3O6BA

A dual e3 mechanism for rub1 ligation to cdc53: dcn1(p)-cdc53(whb) low resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
195
structure length
195
Chain Sequence
b'PKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title A dual E3 mechanism for Rub1 ligation to Cdc53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase, cell cycle
total genus 57
structure length 195
sequence length 195
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o6bA01
1FW4A 4MEWA 4DS7A 4DIRA 1DJYA 1J1DA 2K0JA 2LCPA 2JNXA 1NCZA 1ALVA 2K7BA 3TUYC 2M8UA 1TOPA 3PN7C 1D1OA 2LC5A 2LV7A 1ODBA 1ZOTB 1OZOA 4F0ZB 1BU3A 4A4CA 1QJTA 2KDHA 4YGEB 3WHUB 2ZRSA 3SG4A 4PE1A 2M7NA 3NSIA 3OB2B 3KO0A 1RK9A 3RM1A 1CNPA 1JFJA 4E68A 1GGZA 1XFUO 2KGBC 3IQOA 1NX3A 2F3ZA 4I5JA 1OMDA 1SNLA 1S3PA 1NX2A 5I2LA 1B47A 1YRUB 1IJ5A 1NPQA 2MAZA 1CDMA 1U5IA 3VROA 1FI6A 1SMGA 2LLUA 1AJ5A 4U8DA 2NLNA 1SPYA 1WRKA 2QPTA 1J1EA 2ISDA 1J7PA 1MHOA 1TTXA 1JFKA 1TNXA 2DOQA 4C0LA 2JT0A 2K2FA 1SCMC 1DVIA 1KFXS 5KSZA 5JOLA 1DGVA 1A75B 1AHRA 1EG4A 1CMGA 2FJUB 1K90D 2LVIA 4QJ4B 4GGFA 2HPSA 2WCFA 1WRLA 1G4YR 2L2EA 3BYAA 5DKQA 2ZRTA 3SG6A 1B4CA 1WDCB 2ZFDA 1SY9A 2LVJA 3EK4A 2KI6C 1KQMC 2BE4A 3PALA 4JWQA 2JRFA 3CZTX 3FWCA 4JPZB 2QACA 3MSEB 1KFXL 1S5GZ 2PALA 3O78A 4YRUA 2LVKA 2M3WA 1J7RA 2AUCA 1GGWA 1PK0D 1OOJA 3O6BA 1ZACA 2PVBA 3AAKA 3NSOA 2O60A 4XYNA 2LNKA 2SASA 2FCDA 2F3YA 2KYFA 3GK2A 2LP3A 1YTZC 3OX5A 1V1GA 3ZWHA 1TNQA 1RROA 4D1EA 4HREE 2K8MB 2Y5IA 5ER5A 3NSKA 5AFPA 4JQ0D 1S5GY 1UHIA 4PALA 2WOSA 1S6IA 1L2OB 3BOWB 4ORBB 2OTGB 3EK8A 1L7ZA 2EC6B 1TRFA 1OMRA 1SR6C 3CR4X 1KFUS 1VRKA 2JQ6A 5AANA 3WXAA 1XVJA 2F2OA 3DVMA 5CSIA 1UHHA 2M49B 1IQ5A 2JOJA 1J7OA 4MRYA 1S36A 2HF5A 1Y1XA 1Y0VH 2KAVA 1XFZO 3DF0B 4M2PA 5KTYA 3HX4A 2WNDA 4P2YB 2MBXA 1BLQA 1CLLA 1PSRA 4PCWA 4PE0A 1BMOA 1PVAA 1MF8B 1TNWA 3EVUA 1JF2A 1MQ1A 4YBHB 4A4BA 1B7TY 1F54A 4Q04A 2EGDA 3BQ3A 4GUKA 1XO5A 3LK1A 1XA5A 2JZIA 1OE9B 1G33A 1CFPA 1K9UA 2CT9A 4YGDB 2F33A 2EHBA 4MLWA 5AXIA 1EG3A 2GGMA 1J7QA 2L51A 2PMYA 2Q4UA 1DF0A 1LA0A 2NCOA 2Y4QA 3CS1A 4FQOA 4N1FA 3TUYB 5JJGA 1QLKA 3PN7B 1WLMA 2BCXA 5I8NA 2LANA 2LP2A 1FBVA 1JWDA 4HRGA 2KBIA 4C0JA 1SYMA 2KSPA 2M9GA 1SK6D 1ALWA 1QS7A 3QRXA 2CCMA 4YGAA 1TN4A 1DT7B 1KSOA 1IG5A 2G2BA 1K94A 2JPTA 3ICBA 4DCKA 5I2QA 3PFVA 1QV0A 1QX5B 1IKUA 1F70A 1Y6WA 4YGCB 3JTDB 5AEQA 1MUXA 1HQVA 3PLFB 1SCMB 4NQGA 2VRGA 3SJSA 2WORA 3GK4X 4TNCA 1F55A 3I5GC 3F45A 2E6WA 3BXKA 4GGFC 1XFXO 3BUXB 1UP5A 2LHIA 4GFTA 3IQQA 1V1FA 1QLSA 2F2PA 4OV2A 1YR5A 1KQMB 1BT6A 4AQJA 1PVBA 1IRJA 1C7WA 4P5OE 1JSAA 1BODA 1S26D 1BG1A 1R6PA 2SCPA 4WQ2A 4I5NB 3JVTC 1K9PA 1ZFSA 1K96A 1CKKA 3KF9A 2KAYA 5HKWA 3C1VA 4OR9B 1K8UA 2CBLA 2L50A 2LUCA 1NUBA 4NDDA 4M2QA 5I2OA 1DJIA 2COLB 1K95A 1SL9A 4PHNA 3AAJA 3I5HC 1CLMA 2I94A 1AUIB 1YVHA 1TNPA 1EL4A 1XYDA 1K2HA 1KCYA 2M1UA 2TN4A 2WCBA 3SG7A 1A4PA 1LINA 1Y1UA 4QJ3B 5GQQC 2LMUA 4ICBA 1NCYA 1AJ4A 5CSJA 3WHTB 5IBWA 3TZ1A 1S1EA 3VGOA 1SR6B 2BL0C 1MXLC 5BPJA 3NXAA 1LA3A 1QX7A 1UWOA 1C07A 2LVVA 4L9MA 3CR2A 1CM1A 1CB1A 3A4UB 1CLBA 1IJ6A 1GJYA 1QASA 2L98A 1DF0B 2H2KA 4OCIA 3ZNIA 1DJZA 1WY9A 2KGRA 2L0PA 3I5FB 4N5XA 5D7FA 3D0YA 3EVVA 4I5KA 1K93D 1X02A 5ER4X 1S6CA 3WNXB 3PSRA 4CPVA 1QATA 3EKJA 2OS8C 3TS5C 2O5GA 3DVKA 2RGIA 3LK0A 2LMTA 2MHHA 2LLTA 1KK8C 1YX8A 2M29A 4R1EA 4YI8A 1M45A 1YX7A 1OSAA 1YUSA 2LE9B 2ZN8A 2IS9A 1AVSA 3EVRA 1LVCD 5FYXA 1A03A 1F71A 3VRNA 1H4BA 2GGZA 1NYAA 3EKHA 3H4SE 2CNPA 3GOFA 1DJGA 2HETA 2R2IA 3CLNA 1F4QA 2JNFA 4ZCVA 2M0RA 4M2OA 1M63B 3CTNA 1NX1A 2BE6A 3SG3A 5CSNA 2CTNA 4XJKA 2MA2A 2JTTA 3K21A 3FIAA 1PULA 1RFJA 1KFUL 1DJXA 1BOCA 4FTGA 5G08A 4UPGA 1U5IB 1JF0A 1YUTA 4N1GA 1HT9A 3DVEA 1RWYA 2WCEA 2GV5A 1JUOA 1J55A 3D10A 5DKRA 4CIDA 2K2AA 2K61A 2LLSA 2KHNA 3FWBA 3LCPC 2KQYA 4I5LB 3LLEA 2MJWB 4WRIA 1QVIZ 4GBAA 4MBEA 2ZNDA 1LKJA 3FS7A 1BR1B 3VRQA 1EXRA 1RECA 2CXJA 2JT8A 3NSLA 1UHJA 2JT3A 2ZN9A 2KI4C 2LUXA 5HLVA 2NCPA 2NXQA 1SRAA 1WLZA 5HYDA 5CSFA 2I2RE 1PALA 2JXLA 2JTZA 1QX2A 3SG2A 1SL8A 1OZSA 2BKIB 1QVIY 3HCMA 5HKZA 1CDLA 5D69A 2D8NA 2M1KB 4CLNA 3BOWA 1RTP1 2FCEA 1CFFA 3JVTB 2L4IA 1GQMA 5DKNA 1YURA 1IH0A 4ZCUA 1JC2A 5K89A 4MZLA 1M31A 2LAPA 4GGNA 1YRTB 3DD4A 1KK7Z 1YUUA 5J3XA 1PRWA 4ORAB 3D0YB 3I5HB 1FPWA 1WRZA 1N0YA 2PSRA 3BUOB 1YVLA 4PHJA 3DF0A 2P6BB 2HQWA 1A2XA 2BCBA 3CWGA 1W7JB 3I5IC 1UHKA 4AQIA 1DMOA 1H8BA 1BF5A 1W7IB 1NSHA 2H61C 4AOMA 1XFWO 2I18A 2FOTA 1N65A 1CDNA 2ZNEA 2I7AA 1EH2A 2BL0B 1M46A 3SIAA 1KK7Y 1KWOC 3PATA 4NDCA 4YI9A 1R2UA 1F4OA 2JULA 1N2DA 1B8LA 2KFGA 2KI6D 2Y1NA 1CTRA 2Y1MA 3RLZA 2BECA 2K7DA 4PHMA 1S6JA 1OMVA 1QIVA 1RJVA 3JTDC 1NX0A 1DGUA 4MRXA 2PRUA 2AMIA 5HKYA 2JU0A 2OS8B 4XJKB 2JC2A 3TDIA 3TS5B 2E30A 1E8AA 1XK4C 3VRRA 2KBMA 4MZKA 3KEVA 3SIBA 1QTXA 1KQVA 4C0KA 1KK8B 2H61A 2BBNA 1PSBA 2LM5A 1UURA 1BJFA 1UUSA 2MLEC 1MR8A 4YGBB 4OKHA 3O2PA 3OHMB 4DRWA 3LL8B 3EK7A 2M97A 1G8IA 4WQ3A 4CFQA 1F8HA 2V53A 1SBJA 2KFFA 2LHLA 1Y1AA 1OQPA 2F8PA 1IWQA 1BR4B 3KHEA 4DUQA 2JWWA 3M0WA 3VRPA 4GAOA 2L5XB 1XK4A 1M39A 1FF1A 3OX6A 5CPVA 1CFDA 2K7OA 3CR5X 1CM4A 2LMVA 2AAOA 4GNKB 5KU1A 1AP4A 4HRHA 4ORCB 3A8RA 3E3RA 3KPXA 4OVNF 1QXPA 1XFYO 1WDCC 3DVJA 4BY5A 5PALA 1TCFA 1B8RA 1K9KA 1UHNA 1TCOB 4MVFA 1SW8A 3BUNB 1IGVA 3AKAA 1KSMA 3OP0A 3BUMB 2K7CA 1A75A 2KI4B 1DTLA 4MN0A 1B7TZ 5F6TA 3BUWB 2BBMA 2HQ8A 4BY4A 2WC8A 2PASA 1JBAA 3CGAA 2G9BA 3PM8A 3I5FC 4MZJA 1CMFA 2BKHB 3IF7A 3O4YA 1B1GA 2KNEA 3GK1A 4HSZA 2KAXA 2KYCA 4GPLB 1IQ3A 4CFRA 1L2OC 3OB1B 4MSPA 2OTGC 4IL1A 1QV1A 1TIZA 2KQ6A 2EC6C 2L4HA 2M7LA 1DJWA 5AERA 4ETOA 3SG5A 4PHKA 3TDUA 3I5GB 4PDZA 1ZMZA 1NCXA 4PE4A 5B8IB 2KOTA 1MXEA 2OPOA 2Q91A 2B1UA 1XFVO 1LXFC 1B8CA 2NZ0A 1ZUZA 1FI5A 3TDZA 1NP8A 3I5IB 4USLA 1CFCA 1NWDA 2A4JA 1Q80A 1DJHA 2BCAA 1CDPA 1QIWA 2JXCA 2MRDA 5HLOA 1AK8A 1B9AA 2MLFC 3AKBA 5TNCA 1C7VA 1SCVA 1EJ3A 2KFHA 1SKTA 1A29A 1KWOB 1SL7A 4PE7A 4QJ5B 4NDBA 1NIWA 2ZKMX 1MWNA
