3O6BA

A dual e3 mechanism for rub1 ligation to cdc53: dcn1(p)-cdc53(whb) low resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
195
structure length
195
Chain Sequence
PKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase, cell cycle
molecule keywords Defective in cullin neddylation protein 1
publication title A dual E3 mechanism for Rub1 ligation to Cdc53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 57
structure length 195
sequence length 195
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o6bA01
3MSEB 4GNKB 1LA0A 4A4CA 2K7BA 3O2PA 2EGDA 1AK8A 4MN0A 2Y1NA 2QPTA 2NLNA 2L50A 3FWBA 2M9GA 1RJVA 1NX3A 1AP4A 4XJKB 2BCXA 2BKIB 1UHNA 2F3ZA 4P5OE 2K61A 3TUYC 1F4QA 1S3PA 1FI5A 1CM4A 2BECA 5ER5A 2KNEA 1BG1A 2I94A 5DKNA 2KFHA 3QRXA 1NCZA 4GAOA 1CFDA 4N5XA 4XJKA 3CR5X 1JF2A 1YR5A 2BE4A 1Y1UA 2M7LA 1A03A 2K7OA 5IBWA 1DJWA 1XYDA 1KFUS 1QV1A 3GOFA 5GQQC 5B8IB 2M29A 4C0JA 5I8NA 1R2UA 2PVBA 1XA5A 2NCOA 3EVVA 2PASA 3NSKA 3BUWB 4JWQA 5D69A 2ZNDA 3AAKA 4YBHB 1CDPA 1YURA 2KSPA 5G08A 3DVEA 1PULA 3SIAA 1TCOB 3VRRA 3RLZA 4MRXA 2A4JA 4M2QA 5CSJA 2R2IA 3SIBA 4AQJA 1J7PA 1MR8A 1NSHA 1OMVA 4YGCB 2K7DA 4ICBA 3E3RA 5DKQA 1UHIA 4OCIA 1A29A 1J7QA 1QIWA 3LK0A 2BBNA 4PCWA 4YI8A 1CB1A 2EHBA 3PLFB 2WC8A 2LP3A 1NIWA 1K95A 2KHNA 5CPVA 4GGFA 2M97A 1IWQA 2O5GA 2ISDA 1V1FA 4JPZB 3WXAA 4GFTA 1UHKA 1DVIA 4I5LB 5HKYA 2LMUA 2JPTA 3SG2A 1NP8A 1QATA 3BQ3A 1FI6A 1XFWO 4USLA 4PE4A 1MQ1A 1YVLA 2Y4QA 3C1VA 2BL0C 3SG6A 1M31A 5DKRA 1KQVA 2OPOA 5ER4X 1JWDA 2K8MB 1Q80A 4ORBB 3TS5C 3I5IB 1B47A 4L9MA 1SL8A 3BUOB 2JXLA 2JT8A 2F3YA 1QVIZ 2JQ6A 5CSNA 1TIZA 3I5GC 1F71A 5AFPA 1EJ3A 2NZ0A 3CS1A 3VRQA 1QIVA 3CR4X 4MEWA 1KQMB 1SMGA 1BLQA 2FJUB 