1YUTA

Solution structure of calcium-s100a13 (minimized mean structure)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium-binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 38
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yutA00
4PHJA 1WY9A 1N2DA 1LXFC 2WCFA 1NP8A 2ZNDA 2JWWA 3SJSA 3GOFA 2FCDA 1CLBA 3DVMA 2JPTA 1S1EA 5KSZA 1ALWA 1YVHA 3KPXA 5ER5A 3EK8A 1QV1A 1YR5A 2ZKMX 3ICBA 4M2QA 2Y1MA 4PALA 2NCOA 3O78A 1KWOC 4N1FA 2HQ8A 1EG4A 1K93D 2CCMA 3OP0A 2COLB 1QATA 1FBVA 2LE9B 1XFXO 1EJ3A 2MBXA 1ODBA 4HRHA 1KQVA 3D0YB 1YX8A 1DJYA 1ZUZA 1TRFA 4PHKA 4WQ2A 1PSRA 2L2EA 1RWYA 4QJ4B 2JC2A 2K7DA 2PALA 1QTXA 1B8LA 5I8NA 2M0RA 2BKHB 5KTYA 1KSMA 4OR9B 3AAJA 3TS5C 1A2XA 4NDCA 2FOTA 1YX7A 1D1OA 2M7NA 4CFQA 1DJIA 2FJUB 1CM4A 1Y1AA 2KQYA 1MF8B 1TN4A 3VGOA 3AAKA 1M31A 3CZTX 3FWCA 4YI9A 4WRIA 1JC2A 2LLTA 2K2AA 3OHMB 4XYNA 2OS8B 3BUXB 2BCBA 3DVKA 2KAYA 4QJ3B 3NSLA 4YRUA 5B8IB 2M3WA 2K7CA 3PATA 4YGAA 1DJGA 1S6IA 2Y4QA 3EK4A 1JWDA 1E8AA 2KI4C 1BOCA 2BL0C 1CM1A 2QACA 1KK8C 1QJTA 4GGFC 3TUYB 1S3PA 3TZ1A 1IQ3A 3TDZA 2EC6B 5HLOA 2I94A 2Q91A 1TIZA 1DVIA 3OB1B 4BY5A 2JZIA 2KBMA 2M7LA 1B8CA 2KFFA 3I5FB 4GAOA 5CPVA 3DF0A 2BKIB 2GGMA 3AKAA 3KF9A 1GQMA 2LVIA 4PHMA 1KFXL 1PVAA 3WNXB 2KOTA 4U8DA 1CNPA 3MSEB 1AJ5A 1QX2A 1B8RA 1IH0A 2JRFA 4MZKA 2Y5IA 2EHBA 1EXRA 3TDIA 4CIDA 2WORA 4PE0A 1NCYA 1PVBA 4R1EA 4GBAA 4A4BA 1A75A 5HKYA 1F55A 2F3ZA 3JVTC 4MLWA 3E3RA 2JTZA 1G4YR 2OTGC 1W7IB 5AANA 3GK2A 1NUBA 3O4YA 4OCIA 1NCXA 1SW8A 3I5GC 4ICBA 1FPWA 1CMFA 1YTZC 1LKJA 4TNCA 1KCYA 2MHHA 4MBEA 3I5HC 5IBWA 2L0PA 4ZCVA 1SR6B 1UHJA 1YUTA 4FQOA 1KFXS 1WLZA 4I5LB 2CNPA 4D1EA 1XO5A 2MLFC 2H61A 3BQ3A 3SG5A 2LM5A 3NXAA 4GUKA 5JOLA 1WRLA 3NSKA 1DJZA 2LANA 2LAPA 3GK4X 5I2LA 1XFVO 1SK6D 1OZOA 2FCEA 3BOWA 1DTLA 1J7RA 1Y6WA 2KFHA 1DF0A 2WOSA 3OB2B 2ZN8A 1L2OC 2VRGA 1HT9A 1IWQA 1DGVA 1S36A 1CTRA 2E30A 3QRXA 5G08A 5CSFA 2HF5A 3RLZA 1J7PA 4PHNA 1S5GY 1KQMC 3HX4A 1GJYA 4NDDA 1KFUL 2KDHA 3BOWB 1JF2A 2KFGA 1Y1UA 4C0LA 4YGCB 2MAZA 5AXIA 1M46A 2BBNA 3SG7A 2G9BA 4CLNA 3CLNA 4IL1A 1NX1A 1MUXA 2RGIA 1OZSA 1U5IA 2LMUA 3K21A 1F4QA 2E6WA 2KAXA 1AJ4A 3NSIA 4MN0A 4MSPA 5DKRA 1JF0A 1J7OA 1H8BA 2L50A 2F8PA 4GGFA 2I18A 4FTGA 3PM8A 2IS9A 2LLUA 4ORAB 2BCAA 1CB1A 1AVSA 1RROA 4AQJA 2BBMA 1CDMA 1K9PA 2LLSA 2KNEA 4F0ZB 1UHIA 4MZJA 4ZCUA 1ZOTB 1CDPA 1A4PA 3FIAA 3FS7A 1MXEA 1RECA 4PE1A 1U5IB 5TNCA 1KFUS 2KGRA 1K8UA 3LCPC 2K61A 4YGBB 1OE9B 1JBAA 1BU3A 1SMGA 1B4CA 3SIAA 1CFDA 1S26D 2DOQA 1DJWA 4JQ0D 1SYMA 3O6BA 1LVCD 3F45A 2B1UA 2M29A 3BYAA 3ZWHA 1CFCA 2LNKA 2MRDA 2TN4A 1J7QA 2JXCA 2JTTA 1B47A 3C1VA 4XJKA 3BUNB 1N0YA 2CT9A 1LA0A 5PALA 1OQPA 1V1FA 2K7BA 2NXQA 1C7WA 1K9UA 1WRZA 1CMGA 1IQ5A 1G33A 3NSOA 1WRKA 1SBJA 2I7AA 3PN7B 5I2QA 1CKKA 1IG5A 4YGEB 1IKUA 1C07A 1C7VA 3CTNA 1QVIZ 1YUSA 1IGVA 1RK9A 3VRRA 1CLLA 1XYDA 2PSRA 5FYXA 4NDBA 1OSAA 4DCKA 1RTP1 4PDZA 1JUOA 5DKNA 5K89A 4MZLA 4MRYA 2GGZA 4PE7A 2LHIA 1X02A 3PFVA 3I5IB 3H4SE 3KEVA 2ZRSA 4E68A 4P5OE 1A03A 1OOJA 1MR8A 2KQ6A 2Q4UA 4M2OA 1BODA 4OVNF 4YBHB 4L9MA 3KHEA 3CR5X 3RM1A 1IJ5A 3LK1A 1S6CA 1XK4C 1UHNA 1SNLA 1SL9A 2OS8C 2R2IA 1WDCB 3BXKA 3DF0B 3LL8B 4MVFA 2WCBA 1TNWA 2Y1NA 3DD4A 4CPVA 1K96A 5HLVA 1BG1A 3TUYC 1SCMB 5AFPA 2EC6C 1SPYA 4DIRA 1A29A 1SY9A 4GGNA 1NCZA 3KO0A 1JFKA 3SG4A 1NSHA 2GV5A 4GNKB 1ZFSA 1RFJA 2JNXA 3I5FC 1IJ6A 1NX3A 3EVUA 2KBIA 1A75B 4Q04A 2JOJA 4P2YB 3JTDB 1FF1A 1AHRA 2K7OA 4A4CA 1KK7Z 1QLSA 1NPQA 1RJVA 1UP5A 2MJWB 4YGDB 2L51A 3SG6A 3VRNA 1N65A 3VROA 2G2BA 1W7JB 5GQQC 1NWDA 1GGWA 5CSNA 5I2OA 2V53A 5J3XA 1XFZO 1QS7A 1SRAA 2JXLA 3CR4X 3EVRA 1S6JA 1J1EA 3OX6A 1CLMA 2LUCA 3DVEA 3IF7A 3TDUA 1FW4A 1KWOB 1M45A 1XA5A 3WHTB 2MA2A 1NYAA 2KI6D 2PASA 4BY4A 1UUSA 4I5JA 2LP2A 1TNXA 5ER4X 1CFFA 1G8IA 1SR6C 1UWOA 2JT0A 4HRGA 1AUIB 3PSRA 1UHHA 4I5NB 4MEWA 3FWBA 1DF0B 1QLKA 4AOMA 1JFJA 1DJHA 3CR2A 2KSPA 1L7ZA 2LVKA 4QJ5B 3TS5B 5KU1A 2A4JA 2M1UA 3LLEA 4GPLB 3SG3A 2WNDA 3D0YA 5AERA 1JSAA 1YURA 2LMTA 2KYCA 2CBLA 1XVJA 1V1GA 4WQ3A 1ZMZA 5JJGA 2ZN9A 1BR4B 1R2UA 2K0JA 3EVVA 3VRPA 4HSZA 1DJXA 4NQGA 2I2RE 1QX5B 2H61C 1F4OA 3EK7A 5D69A 1R6PA 1PRWA 4I5KA 4C0JA 2JT8A 1F70A 2SASA 4PCWA 3CGAA 2JNFA 2LV7A 1PULA 2KI4B 2CTNA 2BL0B 3SG2A 1KK8B 5CSJA 1NX0A 5BPJA 3PALA 2O60A 2M49B 1QV0A 4ORCB 1QASA 3DVJA 2BE4A 1IRJA 3HCMA 3AKBA 3EKJA 3CWGA 4USLA 1SL7A 3WHUB 1XK4A 1YRUB 2JU0A 2PRUA 2D8NA 1CDNA 1J1DA 2H2KA 1MHOA 2LUXA 4JWQA 2ZNEA 2PVBA 1K90D 3GK1A 4DUQA 3VRQA 2WCEA 4N1GA 1LINA 2LMVA 1YVLA 2ISDA 3IQOA 1ZACA 2KYFA 1PK0D 1CDLA 2M8UA 2SCPA 4MRXA 3OX5A 1B7TZ 1YRTB 2CXJA 2JULA 1DMOA 2QPTA 1XFWO 1VRKA 3JVTB 1AK8A 1B9AA 2NZ0A 2LP3A 2P6BB 2M1KB 1DGUA 2M97A 2OTGB 1BJFA 3CS1A 5DKQA 2K2FA 1QIWA 4XJKB 1K2HA 1BR1B 2AAOA 2EGDA 2LCPA 3I5GB 2F2OA 2F3YA 1H4BA 3PLFB 1M39A 3I5HB 3WXAA 2LC5A 2LHLA 5HKWA 1OMDA 3SIBA 2HETA 2MLEC 1XFYO 1Y1XA 3BUWB 1PSBA 5D7FA 2L4IA 2PMYA 1MXLC 2AUCA 1AP4A 1Y0VH 1TNQA 1TCOB 2LVVA 1K95A 2BCXA 2JT3A 1FI6A 2BE6A 2BECA 5AEQA 1XFUO 2L5XB 1NX2A 3EKHA 1B7TY 2OPOA 1UURA 3PN7C 4N5XA 1DT7B 1QVIY 2JQ6A 1OMRA 3M0WA 1BF5A 1BLQA 1L2OB 1F8HA 1FI5A 1EL4A 2NLNA 2KHNA 2O5GA 1BT6A 4DRWA 1GGZA 4ORBB 1PALA 3BUMB 3LK0A 1TNPA 3ZNIA 5F6TA 1OMVA 1ALVA 3A8RA 1TTXA 1QXPA 3I5IC 1UHKA 1YUUA 3BUOB 1KQMB 4JPZB 3IQQA 4ETOA 1S5GZ 1SL8A 4OKHA 1MQ1A 1LA3A 2WC8A 1F71A 2ZFDA 1MWNA 3O2PA 1WDCC 1K94A 1TOPA 3D10A 1M63B 4CFRA 4DS7A 1B1GA 4OV2A 4M2PA 4AQIA 1HQVA 2HQWA 1CFPA 1TCFA 1F54A 3A4UB 2HPSA 1SCMC 2K8MB 2F2PA 2F33A 2NCPA 2L98A 1J55A 2M9GA 4GFTA 4PE4A 1K9KA 4YI8A 5CSIA 1QX7A 1KSOA 5HYDA 4UPGA 2KGBC 1NIWA 5HKZA 1KK7Y 1Q80A 4HREE 1SKTA 4C0KA 3JTDC 1WLMA 1EH2A 2KI6C 2LVJA 1BMOA 1SCVA 2AMIA 2L4HA 1EG3A 2ZRTA 1QIVA 2KAVA