chains in the Genus database with same CATH superfamily
1FW4A 4MEWA 4DS7A 4DIRA 1DJYA 3CZ1A 1J1DA 2K0JA 2LCPA 2JNXA 1NCZA 1ALVA 2K7BA 3TUYC 2M8UA 1TOPA 3PN7C 1D1OA 2LC5A 2LV7A 1OOGA 3B87A 1ODBA 1ZOTB 1OZOA 4F0ZB 1BU3A 4A4CA 1QJTA 2KDHA 4YGEB 3WHUB 2ZRSA 2ERBA 4PE1A 2M7NA 3NSIA 3OB2B 3KO0A 1RK9A 3RM1A 3SG4A 1CNPA 4E68A 1GGZA 1XFUO 2KGBC 3IQOA 1NX3A 2F3ZA 4I5JA 1OMDA 1SNLA 1S3PA 1NX2A 5I2LA 1B47A 1YRUB 1IJ5A 1NPQA 2QDIA 2MAZA 1CDMA 1QWVA 1U5IA 3VROA 1FI6A 1SMGA 2LLUA 1AJ5A 4U8DA 2NLNA 1SPYA 4F7FA 1T14A 1WRKA 2QPTA 1J1EA 2QEOA 2ISDA 1J7PA 1MHOA 1TTXA 1JFKA 1TNXA 2DOQA 3Q8IA 4C0LA 2JT0A 2K2FA 3L4LA 1SCMC 1DVIA 2BAPA 1KFXS 5KSZA 3PM2A 5JOLA 1DGVA 1A75B 3SS4A 1AHRA 1EG4A 1Z4HA 1CMGA 2FJUB 1K90D 2LVIA 4QJ4B 4GGFA 2HPSA 2WCFA 1WRLA 1G4YR 2L2EA 3BYAA 5DKQA 2ZRTA 3SG6A 1B4CA 1WDCB 2ZFDA 1SY9A 2LVJA 3EK4A 2KI6C 1KQMC 2BE4A 3PALA 1C3ZA 4JWQA 1P28A 2JRFA 3CZTX 3FWCA 4JPZB 2QACA 3MSEB 1KFXL 1S5GZ 2PALA 3O78A 4YRUA 2LVKA 2M3WA 1J7RA 2AUCA 1GGWA 1PK0D 1OOJA 3O6BA 1ZACA 2PVBA 3AAKA 3B86A 3RZSA 3NSOA 2O60A 4XYNA 2LNKA 2SASA 2FCDA 2F3YA 2KYFA 3DYEA 3GK2A 2LP3A 1YTZC 3OX5A 1V1GA 3ZWHA 1TNQA 3D75A 1RROA 3CDNA 4HREE 4JKTA 2K8MB 2Y5IA 4D1EA 5ER5A 3NSKA 5AFPA 4JQ0D 1S5GY 2WCKA 1UHIA 4PALA 2L2CA 2WOSA 1S6IA 3R1VA 1L2OB 3BOWB 4ORBB 2OTGB 2GTEA 3EK8A 3S0FA 1L7ZA 2EC6B 1TRFA 2QEBA 3PJIA 5EL2A 1OMRA 1SR6C 3CR4X 1KFUS 1VRKA 2JQ6A 5AANA 3WXAA 1XVJA 2F2OA 3DVMA 5CSIA 1UHHA 2M49B 1IQ5A 2JOJA 1J7OA 4MRYA 1S36A 2HF5A 1Y1XA 1Y0VH 2KAVA 1XFZO 3DF0B 4M2PA 5KTYA 3HX4A 2WNDA 4P2YB 2MBXA 1BLQA 1CLLA 1PSRA 4INXA 4PCWA 1BMOA 1PVAA 4PE0A 1MF8B 3R1PA 1TNWA 3EVUA 1JF2A 1MQ1A 3CZ0A 4YBHB 2K60A 4A4BA 1B7TY 2JPOA 1F54A 4Q04A 2EGDA 3BQ3A 4GUKA 1XO5A 3LK1A 1XA5A 2JZIA 1OE9B 2WCMA 2P71A 1G33A 1CFPA 1K9UA 2CT9A 4YGDB 2F33A 2EHBA 3B6XA 4MLWA 5AXIA 1EG3A 2GGMA 1J7QA 5I94A 2L51A 2PMYA 2Q4UA 1DF0A 1LA0A 2NCOA 2Y4QA 3CS1A 4FQOA 4N1FA 3TUYB 5JJGA 1QLKA 3PN7B 1WLMA 2BCXA 5I8NA 2LANA 2LP2A 1FBVA 1JWDA 4HRGA 5FI6A 2KBIA 4OZDA 4C0JA 1SYMA 2KSPA 2M9GA 3L47A 3R72A 1SK6D 3V2LA 1ALWA 2WCHA 1QS7A 3FE9A 3QRXA 2CCMA 4YGAA 1TN4A 1DT7B 3CZ2A 1KSOA 1IG5A 2G2BA 1K94A 1XFRA 2JPTA 3ICBA 4DCKA 5I2QA 3PFVA 1QV0A 1QX5B 1IKUA 3QMEA 1F70A 1Y6WA 4YGCB 3JTDB 5AEQA 2BNXA 1MUXA 1HQVA 3OGNA 2P70A 3PLFB 1OW4A 1SCMB 3IVTA 5FI2A 4NQGA 2VRGA 3D78A 3SJSA 2WORA 3GK4X 4TNCA 1F55A 3I5GC 3F45A 2E6WA 3BXKA 4GGFC 1XFXO 3BUXB 1UP5A 2LHIA 4GFTA 3IQQA 1V1FA 1QLSA 2F2PA 1ORGA 4OV2A 1YR5A 1KQMB 1BT6A 4AQJA 1PVBA 1IRJA 1C7WA 4P5OE 1JSAA 1BODA 1S26D 2PYQA 1BG1A 1R6PA 2SCPA 4WQ2A 3BFAA 4I5NB 3JVTC 1K9PA 1ZFSA 1K96A 1CKKA 3KF9A 2KAYA 5HKWA 2WC5A 1OOIX 3C1VA 4OR9B 1K8UA 2CBLA 2L50A 2LUCA 1NUBA 4NDDA 4M2QA 5I2OA 1DJIA 3BJHA 2COLB 1K95A 1SL9A 4PHNA 3DY9A 2WC6A 3AAJA 3I5HC 1CLMA 2I94A 1AUIB 1YVHA 1TNPA 1EL4A 1XYDA 1K2HA 1KCYA 2M1UA 2TN4A 3R1OA 2WCBA 3SG7A 1A4PA 1LINA 1Y1UA 3BFBA 4QJ3B 5GQQC 2LMUA 4ICBA 1NCYA 1AJ4A 5CSJA 3WHTB 5IBWA 3TZ1A 1S1EA 3VGOA 1SR6B 2BL0C 1MXLC 5BPJA 3NXAA 1LA3A 1QX7A 1UWOA 1C07A 2LVVA 4L9MA 3UO9A 3CR2A 1CM1A 2KPHA 1CB1A 3A4UB 1CLBA 1IJ6A 1GJYA 1QASA 2L98A 1DF0B 2H2KA 4OCIA 3ZNIA 1DJZA 1WY9A 2KGRA 2L0PA 3I5FB 4N5XA 5D7FA 3D0YA 3EVVA 4I5KA 1K93D 1X02A 5ER4X 1S6CA 1TUZA 3WNXB 3PSRA 4CPVA 1QATA 3EKJA 3D76A 2OS8C 3TS5C 3SS5A 2O5GA 3DVKA 2RGIA 3LK0A 2LMTA 2MHHA 5D3OA 2LLTA 1KK8C 1YX8A 2M29A 4R1EA 4YI8A 1M45A 1W9ZA 1OSAA 1YUSA 1YX7A 2LE9B 2ZN8A 2IS9A 1AVSA 1JFJA 3EVRA 1LVCD 5FYXA 1A03A 1F71A 3CABA 3VRNA 1H4BA 2GGZA 1NYAA 3EKHA 3H4SE 2CNPA 3GOFA 1LS8A 2PQLA 1DJGA 2HETA 2R2IA 3CLNA 1F4QA 2JNFA 4JD9A 2M0RA 4ZCVA 4M2OA 1M63B 3CTNA 1NX1A 2BE6A 3SG3A 5CSNA 2CTNA 3NHIA 4XJKA 2MA2A 2JTTA 3K21A 3UNWA 3FIAA 1PULA 1RFJA 1KFUL 1DJXA 1BOCA 4FTGA 3S0AA 5FI7A 5G08A 4UPGA 1U5IB 1JF0A 1YUTA 4N1GA 1HT9A 1TUJA 3DVEA 1RWYA 2WCEA 2GV5A 1JUOA 3NHTA 2KLEA 1J55A 3D10A 5DKRA 4CIDA 2K2AA 2K61A 3S0GA 2LLSA 2KHNA 3FWBA 3LCPC 2KQYA 4I5LB 3LLEA 2MJWB 4WRIA 1QVIZ 4GBAA 4MBEA 2ZNDA 1LKJA 3FS7A 1BR1B 3VRQA 1EXRA 1RECA 2CXJA 2JT8A 3CYZA 3NSLA 1UHJA 2JT3A 3D77A 2ZN9A 4PT1A 2KI4C 2LUXA 5HLVA 2NCPA 2NXQA 1SRAA 3S0EA 1WLZA 1Z2CB 5HYDA 5CSFA 2I2RE 1PALA 2JXLA 2JTZA 5DICA 1QX2A 3SG2A 1SL8A 1OZSA 2BKIB 1QVIY 3HCMA 5HKZA 1CDLA 5D69A 2D8NA 2M1KB 4CLNA 3BOWA 1RTP1 2FCEA 1CFFA 3JVTB 3VB1A 2L4IA 2WCLA 1GQMA 5DKNA 3DZTA 1YURA 1IH0A 4ZCUA 1JC2A 5K89A 3K1EA 4MZLA 1M31A 2LAPA 4GGNA 1YRTB 1SSEB 3DD4A 1KK7Z 1YUUA 5J3XA 1PRWA 4ORAB 3D0YB 3I5HB 1FPWA 1WRZA 1N0YA 3L4AA 2PSRA 3BUOB 1YVLA 4PHJA 3DF0A 2P6BB 2HQWA 1A2XA 2BCBA 3CWGA 1W7JB 3I5IC 4INWA 1UHKA 4AQIA 1DMOA 1H8BA 1BF5A 1W7IB 1NSHA 2H61C 4AOMA 1XFWO 2I18A 2FOTA 4FQTA 1N65A 1CDNA 2ZNEA 2I7AA 1EH2A 2BL0B 3FE6A 1M46A 3SIAA 3S0DA 1KK7Y 1KWOC 3DXLA 3PATA 4NDCA 4YI9A 1R2UA 1F4OA 5HKYA 2JULA 1N2DA 1B8LA 2KFGA 2KI6D 2Y1NA 1CTRA 2KLDA 2Y1MA 2QEVA 3RLZA 2BECA 2K7DA 4PHMA 1S6JA 1OMVA 1QIVA 1RJVA 3JTDC 1NX0A 1DGUA 4MRXA 1DQEA 2AMIA 2PRUA 2JU0A 2OS8B 4XJKB 2JC2A 3TDIA 3TS5B 2E30A 1E8AA 1XK4C 3VRRA 2KBMA 4MZKA 3KEVA 