1FBVA 2KAYA 2KI6D 2F8PA 2KFFA 3CZTX 4PHMA 3EK7A 2BCAA 2FCEA 5HLVA 1CLMA 3EVRA 3PN7B 2I18A 4AQIA 2L2EA 1V1GA 4CFQA 1TNWA 5F6TA 2LHIA 2L98A 3PATA 1S5GY 1ZFSA 4NDDA 4I5NB 1UWOA 2GGZA 1OOJA 1Y6WA 2HF5A 1XO5A 4WRIA 4PE1A 3PFVA 4FQOA 2PSRA 1QTXA 4OVNF 1QJTA 1NPQA 1WRZA 1QX7A 3KHEA 2EC6B 1XFUO 3I5FB 1CDMA 1MHOA 1K9KA 2E30A 2JOJA 3FIAA 5FYXA 3RM1A 1DF0B 2OTGC 2PALA 2CXJA 1LXFC 1AHRA 2M3WA 1QV0A 3CR2A 4M2OA 1CDNA 1HQVA 1MXEA 2O60A 1FW4A 1VRKA 2OTGB 3A8RA 4I5JA 3PSRA 1H8BA 3DF0B 4OR9B 1DF0A 4MVFA 1KWOB 3ICBA 4I5KA 1K96A 1DJZA 3LCPC 1DTLA 2CCMA 5KU1A 1F54A 1CFFA 4IL1A 4N1FA 2M8UA 2LNKA 3DF0A 1XFVO 1DMOA 1K9PA 4NDBA 1XFXO 2LVVA 1C7VA 5HLOA 2GV5A 2SASA 2F2OA 4GBAA 1DJYA 3JTDB 1WLZA 2TN4A 1QXPA 5HKZA 3PM8A 2ZN9A 2M1KB 3CGAA 1IQ5A 3NSIA 1KCYA 4BY4A 2LV7A 2Y1MA 1F70A 1AUIB 1KFXL 2AAOA 2KBIA 2QACA 1ZOTB 1QASA 2AUCA 1BU3A 4MZLA 3SG5A 2HQWA 5I2OA 2NXQA 1F8HA 1M46A 1GGWA 1L2OC 3VGOA 4DIRA 1K8UA 3WNXB 1RWYA 1XVJA 5JJGA 1NX2A 1OMDA 1A4PA 1WLMA 3D10A 1L2OB 2H61A 4C0LA 1IRJA 2HETA 3AKBA 1ZACA 4ETOA 1BODA 3O78A 1KK8B 3OP0A 1X02A 4FTGA 1CFPA 1F4OA 4PALA 2WNDA 2KAVA 2KGBC 4YI9A 3WHTB 2JTTA 3OX5A 1B8CA 3D0YB 1CDLA 4GGFC 3TZ1A 3ZNIA 1BOCA 1F55A 2G2BA 2KQ6A 3SG7A 1UP5A 1N0YA 1YUTA 2H2KA 2ZN8A 3AKAA 1WRKA 2K2AA 4DUQA 1JC2A 1JBAA 1BMOA 2CTNA 2FCDA 3D0YA 4YGDB 3EVUA 1ODBA 4PHJA 2JZIA 3GK1A 4MBEA 4UPGA 1EH2A 2M1UA 1SR6B 3LL8B 1C7WA 4MLWA 5TNCA 1IGVA 2BE6A 1JFJA 3KPXA 1H4BA 2M7NA 3CLNA 1M45A 1S5GZ 3LK1A 4E68A 3I5IC 4PHNA 1S26D 1BJFA 2L51A 3F45A 2HQ8A 5I2LA 3NSOA 1GGZA 1SYMA 4ORCB 4TNCA 4XYNA 5KSZA 1DT7B 1ALWA 4HRHA 1SL9A 2BKHB 4PE0A 1KQMC 1SKTA 4CIDA 1QS7A 2SCPA 1SK6D 4ZCUA 1YX8A 1RK9A 1W7IB 1LVCD 2JNFA 2OS8B 4QJ3B 3PN7C 1CNPA 4HREE 1GJYA 