chains in the Genus database with same CATH superfamily
4PHJA 1WY9A 2KPHA 1N2DA 1ORGA 1LXFC 2WCFA 1NP8A 2ZNDA 2JWWA 3SJSA 3N7HA 3GOFA 2FCDA 1CLBA 3DVMA 2JPTA 1S1EA 5KSZA 3S0FA 1ALWA 1YVHA 3KPXA 5ER5A 3EK8A 1QV1A 1YR5A 2ZKMX 3ICBA 4M2QA 2Y1MA 4PALA 2NCOA 3O78A 1KWOC 4N1FA 2HQ8A 1EG4A 1K93D 2CCMA 3OP0A 3SS3A 2COLB 1QATA 1FBVA 2LE9B 1XFXO 1EJ3A 3CZ2A 2MBXA 1ODBA 4HRHA 1KQVA 3D0YB 1YX8A 1DJYA 1ZUZA 1TRFA 4F7FA 4PHKA 4WQ2A 1PSRA 2PQLA 3L4LA 2L2EA 1RWYA 4QJ4B 2JC2A 2K7DA 2PALA 1QTXA 1B8LA 5I8NA 2M0RA 2BKHB 5KTYA 1KSMA 4OR9B 3AAJA 3TS5C 3FE9A 1A2XA 4NDCA 2FOTA 1YX7A 1D1OA 2M7NA 5HL1A 4CFQA 1DJIA 2FJUB 3O4XA 1XFRA 1CM4A 1Y1AA 2KQYA 3D73A 2QEHA 1MF8B 1TN4A 3SS5A 3UO9A 2WCHA 3VGOA 3AAKA 1M31A 3CZTX 3FWCA 4YI9A 4WRIA 1JC2A 2LLTA 2K2AA 3OGNA 1TWOA 3CDNA 3OHMB 4XYNA 2OS8B 3BUXB 2BCBA 3DVKA 2KAYA 4QJ3B 3NSLA 4YRUA 5B8IB 2M3WA 2K7CA 3PATA 4YGAA 1DJGA 1S6IA 2Y4QA 3EK4A 1JWDA 1E8AA 2KI4C 1BOCA 2BL0C 1CM1A 1SSEB 1KK8C 1QJTA 2QACA 4GGFC 1S3PA 3TUYB 3TZ1A 3TDZA 1IQ3A 2EC6B 5HLOA 2I94A 2Q91A 4FQTA 1TIZA 1DVIA 3OB1B 4BY5A 2JZIA 2KBMA 3R1VA 2M7LA 1B8CA 2KFFA 3I5FB 4GAOA 5CPVA 3QMEA 3DF0A 2BKIB 2GGMA 3AKAA 3KF9A 1GQMA 2LVIA 4PHMA 1KFXL 1PVAA 3WNXB 2KOTA 4U8DA 1CNPA 3MSEB 2WCLA 1AJ5A 1OOHA 1QX2A 1B8RA 1Z2CB 1IH0A 3IVTA 2JRFA 3PM2A 4MZKA 2Y5IA 2EHBA 1EXRA 3TDIA 4CIDA 2WORA 4PE0A 1NCYA 1PVBA 4R1EA 4GBAA 4A4BA 1A75A 5HKYA 1F55A 2F3ZA 2K60A 3JVTC 4MLWA 3E3RA 2JTZA 1G4YR 2OTGC 1W7IB 5AANA 3GK2A 1NUBA 3O4YA 4OCIA 1NCXA 1SW8A 3I5GC 4ICBA 1FPWA 1CMFA 1C3YA 1YTZC 1LKJA 4TNCA 1KCYA 2MHHA 4MBEA 3I5HC 3PJIA 5IBWA 2L0PA 4ZCVA 1SR6B 1UHJA 1YUTA 4FQOA 1KFXS 1WLZA 4I5LB 2CNPA 4D1EA 1OW4A 1T14A 1XO5A 2MLFC 2H61A 3BQ3A 3SG5A 2LM5A 3NXAA 4GUKA 5EL2A 5JOLA 1WRLA 3NSKA 1DJZA 2LANA 2LAPA 3GK4X 5I2LA 1XFVO 1SK6D 1DEKA 1OZOA 2FCEA 3BOWA 1DTLA 1J7RA 1Y6WA 2KFHA 1DF0A 2WOSA 3OB2B 2ZN8A 1L2OC 3CYZA 1OOFA 2VRGA 1HT9A 1IWQA 1DGVA 1S36A 1CTRA 2E30A 1GM0A 3QRXA 5G08A 5CSFA 3EG5B 2HF5A 3RLZA 2PYQA 1J7PA 4PHNA 1S5GY 1KQMC 2WC6A 3HX4A 1GJYA 4NDDA 1KFUL 3Q8IA 2KDHA 3BOWB 1JF2A 2KFGA 1Y1UA 3FE8A 2L5YA 4YGCB 4C0LA 2MAZA 5AXIA 1M46A 2BBNA 2JPOA 2G9BA 3SG7A 3CLNA 4CLNA 4IL1A 1NX1A 1MUXA 2RGIA 3L4AA 1OZSA 1U5IA 2LMUA 3K21A 1F4QA 2E6WA 2KAXA 1AJ4A 3NSIA 4MN0A 4MSPA 5DKRA 1JF0A 1J7OA 3BFAA 3BFBA 1H8BA 2L50A 2F8PA 4INXA 4GGFA 2I18A 4FTGA 3PM8A 2IS9A 2LLUA 4ORAB 2BCAA 1CB1A 1AVSA 1RROA 4AQJA 3B87A 2BBMA 1CDMA 1K9PA 2LLSA 2KNEA 4F0ZB 1UHIA 4MZJA 4ZCUA 1ZOTB 3S0GA 1CDPA 1A4PA 3FIAA 3FS7A 1MXEA 1RECA 4PE1A 1U5IB 5TNCA 1KFUS 2KGRA 1K8UA 3LCPC 2K61A 4YGBB 1OE9B 3R72A 3K1EA 1JBAA 1BU3A 1SMGA 1B4CA 3SIAA 1CFDA 1S26D 1W9ZA 2DOQA 1DJWA 4JQ0D 3UNWA 1SYMA 3O6BA 1LVCD 3F45A 2B1UA 2M29A 3BYAA 3DZTA 3ZWHA 2LNKA 1CFCA 2QEVA 2MRDA 2TN4A 1J7QA 2JXCA 2JTTA 1B47A 3C1VA 4XJKA 3BUNB 1N0YA 2CT9A 1LA0A 5PALA 1OQPA 1V1FA 2K7BA 2NXQA 1C7WA 1K9UA 2WCJA 1WRZA 1LS8A 1CMGA 1IQ5A 1G33A 3BFHA 1WRKA 1SBJA 2I7AA 3NSOA 3PN7B 5I2QA 4OZDA 1IG5A 4YGEB 1IKUA 1C07A 1C7VA 1CKKA 3CTNA 1QVIZ 1YUSA 1IGVA 1RK9A 3VRRA 1CLLA 1XYDA 2PSRA 5FYXA 4NDBA 1OSAA 4DCKA 1RTP1 4PDZA 1JUOA 5DKNA 1DQEA 3NGVA 5K89A 4MZLA 4MRYA 2GGZA 4PE7A 2LHIA 1X02A 3PFVA 3I5IB 3H4SE 3KEVA 2ZRSA 4E68A 4P5OE 1A03A 1OOJA 1MR8A 2KQ6A 2Q4UA 1C3ZA 4M2OA 4OVNF 4YBHB 1BODA 4L9MA 3KHEA 3CR5X 3RM1A 1IJ5A 3LK1A 1S6CA 1XK4C 1UHNA 1SNLA 1SL9A 2OS8C 2R2IA 1WDCB 3BXKA 3DF0B 3LL8B 4MVFA 2WCBA 2QEOA 3R1OA 1P28A 1TNWA 2Y1NA 3V2LA 3DD4A 4CPVA 1K96A 5HLVA 1BG1A 3TUYC 1SCMB 5AFPA 2EC6C 1SPYA 4DIRA 1A29A 1SY9A 4GGNA 1NCZA 3B88A 1JFKA 3KO0A 3SG4A 1NSHA 2GV5A 3B86A 4GNKB 1ZFSA 1RFJA 2JNXA 3I5FC 1OOIX 1IJ6A 1NX3A 3EVUA 2KBIA 1A75B 3DXLA 2JOJA 4P2YB 3JTDB 4Q04A 1FF1A 1AHRA 2K7OA 4A4CA 1KK7Z 1QLSA 1NPQA 1RJVA 1UP5A 2MJWB 4YGDB 2L51A 3SG6A 4PT1A 3VRNA 1N65A 3VROA 3D75A 2G2BA 2WCKA 1W7JB 5GQQC 2QEBA 1NWDA 1GGWA 5CSNA 1IIOA 5I2OA 2V53A 5J3XA 1XFZO 1QS7A 1SRAA 2JXLA 3CR4X 3EVRA 1S6JA 1J1EA 3OX6A 1CLMA 4JKTA 2LUCA 3DVEA 3IF7A 3TDUA 1FW4A 1KWOB 1M45A 1XA5A 3WHTB 2MA2A 3NHTA 1NYAA 2KI6D 2PASA 4BY4A 1UUSA 4I5JA 2LP2A 4IJ7A 1TNXA 5ER4X 1CFFA 1G8IA 1SR6C 1UWOA 2JT0A 4HRGA 1AUIB 3PSRA 1UHHA 4I5NB 2H8VA 4MEWA 3FWBA 1DF0B 1QLKA 4AOMA 1JFJA 3S0BA 1DJHA 3CR2A 5DICA 2KSPA 1L7ZA 2LVKA 4QJ5B 3TS5B 5KU1A 2A4JA 5FI2A 2WCMA 2M1UA 3LLEA 4GPLB 3SG3A 2WNDA 3D0YA 3CABA 5AERA 1JSAA 1YURA 3DYEA 2LMTA 5FI6A 2KYCA 2CBLA 3S0AA 1XVJA 1V1GA 3D78A 4WQ3A 1ZMZA 5JJGA 2ZN9A 1BR4B 1R2UA 2K0JA 5FI7A 3RZSA 3B6XA 3EVVA 1TUJA 3VRPA 4HSZA 1DJXA 4NQGA 4KYNA 2I2RE 3B7AA 1QX5B 2H61C 1F4OA 3EK7A 5D69A 1R6PA 1PRWA 4I5KA 4JD9A 3BJHA 2JT8A 4C0JA 5I94A 1F70A 3D77A 2SASA 4PCWA 3CGAA 2JNFA 2LV7A 1PULA 2KI4B 2CTNA 3OBVA 2BL0B 3SG2A 1KK8B 5CSJA 1NX0A 5BPJA 3PALA 2O60A 2M49B 1QV0A 4ORCB 1QASA 3DVJA 2BE4A 1IRJA 3HCMA 2L2CA 3AKBA 3EKJA 3CWGA 4USLA 1SL7A 3WHUB 1XK4A 1YRUB 2JU0A 2PRUA 2D8NA 1CDNA 1J1DA 2H2KA 2P70A 1MHOA 2LUXA 1OOGA 4JWQA 2ZNEA 2PVBA 1K90D 1TUZA 3GK1A 4DUQA 3VRQA 2WCEA 4N1GA 1LINA 2LMVA 1YVLA 2ISDA 3IQOA 1ZACA 2KYFA 1PK0D 1CDLA 2M8UA 2SCPA 4MRXA 3OX5A 2QDIA 1B7TZ 1YRTB 2CXJA 2JULA 2WC5A 1Z4HA 1DMOA 2QPTA 1XFWO 1VRKA 3JVTB 1AK8A 1B9AA 2NZ0A 2LP3A 2P6BB 2M1KB 1DGUA 2M97A 2OTGB 1BJFA 