX6A 3PALA 1TCFA 2F8PA 2L0PA 2GV5A 4N1GA 1OOIX 3S0GA 2F2PA 3TUYC 1KQMB 4PCWA 3EK7A 2ERBA 3O2PA 3O4YA 1WRZA 2F33A 2BCBA 2JT8A 3CZ0A 3EVVA 5I2QA 3S0BA 1XVJA 2COLB 1OOFA 3LCPC 1D1OA 4WRIA 5HLVA 1KWOB 1QTXA 1OQPA 3VROA 1LA3A 1DJIA 1NX3A 1KK8B 1SBJA 4INXA 2QACA 5FYXA 4HSZA 1BOCA 2KAXA 1SK6D 4MVFA 4YGCB 2JNFA 1CFCA 1F71A 5KSZA 2BE6A 1DGUA 2LP2A 1WY9A 3DVJA 1A2XA 5B8IB 2QEHA 1JSAA 3DVKA 1EL4A 2LVIA 3AKBA 2F3YA 3WXAA 4JWQA 3SS3A 2I94A 1S5GY 1J7OA 4YI8A 3FWBA 1UHJA 1QX5B 2JU0A 1YX7A 4GGNA 4MRXA 3KF9A 2L2EA 2JRFA 1QV0A 3CLNA 5FI6A 1G4YR 1A03A 1F54A 2ZNEA 1PSRA 1KFUS 2R2IA 2OPOA 1M31A 1FBVA 2HQWA 1F4OA 2KBIA 2L4IA 2LUXA 4DS7A 3R1VA 3DVEA 5HKYA 4OV2A 4YGBB 5AFPA 5DKRA 5HKWA 3QMEA 2MBXA 3H4SE 1W9ZA 2M9GA 1CDLA 3R72A 5HL1A 2EC6B 2FCDA 2KHNA 3I5HC 1UHHA 1GQMA 1B47A 1SPYA 3UO9A 1NCXA 2B1UA 2IS9A 1QIVA 3PM8A 4MZKA 1IKUA 4I5JA 1M45A 2WC6A 1TNPA 3TS5C 2M1KB 1KSOA 1DF0A 1TIZA 2CTNA 1TUJA 1RTP1 5D69A 2M49B 3PN7C 5K89A 1GM0A 3K1EA 1B8RA 2KGRA 3WNXB 3LK1A 1BT6A 1U5IA 1DF0B 1LXFC 3BXKA 2JC2A 4XYNA 1QATA 5CSJA 2GGMA 1NWDA 4A4BA 1IG5A 1F4QA 1T14A 1H8BA 1U5IB 1XFUO 1L2OB 3PLFB 1R2UA 2QEOA 1CMGA 3I5GB 4GBAA 3DYEA 5KU1A 1B7TZ 3NSOA 1JC2A 2OTGB 1AJ5A 4QJ5B 3BFAA 2O60A 2L2CA 2LCPA 4AOMA 1CFFA 1V1FA 2QPTA 5F6TA 3S0AA 4MLWA 3BOWB 3TDZA 3BUOB 1C7VA 1MWNA 2JPTA 2K2AA 1UUSA 3CWGA 5EL2A 3CZ1A 3SIAA 2WCHA 3RZSA 3PM2A 1IJ5A 2K7OA 4PT1A 1SRAA 4GGFA 1Y1AA 4U8DA 1KQVA 1ZMZA 2CBLA 2L4HA 1OOGA 3AAKA 1J1DA 2CXJA 2KI6C 3CYZA 1ZUZA 2K61A 1K95A 2MRDA 3R1PA 3V2LA 3WHUB 3ZNIA 3SG4A 3E3RA 3EG5B 2NXQA 4MSPA 2K7CA 5J3XA 4ETOA 2H61A 4I5NB 4NDBA 2GTEA 1PVAA 1CDNA 3FWCA 1TRFA 1NSHA 2JPOA 2P71A 1J7RA 1G33A 1JF0A 1N65A 4DIRA 5HLOA 1UWOA 3BUMB 4MBEA 3AKAA 2KDHA 3IVTA 4PE4A 1K9PA 3K21A 5G08A 2K7BA 1Z2CB 1SNLA 2KFGA 2M97A 1YRTB 1DJZA 2G9BA 3FE8A 4ZCUA 1WDCB 5AXIA 3PATA 1JFKA 2FCEA 2FOTA 2G2BA 1WRKA 2I2RE 3DZTA 1CFPA 1BR1B 1DJHA 1YVLA 3C1VA 5CSFA 2F2OA 2PMYA 2L98A 1PALA 1YRUB 4PDZA 1YX8A 2VRGA 4Q04A 1S6JA 4YBHB 1VRKA 2WC5A 4TNCA 1DGVA 2WC8A 2TN4A 2FJUB 3NSKA 4ORCB 3AAJA 3M0WA 2BL0C 1Y1UA 4IL1A 4YGDB 1TNWA 3EK8A 1Y1XA 1DTLA 2FJYA 