1KFUL 2M0RA 2D8NA 1NUBA 1CKKA 1N2DA 1W7JB 2LLTA 1Y1AA 2ZRTA 4QJ4B 2JNXA 3EKHA 1D1OA 2WCBA 1G8IA 1OE9B 1B9AA 2MLEC 3DVMA 4DRWA 4ORAB 2MAZA 3JVTB 1S6CA 1S1EA 4HRGA 2LMTA 4CFRA 1PSRA 2L4HA 1PK0D 2PMYA 2LLSA 2Q91A 2KYCA 3IQOA 2EC6C 5PALA 2DOQA 3I5FC 1S6JA 1YUUA 2LVKA 2WOSA 2BBMA 4WQ3A 1NWDA 1EG4A 1OZOA 1KFXS 2GGMA 1TRFA 3PALA 1B7TY 2B1UA 3LLEA 3I5HB 3TDIA 1ZMZA 3AAJA 1QLSA 1RFJA 1JUOA 1K90D 3BUXB 2MJWB 4C0KA 4DCKA 1FF1A 1UURA 4YRUA 2ZRSA 1IG5A 2KI4C 1KWOC 4MRYA 4MZJA 2I2RE 4YGEB 1MUXA 1NYAA 1S6IA 1WDCB 1YRUB 2JTZA 1IH0A 4GGNA 3VROA 2KI4B 3VRPA 2Y5IA 1IJ5A 1CMFA 1LKJA 4GUKA 1YX7A 3DD4A 1LINA 1YTZC 2JXCA 1JF0A 1J55A 2LAPA 1OMRA 3KEVA 2L0PA 3JTDC 1AJ5A 3EK8A 2ZNEA 3KO0A 3WHUB 2WCEA 1J1EA 1NX0A 1NCYA 3O6BA 1IQ3A 2F2PA 1HT9A 2LANA 2LUXA 2E6WA 4MSPA 3DVJA 1SNLA 1E8AA 1RROA 3FS7A 1S36A 2K7CA 1CTRA 1J1DA 3GK2A 1SCMB 2LVIA 1G33A 2VRGA 1PSBA 2COLB 1OQPA 1SL7A 3OHMB 2JT3A 2H61C 2KDHA 4P2YB 5AANA 2JU0A 4JQ0D 2Q4UA 3O4YA 3SG3A 3OB1B 1CFCA 1LA3A 2IS9A 4A4BA 2KAXA 1AJ4A 2K2FA 1KK7Z 1B1GA 5CSFA 4CLNA 3BOWB 1KK8C 3OX6A 4OKHA 1K2HA 1TN4A 1RTP1 3KF9A 1CM1A 2HPSA 3TUYB 3HX4A 4R1EA 4N1GA 1PVBA 1RECA 1XFZO 1ALVA 2G9BA 3BOWA 1NCXA 3BXKA 1M39A 4WQ2A 2JULA 4DS7A 2BCBA 3M0WA 1BR4B 1TOPA 2ZKMX 1DGVA 1YVHA 3TDUA 1GQMA 1XFYO 3TS5B 1B8LA 1EL4A 2KBMA 1SR6C 3IQQA 3H4SE 1KK7Y 3BUMB 1EXRA 2MHHA 2RGIA 1J7RA 4CPVA 2AMIA 2P6BB 1TTXA 4PHKA 3EKJA 3SG4A 2KYFA 2LE9B 2FOTA 1WY9A 1MWNA 4HSZA 2KOTA 3NXAA 1PRWA 5AEQA 2WCFA 5HYDA 3GK4X 1J7OA 4GPLB 5K89A 2I7AA 1EG3A 4NDCA 5HKWA 3OB2B 1K94A 1B4CA 2OS8C 5J3XA 4QJ5B 2CBLA 1BF5A 3TDZA 1AVSA 4NQGA 2JRFA 5AXIA 2M49B 2LLUA 1B7TZ 1K93D 1NX1A 3HCMA 3VRNA 1CLBA 1DGUA 1BR1B 1KSMA 1R6PA 2JT0A 3NSLA 3ZWHA 2KGRA 2MBXA 