3CS1A 5DKQA 2K2FA 1QIWA 3L47A 1DELA 4XJKB 1K2HA 1BR1B 2AAOA 2EGDA 2LCPA 3I5GB 2F2OA 2F3YA 1QWVA 3R1PA 1H4BA 3PLFB 1M39A 3D76A 2KLEA 3I5HB 3WXAA 2LC5A 2LHLA 2BAPA 5HKWA 1OMDA 3SIBA 2HETA 2MLEC 1XFYO 1Y1XA 3BUWB 1PSBA 5D7FA 2L4IA 2PMYA 1MXLC 2AUCA 1AP4A 1Y0VH 1TNQA 1TCOB 2LVVA 3VB1A 1K95A 2BCXA 2JT3A 3S0DA 1DC1A 1FI6A 2ERBA 2BE6A 4INWA 2BECA 5AEQA 1XFUO 2L5XB 1NX2A 3CZ1A 3EKHA 2BNXA 1B7TY 2GTEA 2FJYA 2OPOA 1UURA 3PN7C 4N5XA 1DT7B 3CZ0A 1QVIY 2JQ6A 1OMRA 3M0WA 1BF5A 1BLQA 1L2OB 1F8HA 1FI5A 1EL4A 2NLNA 2KHNA 2O5GA 1BT6A 4DRWA 1GGZA 4ORBB 1PALA 3BUMB 3LK0A 1TNPA 3DY9A 3ZNIA 5F6TA 1OMVA 1ALVA 3A8RA 1TTXA 1QXPA 3I5IC 1UHKA 1YUUA 3BUOB 1KQMB 4JPZB 3IQQA 4ETOA 1S5GZ 1SL8A 4OKHA 1MQ1A 1LA3A 2WC8A 3D74A 5D3OA 1F71A 2ZFDA 1MWNA 3O2PA 1WDCC 1K94A 2KLDA 3NHIA 1TOPA 3D10A 1M63B 4CFRA 4DS7A 1B1GA 4OV2A 4M2PA 3S0EA 1HQVA 2HQWA 4AQIA 1TCFA 1CFPA 3A4UB 1F54A 2HPSA 1SCMC 2K8MB 2F2PA 2F33A 2NCPA 2L98A 1J55A 2M9GA 4GFTA 4PE4A 1K9KA 4YI8A 5CSIA 1QX7A 3SS4A 1KSOA 5HYDA 4UPGA 2KGBC 2YGUA 2P71A 1NIWA 5HKZA 1KK7Y 1Q80A 4HREE 3FE6A 1SKTA 4C0KA 3JTDC 1WLMA 1EH2A 2KI6C 2LVJA 1BMOA 1SCVA 2AMIA 2L4HA 1EG3A 2ZRTA 1QIVA 2KAVA
chains in the Genus database with same CATH topology
4PHJA 1WY9A 1N2DA 1LXFC 2WCFA 1NP8A 2ZNDA 2JWWA 3SJSA 3GOFA 2FCDA 1CLBA 3DVMA 2JPTA 1S1EA 5KSZA 1ALWA 1YVHA 3KPXA 5ER5A 3EK8A 1QV1A 1YR5A 2ZKMX 3ICBA 4M2QA 2Y1MA 4PALA 2NCOA 3O78A 1KWOC 4N1FA 2HQ8A 1EG4A 1K93D 2CCMA 3OP0A 2COLB 1QATA 1FBVA 2LE9B 1XFXO 1EJ3A 2MBXA 1ODBA 4HRHA 1KQVA 3D0YB 1YX8A 1DJYA 1ZUZA 1TRFA 4PHKA 4WQ2A 1PSRA 2L2EA 1RWYA 4QJ4B 2JC2A 2K7DA 2PALA 1QTXA 1B8LA 5I8NA 2M0RA 2BKHB 5KTYA 1KSMA 4OR9B 3AAJA 3TS5C 1A2XA 4NDCA 2FOTA 1YX7A 1D1OA 2M7NA 4CFQA 1DJIA 2FJUB 1CM4A 1Y1AA 2KQYA 1MF8B 1TN4A 3VGOA 3AAKA 1M31A 3CZTX 3FWCA 4YI9A 4WRIA 1JC2A 2LLTA 2K2AA 3OHMB 4XYNA 2OS8B 3BUXB 2BCBA 3DVKA 2KAYA 4QJ3B 3NSLA 4YRUA 5B8IB 2M3WA 2K7CA 3PATA 4YGAA 1DJGA 1S6IA 2Y4QA 3EK4A 1JWDA 1E8AA 2KI4C 1BOCA 2BL0C 1CM1A 2QACA 1KK8C 1QJTA 4GGFC 3TUYB 1S3PA 3TZ1A 1IQ3A 3TDZA 2EC6B 5HLOA 2I94A 2Q91A 1TIZA 1DVIA 3OB1B 4BY5A 2JZIA 2KBMA 2M7LA 1B8CA 2KFFA 3I5FB 4GAOA 5CPVA 3DF0A 2BKIB 2GGMA 3AKAA 3KF9A 1GQMA 2LVIA 4PHMA 1KFXL 1PVAA 3WNXB 2KOTA 4U8DA 1CNPA 3MSEB 1AJ5A 1QX2A 1B8RA 1IH0A 2JRFA 4MZKA 2Y5IA 2EHBA 1EXRA 3TDIA 4CIDA 2WORA 4PE0A 1NCYA 1PVBA 4R1EA 4GBAA 4A4BA 1A75A 5HKYA 1F55A 2F3ZA 3JVTC 4MLWA 3E3RA 2JTZA 1G4YR 2OTGC 1W7IB 5AANA 3GK2A 1NUBA 3O4YA 4OCIA 1NCXA 1SW8A 3I5GC 4ICBA 1FPWA 1CMFA 1YTZC 1LKJA 4TNCA 1KCYA 2MHHA 4MBEA 3I5HC 5IBWA 2L0PA 4ZCVA 1SR6B 1UHJA 1YUTA 4FQOA 1KFXS 1WLZA 4I5LB 2CNPA 4D1EA 1XO5A 2MLFC 2H61A 3BQ3A 3SG5A 2LM5A 3NXAA 4GUKA 5JOLA 1WRLA 3NSKA 1DJZA 2LANA 2LAPA 3GK4X 5I2LA 1XFVO 1SK6D 1OZOA 2FCEA 3BOWA 1DTLA 1J7RA 1Y6WA 2KFHA 1DF0A 2WOSA 3OB2B 2ZN8A 1L2OC 2VRGA 1HT9A 1IWQA 1DGVA 1S36A 1CTRA 2E30A 3QRXA 5G08A 5CSFA 2HF5A 3RLZA 1J7PA 4PHNA 1S5GY 1KQMC 3HX4A 1GJYA 4NDDA 1KFUL 2KDHA 3BOWB 1JF2A 2KFGA 1Y1UA 4C0LA 4YGCB 2MAZA 5AXIA 1M46A 2BBNA 3SG7A 2G9BA 4CLNA 3CLNA 4IL1A 1NX1A 1MUXA 2RGIA 1OZSA 1U5IA 2LMUA 3K21A 1F4QA 2E6WA 2KAXA 1AJ4A 3NSIA 4MN0A 4MSPA 5DKRA 1JF0A 1J7OA 1H8BA 2L50A 2F8PA 4GGFA 2I18A 4FTGA 3PM8A 2IS9A 2LLUA 4ORAB 2BCAA 1CB1A 1AVSA 1RROA 4AQJA 2BBMA 1CDMA 1K9PA 2LLSA 2KNEA 4F0ZB 1UHIA 4MZJA 4ZCUA 1ZOTB 1CDPA 1A4PA 3FIAA 3FS7A 1MXEA 1RECA 4PE1A 1U5IB 5TNCA 1KFUS 2KGRA 1K8UA 3LCPC 2K61A 4YGBB 1OE9B 1JBAA 1BU3A 1SMGA 1B4CA 3SIAA 1CFDA 1S26D 2DOQA 1DJWA 4JQ0D 1SYMA 3O6BA 1LVCD 3F45A 2B1UA 2M29A 3BYAA 3ZWHA 1CFCA 2LNKA 2MRDA 2TN4A 1J7QA 2JXCA 2JTTA 1B47A 3C1VA 4XJKA 3BUNB 1N0YA 2CT9A 1LA0A 5PALA 1OQPA 1V1FA 2K7BA 2NXQA 1C7WA 1K9UA 1WRZA 1CMGA 1IQ5A 1G33A 3NSOA 1WRKA 1SBJA 2I7AA 3PN7B 5I2QA 1CKKA 1IG5A 4YGEB 1IKUA 1C07A 1C7VA 3CTNA 1QVIZ 1YUSA 1IGVA 1RK9A 3VRRA 1CLLA 1XYDA 2PSRA 5FYXA 4NDBA 1OSAA 4DCKA 1RTP1 4PDZA 1JUOA 5DKNA 5K89A 4MZLA 4MRYA 2GGZA 4PE7A 2LHIA 1X02A 3PFVA 3I5IB 3H4SE 3KEVA 2ZRSA 4E68A 4P5OE 1A03A 1OOJA 1MR8A 2KQ6A 2Q4UA 4M2OA 1BODA 4OVNF 4YBHB 4L9MA 3KHEA 3CR5X 3RM1A 1IJ5A 3LK1A 1S6CA 1XK4C 1UHNA 1SNLA 1SL9A 2OS8C 2R2IA 1WDCB 3BXKA 3DF0B 3LL8B 4MVFA 2WCBA 1TNWA 2Y1NA 3DD4A 4CPVA 1K96A 5HLVA 1BG1A 3TUYC 1SCMB 5AFPA 2EC6C 1SPYA 4DIRA 1A29A 1SY9A 4GGNA 1NCZA 3KO0A 1JFKA 3SG4A 1NSHA 2GV5A 4GNKB 1ZFSA 1RFJA 2JNXA 3I5FC 1IJ6A 1NX3A 3EVUA 2KBIA 1A75B 4Q04A 2JOJA 4P2YB 3JTDB 1FF1A 1AHRA 2K7OA 4A4CA 1KK7Z 1QLSA 1NPQA 1RJVA 1UP5A 2MJWB 4YGDB 2L51A 3SG6A 3VRNA 1N65A 3VROA 2G2BA 1W7JB 5GQQC 1NWDA 1GGWA 5CSNA 5I2OA 2V53A 5J3XA 1XFZO 1QS7A 1SRAA 2JXLA 3CR4X 3EVRA 1S6JA 1J1EA 3OX6A 1CLMA 2LUCA 3DVEA 3IF7A 3TDUA 1FW4A 1KWOB 1M45A 1XA5A 3WHTB 2MA2A 1NYAA 2KI6D 2PASA 4BY4A 1UUSA 4I5JA 2LP2A 1TNXA 5ER4X 1CFFA 1G8IA 1SR6C 1UWOA 2JT0A 4HRGA 1AUIB 3PSRA 1UHHA 4I5NB 4MEWA 3FWBA 1DF0B 1QLKA 4AOMA 1JFJA 1DJHA 3CR2A 2KSPA 1L7ZA 2LVKA 4QJ5B 3TS5B 5KU1A 2A4JA 2M1UA 3LLEA 4GPLB 3SG3A 2WNDA 3D0YA 5AERA 1JSAA 1YURA 2LMTA 2KYCA 2CBLA 1XVJA 1V1GA 4WQ3A 1ZMZA 5JJGA 2ZN9A 1BR4B 1R2UA 2K0JA 3EVVA 3VRPA 4HSZA 1DJXA 4NQGA 2I2RE 1QX5B 2H61C 1F4OA 3EK7A 5D69A 1R6PA 1PRWA 4I5KA 4C0JA 2JT8A 1F70A 2SASA 4PCWA 3CGAA 2JNFA 2LV7A 1PULA 2KI4B 2CTNA 2BL0B 3SG2A 1KK8B 5CSJA 1NX0A 5BPJA 3PALA 2O60A 2M49B 1QV0A 4ORCB 1QASA 3DVJA 2BE4A 1IRJA 3HCMA 3AKBA 3EKJA 3CWGA 4USLA 1SL7A 3WHUB 1XK4A 1YRUB 2JU0A 2PRUA 2D8NA 1CDNA 1J1DA 2H2KA 1MHOA 2LUXA 4JWQA 2ZNEA 2PVBA 1K90D 3GK1A 4DUQA 3VRQA 