3CZ2A 5CSNA 1DJGA 1ALVA 1K93D 1MF8B 1EXRA 1AVSA 1IRJA 3O78A 2WNDA 4N1FA 5HKZA 2BBNA 1KQMC 4OKHA 3TUYB 2PVBA 2KBMA 5DKQA 3OB2B 2E30A 1JUOA 1EJ3A 2HPSA 1SY9A 3NHIA 3IQOA 4NQGA 2PASA 4USLA 1RK9A 1AUIB 3SIBA 1GGZA 1SL8A 1CB1A 4GPLB 2L5XB 1YUSA 1XFZO 1KK8C 2JULA 5D3OA 3BJHA 5TNCA 2KAYA 1N2DA 2PYQA 1LS8A 4OCIA 1QX7A 2PSRA 1XFXO 2CT9A 1SCVA 2MJWB 3BYAA 1OMVA 1QXPA 2AAOA 2JOJA 2WORA 2GGZA 1IJ6A 1QVIZ 4ORBB 3CTNA 1K96A 1NCZA 1N0YA 1TNQA 1WLZA 1K2HA
chains in the Genus database with same CATH topology
2WCLA 2WCMA 1T14A 1OOHA 3D73A 2WCJA 2QEOA 3DYEA 3CDNA 3BFAA 3OGNA 3VB1A 3L47A 2L2CA 3FE9A 1P28A 3S0AA 4OZDA 3B7AA 5DICA 3L4LA 2H8VA 3D74A 3S0EA 5EL2A 3CZ1A 2WCHA 3N7HA 3RZSA 4PT1A 3D78A 1TWOA 1OOGA 1ORGA 3BFBA 1C3YA 3NHTA 3CYZA 4JD9A 3R1PA 3V2LA 3S0DA 3BFHA 2GTEA 3DXLA 2JPOA 2P71A 1OOIX 3S0GA 2ERBA 3CZ0A 3FE6A 3S0BA 1OW4A 1OOFA 2PQLA 2WCKA 4INXA 3FE8A 1QWVA 3DZTA 2QEHA 3D76A 4INWA 3S0FA 1C3ZA 2WC5A 3NGVA 3L4AA 4F7FA 2FJYA 3CZ2A 3R1VA 4FQTA 2KPHA 3QMEA 3PJIA 3R72A 3B87A 3DY9A 3NHIA 2QEVA 2QDIA 2QEBA 2WC6A 3BJHA 1DQEA 1TUJA 3B86A 1LS8A 1GM0A 3B6XA 3K1EA 3D75A 3B88A 3CABA 1XFRA 2P70A 3R1OA 3D77A 3Q8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCL A;  2WCM A;  1T14 A;  1OOH A;  3D73 A;  2WCJ A;  2QEO A;  3DYE A;  3CDN A;  3BFA A;  3OGN A;  3VB1 A;  3L47 A;  2L2C A;  3FE9 A;  1P28 A;  3S0A A;  4OZD A;  3B7A A;  5DIC A;  3L4L A;  2H8V A;  3D74 A;  3S0E A;  5EL2 A;  3CZ1 A;  2WCH A;  3N7H A;  3RZS A;  4PT1 A;  3D78 A;  1TWO A;  1OOG A;  1ORG A;  3BFB A;  1C3Y A;  3NHT A;  3CYZ A;  4JD9 A;  3R1P A;  3V2L A;  3S0D A;  3BFH A;  2GTE A;  3DXL A;  2JPO A;  2P71 A;  1OOI X;  3S0G A;  2ERB A;  3CZ0 A;  3FE6 A;  3S0B A;  1OW4 A;  1OOF A;  2PQL A;  2WCK A;  4INX A;  3FE8 A;  1QWV A;  3DZT A;  2QEH A;  3D76 A;  4INW A;  3S0F A;  1C3Z A;  2WC5 A;  3NGV A;  3L4A A;  4F7F A;  2FJY A;  3CZ2 A;  3R1V A;  4FQT A;  2KPH A;  3QME A;  3PJI A;  3R72 A;  3B87 A;  3DY9 A;  3NHI A;  2QEV A;  2QDI A;  2QEB A;  2WC6 A;  3BJH A;  1DQE A;  1TUJ A;  3B86 A;  1LS8 A;  1GM0 A;  3B6X A;  3K1E A;  3D75 A;  3B88 A;  3CAB A;  1XFR A;  2P70 A;  3R1O A;  3D77 A;  3Q8I A; 