3JVTC 1YUSA 2KI6C 2LM5A 1DJIA 5BPJA 1UHJA 1CMGA 4MZKA 1YRTB 1G4YR 1KSOA 2LUCA 3BYAA 2WORA 1PVAA 1WRLA 2JWWA 1JFKA 2L5XB 1TNQA 1TNPA 2MRDA 1DJHA 4Q04A 2BL0B 2LHLA 1SBJA 2KFGA 1QLKA 1JSAA 1MXLC 1U5IB 1ZUZA 1XK4C 1N65A 2LCPA 1SY9A 2V53A 1SCVA 3I5HC 2NCPA 3A4UB 1IJ6A 3DVKA 1A75B 1UHHA 1SRAA 1OZSA 2LP2A 3I5GB 1U5IA 2LC5A 3FWCA 1A2XA 1L7ZA 1Y1XA 4YGAA 2CNPA 4PE7A 1IKUA 1M63B 1Y0VH 1OSAA 1A75A 2CT9A 1WDCC 1K9UA 2MA2A 1FPWA 4U8DA 1XK4A 4OV2A 4YGBB 2L4IA 1MF8B 1SW8A 4AOMA 1CLLA 3BUNB 1DJXA 1UUSA 1QX5B 2LMVA 5CSIA 2PRUA 1TNXA 1QVIY 3K21A 4BY5A 1SPYA 5I2QA 4PDZA 2KQYA 1BT6A 1C07A 5D7FA 2MLFC 1QX2A 4M2PA 2K0JA 3CTNA 3IF7A 2LVJA 4D1EA 1PALA 3CWGA 5AERA 3SJSA 1B8RA 2JC2A 1DJGA 5KTYA 1SCMC 4F0ZB 4ZCVA 3EK4A 5JOLA 2ZFDA 1TCFA 2F33A
chains in the Genus database with same CATH superfamily
3MSEB 2WCJA 1LA0A 4GNKB 4A4CA 2K7BA 3O2PA 2EGDA 1AK8A 3OGNA 4MN0A 2Y1NA 3V2LA 4JKTA 2QPTA 2NLNA 4OZDA 2FJYA 2L50A 3FWBA 2M9GA 1RJVA 1XFRA 1NX3A 1AP4A 4XJKB 2BCXA 2BKIB 1UHNA 2F3ZA 3PJIA 4P5OE 3L47A 2K61A 3TUYC 1F4QA 1S3PA 1FI5A 1CM4A 2BECA 1Z4HA 5ER5A 2KNEA 1BG1A 2I94A 5DKNA 2KFHA 3QRXA 1NCZA 3OBVA 4GAOA 2QEVA 1CFDA 4N5XA 4XJKA 3CR5X 3K1EA 1JF2A 1OOIX 3RZSA 1YR5A 2BE4A 4INXA 1Y1UA 2M7LA 1A03A 2K7OA 5IBWA 1DJWA 1XYDA 1KFUS 1QV1A 3BFHA 3GOFA 5GQQC 5B8IB 2M29A 4C0JA 5I8NA 1R2UA 2PVBA 1XA5A 2NCOA 3EVVA 2PASA 3NSKA 3BUWB 3D74A 4JWQA 5D69A 2ZNDA 3AAKA 4YBHB 1CDPA 1YURA 2KSPA 5G08A 3DVEA 1OOFA 1PULA 1TCOB 3SIAA 3VRRA 4KYNA 3RLZA 4MRXA 2A4JA 4M2QA 5CSJA 2R2IA 3SIBA 4AQJA 1J7PA 1T14A 1MR8A 1NSHA 1OMVA 3SS3A 4YGCB 2K7DA 4ICBA 3BFBA 3E3RA 5DKQA 1UHIA 4OCIA 2WCMA 1A29A 1J7QA 1QIWA 3LK0A 2BBNA 4PCWA 4YI8A 1CB1A 2EHBA 3PLFB 2WC8A 2JPOA 2LP3A 1NIWA 1K95A 