2WCEA 4N1GA 1LINA 2LMVA 1YVLA 2ISDA 3IQOA 1ZACA 2KYFA 1PK0D 1CDLA 2M8UA 2SCPA 4MRXA 3OX5A 1B7TZ 1YRTB 2CXJA 2JULA 1DMOA 2QPTA 1XFWO 1VRKA 3JVTB 1AK8A 1B9AA 2NZ0A 2LP3A 2P6BB 2M1KB 1DGUA 2M97A 2OTGB 1BJFA 3CS1A 5DKQA 2K2FA 1QIWA 4XJKB 1K2HA 1BR1B 2AAOA 2EGDA 2LCPA 3I5GB 2F2OA 2F3YA 1H4BA 3PLFB 1M39A 3I5HB 3WXAA 2LC5A 2LHLA 5HKWA 1OMDA 3SIBA 2HETA 2MLEC 1XFYO 1Y1XA 3BUWB 1PSBA 5D7FA 2L4IA 2PMYA 1MXLC 2AUCA 1AP4A 1Y0VH 1TNQA 1TCOB 2LVVA 1K95A 2BCXA 2JT3A 1FI6A 2BE6A 2BECA 5AEQA 1XFUO 2L5XB 1NX2A 3EKHA 1B7TY 2OPOA 1UURA 3PN7C 4N5XA 1DT7B 1QVIY 2JQ6A 1OMRA 3M0WA 1BF5A 1BLQA 1L2OB 1F8HA 1FI5A 1EL4A 2NLNA 2KHNA 2O5GA 1BT6A 4DRWA 1GGZA 4ORBB 1PALA 3BUMB 3LK0A 1TNPA 3ZNIA 5F6TA 1OMVA 1ALVA 3A8RA 1TTXA 1QXPA 3I5IC 1UHKA 1YUUA 3BUOB 1KQMB 4JPZB 3IQQA 4ETOA 1S5GZ 1SL8A 4OKHA 1MQ1A 1LA3A 2WC8A 1F71A 2ZFDA 1MWNA 3O2PA 1WDCC 1K94A 1TOPA 3D10A 1M63B 4CFRA 4DS7A 1B1GA 4OV2A 4M2PA 4AQIA 1HQVA 2HQWA 1CFPA 1TCFA 1F54A 3A4UB 2HPSA 1SCMC 2K8MB 2F2PA 2F33A 2NCPA 2L98A 1J55A 2M9GA 4GFTA 4PE4A 1K9KA 4YI8A 5CSIA 1QX7A 1KSOA 5HYDA 4UPGA 2KGBC 1NIWA 5HKZA 1KK7Y 1Q80A 4HREE 1SKTA 4C0KA 3JTDC 1WLMA 1EH2A 2KI6C 2LVJA 1BMOA 1SCVA 2AMIA 2L4HA 1EG3A 2ZRTA 1QIVA 2KAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHJ A;  1WY9 A;  1N2D A;  1LXF C;  2WCF A;  1NP8 A;  2ZND A;  2JWW A;  3SJS A;  3GOF A;  2FCD A;  1CLB A;  3DVM A;  2JPT A;  1S1E A;  5KSZ A;  1ALW A;  1YVH A;  3KPX A;  5ER5 A;  3EK8 A;  1QV1 A;  1YR5 A;  2ZKM X;  3ICB A;  4M2Q A;  2Y1M A;  4PAL A;  2NCO A;  3O78 A;  1KWO C;  4N1F A;  2HQ8 A;  1EG4 A;  1K93 D;  2CCM A;  3OP0 A;  2COL B;  1QAT A;  1FBV A;  2LE9 B;  1XFX O;  1EJ3 A;  2MBX A;  1ODB A;  4HRH A;  1KQV A;  3D0Y B;  1YX8 A;  1DJY A;  1ZUZ A;  1TRF A;  4PHK A;  4WQ2 A;  1PSR A;  2L2E A;  1RWY A;  4QJ4 B;  2JC2 A;  2K7D A;  2PAL A;  1QTX A;  1B8L A;  5I8N A;  2M0R A;  2BKH B;  5KTY A;  1KSM A;  4OR9 B;  3AAJ A;  3TS5 C;  1A2X A;  4NDC A;  2FOT A;  1YX7 A;  1D1O A;  2M7N A;  4CFQ A;  1DJI A;  2FJU B;  1CM4 A;  1Y1A A;  2KQY A;  1MF8 B;  1TN4 A;  3VGO A;  3AAK A;  1M31 A;  3CZT X;  3FWC A;  4YI9 A;  4WRI A;  1JC2 A;  2LLT A;  2K2A A;  3OHM B;  4XYN A;  2OS8 B;  3BUX B;  2BCB A;  3DVK A;  2KAY A;  4QJ3 B;  3NSL A;  4YRU A;  5B8I B;  2M3W A;  2K7C A;  3PAT A;  4YGA A;  1DJG A;  1S6I A;  2Y4Q A;  3EK4 A;  1JWD A;  1E8A A;  2KI4 C;  1BOC A;  2BL0 C;  1CM1 A;  2QAC A;  1KK8 C;  1QJT A;  4GGF C;  3TUY B;  1S3P A;  3TZ1 A;  1IQ3 A;  3TDZ A;  2EC6 B;  5HLO A;  2I94 A;  2Q91 A;  1TIZ A;  1DVI A;  3OB1 B;  4BY5 A;  2JZI A;  2KBM A;  2M7L A;  1B8C A;  2KFF A;  3I5F B;  4GAO A;  5CPV A;  3DF0 A;  2BKI B;  2GGM A;  3AKA A;  3KF9 A;  1GQM A;  2LVI A;  4PHM A;  1KFX L;  1PVA A;  3WNX B;  2KOT A;  4U8D A;  1CNP A;  3MSE B;  1AJ5 A;  1QX2 A;  1B8R A;  1IH0 A;  2JRF A;  4MZK A;  2Y5I A;  2EHB A;  1EXR A;  3TDI A;  4CID A;  2WOR A;  4PE0 A;  1NCY A;  1PVB A;  4R1E A;  4GBA A;  4A4B A;  1A75 A;  5HKY A;  1F55 A;  2F3Z A;  3JVT C;  4MLW A;  3E3R A;  2JTZ A;  1G4Y R;  2OTG C;  1W7I B;  5AAN A;  3GK2 A;  1NUB A;  3O4Y A;  4OCI A;  1NCX A;  1SW8 A;  3I5G C;  4ICB A;  1FPW A;  1CMF A;  1YTZ C;  1LKJ A;  4TNC A;  1KCY A;  2MHH A;  4MBE A;  3I5H C;  5IBW A;  2L0P A;  4ZCV A;  1SR6 B;  1UHJ A;  1YUT A;  4FQO A;  1KFX S;  1WLZ A;  4I5L B;  2CNP A;  4D1E A;  1XO5 A;  2MLF C;  2H61 A;  3BQ3 A;  3SG5 A;  2LM5 A;  3NXA A;  4GUK A;  5JOL A;  1WRL A;  3NSK A;  1DJZ A;  2LAN A;  2LAP A;  3GK4 X;  5I2L A;  1XFV O;  1SK6 D;  1OZO A;  2FCE A;  3BOW A;  1DTL A;  1J7R A;  1Y6W A;  2KFH A;  1DF0 A;  2WOS A;  3OB2 B;  2ZN8 A;  1L2O C;  2VRG A;  1HT9 A;  1IWQ A;  1DGV A;  1S36 A;  1CTR A;  2E30 A;  3QRX A;  5G08 A;  5CSF A;  2HF5 A;  3RLZ A;  1J7P A;  4PHN A;  1S5G Y;  1KQM C;  3HX4 A;  1GJY A;  4NDD A;  1KFU L;  2KDH A;  3BOW B;  1JF2 A;  2KFG A;  1Y1U A;  4C0L A;  4YGC B;  2MAZ A;  5AXI A;  1M46 A;  2BBN A;  3SG7 A;  2G9B A;  4CLN A;  3CLN A;  4IL1 A;  1NX1 A;  1MUX A;  2RGI A;  1OZS A;  1U5I A;  2LMU A;  3K21 A;  1F4Q A;  2E6W A;  2KAX A;  1AJ4 A;  3NSI A;  4MN0 A;  4MSP A;  5DKR A;  1JF0 A;  1J7O A;  1H8B A;  2L50 A;  2F8P A;  4GGF A;  2I18 A;  4FTG A;  3PM8 A;  2IS9 A;  2LLU A;  4ORA B;  2BCA A;  1CB1 A;  1AVS A;  1RRO A;  4AQJ A;  2BBM A;  1CDM A;  1K9P A;  2LLS A;  2KNE A;  4F0Z B;  1UHI A;  4MZJ A;  4ZCU A;  1ZOT B;  1CDP A;  1A4P A;  3FIA A;  3FS7 A;  1MXE A;  1REC A;  4PE1 A;  1U5I B;  5TNC A;  1KFU S;  2KGR A;  1K8U A;  3LCP C;  2K61 A;  4YGB B;  1OE9 B;  1JBA A;  1BU3 A;  1SMG A;  1B4C A;  3SIA A;  1CFD A;  1S26 D;  2DOQ A;  1DJW A;  4JQ0 D;  1SYM A;  3O6B A;  1LVC D;  3F45 A;  2B1U A;  2M29 A;  3BYA A;  3ZWH A;  1CFC A;  2LNK A;  2MRD A;  2TN4 A;  1J7Q A;  2JXC A;  2JTT A;  1B47 A;  3C1V A;  4XJK A;  3BUN B;  1N0Y A;  2CT9 A;  1LA0 A;  5PAL A;  1OQP A;  1V1F A;  2K7B A;  2NXQ A;  1C7W A;  1K9U A;  1WRZ A;  1CMG A;  1IQ5 A;  1G33 A;  3NSO A;  1WRK A;  1SBJ A;  2I7A A;  3PN7 B;  5I2Q A;  1CKK A;  1IG5 A;  4YGE B;  1IKU A;  1C07 A;  1C7V A;  3CTN A;  1QVI Z;  1YUS A;  1IGV A;  1RK9 A;  3VRR A;  1CLL A;  1XYD A;  2PSR A;  5FYX A;  4NDB A;  1OSA A;  4DCK A;  1RTP 1;  4PDZ A;  1JUO A;  5DKN A;  5K89 A;  4MZL A;  4MRY A;  2GGZ A;  4PE7 A;  2LHI A;  1X02 A;  3PFV A;  3I5I B;  3H4S E;  3KEV A;  2ZRS A;  4E68 A;  4P5O E;  1A03 A;  1OOJ A;  1MR8 A;  2KQ6 A;  2Q4U