3SIBA 1QTXA 1KQVA 4C0KA 1KK8B 2H61A 2BBNA 1PSBA 2LM5A 3SS3A 1UURA 1BJFA 1UUSA 2H8VA 2MLEC 1MR8A 4IJ7A 4YGBB 4OKHA 3O2PA 3OHMB 4DRWA 1GM0A 3LL8B 3S0BA 3EK7A 2M97A 1G8IA 4WQ3A 4CFQA 1F8HA 2V53A 1SBJA 2KFFA 2LHLA 1Y1AA 3BFHA 1OQPA 2F8PA 3FE8A 1IWQA 1DC1A 1BR4B 3KHEA 4DUQA 2JWWA 3M0WA 3VRPA 1OOFA 4GAOA 2L5XB 1XK4A 2WCJA 1M39A 1FF1A 1C3YA 3OX6A 5CPVA 1CFDA 4KYNA 5HL1A 2K7OA 3CR5X 1CM4A 2LMVA 2AAOA 3N7HA 4GNKB 5KU1A 1AP4A 4HRHA 4ORCB 3A8RA 3E3RA 3KPXA 4OVNF 1QXPA 1XFYO 1WDCC 1DEKA 3DVJA 4BY5A 5PALA 1TCFA 1B8RA 1K9KA 1UHNA 1TCOB 4MVFA 1SW8A 3BUNB 1IGVA 3AKAA 1KSMA 3OP0A 2L5YA 3BUMB 2K7CA 2QEHA 1A75A 2KI4B 1DTLA 4MN0A 1B7TZ 3NGVA 3BUWB 5F6TA 2BBMA 2HQ8A 4BY4A 2WC8A 2PASA 3D74A 1JBAA 2FJYA 2G9BA 3CGAA 3PM8A 2YGUA 3I5FC 4MZJA 1CMFA 2BKHB 3IF7A 1TWOA 3O4YA 1B1GA 2KNEA 3GK1A 4HSZA 3D73A 2KAXA 2KYCA 4GPLB 1IQ3A 4CFRA 1L2OC 3B88A 3OB1B 4MSPA 2OTGC 4IL1A 1QV1A 1TIZA 2KQ6A 2EC6C 2L4HA 2M7LA 1OOHA 1DJWA 5AERA 4ETOA 3SG5A 3O4XA 4PHKA 3TDUA 3I5GB 4PDZA 1ZMZA 1NCXA 4PE4A 5B8IB 2KOTA 1MXEA 2OPOA 2Q91A 2B1UA 1XFVO 3B7AA 1LXFC 1B8CA 2NZ0A 1ZUZA 1FI5A 1DELA 3TDZA 1NP8A 3I5IB 4USLA 1CFCA 1NWDA 1Q80A 2A4JA 1DJHA 1CDPA 1QIWA 2BCAA 2JXCA 2MRDA 5HLOA 1AK8A 1B9AA 2MLFC 3AKBA 3EG5B 3OBVA 5TNCA 1IIOA 1C7VA 1SCVA 1EJ3A 2KFHA 1SKTA 1A29A 1KWOB 1SL7A 4PE7A 4QJ5B 4NDBA 1NIWA 2ZKMX 1MWNA
chains in the Genus database with same CATH topology
1FW4A 4MEWA 4DS7A 4DIRA 1DJYA 1J1DA 2K0JA 2LCPA 2JNXA 1NCZA 1ALVA 2K7BA 3TUYC 2M8UA 1TOPA 3PN7C 1D1OA 2LC5A 2LV7A 1ODBA 1ZOTB 1OZOA 4F0ZB 1BU3A 4A4CA 1QJTA 2KDHA 4YGEB 3WHUB 2ZRSA 3SG4A 4PE1A 2M7NA 3NSIA 3OB2B 3KO0A 1RK9A 3RM1A 1CNPA 1JFJA 4E68A 1GGZA 1XFUO 2KGBC 3IQOA 1NX3A 2F3ZA 4I5JA 1OMDA 1SNLA 1S3PA 1NX2A 5I2LA 1B47A 1YRUB 1IJ5A 1NPQA 2MAZA 1CDMA 1U5IA 3VROA 1FI6A 1SMGA 2LLUA 1AJ5A 4U8DA 2NLNA 1SPYA 1WRKA 2QPTA 1J1EA 2ISDA 1J7PA 1MHOA 1TTXA 1JFKA 1TNXA 2DOQA 4C0LA 2JT0A 2K2FA 1SCMC 1DVIA 1KFXS 5KSZA 5JOLA 1DGVA 1A75B 1AHRA 1EG4A 1CMGA 2FJUB 1K90D 2LVIA 4QJ4B 4GGFA 2HPSA 2WCFA 1WRLA 1G4YR 2L2EA 3BYAA 5DKQA 2ZRTA 3SG6A 1B4CA 1WDCB 2ZFDA 1SY9A 2LVJA 3EK4A 2KI6C 1KQMC 2BE4A 3PALA 4JWQA 2JRFA 3CZTX 3FWCA 4JPZB 2QACA 3MSEB 1KFXL 1S5GZ 2PALA 3O78A 4YRUA 2LVKA 2M3WA 1J7RA 2AUCA 1GGWA 1PK0D 1OOJA 3O6BA 1ZACA 2PVBA 3AAKA 3NSOA 2O60A 4XYNA 2LNKA 2SASA 2FCDA 2F3YA 2KYFA 3GK2A 2LP3A 1YTZC 3OX5A 1V1GA 3ZWHA 1TNQA 1RROA 4D1EA 4HREE 2K8MB 2Y5IA 5ER5A 3NSKA 5AFPA 4JQ0D 1S5GY 1UHIA 4PALA 2WOSA 1S6IA 1L2OB 3BOWB 4ORBB 2OTGB 3EK8A 1L7ZA 2EC6B 1TRFA 1OMRA 1SR6C 3CR4X 1KFUS 1VRKA 2JQ6A 5AANA 3WXAA 1XVJA 2F2OA 3DVMA 5CSIA 1UHHA 2M49B 1IQ5A 2JOJA 1J7OA 4MRYA 1S36A 2HF5A 1Y1XA 1Y0VH 2KAVA 1XFZO 3DF0B 4M2PA 5KTYA 3HX4A 2WNDA 4P2YB 2MBXA 1BLQA 1CLLA 1PSRA 4PCWA 4PE0A 1BMOA 1PVAA 1MF8B 1TNWA 3EVUA 1JF2A 1MQ1A 4YBHB 4A4BA 1B7TY 1F54A 4Q04A 2EGDA 3BQ3A 4GUKA 1XO5A 3LK1A 1XA5A 2JZIA 1OE9B 1G33A 1CFPA 1K9UA 2CT9A 4YGDB 2F33A 2EHBA 4MLWA 5AXIA 1EG3A 2GGMA 1J7QA 2L51A 2PMYA 2Q4UA 1DF0A 1LA0A 2NCOA 2Y4QA 3CS1A 4FQOA 4N1FA 3TUYB 5JJGA 1QLKA 3PN7B 1WLMA 2BCXA 5I8NA 2LANA 2LP2A 1FBVA 1JWDA 4HRGA 2KBIA 4C0JA 1SYMA 2KSPA 2M9GA 1SK6D 1ALWA 1QS7A 3QRXA 2CCMA 4YGAA 1TN4A 1DT7B 1KSOA 1IG5A 2G2BA 1K94A 2JPTA 3ICBA 4DCKA 5I2QA 3PFVA 1QV0A 1QX5B 1IKUA 1F70A 1Y6WA 4YGCB 3JTDB 5AEQA 1MUXA 1HQVA 3PLFB 1SCMB 4NQGA 2VRGA 3SJSA 2WORA 3GK4X 4TNCA 1F55A 3I5GC 3F45A 2E6WA 3BXKA 4GGFC 1XFXO 3BUXB 1UP5A 2LHIA 4GFTA 3IQQA 1V1FA 1QLSA 2F2PA 4OV2A 1YR5A 1KQMB 1BT6A 4AQJA 1PVBA 1IRJA 1C7WA 4P5OE 1JSAA 1BODA 1S26D 1BG1A 1R6PA 2SCPA 4WQ2A 4I5NB 3JVTC 1K9PA 1ZFSA 1K96A 1CKKA 3KF9A 2KAYA 5HKWA 3C1VA 4OR9B 1K8UA 2CBLA 2L50A 2LUCA 1NUBA 4NDDA 4M2QA 5I2OA 1DJIA 2COLB 1K95A 1SL9A 4PHNA 3AAJA 3I5HC 1CLMA 2I94A 1AUIB 1YVHA 1TNPA 1EL4A 1XYDA 1K2HA 1KCYA 2M1UA 2TN4A 2WCBA 3SG7A 1A4PA 1LINA 1Y1UA 4QJ3B 5GQQC 2LMUA 4ICBA 1NCYA 1AJ4A 5CSJA 3WHTB 5IBWA 3TZ1A 1S1EA 3VGOA 1SR6B 2BL0C 1MXLC 5BPJA 3NXAA 1LA3A 1QX7A 1UWOA 1C07A 2LVVA 4L9MA 3CR2A 1CM1A 1CB1A 3A4UB 1CLBA 1IJ6A 1GJYA 1QASA 2L98A 1DF0B 2H2KA 4OCIA 3ZNIA 1DJZA 1WY9A 2KGRA 2L0PA 3I5FB 4N5XA 5D7FA 3D0YA 3EVVA 4I5KA 1K93D 1X02A 5ER4X 1S6CA 3WNXB 3PSRA 4CPVA 1QATA 3EKJA 2OS8C 3TS5C 2O5GA 3DVKA 2RGIA 3LK0A 2LMTA 2MHHA 2LLTA 1KK8C 1YX8A 2M29A 4R1EA 4YI8A 1M45A 1YX7A 1OSAA 1YUSA 2LE9B 2ZN8A 2IS9A 1AVSA 3EVRA 1LVCD 5FYXA 1A03A 1F71A 3VRNA 1H4BA 2GGZA 1NYAA 3EKHA 3H4SE 2CNPA 3GOFA 1DJGA 2HETA 2R2IA 3CLNA 1F4QA 2JNFA 4ZCVA 2M0RA 4M2OA 1M63B 3CTNA 1NX1A 2BE6A 3SG3A 5CSNA 2CTNA 4XJKA 2MA2A 2JTTA 3K21A 3FIAA 1PULA 1RFJA 1KFUL 1DJXA 1BOCA 4FTGA 5G08A 4UPGA 1U5IB 1JF0A 1YUTA 4N1GA 1HT9A 3DVEA 1RWYA 2WCEA 2GV5A 1JUOA 1J55A 3D10A 5DKRA 4CIDA 2K2AA 2K61A 2LLSA 2KHNA 3FWBA 3LCPC 2KQYA 4I5LB 3LLEA 2MJWB 4WRIA 1QVIZ 4GBAA 4MBEA 2ZNDA 1LKJA 3FS7A 1BR1B 3VRQA 1EXRA 1RECA 2CXJA 2JT8A 3NSLA 1UHJA 2JT3A 2ZN9A 2KI4C 2LUXA 5HLVA 2NCPA 2NXQA 1SRAA 1WLZA 5HYDA 5CSFA 2I2RE 1PALA 2JXLA 2JTZA 1QX2A 3SG2A 1SL8A 1OZSA 2BKIB 1QVIY 3HCMA 5HKZA 1CDLA 5D69A 2D8NA 2M1KB 4CLNA 3BOWA 1RTP1 2FCEA 1CFFA 3JVTB 2L4IA 1GQMA 5DKNA 1YURA 1IH0A 4ZCUA 1JC2A 5K89A 4MZLA 1M31A 2LAPA 4GGNA 1YRTB 3DD4A 1KK7Z 1YUUA 5J3XA 1PRWA 4ORAB 3D0YB 3I5HB 1FPWA 1WRZA 1N0YA 2PSRA 3BUOB 1YVLA 4PHJA 3DF0A 2P6BB 2HQWA 1A2XA 2BCBA 3CWGA 1W7JB 3I5IC 1UHKA 4AQIA 1DMOA 1H8BA 1BF5A 1W7IB 1NSHA 2H61C 4AOMA 1XFWO 2I18A 2FOTA 1N65A 1CDNA 2ZNEA 2I7AA 1EH2A 2BL0B 1M46A 3SIAA 1KK7Y 1KWOC 3PATA 4NDCA 4YI9A 1R2UA 1F4OA 2JULA 1N2DA 