2KHNA 5CPVA 4GGFA 2M97A 1IWQA 2O5GA 2ISDA 1V1FA 4JPZB 3WXAA 4GFTA 1UHKA 3UNWA 1DVIA 4I5LB 5HKYA 2LMUA 2JPTA 3SG2A 1NP8A 1QATA 3BQ3A 1FI6A 1XFWO 4USLA 4PE4A 1MQ1A 1YVLA 2Y4QA 3C1VA 2BL0C 3SG6A 4IJ7A 1M31A 5DKRA 1KQVA 2OPOA 5ER4X 1JWDA 2K8MB 1Q80A 4ORBB 3TS5C 3B6XA 1QWVA 1B47A 3I5IB 1SL8A 3BUOB 4L9MA 2JXLA 2JT8A 2F3YA 1QVIZ 2JQ6A 5CSNA 3CZ2A 1TIZA 3I5GC 1F71A 5AFPA 1EJ3A 2NZ0A 3CS1A 3VRQA 1QIVA 3CR4X 4MEWA 1TUJA 1KQMB 1SMGA 2H8VA 2FJUB 1BLQA 1DEKA 1FBVA 2KAYA 2KI6D 2F8PA 2KFFA 3CZTX 1C3YA 2K60A 4PHMA 1IIOA 3EK7A 2BCAA 2FCEA 5HLVA 5HL1A 1CLMA 3EVRA 3PN7B 2I18A 4AQIA 2L2EA 1V1GA 3NHIA 4CFQA 1TNWA 5F6TA 2LHIA 2L98A 3PATA 3BJHA 1S5GY 1ZFSA 4NDDA 4I5NB 1UWOA 2GGZA 1OOJA 1Y6WA 2HF5A 1XO5A 3O4XA 4WRIA 2QDIA 4PE1A 3PFVA 4PT1A 4FQOA 2PSRA 1QTXA 4OVNF 1QJTA 1NPQA 1WRZA 1QX7A 3KHEA 2EC6B 1XFUO 3I5FB 1CDMA 1MHOA 1K9KA 2BAPA 2E30A 2JOJA 3CZ1A 3FIAA 5FYXA 3SS4A 3RM1A 1DF0B 2OTGC 2PALA 2CXJA 1LXFC 1AHRA 2M3WA 1QV0A 3CR2A 4M2OA 1CDNA 1HQVA 1MXEA 2O60A 1FW4A 1VRKA 2OTGB 2QEBA 3A8RA 4I5JA 3UO9A 3PSRA 1H8BA 3DF0B 4OR9B 2PYQA 1DF0A 4MVFA 1KWOB 3ICBA 4I5KA 1K96A 1DJZA 3LCPC 1DTLA 2CCMA 5KU1A 1F54A 1CFFA 4IL1A 4N1FA 2M8UA 2LNKA 3DF0A 1XFVO 1DMOA 1K9PA 4NDBA 1XFXO 2LVVA 1C7VA 5HLOA 2GV5A 2SASA 3DXLA 2F2OA 4GBAA 1DJYA 3JTDB 1WLZA 3Q8IA 2TN4A 1QXPA 5HKZA 3PM8A 2ZN9A 3FE8A 2M1KB 3CGAA 3R1OA 1IQ5A 3NSIA 1KCYA 4BY4A 2LV7A 2Y1MA 1F70A 1AUIB 1KFXL 2AAOA 2KBIA 2QACA 1ZOTB 5FI6A 1SSEB 4F7FA 2L5YA 1QASA 2AUCA 1BU3A 4MZLA 3SG5A 2HQWA 5I2OA 2NXQA 1F8HA 1M46A 1GGWA 1L2OC 3VGOA 4DIRA 1K8UA 3WNXB 1RWYA 1XVJA 5JJGA 1NX2A 1OMDA 1A4PA 1WLMA 3D10A 1L2OB 2H61A 2P70A 4C0LA 1IRJA 2HETA 3AKBA 1ZACA 3S0EA 4ETOA 1BODA 3O78A 1KK8B 3D78A 1X02A 3OP0A 4FTGA 