#chains in the Genus database with same CATH topology
 5I2O A;  2KI4 B;  1XFV O;  2MHH A;  2JQ6 A;  1DEK A;  1ALW A;  2JXC A;  4N5X A;  3MSE B;  2HET A;  1TOP A;  4QJ4 B;  2WCJ A;  5CPV A;  1QX2 A;  1ZAC A;  1B9A A;  2ZN9 A;  1YTZ C;  4DUQ A;  1S36 A;  2KSP A;  3OGN A;  3L47 A;  3SJS A;  3GOF A;  3VB1 A;  1MQ1 A;  2KQY A;  1EG3 A;  4ORA B;  1ZOT B;  3FE9 A;  1KSM A;  2AUC A;  2LLT A;  2M29 A;  2H2K A;  1TCO B;  1B7T Y;  3B7A A;  1QAS A;  1CLB A;  3CS1 A;  2H8V A;  1S1E A;  1QLS A;  3CR5 X;  1OZS A;  1BJF A;  3S0E A;  4DCK A;  3N7H A;  3SG7 A;  2JZI A;  1SW8 A;  3D78 A;  4FTG A;  2JXL A;  1DJX A;  3BFB A;  1C3Y A;  4PE1 A;  4A4C A;  4ZCV A;  4JD9 A;  3F45 A;  1DJY A;  2M1U A;  2K0J A;  4OR9 B;  2OS8 B;  2WCF A;  1HT9 A;  3DF0 A;  4C0L A;  1UHI A;  1S26 D;  3JTD C;  3BOW A;  1ODB A;  3DXL A;  3ZWH A;  1MXE A;  4F0Z B;  3HCM A;  2HQ8 A;  1CM1 A;  1B1G A;  3OX5 A;  1L2O C;  1RWY A;  3DF0 B;  4C0J A;  3SG5 A;  3DD4 A;  1PK0 D;  3I5G C;  3IF7 A;  1A29 A;  3BUW B;  3FE6 A;  1KFX S;  1OZO A;  1QS7 A;  2BAP A;  1XO5 A;  2LUC A;  3D0Y A;  2OTG C;  2ZN8 A;  3RLZ A;  1C7W A;  1DVI A;  3VGO A;  2E6W A;  4BY5 A;  5AER A;  2K7D A;  3NSL A;  3UNW A;  3BUX B;  3D0Y B;  5I94 A;  1MHO A;  1SCM B;  1CKK A;  2JT0 A;  1S6C A;  2MA2 A;  1NYA A;  4GFT A;  1DEL A;  4I5L B;  3I5F C;  3NSI A;  1SL7 A;  1SKT A;  1YVH A;  1GGW A;  2LLS A;  1JWD A;  1SR6 B;  1W7I B;  3L4A A;  3LL8 B;  2M8U A;  4GGF C;  1JFJ A;  3OBV A;  3CZT X;  4NDC A;  2BCX A;  2WCE A;  4WQ2 A;  1CDM A;  3I5I B;  1IIO A;  4MRY A;  3GK2 A;  1A75 A;  3JVT B;  4E68 A;  2O5G A;  2SCP A;  1K90 D;  3A4U B;  1MXL C;  3BUN B;  5HYD A;  2H61 C;  3EVR A;  5ER5 A;  1XYD A;  2WCB A;  1J7Q A;  1Z4H A;  3B87 A;  1UHK A;  3IQQ A;  2A4J A;  1EH2 A;  1F70 A;  2MLE C;  1KCY A;  3DY9 A;  1CFD A;  5FI2 A;  2JNX A;  2JTZ A;  1A75 B;  3O6B A;  5I8N A;  3SS5 A;  1IH0 A;  1EG4 A;  2QDI A;  1KFU L;  1HQV A;  1Y6W A;  2ZRS A;  4JQ0 D;  2QEB A;  4DRW A;  2ZFD A;  1X02 A;  3TZ1 A;  3LK0 A;  1BG1 