1B8LA 2KFGA 2KI6D 2Y1NA 1CTRA 2Y1MA 3RLZA 2BECA 2K7DA 4PHMA 1S6JA 1OMVA 1QIVA 1RJVA 3JTDC 1NX0A 1DGUA 4MRXA 2PRUA 2AMIA 5HKYA 2JU0A 2OS8B 4XJKB 2JC2A 3TDIA 3TS5B 2E30A 1E8AA 1XK4C 3VRRA 2KBMA 4MZKA 3KEVA 3SIBA 1QTXA 1KQVA 4C0KA 1KK8B 2H61A 2BBNA 1PSBA 2LM5A 1UURA 1BJFA 1UUSA 2MLEC 1MR8A 4YGBB 4OKHA 3O2PA 3OHMB 4DRWA 3LL8B 3EK7A 2M97A 1G8IA 4WQ3A 4CFQA 1F8HA 2V53A 1SBJA 2KFFA 2LHLA 1Y1AA 1OQPA 2F8PA 1IWQA 1BR4B 3KHEA 4DUQA 2JWWA 3M0WA 3VRPA 4GAOA 2L5XB 1XK4A 1M39A 1FF1A 3OX6A 5CPVA 1CFDA 2K7OA 3CR5X 1CM4A 2LMVA 2AAOA 4GNKB 5KU1A 1AP4A 4HRHA 4ORCB 3A8RA 3E3RA 3KPXA 4OVNF 1QXPA 1XFYO 1WDCC 3DVJA 4BY5A 5PALA 1TCFA 1B8RA 1K9KA 1UHNA 1TCOB 4MVFA 1SW8A 3BUNB 1IGVA 3AKAA 1KSMA 3OP0A 3BUMB 2K7CA 1A75A 2KI4B 1DTLA 4MN0A 1B7TZ 5F6TA 3BUWB 2BBMA 2HQ8A 4BY4A 2WC8A 2PASA 1JBAA 3CGAA 2G9BA 3PM8A 3I5FC 4MZJA 1CMFA 2BKHB 3IF7A 3O4YA 1B1GA 2KNEA 3GK1A 4HSZA 2KAXA 2KYCA 4GPLB 1IQ3A 4CFRA 1L2OC 3OB1B 4MSPA 2OTGC 4IL1A 1QV1A 1TIZA 2KQ6A 2EC6C 2L4HA 2M7LA 1DJWA 5AERA 4ETOA 3SG5A 4PHKA 3TDUA 3I5GB 4PDZA 1ZMZA 1NCXA 4PE4A 5B8IB 2KOTA 1MXEA 2OPOA 2Q91A 2B1UA 1XFVO 1LXFC 1B8CA 2NZ0A 1ZUZA 1FI5A 3TDZA 1NP8A 3I5IB 4USLA 1CFCA 1NWDA 2A4JA 1Q80A 1DJHA 2BCAA 1CDPA 1QIWA 2JXCA 2MRDA 5HLOA 1AK8A 1B9AA 2MLFC 3AKBA 5TNCA 1C7VA 1SCVA 1EJ3A 2KFHA 1SKTA 1A29A 1KWOB 1SL7A 4PE7A 4QJ5B 4NDBA 1NIWA 2ZKMX 1MWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FW4 A;  4MEW A;  4DS7 A;  4DIR A;  1DJY A;  1J1D A;  2K0J A;  2LCP A;  2JNX A;  1NCZ A;  1ALV A;  2K7B A;  3TUY C;  2M8U A;  1TOP A;  3PN7 C;  1D1O A;  2LC5 A;  2LV7 A;  1ODB A;  1ZOT B;  1OZO A;  4F0Z B;  1BU3 A;  4A4C A;  1QJT A;  2KDH A;  4YGE B;  3WHU B;  2ZRS A;  3SG4 A;  4PE1 A;  2M7N A;  3NSI A;  3OB2 B;  3KO0 A;  1RK9 A;  3RM1 A;  1CNP A;  1JFJ A;  4E68 A;  1GGZ A;  1XFU O;  2KGB C;  3IQO A;  1NX3 A;  2F3Z A;  4I5J A;  1OMD A;  1SNL A;  1S3P A;  1NX2 A;  5I2L A;  1B47 A;  1YRU B;  1IJ5 A;  1NPQ A;  2MAZ A;  1CDM A;  1U5I A;  3VRO A;  1FI6 A;  1SMG A;  2LLU A;  1AJ5 A;  4U8D A;  2NLN A;  1SPY A;  1WRK A;  2QPT A;  1J1E A;  2ISD A;  1J7P A;  1MHO A;  1TTX A;  1JFK A;  1TNX A;  2DOQ A;  4C0L A;  2JT0 A;  2K2F A;  1SCM C;  1DVI A;  1KFX S;  5KSZ A;  5JOL A;  1DGV A;  1A75 B;  1AHR A;  1EG4 A;  1CMG A;  2FJU B;  1K90 D;  2LVI A;  4QJ4 B;  4GGF A;  2HPS A;  2WCF A;  1WRL A;  1G4Y R;  2L2E A;  3BYA A;  5DKQ A;  2ZRT A;  3SG6 A;  1B4C A;  1WDC B;  2ZFD A;  1SY9 A;  2LVJ A;  3EK4 A;  2KI6 C;  1KQM C;  2BE4 A;  3PAL A;  4JWQ A;  2JRF A;  3CZT X;  3FWC A;  4JPZ B;  2QAC A;  3MSE B;  1KFX L;  1S5G Z;  2PAL A;  3O78 A;  4YRU A;  2LVK A;  2M3W A;  1J7R A;  2AUC A;  1GGW A;  1PK0 D;  1OOJ A;  3O6B A;  1ZAC A;  2PVB A;  3AAK A;  3NSO A;  2O60 A;  4XYN A;  2LNK A;  2SAS A;  2FCD A;  2F3Y A;  2KYF A;  3GK2 A;  2LP3 A;  1YTZ C;  3OX5 A;  1V1G A;  3ZWH A;  1TNQ A;  1RRO A;  4D1E A;  4HRE E;  2K8M B;  2Y5I A;  5ER5 A;  3NSK A;  5AFP A;  4JQ0 D;  1S5G Y;  1UHI A;  4PAL A;  2WOS A;  1S6I A;  1L2O B;  3BOW B;  4ORB B;  2OTG B;  3EK8 A;  1L7Z A;  2EC6 B;  1TRF A;  1OMR A;  1SR6 C;  3CR4 X;  1KFU S;  1VRK A;  2JQ6 A;  5AAN A;  3WXA A;  1XVJ A;  2F2O A;  3DVM A;  5CSI A;  1UHH A;  2M49 B;  1IQ5 A;  2JOJ A;  1J7O A;  4MRY A;  1S36 A;  2HF5 A;  1Y1X A;  1Y0V H;  2KAV A;  1XFZ O;  3DF0 B;  4M2P A;  5KTY A;  3HX4 A;  2WND A;  4P2Y B;  2MBX A;  1BLQ A;  1CLL A;  1PSR A;  4PCW A;  4PE0 A;  1BMO A;  1PVA A;  1MF8 B;  1TNW A;  3EVU A;  1JF2 A;  1MQ1 A;  4YBH B;  4A4B A;  1B7T Y;  1F54 A;  4Q04 A;  2EGD A;  3BQ3 A;  4GUK A;  1XO5 A;  3LK1 A;  1XA5 A;  2JZI A;  1OE9 B;  1G33 A;  1CFP A;  1K9U A;  2CT9 A;  4YGD B;  2F33 A;  2EHB A;  4MLW A;  5AXI A;  1EG3 A;  2GGM A;  1J7Q A;  2L51 A;  2PMY A;  2Q4U A;  1DF0 A;  1LA0 A;  2NCO A;  2Y4Q A;  3CS1 A;  4FQO A;  4N1F A;  3TUY B;  5JJG A;  1QLK A;  3PN7 B;  1WLM A;  2BCX A;  5I8N A;  2LAN A;  2LP2 A;  1FBV A;  1JWD A;  4HRG A;  2KBI A;  4C0J A;  1SYM A;  2KSP A;  2M9G A;  1SK6 D;  1ALW A;  1QS7 A;  3QRX A;  2CCM A;  4YGA A;  1TN4 A;  1DT7 B;  1KSO A;  1IG5 A;  2G2B A;  1K94 A;  2JPT A;  3ICB A;  4DCK A;  5I2Q A;  3PFV A;  1QV0 A;  1QX5 B;  1IKU A;  1F70 A;  1Y6W A;  4YGC B;  3JTD B;  5AEQ A;  1MUX A;  1HQV A;  3PLF B;  1SCM B;  4NQG A;  2VRG A;  3SJS A;  2WOR A;  3GK4 X;  4TNC A;  1F55 A;  3I5G C;  3F45 A;  2E6W A;  3BXK A;  4GGF C;  1XFX O;  3BUX B;  1UP5 A;  2LHI A;  4GFT A;  3IQQ A;  1V1F A;  1QLS A;  2F2P A;  4OV2 A;  1YR5 A;  1KQM B;  1BT6 A;  4AQJ A;  1PVB A;  1IRJ A;  1C7W A;  4P5O E;  1JSA A;  1BOD A;  1S26 D;  1BG1 A;  1R6P A;  2SCP A;  4WQ2 A;  4I5N B;  3JVT C;  1K9P A;  1ZFS A;  1K96 A;  1CKK A;  3KF9 A;  2KAY A;  5HKW A;  3C1V A;  4OR9 B;  1K8U A;  2CBL A;  2L50 A;  2LUC A;  1NUB A;  4NDD A;  4M2Q A;  5I2O A;  1DJI A;  2COL B;  1K95 A;  1SL9 A;  4PHN A;  3AAJ A;  3I5H C;  1CLM A;  2I94 A;  1AUI B;  1YVH A;  1TNP A;  1EL4 A;  1XYD A;  1K2H A;  1KCY A;  2M1U A;  2TN4 A;  2WCB A;  3SG7 A;  1A4P A;  1LIN A;  1Y1U A;  4QJ3 B;  5GQQ C;  2LMU A;  4ICB A;  1NCY A;  1AJ4 A;  5CSJ A;  3WHT B;  5IBW A;  3TZ1 A;  1S1E A;  3VGO A;  1SR6 B;  2BL0 C;  1MXL C;  5BPJ A;  3NXA A;  1LA3 A;  1QX7 A;  1UWO A;  1C07 A;  2LVV A;  4L9M A;  3CR2 A;  1CM1 A;  1CB1 A;  3A4U B;  1CLB A;  1IJ6 A;  1GJY A;  1QAS A;  2L98 A;  1DF0 B;  2H2K A;  4OCI A;  3ZNI A;  1DJZ A;  1WY9 A;  2KGR A;  2L0P A;  3I5F B;  4N5X A;  5D7F A;  3D0Y