1CFPA 1F4OA 4PALA 2WNDA 2KAVA 2KGBC 4YI9A 3WHTB 1DC1A 2JTTA 3OX5A 1B8CA 3D0YB 1CDLA 4GGFC 3TZ1A 3ZNIA 1DELA 1BOCA 1F55A 2G2BA 2KQ6A 3SG7A 1UP5A 1N0YA 1YUTA 2H2KA 2ZN8A 3AKAA 1WRKA 2K2AA 4DUQA 1JC2A 1JBAA 3B86A 1BMOA 2CTNA 2FCDA 3D0YA 4YGDB 3EVUA 1ODBA 4PHJA 2JZIA 3GK1A 4MBEA 2WCHA 3SS5A 4UPGA 1EH2A 2M1UA 1SR6B 3LL8B 1C7WA 4MLWA 5TNCA 1IGVA 2BE6A 3S0GA 1JFJA 3KPXA 1H4BA 2M7NA 3B7AA 3CLNA 1M45A 1S5GZ 3LK1A 4E68A 3I5IC 3FE9A 4PHNA 1S26D 3CDNA 1BJFA 2L51A 3F45A 2HQ8A 3D73A 5I2LA 3NSOA 1GGZA 1SYMA 4ORCB 4TNCA 4XYNA 5KSZA 1ORGA 1ALWA 1DT7B 4HRHA 1SL9A 2BKHB 4PE0A 1KQMC 1SKTA 4CIDA 1QS7A 3QMEA 2SCPA 1SK6D 4ZCUA 1YX8A 1RK9A 1W7IB 1LVCD 2JNFA 2OS8B 4QJ3B 3PN7C 1CNPA 4HREE 1GJYA 1KFUL 2M0RA 2D8NA 1NUBA 1CKKA 1N2DA 1W7JB 2KLEA 2LLTA 1Y1AA 2ZRTA 4QJ4B 2JNXA 3EKHA 1D1OA 2WCBA 5FI7A 1G8IA 1OE9B 1B9AA 2MLEC 3DVMA 4DRWA 2WC6A 4ORAB 2MAZA 5EL2A 3JVTB 3EG5B 1S6CA 1S1EA 4HRGA 4JD9A 2LMTA 4CFRA 1PSRA 2L4HA 3R1VA 3S0FA 1PK0D 2PMYA 2LLSA 2Q91A 5D3OA 2KPHA 2KYCA 3IQOA 2EC6C 5PALA 2DOQA 3I5FC 1S6JA 1YUUA 2LVKA 2WOSA 2BBMA 4WQ3A 1NWDA 1EG4A 1OZOA 1KFXS 2GGMA 1TRFA 3PALA 1B7TY 2B1UA 3LLEA 3I5HB 3VB1A 3TDIA 1TUZA 1ZMZA 3AAJA 1QLSA 1RFJA 1JUOA 1K90D 3BUXB 2MJWB 3CYZA 4C0KA 4DCKA 1FF1A 1UURA 4YRUA 2ZRSA 1IG5A 2KI4C 1KWOC 3B87A 4MRYA 4MZJA 2I2RE 3L4LA 1MUXA 4YGEB 1NYAA 1S6IA 1WDCB 1YRUB 2JTZA 1IH0A 4GGNA 3VROA 2KI4B 3VRPA 2Y5IA 1IJ5A 1CMFA 1LKJA 1OOHA 1YX7A 4GUKA 3NHTA 2P71A 3DD4A 1LINA 3IVTA 5FI2A 1YTZC 2JXCA 1JF0A 1J55A 2LAPA 1OMRA 3KEVA 2L0PA 3JTDC 3NGVA 1AJ5A 3EK8A 2ZNEA 3KO0A 3WHUB 2WC5A 2WCEA 1J1EA 2ERBA 3S0DA 1NX0A 1NCYA 3O6BA 1IQ3A 2F2PA 1HT9A 2LANA 3FE6A 2LUXA 2E6WA 4MSPA 3DVJA 1SNLA 1E8AA 1RROA 3FS7A 1S36A 3R1PA 2K7CA 1CTRA 1J1DA 