A;  2KFF A;  1WDC C;  1XFY O;  3DVM A;  3KEV A;  4HRH A;  5JJG A;  2BCA A;  1DQE A;  3B86 A;  3PFV A;  2SAS A;  4GNK B;  1UHN A;  1YR5 A;  1NIW A;  2KFH A;  4ICB A;  4I5K A;  5I2L A;  2KQ6 A;  2LLU A;  1FI6 A;  1DC1 A;  3D75 A;  1QIW A;  1XFR A;  1KK7 Z;  2P70 A;  5FI7 A;  2M7N A;  3R1O A;  2Q4U A;  2L5Y A;  2Q91 A;  3PSR A;  1H4B A;  3D77 A;  1CNP A;  1L7Z A;  4AQJ A;  1QVI Y;  1OOH A;  3FS7 A;  4YGE B;  4D1E A;  4HRE E;  2KOT A;  1K9U A;  2L50 A;  2NLN A;  2M0R A;  2Y4Q A;  3KO0 A;  1NX1 A;  4M2Q A;  4NDD A;  1BOD A;  1KWO C;  2JWW A;  3CDN A;  3KHE A;  5DKN A;  2BKI B;  2KGB C;  1MR8 A;  2P6B B;  2ZKM X;  3D10 A;  1P28 A;  2LNK A;  3L4L A;  1YUU A;  1OMR A;  2LVJ A;  2LHL A;  2NCO A;  2RGI A;  1UP5 A;  3NXA A;  1NCY A;  4WQ3 A;  2DOQ A;  2CNP A;  4MN0 A;  1ZFS A;  1RJV A;  1FW4 A;  1TWO A;  1SMG A;  5ER4 X;  3VRP A;  1ORG A;  1S6I A;  2I18 A;  1K8U A;  3NHT A;  4IJ7 A;  3SG2 A;  4PHJ A;  3WHT B;  2K60 A;  1LIN A;  2ZND A;  4KYN A;  5IBW A;  1E8A A;  1KFX L;  2I7A A;  1RFJ A;  1NX2 A;  4BY4 A;  4PAL A;  3VRN A;  1WLM A;  4FQO A;  1AJ4 A;  3LLE A;  4YRU A;  1IWQ A;  4CID A;  2BNX A;  2KI4 C;  1W7J B;  3EK4 A;  4P5O E;  3GK4 X;  3QRX A;  4YGA A;  3VRR A;  2EC6 C;  2LMT A;  5GQQ C;  2K8M B;  5KTY A;  4XJK A;  1A4P A;  1CLM A;  1DT7 B;  2WOS A;  2JTT A;  3HX4 A;  3I5H B;  1OW4 A;  2PQL A;  3OHM B;  5CSI A;  3ICB A;  1PUL A;  1NX0 A;  1IQ5 A;  1PSB A;  1SSE B;  2MAZ A;  4CPV A;  2WCK A;  2KYC A;  4PE7 A;  4XJK B;  3TS5 B;  1WRL A;  1DMO A;  3SG6 A;  2LMV A;  4YI9 A;  1QWV A;  1S5G Z;  2JT3 A;  4PE0 A;  2KLE A;  3PN7 B;  1QJT A;  4MZL A;  1J7P A;  2Y5I A;  1BLQ A;  1TN4 A;  1IQ3 A;  3GK1 A;  2BKH B;  4CFQ A;  3D76 A;  4INW A;  4MZJ A;  2LAP A;  2LC5 A;  1LKJ A;  3CR2 A;  1CLL A;  1YUR A;  1C3Z A;  2ZRT A;  1CM4 A;  1BU3 A;  1J55 A;  1M46 A;  2LM5 A;  2LVV A;  3NGV A;  3SS4 A;  2K2F A;  1F8H A;  4PHK A;  1CDP A;  1OE9 B;  4JPZ B;  2OS8 C;  4F7F A;  1PRW A;  1AP4 A;  1RRO A;  1K94 A;  2L51 A;  3EKJ A;  1IGV A;  2CCM A;  1B4C A;  3JTD B;  1BMO A;  4FQT A;  4PHN A;  2KLD