A;  3EVV A;  4I5K A;  1K93 D;  1X02 A;  5ER4 X;  1S6C A;  3WNX B;  3PSR A;  4CPV A;  1QAT A;  3EKJ A;  2OS8 C;  3TS5 C;  2O5G A;  3DVK A;  2RGI A;  3LK0 A;  2LMT A;  2MHH A;  2LLT A;  1KK8 C;  1YX8 A;  2M29 A;  4R1E A;  4YI8 A;  1M45 A;  1YX7 A;  1OSA A;  1YUS A;  2LE9 B;  2ZN8 A;  2IS9 A;  1AVS A;  3EVR A;  1LVC D;  5FYX A;  1A03 A;  1F71 A;  3VRN A;  1H4B A;  2GGZ A;  1NYA A;  3EKH A;  3H4S E;  2CNP A;  3GOF A;  1DJG A;  2HET A;  2R2I A;  3CLN A;  1F4Q A;  2JNF A;  4ZCV A;  2M0R A;  4M2O A;  1M63 B;  3CTN A;  1NX1 A;  2BE6 A;  3SG3 A;  5CSN A;  2CTN A;  4XJK A;  2MA2 A;  2JTT A;  3K21 A;  3FIA A;  1PUL A;  1RFJ A;  1KFU L;  1DJX A;  1BOC A;  4FTG A;  5G08 A;  4UPG A;  1U5I B;  1JF0 A;  1YUT A;  4N1G A;  1HT9 A;  3DVE A;  1RWY A;  2WCE A;  2GV5 A;  1JUO A;  1J55 A;  3D10 A;  5DKR A;  4CID A;  2K2A A;  2K61 A;  2LLS A;  2KHN A;  3FWB A;  3LCP C;  2KQY A;  4I5L B;  3LLE A;  2MJW B;  4WRI A;  1QVI Z;  4GBA A;  4MBE A;  2ZND A;  1LKJ A;  3FS7 A;  1BR1 B;  3VRQ A;  1EXR A;  1REC A;  2CXJ A;  2JT8 A;  3NSL A;  1UHJ A;  2JT3 A;  2ZN9 A;  2KI4 C;  2LUX A;  5HLV A;  2NCP A;  2NXQ A;  1SRA A;  1WLZ A;  5HYD A;  5CSF A;  2I2R E;  1PAL A;  2JXL A;  2JTZ A;  1QX2 A;  3SG2 A;  1SL8 A;  1OZS A;  2BKI B;  1QVI Y;  3HCM A;  5HKZ A;  1CDL A;  5D69 A;  2D8N A;  2M1K B;  4CLN A;  3BOW A;  1RTP 1;  2FCE A;  1CFF A;  3JVT B;  2L4I A;  1GQM A;  5DKN A;  1YUR A;  1IH0 A;  4ZCU A;  1JC2 A;  5K89 A;  4MZL A;  1M31 A;  2LAP A;  4GGN A;  1YRT B;  3DD4 A;  1KK7 Z;  1YUU A;  5J3X A;  1PRW A;  4ORA B;  3D0Y B;  3I5H B;  1FPW A;  1WRZ A;  1N0Y A;  2PSR A;  3BUO B;  1YVL A;  4PHJ A;  3DF0 A;  2P6B B;  2HQW A;  1A2X A;  2BCB A;  3CWG A;  1W7J B;  3I5I C;  1UHK A;  4AQI A;  1DMO A;  1H8B A;  1BF5 A;  1W7I B;  1NSH A;  2H61 C;  4AOM A;  1XFW O;  2I18 A;  2FOT A;  1N65 A;  1CDN A;  2ZNE A;  2I7A A;  1EH2 A;  2BL0 B;  1M46 A;  3SIA A;  1KK7 Y;  1KWO C;  3PAT A;  4NDC A;  4YI9 A;  1R2U A;  1F4O A;  2JUL A;  1N2D A;  1B8L A;  2KFG A;  2KI6 D;  2Y1N A;  1CTR A;  2Y1M A;  3RLZ A;  2BEC A;  2K7D A;  4PHM A;  1S6J A;  1OMV A;  1QIV A;  1RJV A;  3JTD C;  1NX0 A;  1DGU A;  4MRX A;  2PRU A;  2AMI A;  5HKY A;  2JU0 A;  2OS8 B;  4XJK B;  2JC2 A;  3TDI A;  3TS5 B;  2E30 A;  1E8A A;  1XK4 C;  3VRR A;  2KBM A;  4MZK A;  3KEV A;  3SIB A;  1QTX A;  1KQV A;  4C0K A;  1KK8 B;  2H61 A;  2BBN A;  1PSB A;  2LM5 A;  1UUR A;  1BJF A;  1UUS A;  2MLE C;  1MR8 A;  4YGB B;  4OKH A;  3O2P A;  3OHM B;  4DRW A;  3LL8 B;  3EK7 A;  2M97 A;  1G8I A;  4WQ3 A;  4CFQ A;  1F8H A;  2V53 A;  1SBJ A;  2KFF A;  2LHL A;  1Y1A A;  1OQP A;  2F8P A;  1IWQ A;  1BR4 B;  3KHE A;  4DUQ A;  2JWW A;  3M0W A;  3VRP A;  4GAO A;  2L5X B;  1XK4 A;  1M39 A;  1FF1 A;  3OX6 A;  5CPV A;  1CFD A;  2K7O A;  3CR5 X;  1CM4 A;  2LMV A;  2AAO A;  4GNK B;  5KU1 A;  1AP4 A;  4HRH A;  4ORC B;  3A8R A;  3E3R A;  3KPX A;  4OVN F;  1QXP A;  1XFY O;  1WDC C;  3DVJ A;  4BY5 A;  5PAL A;  1TCF A;  1B8R A;  1K9K A;  1UHN A;  1TCO B;  4MVF A;  1SW8 A;  3BUN B;  1IGV A;  3AKA A;  1KSM A;  3OP0 A;  3BUM B;  2K7C A;  1A75 A;  2KI4 B;  1DTL A;  4MN0 A;  1B7T Z;  5F6T A;  3BUW B;  2BBM A;  2HQ8 A;  4BY4 A;  2WC8 A;  2PAS A;  1JBA A;  3CGA A;  2G9B A;  3PM8 A;  3I5F C;  4MZJ A;  1CMF A;  2BKH B;  3IF7 A;  3O4Y A;  1B1G A;  2KNE A;  3GK1 A;  4HSZ A;  2KAX A;  2KYC A;  4GPL B;  1IQ3 A;  4CFR A;  1L2O C;  3OB1 B;  4MSP A;  2OTG C;  4IL1 A;  1QV1 A;  1TIZ A;  2KQ6 A;  2EC6 C;  2L4H A;  2M7L A;  1DJW A;  5AER A;  4ETO A;  3SG5 A;  4PHK A;  3TDU A;  3I5G B;  4PDZ A;  1ZMZ A;  1NCX A;  4PE4 A;  5B8I B;  2KOT A;  1MXE A;  2OPO A;  2Q91 A;  2B1U A;  1XFV O;  1LXF C;  1B8C A;  2NZ0 A;  1ZUZ A;  1FI5 A;  3TDZ A;  1NP8 A;  3I5I B;  4USL A;  1CFC A;  1NWD A;  2A4J A;  1Q80 A;  1DJH A;  2BCA A;  1CDP A;  1QIW A;  2JXC A;  2MRD A;  5HLO A;  1AK8 A;  1B9A A;  2MLF C;  3AKB A;  5TNC A;  1C7V A;  1SCV A;  1EJ3 A;  2KFH A;  1SKT A;  1A29 A;  1KWO B;  1SL7 A;  4PE7 A;  4QJ5 B;  4NDB A;  1NIW A;  2ZKM X;  1MWN A; 
#chains in the Genus database with same CATH topology
 1FW4 A;  4MEW A;  4DS7 A;  4DIR A;  1DJY A;  3CZ1 A;  1J1D A;  2K0J A;  2LCP A;  2JNX A;  1NCZ A;  1ALV A;  2K7B A;  3TUY C;  2M8U A;  1TOP A;  3PN7 C;  1D1O A;  2LC5 A;  2LV7 A;  1OOG A;  3B87 A;  1ODB A;  1ZOT B;  1OZO A;  4F0Z B;  1BU3 A;  4A4C A;  1QJT A;  2KDH A;  4YGE B;  3WHU B;  2ZRS A;  2ERB A;  4PE1 A;  2M7N A;  3NSI A;  3OB2 B;  3KO0 A;  1RK9 A;  3RM1 A;  3SG4 A;  1CNP A;  4E68 A;  1GGZ A;  1XFU O;  2KGB C;  3IQO A;  1NX3 A;  2F3Z A;  4I5J A;  1OMD A;  1SNL A;  1S3P A;  1NX2 A;  5I2L A;  1B47 A;  1YRU B;  1IJ5 A;  1NPQ A;  2QDI A;  2MAZ A;  1CDM A;  1QWV A;  1U5I A;  3VRO A;  1FI6 A;  1SMG A;  2LLU A;  1AJ5 A;  4U8D A;  2NLN A;  1SPY A;  4F7F A;  1T14 A;  1WRK A;  2QPT A;  1J1E A;  2QEO A;  2ISD A;  1J7P A;  1MHO A;  1TTX A;  1JFK A;  1TNX A;  2DOQ A;  3Q8I A;  4C0L A;  2JT0 A;  2K2F A;  3L4L A;  1SCM C;  1DVI A;  2BAP A;  1KFX S;  5KSZ A;  3PM2 A;  5JOL A;  1DGV A;  1A75 B;  3SS4 A;  1AHR A;  1EG4 A;  1Z4H A;  1CMG A;  2FJU B;  1K90 D;  2LVI A;  4QJ4 B;  4GGF A;  2HPS A;  2WCF A;  1WRL A;  1G4Y R;  2L2E A;  3BYA A;  5DKQ A;  2ZRT A;  3SG6 A;  1B4C A;  1WDC B;  2ZFD A;  1SY9 A;  2LVJ A;  3EK4 A;  2KI6 C;  1KQM C;  2BE4 A;  3PAL A;  1C3Z A;  4JWQ A;  1P28 A;  2JRF A;  3CZT X;  3FWC A;  4JPZ B;  2QAC