A;  4M2O A;  1BOD A;  4OVN F;  4YBH B;  4L9M A;  3KHE A;  3CR5 X;  3RM1 A;  1IJ5 A;  3LK1 A;  1S6C A;  1XK4 C;  1UHN A;  1SNL A;  1SL9 A;  2OS8 C;  2R2I A;  1WDC B;  3BXK A;  3DF0 B;  3LL8 B;  4MVF A;  2WCB A;  1TNW A;  2Y1N A;  3DD4 A;  4CPV A;  1K96 A;  5HLV A;  1BG1 A;  3TUY C;  1SCM B;  5AFP A;  2EC6 C;  1SPY A;  4DIR A;  1A29 A;  1SY9 A;  4GGN A;  1NCZ A;  3KO0 A;  1JFK A;  3SG4 A;  1NSH A;  2GV5 A;  4GNK B;  1ZFS A;  1RFJ A;  2JNX A;  3I5F C;  1IJ6 A;  1NX3 A;  3EVU A;  2KBI A;  1A75 B;  4Q04 A;  2JOJ A;  4P2Y B;  3JTD B;  1FF1 A;  1AHR A;  2K7O A;  4A4C A;  1KK7 Z;  1QLS A;  1NPQ A;  1RJV A;  1UP5 A;  2MJW B;  4YGD B;  2L51 A;  3SG6 A;  3VRN A;  1N65 A;  3VRO A;  2G2B A;  1W7J B;  5GQQ C;  1NWD A;  1GGW A;  5CSN A;  5I2O A;  2V53 A;  5J3X A;  1XFZ O;  1QS7 A;  1SRA A;  2JXL A;  3CR4 X;  3EVR A;  1S6J A;  1J1E A;  3OX6 A;  1CLM A;  2LUC A;  3DVE A;  3IF7 A;  3TDU A;  1FW4 A;  1KWO B;  1M45 A;  1XA5 A;  3WHT B;  2MA2 A;  1NYA A;  2KI6 D;  2PAS A;  4BY4 A;  1UUS A;  4I5J A;  2LP2 A;  1TNX A;  5ER4 X;  1CFF A;  1G8I A;  1SR6 C;  1UWO A;  2JT0 A;  4HRG A;  1AUI B;  3PSR A;  1UHH A;  4I5N B;  4MEW A;  3FWB A;  1DF0 B;  1QLK A;  4AOM A;  1JFJ A;  1DJH A;  3CR2 A;  2KSP A;  1L7Z A;  2LVK A;  4QJ5 B;  3TS5 B;  5KU1 A;  2A4J A;  2M1U A;  3LLE A;  4GPL B;  3SG3 A;  2WND A;  3D0Y A;  5AER A;  1JSA A;  1YUR A;  2LMT A;  2KYC A;  2CBL A;  1XVJ A;  1V1G A;  4WQ3 A;  1ZMZ A;  5JJG A;  2ZN9 A;  1BR4 B;  1R2U A;  2K0J A;  3EVV A;  3VRP A;  4HSZ A;  1DJX A;  4NQG A;  2I2R E;  1QX5 B;  2H61 C;  1F4O A;  3EK7 A;  5D69 A;  1R6P A;  1PRW A;  4I5K A;  4C0J A;  2JT8 A;  1F70 A;  2SAS A;  4PCW A;  3CGA A;  2JNF A;  2LV7 A;  1PUL A;  2KI4 B;  2CTN A;  2BL0 B;  3SG2 A;  1KK8 B;  5CSJ A;  1NX0 A;  5BPJ A;  3PAL A;  2O60 A;  2M49 B;  1QV0 A;  4ORC B;  1QAS A;  3DVJ A;  2BE4 A;  1IRJ A;  3HCM A;  3AKB A;  3EKJ A;  3CWG A;  4USL A;  1SL7 A;  3WHU B;  1XK4 A;  1YRU B;  2JU0 A;  2PRU A;  2D8N A;  1CDN A;  1J1D A;  2H2K A;  1MHO A;  2LUX A;  4JWQ A;  2ZNE A;  2PVB A;  1K90 D;  3GK1 A;  4DUQ A;  3VRQ A;  2WCE A;  4N1G A;  1LIN A;  2LMV A;  1YVL A;  2ISD A;  3IQO A;  1ZAC A;  2KYF A;  1PK0 D;  1CDL A;  2M8U A;  2SCP A;  4MRX A;  3OX5 A;  1B7T Z;  1YRT B;  2CXJ A;  2JUL A;  1DMO A;  2QPT A;  1XFW O;  1VRK A;  3JVT B;  1AK8 A;  1B9A A;  2NZ0 A;  2LP3 A;  2P6B B;  2M1K B;  1DGU A;  2M97 A;  2OTG B;  1BJF A;  3CS1 A;  5DKQ A;  2K2F A;  1QIW A;  4XJK B;  1K2H A;  1BR1 B;  2AAO A;  2EGD A;  2LCP A;  3I5G B;  2F2O A;  2F3Y A;  1H4B A;  3PLF B;  1M39 A;  3I5H B;  3WXA A;  2LC5 A;  2LHL A;  5HKW A;  1OMD A;  3SIB A;  2HET A;  2MLE C;  1XFY O;  1Y1X A;  3BUW B;  1PSB A;  5D7F A;  2L4I A;  2PMY A;  1MXL C;  2AUC A;  1AP4 A;  1Y0V H;  1TNQ A;  1TCO B;  2LVV A;  1K95 A;  2BCX A;  2JT3 A;  1FI6 A;  2BE6 A;  2BEC A;  5AEQ A;  1XFU O;  2L5X B;  1NX2 A;  3EKH A;  1B7T Y;  2OPO A;  1UUR A;  3PN7 C;  4N5X A;  1DT7 B;  1QVI Y;  2JQ6 A;  1OMR A;  3M0W A;  1BF5 A;  1BLQ A;  1L2O B;  1F8H A;  1FI5 A;  1EL4 A;  2NLN A;  2KHN A;  2O5G A;  1BT6 A;  4DRW A;  1GGZ A;  4ORB B;  1PAL A;  3BUM B;  3LK0 A;  1TNP A;  3ZNI A;  5F6T A;  1OMV A;  1ALV A;  3A8R A;  1TTX A;  1QXP A;  3I5I C;  1UHK A;  1YUU A;  3BUO B;  1KQM B;  4JPZ B;  3IQQ A;  4ETO A;  1S5G Z;  1SL8 A;  4OKH A;  1MQ1 A;  1LA3 A;  2WC8 A;  1F71 A;  2ZFD A;  1MWN A;  3O2P A;  1WDC C;  1K94 A;  1TOP A;  3D10 A;  1M63 B;  4CFR A;  4DS7 A;  1B1G A;  4OV2 A;  4M2P A;  4AQI A;  1HQV A;  2HQW A;  1CFP A;  1TCF A;  1F54 A;  3A4U B;  2HPS A;  1SCM C;  2K8M B;  2F2P A;  2F33 A;  2NCP A;  2L98 A;  1J55 A;  2M9G A;  4GFT A;  4PE4 A;  1K9K A;  4YI8 A;  5CSI A;  1QX7 A;  1KSO A;  5HYD A;  4UPG A;  2KGB C;  1NIW A;  5HKZ A;  1KK7 Y;  1Q80 A;  4HRE E;  1SKT A;  4C0K A;  3JTD C;  1WLM A;  1EH2 A;  2KI6 C;  2LVJ A;  1BMO A;  1SCV A;  2AMI A;  2L4H A;  1EG3 A;  2ZRT A;  1QIV A;  2KAV A; 
#chains in the Genus database with same CATH topology
 4PHJ A;  1WY9 A;  2KPH A;  1N2D A;  1ORG A;  1LXF C;  2WCF A;  1NP8 A;  2ZND A;  2JWW A;  3SJS A;  3N7H A;  3GOF A;  2FCD A;  1CLB A;  3DVM A;  2JPT A;  1S1E A;  5KSZ A;  3S0F A;  1ALW A;  1YVH A;  3KPX A;  5ER5 A;  3EK8 A;  1QV1 A;  1YR5 A;  2ZKM X;  3ICB A;  4M2Q A;  2Y1M A;  4PAL A;  2NCO A;  3O78 A;  1KWO C;  4N1F A;  2HQ8 A;  1EG4 A;  1K93 D;  2CCM A;  3OP0 A;  3SS3 A;  2COL B;  1QAT A;  1FBV A;  2LE9 B;  1XFX O;  1EJ3 A;  3CZ2 A;  2MBX A;  1ODB A;  4HRH A;  1KQV A;  3D0Y B;  1YX8 A;  1DJY A;  1ZUZ A;  1TRF A;  4F7F A;  4PHK A;  4WQ2 A;  1PSR A;  2PQL A;  3L4L A;  2L2E A;  1RWY A;  4QJ4 B;  2JC2 A;  2K7D A;  2PAL A;  1QTX A;  1B8L A;  5I8N A;  2M0R A;  2BKH B;  5KTY A;  1KSM A;  4OR9 B;  3AAJ A;  3TS5 C;  3FE9 A;  1A2X A;  4NDC A;  2FOT A;  1YX7 A;  1D1O A;  2M7N A;  5HL1 A;  4CFQ A;  1DJI A;  2FJU B;  3O4X A;  1XFR A;  1CM4 A;  1Y1A A;  2KQY A;  3D73 A;  2QEH A;  1MF8 B;  1TN4 A;  3SS5 A;  3UO9 A;  2WCH A;  3VGO A;  3AAK A;  1M31 A;  3CZT X;  3FWC A;  4YI9 A;  4WRI A;  1JC2 A;  2LLT A;  2K2A A;  3OGN A;  1TWO A;  3CDN A;  3OHM B;  4XYN A;  2OS8 B;  3BUX B;  2BCB A;  3DVK A;  2KAY A;  4QJ3 B;  3NSL A;  4YRU A;  5B8I B;  2M3W A;  2K7C A;  3PAT A;  4YGA A;  1DJG A;  1S6I A;  2Y4Q A;  3EK4 A;  1JWD A;  1E8A A;  2KI4 C;  1BOC A;  2BL0 C;  1CM1 A;  1SSE B;  1KK8 C;  1QJT A;  2QAC A;  4GGF