A;  2KPH A;  2HF5 A;  1Y0V H;  2KAV A;  3PJI A;  3A8R A;  4M2P A;  4QJ3 B;  5D7F A;  1PVB A;  2M3W A;  1AK8 A;  1F55 A;  1JF2 A;  4C0K A;  1JBA A;  3EKH A;  2V53 A;  2QEV A;  1BR4 B;  1QLK A;  2LMU A;  3CGA A;  1GJY A;  2D8N A;  1R6P A;  1XK4 A;  2KYF A;  5AAN A;  1LA0 A;  3EVU A;  4HRG A;  2F3Z A;  1SCM C;  1G8I A;  2LVK A;  1S3P A;  1UUR A;  1V1G A;  4AQI A;  5JOL A;  3B6X A;  3O4X A;  2LAN A;  5AEQ A;  3VRQ A;  1OMD A;  3B88 A;  2BEC A;  3CAB A;  1NP8 A;  2MLF C;  4OVN F;  2PRU A;  4CLN A;  3I5F B;  3S0F A;  3Q8I A;  1TTX A;  1Q80 A;  1REC A;  2LV7 A;  1SR6 C;  2LP3 A;  1XK4 C;  2WCL A;  2WCM A;  2KNE A;  4P2Y B;  3D73 A;  2EGD A;  1DJW A;  1TNX A;  4L9M A;  1KK7 Y;  2Y1M A;  4GAO A;  3TDI A;  3I5I C;  1FPW A;  1XA5 A;  3FIA A;  1XFW O;  2KI6 D;  4PHM A;  3JVT C;  5BPJ A;  1NUB A;  3OP0 A;  3CR4 X;  2ISD A;  4R1E A;  1SL9 A;  2BE4 A;  1B8L A;  2PAL A;  1J1E A;  1BF5 A;  1AHR A;  3KPX A;  2Y1N A;  3BQ3 A;  1OSA A;  4OZD A;  1QV1 A;  3RM1 A;  1FI5 A;  5DIC A;  3TDU A;  3D74 A;  1CTR A;  2LE9 B;  1MUX A;  2AMI A;  4MEW A;  4UPG A;  1C07 A;  2NZ0 A;  5PAL A;  4CFR A;  1YUT A;  1M39 A;  3SG3 A;  2YGU A;  2M7L A;  4M2O A;  1LVC D;  1CMF A;  2LHI A;  2NCP A;  1M63 B;  3S0D A;  1B8C A;  1OOJ A;  1TUZ A;  2BBM A;  4GUK A;  1FF1 A;  2BL0 B;  4JKT A;  3BFH A;  1SYM A;  2EHB A;  3OB1 B;  1NPQ A;  1K9K A;  3OX6 A;  3PAL A;  1TCF A;  2F8P A;  2L0P A;  2GV5 A;  4N1G A;  1OOI X;  3S0G A;  2F2P A;  3TUY C;  1KQM B;  4PCW A;  3EK7 A;  2ERB A;  3O2P A;  3O4Y A;  1WRZ A;  2F33 A;  2BCB A;  2JT8 A;  3CZ0 A;  3EVV A;  5I2Q A;  3S0B A;  1XVJ A;  2COL B;  1OOF A;  3LCP C;  1D1O A;  4WRI A;  5HLV A;  1KWO B;  1QTX A;  1OQP A;  3VRO A;  1LA3 A;  1DJI A;  1NX3 A;  1KK8 B;  1SBJ A;  4INX A;  2QAC A;  5FYX A;  4HSZ A;  1BOC A;  2KAX A;  1SK6 D;  4MVF A;  4YGC B;  2JNF A;  1CFC A;  1F71 A;  5KSZ A;  2BE6 A;  1DGU A;  2LP2 A;  1WY9 A;  3DVJ A;  1A2X A;  5B8I B;  2QEH A;  1JSA A;  3DVK A;  1EL4 A;  2LVI A;  3AKB A;  2F3Y A;  3WXA A;  4JWQ A;  3SS3 A;  2I94 A;  1S5G Y;  1J7O A;  4YI8 A;  3FWB A;  