A;  3MSE B;  1KFX L;  1S5G Z;  2PAL A;  3O78 A;  4YRU A;  2LVK A;  2M3W A;  1J7R A;  2AUC A;  1GGW A;  1PK0 D;  1OOJ A;  3O6B A;  1ZAC A;  2PVB A;  3AAK A;  3B86 A;  3RZS A;  3NSO A;  2O60 A;  4XYN A;  2LNK A;  2SAS A;  2FCD A;  2F3Y A;  2KYF A;  3DYE A;  3GK2 A;  2LP3 A;  1YTZ C;  3OX5 A;  1V1G A;  3ZWH A;  1TNQ A;  3D75 A;  1RRO A;  3CDN A;  4HRE E;  4JKT A;  2K8M B;  2Y5I A;  4D1E A;  5ER5 A;  3NSK A;  5AFP A;  4JQ0 D;  1S5G Y;  2WCK A;  1UHI A;  4PAL A;  2L2C A;  2WOS A;  1S6I A;  3R1V A;  1L2O B;  3BOW B;  4ORB B;  2OTG B;  2GTE A;  3EK8 A;  3S0F A;  1L7Z A;  2EC6 B;  1TRF A;  2QEB A;  3PJI A;  5EL2 A;  1OMR A;  1SR6 C;  3CR4 X;  1KFU S;  1VRK A;  2JQ6 A;  5AAN A;  3WXA A;  1XVJ A;  2F2O A;  3DVM A;  5CSI A;  1UHH A;  2M49 B;  1IQ5 A;  2JOJ A;  1J7O A;  4MRY A;  1S36 A;  2HF5 A;  1Y1X A;  1Y0V H;  2KAV A;  1XFZ O;  3DF0 B;  4M2P A;  5KTY A;  3HX4 A;  2WND A;  4P2Y B;  2MBX A;  1BLQ A;  1CLL A;  1PSR A;  4INX A;  4PCW A;  1BMO A;  1PVA A;  4PE0 A;  1MF8 B;  3R1P A;  1TNW A;  3EVU A;  1JF2 A;  1MQ1 A;  3CZ0 A;  4YBH B;  2K60 A;  4A4B A;  1B7T Y;  2JPO A;  1F54 A;  4Q04 A;  2EGD A;  3BQ3 A;  4GUK A;  1XO5 A;  3LK1 A;  1XA5 A;  2JZI A;  1OE9 B;  2WCM A;  2P71 A;  1G33 A;  1CFP A;  1K9U A;  2CT9 A;  4YGD B;  2F33 A;  2EHB A;  3B6X A;  4MLW A;  5AXI A;  1EG3 A;  2GGM A;  1J7Q A;  5I94 A;  2L51 A;  2PMY A;  2Q4U A;  1DF0 A;  1LA0 A;  2NCO A;  2Y4Q A;  3CS1 A;  4FQO A;  4N1F A;  3TUY B;  5JJG A;  1QLK A;  3PN7 B;  1WLM A;  2BCX A;  5I8N A;  2LAN A;  2LP2 A;  1FBV A;  1JWD A;  4HRG A;  5FI6 A;  2KBI A;  4OZD A;  4C0J A;  1SYM A;  2KSP A;  2M9G A;  3L47 A;  3R72 A;  1SK6 D;  3V2L A;  1ALW A;  2WCH A;  1QS7 A;  3FE9 A;  3QRX A;  2CCM A;  4YGA A;  1TN4 A;  1DT7 B;  3CZ2 A;  1KSO A;  1IG5 A;  2G2B A;  1K94 A;  1XFR A;  2JPT A;  3ICB A;  4DCK A;  5I2Q A;  3PFV A;  1QV0 A;  1QX5 B;  1IKU A;  3QME A;  1F70 A;  1Y6W A;  4YGC B;  3JTD B;  5AEQ A;  2BNX A;  1MUX A;  1HQV A;  3OGN A;  2P70 A;  3PLF B;  1OW4 A;  1SCM B;  3IVT A;  5FI2 A;  4NQG A;  2VRG A;  3D78 A;  3SJS A;  2WOR A;  3GK4 X;  4TNC A;  1F55 A;  3I5G C;  3F45 A;  2E6W A;  3BXK A;  4GGF C;  1XFX O;  3BUX B;  1UP5 A;  2LHI A;  4GFT A;  3IQQ A;  1V1F A;  1QLS A;  2F2P A;  1ORG A;  4OV2 A;  1YR5 A;  1KQM B;  1BT6 A;  4AQJ A;  1PVB A;  1IRJ A;  1C7W A;  4P5O E;  1JSA A;  1BOD A;  1S26 D;  2PYQ A;  1BG1 A;  1R6P A;  2SCP A;  4WQ2 A;  3BFA A;  4I5N B;  3JVT C;  1K9P A;  1ZFS A;  1K96 A;  1CKK A;  3KF9 A;  2KAY A;  5HKW A;  2WC5 A;  1OOI X;  3C1V A;  4OR9 B;  1K8U A;  2CBL A;  2L50 A;  2LUC A;  1NUB A;  4NDD A;  4M2Q A;  5I2O A;  1DJI A;  3BJH A;  2COL B;  1K95 A;  1SL9 A;  4PHN A;  3DY9 A;  2WC6 A;  3AAJ A;  3I5H C;  1CLM A;  2I94 A;  1AUI B;  1YVH A;  1TNP A;  1EL4 A;  1XYD A;  1K2H A;  1KCY A;  2M1U A;  2TN4 A;  3R1O A;  2WCB A;  3SG7 A;  1A4P A;  1LIN A;  1Y1U A;  3BFB A;  4QJ3 B;  5GQQ C;  2LMU A;  4ICB A;  1NCY A;  1AJ4 A;  5CSJ A;  3WHT B;  5IBW A;  3TZ1 A;  1S1E A;  3VGO A;  1SR6 B;  2BL0 C;  1MXL C;  5BPJ A;  3NXA A;  1LA3 A;  1QX7 A;  1UWO A;  1C07 A;  2LVV A;  4L9M A;  3UO9 A;  3CR2 A;  1CM1 A;  2KPH A;  1CB1 A;  3A4U B;  1CLB A;  1IJ6 A;  1GJY A;  1QAS A;  2L98 A;  1DF0 B;  2H2K A;  4OCI A;  3ZNI A;  1DJZ A;  1WY9 A;  2KGR A;  2L0P A;  3I5F B;  4N5X A;  5D7F A;  3D0Y A;  3EVV A;  4I5K A;  1K93 D;  1X02 A;  5ER4 X;  1S6C A;  1TUZ A;  3WNX B;  3PSR A;  4CPV A;  1QAT A;  3EKJ A;  3D76 A;  2OS8 C;  3TS5 C;  3SS5 A;  2O5G A;  3DVK A;  2RGI A;  3LK0 A;  2LMT A;  2MHH A;  5D3O A;  2LLT A;  1KK8 C;  1YX8 A;  2M29 A;  4R1E A;  4YI8 A;  1M45 A;  1W9Z A;  1OSA A;  1YUS A;  1YX7 A;  2LE9 B;  2ZN8 A;  2IS9 A;  1AVS A;  1JFJ A;  3EVR A;  1LVC D;  5FYX A;  1A03 A;  1F71 A;  3CAB A;  3VRN A;  1H4B A;  2GGZ A;  1NYA A;  3EKH A;  3H4S E;  2CNP A;  3GOF A;  1LS8 A;  2PQL A;  1DJG A;  2HET A;  2R2I A;  3CLN A;  1F4Q A;  2JNF A;  4JD9 A;  2M0R A;  4ZCV A;  4M2O A;  1M63 B;  3CTN A;  1NX1 A;  2BE6 A;  3SG3 A;  5CSN A;  2CTN A;  3NHI A;  4XJK A;  2MA2 A;  2JTT A;  3K21 A;  3UNW A;  3FIA A;  1PUL A;  1RFJ A;  1KFU L;  1DJX A;  1BOC A;  4FTG A;  3S0A A;  5FI7 A;  5G08 A;  4UPG A;  1U5I B;  1JF0 A;  1YUT A;  4N1G A;  1HT9 A;  1TUJ A;  3DVE A;  1RWY A;  2WCE A;  2GV5 A;  1JUO A;  3NHT A;  2KLE A;  1J55 A;  3D10 A;  5DKR A;  4CID A;  2K2A A;  2K61 A;  3S0G A;  2LLS A;  2KHN A;  3FWB A;  3LCP C;  2KQY A;  4I5L B;  3LLE A;  2MJW B;  4WRI A;  1QVI Z;  4GBA A;  4MBE A;  2ZND A;  1LKJ A;  3FS7 A;  1BR1 B;  3VRQ A;  1EXR A;  1REC A;  2CXJ A;  2JT8 A;  3CYZ A;  3NSL A;  1UHJ A;  2JT3 A;  3D77 A;  2ZN9 A;  4PT1 A;  2KI4 C;  2LUX A;  5HLV A;  2NCP A;  2NXQ A;  1SRA A;  3S0E A;  1WLZ A;  1Z2C B;  5HYD A;  5CSF A;  2I2R E;  1PAL A;  2JXL A;  2JTZ A;  5DIC A;  1QX2 A;  3SG2 A;  1SL8 A;  1OZS A;  2BKI B;  1QVI Y;  3HCM A;  5HKZ A;  1CDL A;  5D69 A;  2D8N A;  2M1K B;  4CLN A;  3BOW A;  1RTP 1;  2FCE A;  1CFF A;  3JVT B;  3VB1 A;  2L4I A;  2WCL A;  1GQM A;  5DKN A;  3DZT A;  1YUR A;  1IH0 A;  4ZCU A;  1JC2 A;  5K89 A;  3K1E A;  4MZL A;  1M31 A;  2LAP A;  4GGN A;  1YRT B;  1SSE B;  3DD4 A;  1KK7 Z;  1YUU A;  5J3X A;  1PRW A;  4ORA B;  3D0Y B;  3I5H B;  1FPW A;  1WRZ A;  1N0Y A;  3L4A A;  2PSR A;  3BUO B;  1YVL A;  4PHJ A;  3DF0 A;  2P6B B;  2HQW A;  1A2X A;  2BCB A;  3CWG A;  1W7J B;  3I5I C;  4INW A;  1UHK A;  4AQI A;  1DMO