C;  1S3P A;  3TUY B;  3TZ1 A;  3TDZ A;  1IQ3 A;  2EC6 B;  5HLO A;  2I94 A;  2Q91 A;  4FQT A;  1TIZ A;  1DVI A;  3OB1 B;  4BY5 A;  2JZI A;  2KBM A;  3R1V A;  2M7L A;  1B8C A;  2KFF A;  3I5F B;  4GAO A;  5CPV A;  3QME A;  3DF0 A;  2BKI B;  2GGM A;  3AKA A;  3KF9 A;  1GQM A;  2LVI A;  4PHM A;  1KFX L;  1PVA A;  3WNX B;  2KOT A;  4U8D A;  1CNP A;  3MSE B;  2WCL A;  1AJ5 A;  1OOH A;  1QX2 A;  1B8R A;  1Z2C B;  1IH0 A;  3IVT A;  2JRF A;  3PM2 A;  4MZK A;  2Y5I A;  2EHB A;  1EXR A;  3TDI A;  4CID A;  2WOR A;  4PE0 A;  1NCY A;  1PVB A;  4R1E A;  4GBA A;  4A4B A;  1A75 A;  5HKY A;  1F55 A;  2F3Z A;  2K60 A;  3JVT C;  4MLW A;  3E3R A;  2JTZ A;  1G4Y R;  2OTG C;  1W7I B;  5AAN A;  3GK2 A;  1NUB A;  3O4Y A;  4OCI A;  1NCX A;  1SW8 A;  3I5G C;  4ICB A;  1FPW A;  1CMF A;  1C3Y A;  1YTZ C;  1LKJ A;  4TNC A;  1KCY A;  2MHH A;  4MBE A;  3I5H C;  3PJI A;  5IBW A;  2L0P A;  4ZCV A;  1SR6 B;  1UHJ A;  1YUT A;  4FQO A;  1KFX S;  1WLZ A;  4I5L B;  2CNP A;  4D1E A;  1OW4 A;  1T14 A;  1XO5 A;  2MLF C;  2H61 A;  3BQ3 A;  3SG5 A;  2LM5 A;  3NXA A;  4GUK A;  5EL2 A;  5JOL A;  1WRL A;  3NSK A;  1DJZ A;  2LAN A;  2LAP A;  3GK4 X;  5I2L A;  1XFV O;  1SK6 D;  1DEK A;  1OZO A;  2FCE A;  3BOW A;  1DTL A;  1J7R A;  1Y6W A;  2KFH A;  1DF0 A;  2WOS A;  3OB2 B;  2ZN8 A;  1L2O C;  3CYZ A;  1OOF A;  2VRG A;  1HT9 A;  1IWQ A;  1DGV A;  1S36 A;  1CTR A;  2E30 A;  1GM0 A;  3QRX A;  5G08 A;  5CSF A;  3EG5 B;  2HF5 A;  3RLZ A;  2PYQ A;  1J7P A;  4PHN A;  1S5G Y;  1KQM C;  2WC6 A;  3HX4 A;  1GJY A;  4NDD A;  1KFU L;  3Q8I A;  2KDH A;  3BOW B;  1JF2 A;  2KFG A;  1Y1U A;  3FE8 A;  2L5Y A;  4YGC B;  4C0L A;  2MAZ A;  5AXI A;  1M46 A;  2BBN A;  2JPO A;  2G9B A;  3SG7 A;  3CLN A;  4CLN A;  4IL1 A;  1NX1 A;  1MUX A;  2RGI A;  3L4A A;  1OZS A;  1U5I A;  2LMU A;  3K21 A;  1F4Q A;  2E6W A;  2KAX A;  1AJ4 A;  3NSI A;  4MN0 A;  4MSP A;  5DKR A;  1JF0 A;  1J7O A;  3BFA A;  3BFB A;  1H8B A;  2L50 A;  2F8P A;  4INX A;  4GGF A;  2I18 A;  4FTG A;  3PM8 A;  2IS9 A;  2LLU A;  4ORA B;  2BCA A;  1CB1 A;  1AVS A;  1RRO A;  4AQJ A;  3B87 A;  2BBM A;  1CDM A;  1K9P A;  2LLS A;  2KNE A;  4F0Z B;  1UHI A;  4MZJ A;  4ZCU A;  1ZOT B;  3S0G A;  1CDP A;  1A4P A;  3FIA A;  3FS7 A;  1MXE A;  1REC A;  4PE1 A;  1U5I B;  5TNC A;  1KFU S;  2KGR A;  1K8U A;  3LCP C;  2K61 A;  4YGB B;  1OE9 B;  3R72 A;  3K1E A;  1JBA A;  1BU3 A;  1SMG A;  1B4C A;  3SIA A;  1CFD A;  1S26 D;  1W9Z A;  2DOQ A;  1DJW A;  4JQ0 D;  3UNW A;  1SYM A;  3O6B A;  1LVC D;  3F45 A;  2B1U A;  2M29 A;  3BYA A;  3DZT A;  3ZWH A;  2LNK A;  1CFC A;  2QEV A;  2MRD A;  2TN4 A;  1J7Q A;  2JXC A;  2JTT A;  1B47 A;  3C1V A;  4XJK A;  3BUN B;  1N0Y A;  2CT9 A;  1LA0 A;  5PAL A;  1OQP A;  1V1F A;  2K7B A;  2NXQ A;  1C7W A;  1K9U A;  2WCJ A;  1WRZ A;  1LS8 A;  1CMG A;  1IQ5 A;  1G33 A;  3BFH A;  1WRK A;  1SBJ A;  2I7A A;  3NSO A;  3PN7 B;  5I2Q A;  4OZD A;  1IG5 A;  4YGE B;  1IKU A;  1C07 A;  1C7V A;  1CKK A;  3CTN A;  1QVI Z;  1YUS A;  1IGV A;  1RK9 A;  3VRR A;  1CLL A;  1XYD A;  2PSR A;  5FYX A;  4NDB A;  1OSA A;  4DCK A;  1RTP 1;  4PDZ A;  1JUO A;  5DKN A;  1DQE A;  3NGV A;  5K89 A;  4MZL A;  4MRY A;  2GGZ A;  4PE7 A;  2LHI A;  1X02 A;  3PFV A;  3I5I B;  3H4S E;  3KEV A;  2ZRS A;  4E68 A;  4P5O E;  1A03 A;  1OOJ A;  1MR8 A;  2KQ6 A;  2Q4U A;  1C3Z A;  4M2O A;  4OVN F;  4YBH B;  1BOD A;  4L9M A;  3KHE A;  3CR5 X;  3RM1 A;  1IJ5 A;  3LK1 A;  1S6C A;  1XK4 C;  1UHN A;  1SNL A;  1SL9 A;  2OS8 C;  2R2I A;  1WDC B;  3BXK A;  3DF0 B;  3LL8 B;  4MVF A;  2WCB A;  2QEO A;  3R1O A;  1P28 A;  1TNW A;  2Y1N A;  3V2L A;  3DD4 A;  4CPV A;  1K96 A;  5HLV A;  1BG1 A;  3TUY C;  1SCM B;  5AFP A;  2EC6 C;  1SPY A;  4DIR A;  1A29 A;  1SY9 A;  4GGN A;  1NCZ A;  3B88 A;  1JFK A;  3KO0 A;  3SG4 A;  1NSH A;  2GV5 A;  3B86 A;  4GNK B;  1ZFS A;  1RFJ A;  2JNX A;  3I5F C;  1OOI X;  1IJ6 A;  1NX3 A;  3EVU A;  2KBI A;  1A75 B;  3DXL A;  2JOJ A;  4P2Y B;  3JTD B;  4Q04 A;  1FF1 A;  1AHR A;  2K7O A;  4A4C A;  1KK7 Z;  1QLS A;  1NPQ A;  1RJV A;  1UP5 A;  2MJW B;  4YGD B;  2L51 A;  3SG6 A;  4PT1 A;  3VRN A;  1N65 A;  3VRO A;  3D75 A;  2G2B A;  2WCK A;  1W7J B;  5GQQ C;  2QEB A;  1NWD A;  1GGW A;  5CSN A;  1IIO A;  5I2O A;  2V53 A;  5J3X A;  1XFZ O;  1QS7 A;  1SRA A;  2JXL A;  3CR4 X;  3EVR A;  1S6J A;  1J1E A;  3OX6 A;  1CLM A;  4JKT A;  2LUC A;  3DVE A;  3IF7 A;  3TDU A;  1FW4 A;  1KWO B;  1M45 A;  1XA5 A;  3WHT B;  2MA2 A;  3NHT A;  1NYA A;  2KI6 D;  2PAS A;  4BY4 A;  1UUS A;  4I5J A;  2LP2 A;  4IJ7 A;  1TNX A;  5ER4 X;  1CFF A;  1G8I A;  1SR6 C;  1UWO A;  2JT0 A;  4HRG A;  1AUI B;  3PSR A;  1UHH A;  4I5N B;  2H8V A;  4MEW A;  3FWB A;  1DF0 B;  1QLK A;  4AOM A;  1JFJ A;  3S0B A;  1DJH A;  3CR2 A;  5DIC A;  2KSP A;  1L7Z A;  2LVK A;  4QJ5 B;  3TS5 B;  5KU1 A;  2A4J A;  5FI2 A;  2WCM A;  2M1U A;  3LLE A;  4GPL B;  3SG3 A;  2WND A;  3D0Y A;  3CAB A;  5AER A;  1JSA A;  1YUR A;  3DYE A;  2LMT A;  5FI6 A;  2KYC A;  2CBL A;  3S0A A;  1XVJ A;  1V1G A;  3D78 A;  4WQ3 A;  1ZMZ A;  5JJG A;  2ZN9 A;  1BR4 B;  1R2U A;  2K0J A;  5FI7 A;  3RZS A;  3B6X A;  3EVV A;  1TUJ A;  3VRP A;  4HSZ A;  1DJX A;  4NQG A;  4KYN A;  2I2R E;  3B7A A;  1QX5 B;  2H61 C;  1F4O A;  3EK7 A;  5D69 A;  1R6P A;  1PRW A;  4I5K A;  4JD9 A;  3BJH A;  2JT8 A;  4C0J A;  5I94 A;  1F70 A;  3D77 A;  2SAS