1UHJ A;  1QX5 B;  2JU0 A;  1YX7 A;  4GGN A;  4MRX A;  3KF9 A;  2L2E A;  2JRF A;  1QV0 A;  3CLN A;  5FI6 A;  1G4Y R;  1A03 A;  1F54 A;  2ZNE A;  1PSR A;  1KFU S;  2R2I A;  2OPO A;  1M31 A;  1FBV A;  2HQW A;  1F4O A;  2KBI A;  2L4I A;  2LUX A;  4DS7 A;  3R1V A;  3DVE A;  5HKY A;  4OV2 A;  4YGB B;  5AFP A;  5DKR A;  5HKW A;  3QME A;  2MBX A;  3H4S E;  1W9Z A;  2M9G A;  1CDL A;  3R72 A;  5HL1 A;  2EC6 B;  2FCD A;  2KHN A;  3I5H C;  1UHH A;  1GQM A;  1B47 A;  1SPY A;  3UO9 A;  1NCX A;  2B1U A;  2IS9 A;  1QIV A;  3PM8 A;  4MZK A;  1IKU A;  4I5J A;  1M45 A;  2WC6 A;  1TNP A;  3TS5 C;  2M1K B;  1KSO A;  1DF0 A;  1TIZ A;  2CTN A;  1TUJ A;  1RTP 1;  5D69 A;  2M49 B;  3PN7 C;  5K89 A;  1GM0 A;  3K1E A;  1B8R A;  2KGR A;  3WNX B;  3LK1 A;  1BT6 A;  1U5I A;  1DF0 B;  1LXF C;  3BXK A;  2JC2 A;  4XYN A;  1QAT A;  5CSJ A;  2GGM A;  1NWD A;  4A4B A;  1IG5 A;  1F4Q A;  1T14 A;  1H8B A;  1U5I B;  1XFU O;  1L2O B;  3PLF B;  1R2U A;  2QEO A;  1CMG A;  3I5G B;  4GBA A;  3DYE A;  5KU1 A;  1B7T Z;  3NSO A;  1JC2 A;  2OTG B;  1AJ5 A;  4QJ5 B;  3BFA A;  2O60 A;  2L2C A;  2LCP A;  4AOM A;  1CFF A;  1V1F A;  2QPT A;  5F6T A;  3S0A A;  4MLW A;  3BOW B;  3TDZ A;  3BUO B;  1C7V A;  1MWN A;  2JPT A;  2K2A A;  1UUS A;  3CWG A;  5EL2 A;  3CZ1 A;  3SIA A;  2WCH A;  3RZS A;  3PM2 A;  1IJ5 A;  2K7O A;  4PT1 A;  1SRA A;  4GGF A;  1Y1A A;  4U8D A;  1KQV A;  1ZMZ A;  2CBL A;  2L4H A;  1OOG A;  3AAK A;  1J1D A;  2CXJ A;  2KI6 C;  3CYZ A;  1ZUZ A;  2K61 A;  1K95 A;  2MRD A;  3R1P A;  3V2L A;  3WHU B;  3ZNI A;  3SG4 A;  3E3R A;  3EG5 B;  2NXQ A;  4MSP A;  2K7C A;  5J3X A;  4ETO A;  2H61 A;  4I5N B;  4NDB A;  2GTE A;  1PVA A;  1CDN A;  3FWC A;  1TRF A;  1NSH A;  2JPO A;  2P71 A;  1J7R A;  1G33 A;  1JF0 A;  1N65 A;  4DIR A;  5HLO A;  1UWO A;  3BUM B;  4MBE A;  3AKA A;  2KDH A;  3IVT A;  4PE4 A;  1K9P A;  3K21 A;  5G08 A;  2K7B A;  1Z2C B;  1SNL A;  2KFG A;  2M97 A;  1YRT B;  1DJZ A;  2G9B A;  3FE8 A;  4ZCU A;  1WDC B;  5AXI A;  3PAT A;  1JFK A;  2FCE A;  2FOT A;  2G2B A;  1WRK A;  2I2R E;  3DZT A;  1CFP A;  1BR1 