A;  1H8B A;  1BF5 A;  1W7I B;  1NSH A;  2H61 C;  4AOM A;  1XFW O;  2I18 A;  2FOT A;  4FQT A;  1N65 A;  1CDN A;  2ZNE A;  2I7A A;  1EH2 A;  2BL0 B;  3FE6 A;  1M46 A;  3SIA A;  3S0D A;  1KK7 Y;  1KWO C;  3DXL A;  3PAT A;  4NDC A;  4YI9 A;  1R2U A;  1F4O A;  5HKY A;  2JUL A;  1N2D A;  1B8L A;  2KFG A;  2KI6 D;  2Y1N A;  1CTR A;  2KLD A;  2Y1M A;  2QEV A;  3RLZ A;  2BEC A;  2K7D A;  4PHM A;  1S6J A;  1OMV A;  1QIV A;  1RJV A;  3JTD C;  1NX0 A;  1DGU A;  4MRX A;  1DQE A;  2AMI A;  2PRU A;  2JU0 A;  2OS8 B;  4XJK B;  2JC2 A;  3TDI A;  3TS5 B;  2E30 A;  1E8A A;  1XK4 C;  3VRR A;  2KBM A;  4MZK A;  3KEV A;  3SIB A;  1QTX A;  1KQV A;  4C0K A;  1KK8 B;  2H61 A;  2BBN A;  1PSB A;  2LM5 A;  3SS3 A;  1UUR A;  1BJF A;  1UUS A;  2H8V A;  2MLE C;  1MR8 A;  4IJ7 A;  4YGB B;  4OKH A;  3O2P A;  3OHM B;  4DRW A;  1GM0 A;  3LL8 B;  3S0B A;  3EK7 A;  2M97 A;  1G8I A;  4WQ3 A;  4CFQ A;  1F8H A;  2V53 A;  1SBJ A;  2KFF A;  2LHL A;  1Y1A A;  3BFH A;  1OQP A;  2F8P A;  3FE8 A;  1IWQ A;  1DC1 A;  1BR4 B;  3KHE A;  4DUQ A;  2JWW A;  3M0W A;  3VRP A;  1OOF A;  4GAO A;  2L5X B;  1XK4 A;  2WCJ A;  1M39 A;  1FF1 A;  1C3Y A;  3OX6 A;  5CPV A;  1CFD A;  4KYN A;  5HL1 A;  2K7O A;  3CR5 X;  1CM4 A;  2LMV A;  2AAO A;  3N7H A;  4GNK B;  5KU1 A;  1AP4 A;  4HRH A;  4ORC B;  3A8R A;  3E3R A;  3KPX A;  4OVN F;  1QXP A;  1XFY O;  1WDC C;  1DEK A;  3DVJ A;  4BY5 A;  5PAL A;  1TCF A;  1B8R A;  1K9K A;  1UHN A;  1TCO B;  4MVF A;  1SW8 A;  3BUN B;  1IGV A;  3AKA A;  1KSM A;  3OP0 A;  2L5Y A;  3BUM B;  2K7C A;  2QEH A;  1A75 A;  2KI4 B;  1DTL A;  4MN0 A;  1B7T Z;  3NGV A;  3BUW B;  5F6T A;  2BBM A;  2HQ8 A;  4BY4 A;  2WC8 A;  2PAS A;  3D74 A;  1JBA A;  2FJY A;  2G9B A;  3CGA A;  3PM8 A;  2YGU A;  3I5F C;  4MZJ A;  1CMF A;  2BKH B;  3IF7 A;  1TWO A;  3O4Y A;  1B1G A;  2KNE A;  3GK1 A;  4HSZ A;  3D73 A;  2KAX A;  2KYC A;  4GPL B;  1IQ3 A;  4CFR A;  1L2O C;  3B88 A;  3OB1 B;  4MSP A;  2OTG C;  4IL1 A;  1QV1 A;  1TIZ A;  2KQ6 A;  2EC6 C;  2L4H A;  2M7L A;  1OOH A;  1DJW A;  5AER A;  4ETO A;  3SG5 A;  3O4X A;  4PHK A;  3TDU A;  3I5G B;  4PDZ A;  1ZMZ A;  1NCX A;  4PE4 A;  5B8I B;  2KOT A;  1MXE A;  2OPO A;  2Q91 A;  2B1U A;  1XFV O;  3B7A A;  1LXF C;  1B8C A;  2NZ0 A;  1ZUZ A;  1FI5 A;  1DEL A;  3TDZ A;  1NP8 A;  3I5I B;  4USL A;  1CFC A;  1NWD A;  1Q80 A;  2A4J A;  1DJH A;  1CDP A;  1QIW A;  2BCA A;  2JXC A;  2MRD A;  5HLO A;  1AK8 A;  1B9A A;  2MLF C;  3AKB A;  3EG5 B;  3OBV A;  5TNC A;  1IIO A;  1C7V A;  1SCV A;  1EJ3 A;  2KFH A;  1SKT A;  1A29 A;  1KWO B;  1SL7 A;  4PE7 A;  4QJ5 B;  4NDB A;  1NIW A;  2ZKM X;  1MWN A; 
#chains in the Genus database with same CATH homology
 1FW4 A;  4MEW A;  4DS7 A;  4DIR A;  1DJY A;  1J1D A;  2K0J A;  2LCP A;  2JNX A;  1NCZ A;  1ALV A;  2K7B A;  3TUY C;  2M8U A;  1TOP A;  3PN7 C;  1D1O A;  2LC5 A;  2LV7 A;  1ODB A;  1ZOT B;  1OZO A;  4F0Z B;  1BU3 A;  4A4C A;  1QJT A;  2KDH A;  4YGE B;  3WHU B;  2ZRS A;  3SG4 A;  4PE1 A;  2M7N A;  3NSI A;  3OB2 B;  3KO0 A;  1RK9 A;  3RM1 A;  1CNP A;  1JFJ A;  4E68 A;  1GGZ A;  1XFU O;  2KGB C;  3IQO A;  1NX3 A;  2F3Z A;  4I5J A;  1OMD A;  1SNL A;  1S3P A;  1NX2 A;  5I2L A;  1B47 A;  1YRU B;  1IJ5 A;  1NPQ A;  2MAZ A;  1CDM A;  1U5I A;  3VRO A;  1FI6 A;  1SMG A;  2LLU A;  1AJ5 A;  4U8D A;  2NLN A;  1SPY A;  1WRK A;  2QPT A;  1J1E A;  2ISD A;  1J7P A;  1MHO A;  1TTX A;  1JFK A;  1TNX A;  2DOQ A;  4C0L A;  2JT0 A;  2K2F A;  1SCM C;  1DVI A;  1KFX S;  5KSZ A;  5JOL A;  1DGV A;  1A75 B;  1AHR A;  1EG4 A;  1CMG A;  2FJU B;  1K90 D;  2LVI A;  4QJ4 B;  4GGF A;  2HPS A;  2WCF A;  1WRL A;  1G4Y R;  2L2E A;  3BYA A;  5DKQ A;  2ZRT A;  3SG6 A;  1B4C A;  1WDC B;  2ZFD A;  1SY9 A;  2LVJ A;  3EK4 A;  2KI6 C;  1KQM C;  2BE4 A;  3PAL A;  4JWQ A;  2JRF A;  3CZT X;  3FWC A;  4JPZ B;  2QAC A;  3MSE B;  1KFX L;  1S5G Z;  2PAL A;  3O78 A;  4YRU A;  2LVK A;  2M3W A;  1J7R A;  2AUC A;  1GGW A;  1PK0 D;  1OOJ A;  3O6B A;  1ZAC A;  2PVB A;  3AAK A;  3NSO A;  2O60 A;  4XYN A;  2LNK A;  2SAS A;  2FCD A;  2F3Y A;  2KYF A;  3GK2 A;  2LP3 A;  1YTZ C;  3OX5 A;  1V1G A;  3ZWH A;  1TNQ A;  1RRO A;  4D1E A;  4HRE E;  2K8M B;  2Y5I A;  5ER5 A;  3NSK A;  5AFP A;  4JQ0 D;  1S5G Y;  1UHI A;  4PAL A;  2WOS A;  1S6I A;  1L2O B;  3BOW B;  4ORB B;  2OTG B;  3EK8 A;  1L7Z A;  2EC6 B;  1TRF A;  1OMR A;  1SR6 C;  3CR4 X;  1KFU S;  1VRK A;  2JQ6 A;  5AAN A;  3WXA A;  1XVJ A;  2F2O A;  3DVM A;  5CSI A;  1UHH A;  2M49 B;  1IQ5 A;  2JOJ A;  1J7O A;  4MRY A;  1S36 A;  2HF5 A;  1Y1X A;  1Y0V H;  2KAV A;  1XFZ O;  3DF0 B;  4M2P A;  5KTY A;  3HX4 A;  2WND A;  4P2Y B;  2MBX A;  1BLQ A;  1CLL A;  1PSR A;  4PCW A;  4PE0 A;  1BMO A;  1PVA A;  1MF8 B;  1TNW A;  3EVU A;  1JF2 A;  1MQ1 A;  4YBH B;  4A4B A;  1B7T Y;  1F54 A;  4Q04 A;  2EGD A;  3BQ3 A;  4GUK A;  1XO5 A;  3LK1 A;  1XA5 A;  2JZI A;  1OE9 B;  1G33 A;  1CFP A;  1K9U A;  2CT9 A;  4YGD B;  2F33 A;  2EHB A;  4MLW A;  5AXI A;  1EG3 A;  2GGM A;  1J7Q A;  2L51 A;  2PMY A;  2Q4U A;  1DF0 A;  1LA0 A;  2NCO A;  2Y4Q A;  3CS1 A;  4FQO A;  4N1F A;  3TUY B;  5JJG A;  1QLK A;  3PN7 B;  1WLM A;  2BCX A;  5I8N A;  2LAN A;  2LP2 A;  1FBV A;  1JWD A;  4HRG A;  2KBI A;  4C0J A;  1SYM A;  2KSP A;  2M9G A;  1SK6 D;  1ALW A;  1QS7 A;  3QRX A;  2CCM A;  4YGA A;  1TN4 A;  1DT7 B;  1KSO A;  1IG5 A;  2G2B A;  1K94 A;  2JPT A;  3ICB A;  4DCK