A;  4PCW A;  3CGA A;  2JNF A;  2LV7 A;  1PUL A;  2KI4 B;  2CTN A;  3OBV A;  2BL0 B;  3SG2 A;  1KK8 B;  5CSJ A;  1NX0 A;  5BPJ A;  3PAL A;  2O60 A;  2M49 B;  1QV0 A;  4ORC B;  1QAS A;  3DVJ A;  2BE4 A;  1IRJ A;  3HCM A;  2L2C A;  3AKB A;  3EKJ A;  3CWG A;  4USL A;  1SL7 A;  3WHU B;  1XK4 A;  1YRU B;  2JU0 A;  2PRU A;  2D8N A;  1CDN A;  1J1D A;  2H2K A;  2P70 A;  1MHO A;  2LUX A;  1OOG A;  4JWQ A;  2ZNE A;  2PVB A;  1K90 D;  1TUZ A;  3GK1 A;  4DUQ A;  3VRQ A;  2WCE A;  4N1G A;  1LIN A;  2LMV A;  1YVL A;  2ISD A;  3IQO A;  1ZAC A;  2KYF A;  1PK0 D;  1CDL A;  2M8U A;  2SCP A;  4MRX A;  3OX5 A;  2QDI A;  1B7T Z;  1YRT B;  2CXJ A;  2JUL A;  2WC5 A;  1Z4H A;  1DMO A;  2QPT A;  1XFW O;  1VRK A;  3JVT B;  1AK8 A;  1B9A A;  2NZ0 A;  2LP3 A;  2P6B B;  2M1K B;  1DGU A;  2M97 A;  2OTG B;  1BJF A;  3CS1 A;  5DKQ A;  2K2F A;  1QIW A;  3L47 A;  1DEL A;  4XJK B;  1K2H A;  1BR1 B;  2AAO A;  2EGD A;  2LCP A;  3I5G B;  2F2O A;  2F3Y A;  1QWV A;  3R1P A;  1H4B A;  3PLF B;  1M39 A;  3D76 A;  2KLE A;  3I5H B;  3WXA A;  2LC5 A;  2LHL A;  2BAP A;  5HKW A;  1OMD A;  3SIB A;  2HET A;  2MLE C;  1XFY O;  1Y1X A;  3BUW B;  1PSB A;  5D7F A;  2L4I A;  2PMY A;  1MXL C;  2AUC A;  1AP4 A;  1Y0V H;  1TNQ A;  1TCO B;  2LVV A;  3VB1 A;  1K95 A;  2BCX A;  2JT3 A;  3S0D A;  1DC1 A;  1FI6 A;  2ERB A;  2BE6 A;  4INW A;  2BEC A;  5AEQ A;  1XFU O;  2L5X B;  1NX2 A;  3CZ1 A;  3EKH A;  2BNX A;  1B7T Y;  2GTE A;  2FJY A;  2OPO A;  1UUR A;  3PN7 C;  4N5X A;  1DT7 B;  3CZ0 A;  1QVI Y;  2JQ6 A;  1OMR A;  3M0W A;  1BF5 A;  1BLQ A;  1L2O B;  1F8H A;  1FI5 A;  1EL4 A;  2NLN A;  2KHN A;  2O5G A;  1BT6 A;  4DRW A;  1GGZ A;  4ORB B;  1PAL A;  3BUM B;  3LK0 A;  1TNP A;  3DY9 A;  3ZNI A;  5F6T A;  1OMV A;  1ALV A;  3A8R A;  1TTX A;  1QXP A;  3I5I C;  1UHK A;  1YUU A;  3BUO B;  1KQM B;  4JPZ B;  3IQQ A;  4ETO A;  1S5G Z;  1SL8 A;  4OKH A;  1MQ1 A;  1LA3 A;  2WC8 A;  3D74 A;  5D3O A;  1F71 A;  2ZFD A;  1MWN A;  3O2P A;  1WDC C;  1K94 A;  2KLD A;  3NHI A;  1TOP A;  3D10 A;  1M63 B;  4CFR A;  4DS7 A;  1B1G A;  4OV2 A;  4M2P A;  3S0E A;  1HQV A;  2HQW A;  4AQI A;  1TCF A;  1CFP A;  3A4U B;  1F54 A;  2HPS A;  1SCM C;  2K8M B;  2F2P A;  2F33 A;  2NCP A;  2L98 A;  1J55 A;  2M9G A;  4GFT A;  4PE4 A;  1K9K A;  4YI8 A;  5CSI A;  1QX7 A;  3SS4 A;  1KSO A;  5HYD A;  4UPG A;  2KGB C;  2YGU A;  2P71 A;  1NIW A;  5HKZ A;  1KK7 Y;  1Q80 A;  4HRE E;  3FE6 A;  1SKT A;  4C0K A;  3JTD C;  1WLM A;  1EH2 A;  2KI6 C;  2LVJ A;  1BMO A;  1SCV A;  2AMI A;  2L4H A;  1EG3 A;  2ZRT A;  1QIV A;  2KAV A; 
#chains in the Genus database with same CATH homology
 4PHJ A;  1WY9 A;  1N2D A;  1LXF C;  2WCF A;  1NP8 A;  2ZND A;  2JWW A;  3SJS A;  3GOF A;  2FCD A;  1CLB A;  3DVM A;  2JPT A;  1S1E A;  5KSZ A;  1ALW A;  1YVH A;  3KPX A;  5ER5 A;  3EK8 A;  1QV1 A;  1YR5 A;  2ZKM X;  3ICB A;  4M2Q A;  2Y1M A;  4PAL A;  2NCO A;  3O78 A;  1KWO C;  4N1F A;  2HQ8 A;  1EG4 A;  1K93 D;  2CCM A;  3OP0 A;  2COL B;  1QAT A;  1FBV A;  2LE9 B;  1XFX O;  1EJ3 A;  2MBX A;  1ODB A;  4HRH A;  1KQV A;  3D0Y B;  1YX8 A;  1DJY A;  1ZUZ A;  1TRF A;  4PHK A;  4WQ2 A;  1PSR A;  2L2E A;  1RWY A;  4QJ4 B;  2JC2 A;  2K7D A;  2PAL A;  1QTX A;  1B8L A;  5I8N A;  2M0R A;  2BKH B;  5KTY A;  1KSM A;  4OR9 B;  3AAJ A;  3TS5 C;  1A2X A;  4NDC A;  2FOT A;  1YX7 A;  1D1O A;  2M7N A;  4CFQ A;  1DJI A;  2FJU B;  1CM4 A;  1Y1A A;  2KQY A;  1MF8 B;  1TN4 A;  3VGO A;  3AAK A;  1M31 A;  3CZT X;  3FWC A;  4YI9 A;  4WRI A;  1JC2 A;  2LLT A;  2K2A A;  3OHM B;  4XYN A;  2OS8 B;  3BUX B;  2BCB A;  3DVK A;  2KAY A;  4QJ3 B;  3NSL A;  4YRU A;  5B8I B;  2M3W A;  2K7C A;  3PAT A;  4YGA A;  1DJG A;  1S6I A;  2Y4Q A;  3EK4 A;  1JWD A;  1E8A A;  2KI4 C;  1BOC A;  2BL0 C;  1CM1 A;  2QAC A;  1KK8 C;  1QJT A;  4GGF C;  3TUY B;  1S3P A;  3TZ1 A;  1IQ3 A;  3TDZ A;  2EC6 B;  5HLO A;  2I94 A;  2Q91 A;  1TIZ A;  1DVI A;  3OB1 B;  4BY5 A;  2JZI A;  2KBM A;  2M7L A;  1B8C A;  2KFF A;  3I5F B;  4GAO A;  5CPV A;  3DF0 A;  2BKI B;  2GGM A;  3AKA A;  3KF9 A;  1GQM A;  2LVI A;  4PHM A;  1KFX L;  1PVA A;  3WNX B;  2KOT A;  4U8D A;  1CNP A;  3MSE B;  1AJ5 A;  1QX2 A;  1B8R A;  1IH0 A;  2JRF A;  4MZK A;  2Y5I A;  2EHB A;  1EXR A;  3TDI A;  4CID A;  2WOR A;  4PE0 A;  1NCY A;  1PVB A;  4R1E A;  4GBA A;  4A4B A;  1A75 A;  5HKY A;  1F55 A;  2F3Z A;  3JVT C;  4MLW A;  3E3R A;  2JTZ A;  1G4Y R;  2OTG C;  1W7I B;  5AAN A;  3GK2 A;  1NUB A;  3O4Y A;  4OCI A;  1NCX A;  1SW8 A;  3I5G C;  4ICB A;  1FPW A;  1CMF A;  1YTZ C;  1LKJ A;  4TNC A;  1KCY A;  2MHH A;  4MBE A;  3I5H C;  5IBW A;  2L0P A;  4ZCV A;  1SR6 B;  1UHJ A;  1YUT A;  4FQO A;  1KFX S;  1WLZ A;  4I5L B;  2CNP A;  4D1E A;  1XO5 A;  2MLF C;  2H61 A;  3BQ3 A;  3SG5 A;  2LM5 A;  3NXA A;  4GUK A;  5JOL A;  1WRL A;  3NSK A;  1DJZ A;  2LAN A;  2LAP A;  3GK4 X;  5I2L A;  1XFV O;  1SK6 D;  1OZO A;  2FCE A;  3BOW A;  1DTL A;  1J7R A;  1Y6W A;  2KFH A;  1DF0 A;  2WOS A;  3OB2 B;  2ZN8 A;  1L2O C;  2VRG A;  1HT9 A;  1IWQ A;  1DGV A;  1S36 A;  1CTR A;  2E30 A;  3QRX A;  5G08 A;  5CSF A;  2HF5 A;  3RLZ A;  1J7P A;  4PHN A;  1S5G Y;  1KQM C;  3HX4 A;  1GJY A;  4NDD A;  1KFU L;  2KDH A;  3BOW B;  1JF2 A;  2KFG A;  1Y1U A;  4C0L A;  4YGC B;  2MAZ A;  5AXI A;  1M46 A;  2BBN A;  3SG7 A;  2G9B A;  4CLN A;  3CLN A;  4IL1 A;  1NX1 A;  1MUX A;  2RGI