B;  1DJH A;  1YVL A;  3C1V A;  5CSF A;  2F2O A;  2PMY A;  2L98 A;  1PAL A;  1YRU B;  4PDZ A;  1YX8 A;  2VRG A;  4Q04 A;  1S6J A;  4YBH B;  1VRK A;  2WC5 A;  4TNC A;  1DGV A;  2WC8 A;  2TN4 A;  2FJU B;  3NSK A;  4ORC B;  3AAJ A;  3M0W A;  2BL0 C;  1Y1U A;  4IL1 A;  4YGD B;  1TNW A;  3EK8 A;  1Y1X A;  1DTL A;  2FJY A;  3CZ2 A;  5CSN A;  1DJG A;  1ALV A;  1K93 D;  1MF8 B;  1EXR A;  1AVS A;  1IRJ A;  3O78 A;  2WND A;  4N1F A;  5HKZ A;  2BBN A;  1KQM C;  4OKH A;  3TUY B;  2PVB A;  2KBM A;  5DKQ A;  3OB2 B;  2E30 A;  1JUO A;  1EJ3 A;  2HPS A;  1SY9 A;  3NHI A;  3IQO A;  4NQG A;  2PAS A;  4USL A;  1RK9 A;  1AUI B;  3SIB A;  1GGZ A;  1SL8 A;  1CB1 A;  4GPL B;  2L5X B;  1YUS A;  1XFZ O;  1KK8 C;  2JUL A;  5D3O A;  3BJH A;  5TNC A;  2KAY A;  1N2D A;  2PYQ A;  1LS8 A;  4OCI A;  1QX7 A;  2PSR A;  1XFX O;  2CT9 A;  1SCV A;  2MJW B;  3BYA A;  1OMV A;  1QXP A;  2AAO A;  2JOJ A;  2WOR A;  2GGZ A;  1IJ6 A;  1QVI Z;  4ORB B;  3CTN A;  1K96 A;  1NCZ A;  1N0Y A;  1TNQ A;  1WLZ A;  1K2H A; 
#chains in the Genus database with same CATH homology
 2WCL A;  2WCM A;  1T14 A;  1OOH A;  3D73 A;  2WCJ A;  2QEO A;  3DYE A;  3CDN A;  3BFA A;  3OGN A;  3VB1 A;  3L47 A;  2L2C A;  3FE9 A;  1P28 A;  3S0A A;  4OZD A;  3B7A A;  5DIC A;  3L4L A;  2H8V A;  3D74 A;  3S0E A;  5EL2 A;  3CZ1 A;  2WCH A;  3N7H A;  3RZS A;  4PT1 A;  3D78 A;  1TWO A;  1OOG A;  1ORG A;  3BFB A;  1C3Y A;  3NHT A;  3CYZ A;  4JD9 A;  3R1P A;  3V2L A;  3S0D A;  3BFH A;  2GTE A;  3DXL A;  2JPO A;  2P71 A;  1OOI X;  3S0G A;  2ERB A;  3CZ0 A;  3FE6 A;  3S0B A;  1OW4 A;  1OOF A;  2PQL A;  2WCK A;  4INX A;  3FE8 A;  1QWV A;  3DZT A;  2QEH A;  3D76 A;  4INW A;  3S0F A;  1C3Z A;  2WC5 A;  3NGV A;  3L4A A;  4F7F A;  2FJY A;  3CZ2 A;  3R1V A;  4FQT A;  2KPH A;  3QME A;  3PJI A;  3R72 A;  3B87 A;  3DY9 A;  3NHI A;  2QEV A;  2QDI A;  2QEB A;  2WC6 A;  3BJH A;  1DQE A;  1TUJ A;  3B86 A;  1LS8 A;  1GM0 A;  3B6X A;  3K1E A;  3D75 A;  3B88 A;  3CAB A;  1XFR A;  2P70 A;  3R1O A;  3D77 A;  3Q8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...