A;  5I2Q A;  3PFV A;  1QV0 A;  1QX5 B;  1IKU A;  1F70 A;  1Y6W A;  4YGC B;  3JTD B;  5AEQ A;  1MUX A;  1HQV A;  3PLF B;  1SCM B;  4NQG A;  2VRG A;  3SJS A;  2WOR A;  3GK4 X;  4TNC A;  1F55 A;  3I5G C;  3F45 A;  2E6W A;  3BXK A;  4GGF C;  1XFX O;  3BUX B;  1UP5 A;  2LHI A;  4GFT A;  3IQQ A;  1V1F A;  1QLS A;  2F2P A;  4OV2 A;  1YR5 A;  1KQM B;  1BT6 A;  4AQJ A;  1PVB A;  1IRJ A;  1C7W A;  4P5O E;  1JSA A;  1BOD A;  1S26 D;  1BG1 A;  1R6P A;  2SCP A;  4WQ2 A;  4I5N B;  3JVT C;  1K9P A;  1ZFS A;  1K96 A;  1CKK A;  3KF9 A;  2KAY A;  5HKW A;  3C1V A;  4OR9 B;  1K8U A;  2CBL A;  2L50 A;  2LUC A;  1NUB A;  4NDD A;  4M2Q A;  5I2O A;  1DJI A;  2COL B;  1K95 A;  1SL9 A;  4PHN A;  3AAJ A;  3I5H C;  1CLM A;  2I94 A;  1AUI B;  1YVH A;  1TNP A;  1EL4 A;  1XYD A;  1K2H A;  1KCY A;  2M1U A;  2TN4 A;  2WCB A;  3SG7 A;  1A4P A;  1LIN A;  1Y1U A;  4QJ3 B;  5GQQ C;  2LMU A;  4ICB A;  1NCY A;  1AJ4 A;  5CSJ A;  3WHT B;  5IBW A;  3TZ1 A;  1S1E A;  3VGO A;  1SR6 B;  2BL0 C;  1MXL C;  5BPJ A;  3NXA A;  1LA3 A;  1QX7 A;  1UWO A;  1C07 A;  2LVV A;  4L9M A;  3CR2 A;  1CM1 A;  1CB1 A;  3A4U B;  1CLB A;  1IJ6 A;  1GJY A;  1QAS A;  2L98 A;  1DF0 B;  2H2K A;  4OCI A;  3ZNI A;  1DJZ A;  1WY9 A;  2KGR A;  2L0P A;  3I5F B;  4N5X A;  5D7F A;  3D0Y A;  3EVV A;  4I5K A;  1K93 D;  1X02 A;  5ER4 X;  1S6C A;  3WNX B;  3PSR A;  4CPV A;  1QAT A;  3EKJ A;  2OS8 C;  3TS5 C;  2O5G A;  3DVK A;  2RGI A;  3LK0 A;  2LMT A;  2MHH A;  2LLT A;  1KK8 C;  1YX8 A;  2M29 A;  4R1E A;  4YI8 A;  1M45 A;  1YX7 A;  1OSA A;  1YUS A;  2LE9 B;  2ZN8 A;  2IS9 A;  1AVS A;  3EVR A;  1LVC D;  5FYX A;  1A03 A;  1F71 A;  3VRN A;  1H4B A;  2GGZ A;  1NYA A;  3EKH A;  3H4S E;  2CNP A;  3GOF A;  1DJG A;  2HET A;  2R2I A;  3CLN A;  1F4Q A;  2JNF A;  4ZCV A;  2M0R A;  4M2O A;  1M63 B;  3CTN A;  1NX1 A;  2BE6 A;  3SG3 A;  5CSN A;  2CTN A;  4XJK A;  2MA2 A;  2JTT A;  3K21 A;  3FIA A;  1PUL A;  1RFJ A;  1KFU L;  1DJX A;  1BOC A;  4FTG A;  5G08 A;  4UPG A;  1U5I B;  1JF0 A;  1YUT A;  4N1G A;  1HT9 A;  3DVE A;  1RWY A;  2WCE A;  2GV5 A;  1JUO A;  1J55 A;  3D10 A;  5DKR A;  4CID A;  2K2A A;  2K61 A;  2LLS A;  2KHN A;  3FWB A;  3LCP C;  2KQY A;  4I5L B;  3LLE A;  2MJW B;  4WRI A;  1QVI Z;  4GBA A;  4MBE A;  2ZND A;  1LKJ A;  3FS7 A;  1BR1 B;  3VRQ A;  1EXR A;  1REC A;  2CXJ A;  2JT8 A;  3NSL A;  1UHJ A;  2JT3 A;  2ZN9 A;  2KI4 C;  2LUX A;  5HLV A;  2NCP A;  2NXQ A;  1SRA A;  1WLZ A;  5HYD A;  5CSF A;  2I2R E;  1PAL A;  2JXL A;  2JTZ A;  1QX2 A;  3SG2 A;  1SL8 A;  1OZS A;  2BKI B;  1QVI Y;  3HCM A;  5HKZ A;  1CDL A;  5D69 A;  2D8N A;  2M1K B;  4CLN A;  3BOW A;  1RTP 1;  2FCE A;  1CFF A;  3JVT B;  2L4I A;  1GQM A;  5DKN A;  1YUR A;  1IH0 A;  4ZCU A;  1JC2 A;  5K89 A;  4MZL A;  1M31 A;  2LAP A;  4GGN A;  1YRT B;  3DD4 A;  1KK7 Z;  1YUU A;  5J3X A;  1PRW A;  4ORA B;  3D0Y B;  3I5H B;  1FPW A;  1WRZ A;  1N0Y A;  2PSR A;  3BUO B;  1YVL A;  4PHJ A;  3DF0 A;  2P6B B;  2HQW A;  1A2X A;  2BCB A;  3CWG A;  1W7J B;  3I5I C;  1UHK A;  4AQI A;  1DMO A;  1H8B A;  1BF5 A;  1W7I B;  1NSH A;  2H61 C;  4AOM A;  1XFW O;  2I18 A;  2FOT A;  1N65 A;  1CDN A;  2ZNE A;  2I7A A;  1EH2 A;  2BL0 B;  1M46 A;  3SIA A;  1KK7 Y;  1KWO C;  3PAT A;  4NDC A;  4YI9 A;  1R2U A;  1F4O A;  2JUL A;  1N2D A;  1B8L A;  2KFG A;  2KI6 D;  2Y1N A;  1CTR A;  2Y1M A;  3RLZ A;  2BEC A;  2K7D A;  4PHM A;  1S6J A;  1OMV A;  1QIV A;  1RJV A;  3JTD C;  1NX0 A;  1DGU A;  4MRX A;  2PRU A;  2AMI A;  5HKY A;  2JU0 A;  2OS8 B;  4XJK B;  2JC2 A;  3TDI A;  3TS5 B;  2E30 A;  1E8A A;  1XK4 C;  3VRR A;  2KBM A;  4MZK A;  3KEV A;  3SIB A;  1QTX A;  1KQV A;  4C0K A;  1KK8 B;  2H61 A;  2BBN A;  1PSB A;  2LM5 A;  1UUR A;  1BJF A;  1UUS A;  2MLE C;  1MR8 A;  4YGB B;  4OKH A;  3O2P A;  3OHM B;  4DRW A;  3LL8 B;  3EK7 A;  2M97 A;  1G8I A;  4WQ3 A;  4CFQ A;  1F8H A;  2V53 A;  1SBJ A;  2KFF A;  2LHL A;  1Y1A A;  1OQP A;  2F8P A;  1IWQ A;  1BR4 B;  3KHE A;  4DUQ A;  2JWW A;  3M0W A;  3VRP A;  4GAO A;  2L5X B;  1XK4 A;  1M39 A;  1FF1 A;  3OX6 A;  5CPV A;  1CFD A;  2K7O A;  3CR5 X;  1CM4 A;  2LMV A;  2AAO A;  4GNK B;  5KU1 A;  1AP4 A;  4HRH A;  4ORC B;  3A8R A;  3E3R A;  3KPX A;  4OVN F;  1QXP A;  1XFY O;  1WDC C;  3DVJ A;  4BY5 A;  5PAL A;  1TCF A;  1B8R A;  1K9K A;  1UHN A;  1TCO B;  4MVF A;  1SW8 A;  3BUN B;  1IGV A;  3AKA A;  1KSM A;  3OP0 A;  3BUM B;  2K7C A;  1A75 A;  2KI4 B;  1DTL A;  4MN0 A;  1B7T Z;  5F6T A;  3BUW B;  2BBM A;  2HQ8 A;  4BY4 A;  2WC8 A;  2PAS A;  1JBA A;  3CGA A;  2G9B A;  3PM8 A;  3I5F C;  4MZJ A;  1CMF A;  2BKH B;  3IF7 A;  3O4Y A;  1B1G A;  2KNE A;  3GK1 A;  4HSZ A;  2KAX A;  2KYC A;  4GPL B;  1IQ3 A;  4CFR A;  1L2O C;  3OB1 B;  4MSP A;  2OTG C;  4IL1 A;  1QV1 A;  1TIZ A;  2KQ6 A;  2EC6 C;  2L4H A;  2M7L A;  1DJW A;  5AER A;  4ETO A;  3SG5 A;  4PHK A;  3TDU A;  3I5G B;  4PDZ A;  1ZMZ A;  1NCX A;  4PE4 A;  5B8I B;  2KOT A;  1MXE A;  2OPO A;  2Q91 A;  2B1U A;  1XFV O;  1LXF C;  1B8C A;  2NZ0 A;  1ZUZ A;  1FI5 A;  3TDZ A;  1NP8 A;  3I5I B;  4USL A;  1CFC A;  1NWD A;  2A4J A;  1Q80 A;  1DJH A;  2BCA A;  1CDP A;  1QIW A;  2JXC A;  2MRD A;  5HLO A;  1AK8 A;  1B9A A;  2MLF C;  3AKB A;  5TNC A;  1C7V A;  1SCV A;  1EJ3 A;  2KFH A;  1SKT A;  1A29 A;  1KWO B;  1SL7 A;  4PE7 A;  4QJ5 B;  4NDB A;  1NIW A;  2ZKM X;  1MWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...