A;  1OZS A;  1U5I A;  2LMU A;  3K21 A;  1F4Q A;  2E6W A;  2KAX A;  1AJ4 A;  3NSI A;  4MN0 A;  4MSP A;  5DKR A;  1JF0 A;  1J7O A;  1H8B A;  2L50 A;  2F8P A;  4GGF A;  2I18 A;  4FTG A;  3PM8 A;  2IS9 A;  2LLU A;  4ORA B;  2BCA A;  1CB1 A;  1AVS A;  1RRO A;  4AQJ A;  2BBM A;  1CDM A;  1K9P A;  2LLS A;  2KNE A;  4F0Z B;  1UHI A;  4MZJ A;  4ZCU A;  1ZOT B;  1CDP A;  1A4P A;  3FIA A;  3FS7 A;  1MXE A;  1REC A;  4PE1 A;  1U5I B;  5TNC A;  1KFU S;  2KGR A;  1K8U A;  3LCP C;  2K61 A;  4YGB B;  1OE9 B;  1JBA A;  1BU3 A;  1SMG A;  1B4C A;  3SIA A;  1CFD A;  1S26 D;  2DOQ A;  1DJW A;  4JQ0 D;  1SYM A;  3O6B A;  1LVC D;  3F45 A;  2B1U A;  2M29 A;  3BYA A;  3ZWH A;  1CFC A;  2LNK A;  2MRD A;  2TN4 A;  1J7Q A;  2JXC A;  2JTT A;  1B47 A;  3C1V A;  4XJK A;  3BUN B;  1N0Y A;  2CT9 A;  1LA0 A;  5PAL A;  1OQP A;  1V1F A;  2K7B A;  2NXQ A;  1C7W A;  1K9U A;  1WRZ A;  1CMG A;  1IQ5 A;  1G33 A;  3NSO A;  1WRK A;  1SBJ A;  2I7A A;  3PN7 B;  5I2Q A;  1CKK A;  1IG5 A;  4YGE B;  1IKU A;  1C07 A;  1C7V A;  3CTN A;  1QVI Z;  1YUS A;  1IGV A;  1RK9 A;  3VRR A;  1CLL A;  1XYD A;  2PSR A;  5FYX A;  4NDB A;  1OSA A;  4DCK A;  1RTP 1;  4PDZ A;  1JUO A;  5DKN A;  5K89 A;  4MZL A;  4MRY A;  2GGZ A;  4PE7 A;  2LHI A;  1X02 A;  3PFV A;  3I5I B;  3H4S E;  3KEV A;  2ZRS A;  4E68 A;  4P5O E;  1A03 A;  1OOJ A;  1MR8 A;  2KQ6 A;  2Q4U A;  4M2O A;  1BOD A;  4OVN F;  4YBH B;  4L9M A;  3KHE A;  3CR5 X;  3RM1 A;  1IJ5 A;  3LK1 A;  1S6C A;  1XK4 C;  1UHN A;  1SNL A;  1SL9 A;  2OS8 C;  2R2I A;  1WDC B;  3BXK A;  3DF0 B;  3LL8 B;  4MVF A;  2WCB A;  1TNW A;  2Y1N A;  3DD4 A;  4CPV A;  1K96 A;  5HLV A;  1BG1 A;  3TUY C;  1SCM B;  5AFP A;  2EC6 C;  1SPY A;  4DIR A;  1A29 A;  1SY9 A;  4GGN A;  1NCZ A;  3KO0 A;  1JFK A;  3SG4 A;  1NSH A;  2GV5 A;  4GNK B;  1ZFS A;  1RFJ A;  2JNX A;  3I5F C;  1IJ6 A;  1NX3 A;  3EVU A;  2KBI A;  1A75 B;  4Q04 A;  2JOJ A;  4P2Y B;  3JTD B;  1FF1 A;  1AHR A;  2K7O A;  4A4C A;  1KK7 Z;  1QLS A;  1NPQ A;  1RJV A;  1UP5 A;  2MJW B;  4YGD B;  2L51 A;  3SG6 A;  3VRN A;  1N65 A;  3VRO A;  2G2B A;  1W7J B;  5GQQ C;  1NWD A;  1GGW A;  5CSN A;  5I2O A;  2V53 A;  5J3X A;  1XFZ O;  1QS7 A;  1SRA A;  2JXL A;  3CR4 X;  3EVR A;  1S6J A;  1J1E A;  3OX6 A;  1CLM A;  2LUC A;  3DVE A;  3IF7 A;  3TDU A;  1FW4 A;  1KWO B;  1M45 A;  1XA5 A;  3WHT B;  2MA2 A;  1NYA A;  2KI6 D;  2PAS A;  4BY4 A;  1UUS A;  4I5J A;  2LP2 A;  1TNX A;  5ER4 X;  1CFF A;  1G8I A;  1SR6 C;  1UWO A;  2JT0 A;  4HRG A;  1AUI B;  3PSR A;  1UHH A;  4I5N B;  4MEW A;  3FWB A;  1DF0 B;  1QLK A;  4AOM A;  1JFJ A;  1DJH A;  3CR2 A;  2KSP A;  1L7Z A;  2LVK A;  4QJ5 B;  3TS5 B;  5KU1 A;  2A4J A;  2M1U A;  3LLE A;  4GPL B;  3SG3 A;  2WND A;  3D0Y A;  5AER A;  1JSA A;  1YUR A;  2LMT A;  2KYC A;  2CBL A;  1XVJ A;  1V1G A;  4WQ3 A;  1ZMZ A;  5JJG A;  2ZN9 A;  1BR4 B;  1R2U A;  2K0J A;  3EVV A;  3VRP A;  4HSZ A;  1DJX A;  4NQG A;  2I2R E;  1QX5 B;  2H61 C;  1F4O A;  3EK7 A;  5D69 A;  1R6P A;  1PRW A;  4I5K A;  4C0J A;  2JT8 A;  1F70 A;  2SAS A;  4PCW A;  3CGA A;  2JNF A;  2LV7 A;  1PUL A;  2KI4 B;  2CTN A;  2BL0 B;  3SG2 A;  1KK8 B;  5CSJ A;  1NX0 A;  5BPJ A;  3PAL A;  2O60 A;  2M49 B;  1QV0 A;  4ORC B;  1QAS A;  3DVJ A;  2BE4 A;  1IRJ A;  3HCM A;  3AKB A;  3EKJ A;  3CWG A;  4USL A;  1SL7 A;  3WHU B;  1XK4 A;  1YRU B;  2JU0 A;  2PRU A;  2D8N A;  1CDN A;  1J1D A;  2H2K A;  1MHO A;  2LUX A;  4JWQ A;  2ZNE A;  2PVB A;  1K90 D;  3GK1 A;  4DUQ A;  3VRQ A;  2WCE A;  4N1G A;  1LIN A;  2LMV A;  1YVL A;  2ISD A;  3IQO A;  1ZAC A;  2KYF A;  1PK0 D;  1CDL A;  2M8U A;  2SCP A;  4MRX A;  3OX5 A;  1B7T Z;  1YRT B;  2CXJ A;  2JUL A;  1DMO A;  2QPT A;  1XFW O;  1VRK A;  3JVT B;  1AK8 A;  1B9A A;  2NZ0 A;  2LP3 A;  2P6B B;  2M1K B;  1DGU A;  2M97 A;  2OTG B;  1BJF A;  3CS1 A;  5DKQ A;  2K2F A;  1QIW A;  4XJK B;  1K2H A;  1BR1 B;  2AAO A;  2EGD A;  2LCP A;  3I5G B;  2F2O A;  2F3Y A;  1H4B A;  3PLF B;  1M39 A;  3I5H B;  3WXA A;  2LC5 A;  2LHL A;  5HKW A;  1OMD A;  3SIB A;  2HET A;  2MLE C;  1XFY O;  1Y1X A;  3BUW B;  1PSB A;  5D7F A;  2L4I A;  2PMY A;  1MXL C;  2AUC A;  1AP4 A;  1Y0V H;  1TNQ A;  1TCO B;  2LVV A;  1K95 A;  2BCX A;  2JT3 A;  1FI6 A;  2BE6 A;  2BEC A;  5AEQ A;  1XFU O;  2L5X B;  1NX2 A;  3EKH A;  1B7T Y;  2OPO A;  1UUR A;  3PN7 C;  4N5X A;  1DT7 B;  1QVI Y;  2JQ6 A;  1OMR A;  3M0W A;  1BF5 A;  1BLQ A;  1L2O B;  1F8H A;  1FI5 A;  1EL4 A;  2NLN A;  2KHN A;  2O5G A;  1BT6 A;  4DRW A;  1GGZ A;  4ORB B;  1PAL A;  3BUM B;  3LK0 A;  1TNP A;  3ZNI A;  5F6T A;  1OMV A;  1ALV A;  3A8R A;  1TTX A;  1QXP A;  3I5I C;  1UHK A;  1YUU A;  3BUO B;  1KQM B;  4JPZ B;  3IQQ A;  4ETO A;  1S5G Z;  1SL8 A;  4OKH A;  1MQ1 A;  1LA3 A;  2WC8 A;  1F71 A;  2ZFD A;  1MWN A;  3O2P A;  1WDC C;  1K94 A;  1TOP A;  3D10 A;  1M63 B;  4CFR A;  4DS7 A;  1B1G A;  4OV2 A;  4M2P A;  4AQI A;  1HQV A;  2HQW A;  1CFP A;  1TCF A;  1F54 A;  3A4U B;  2HPS A;  1SCM C;  2K8M B;  2F2P A;  2F33 A;  2NCP A;  2L98 A;  1J55 A;  2M9G A;  4GFT A;  4PE4 A;  1K9K A;  4YI8 A;  5CSI A;  1QX7 A;  1KSO A;  5HYD A;  4UPG A;  2KGB C;  1NIW A;  5HKZ A;  1KK7 Y;  1Q80 A;  4HRE E;  1SKT A;  4C0K A;  3JTD C;  1WLM A;  1EH2 A;  2KI6 C;  2LVJ A;  1BMO A;  1SCV A;  2AMI A;  2L4H A;  1EG3 A;  2ZRT A;  1QIV A;  2KAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...