1LS8A 1SCMB 2LVIA 3GK2A 1G33A 3D77A 2VRGA 1PSBA 2COLB 1OQPA 1SL7A 3OHMB 2JT3A 2H61C 2KDHA 4P2YB 5AANA 2JU0A 4JQ0D 2Q4UA 3O4YA 3SG3A 3OB1B 1CFCA 1LA3A 2IS9A 4A4BA 2KAXA 3CABA 1AJ4A 2K2FA 1KK7Z 1B1GA 5CSFA 4CLNA 3BOWB 1KK8C 3OX6A 4OKHA 1K2HA 1TN4A 1RTP1 3KF9A 1CM1A 2HPSA 3TUYB 3HX4A 2WCLA 4R1EA 1GM0A 4N1GA 1PVBA 1RECA 1XFZO 1ALVA 2G9BA 3BOWA 1NCXA 3BXKA 1M39A 4WQ2A 2JULA 4DS7A 2BCBA 3M0WA 1BR4B 1TOPA 2ZKMX 1DGVA 1YVHA 3TDUA 1GQMA 1XFYO 3TS5B 1B8LA 1EL4A 5I94A 2KBMA 2QEHA 1SR6C 3IQQA 3H4SE 1KK7Y 4INWA 3D75A 3BUMB 1EXRA 3DZTA 2MHHA 2RGIA 3R72A 1J7RA 4CPVA 2KLDA 5DICA 3B88A 2AMIA 2P6BB 3PM2A 1TTXA 4PHKA 3EKJA 3SG4A 2KYFA 2LE9B 2FOTA 1WY9A 1DQEA 1MWNA 4HSZA 2KOTA 3NXAA 1PRWA 5AEQA 2WCFA 3BFAA 5HYDA 3GK4X 1J7OA 4GPLB 5K89A 1OW4A 1EG3A 2I7AA 4FQTA 4NDCA 5HKWA 3OB2B 1K94A 1B4CA 3CZ0A 2OS8C 5J3XA 4QJ5B 2CBLA 1BF5A 1P28A 3TDZA 3L4AA 1AVSA 4NQGA 2BNXA 2JRFA 5AXIA 2M49B 2LLUA 1B7TZ 1K93D 1NX1A 3HCMA 3S0BA 3VRNA 1CLBA 1DGUA 1BR1B 1KSMA 1R6PA 2JT0A 3NSLA 3ZWHA 2KGRA 2MBXA 3JVTC 1YUSA 1Z2CB 2KI6C 2LM5A 1DJIA 5BPJA 1UHJA 1CMGA 4MZKA 1YRTB 1G4YR 1KSOA 2LUCA 3BYAA 2WORA 1PVAA 1WRLA 2JWWA 1JFKA 2L5XB 1TNQA 1TNPA 2MRDA 1DJHA 2YGUA 2BL0B 4Q04A 2LHLA 1SBJA 2KFGA 1QLKA 1JSAA 1MXLC 1U5IB 1ZUZA 1XK4C 1N65A 2LCPA 1SY9A 2V53A 1SCVA 3I5HC 2NCPA 3A4UB 1IJ6A 3DVKA 1A75B 1UHHA 3S0AA 1SRAA 1OZSA 2LP2A 3I5GB 1TWOA 1U5IA 2LC5A 1W9ZA 2WCKA 1A2XA 1L7ZA 1Y1XA 3FWCA 2CNPA 4YGAA 2GTEA 4PE7A 1IKUA 1M63B 1Y0VH 1OOGA 1A75A 1OSAA 2CT9A 3D76A 1WDCC 1K9UA 2MA2A 1FPWA 4U8DA 1XK4A 4OV2A 4YGBB 2L4IA 1MF8B 1SW8A 2L2CA 4AOMA 1CLLA 3BUNB 1DJXA 3DY9A 1UUSA 1QX5B 2LMVA 5CSIA 2PRUA 1TNXA 1QVIY 2PQLA 3K21A 4BY5A 1SPYA 5I2QA 4PDZA 2KQYA 2QEOA 1BT6A 1C07A 5D7FA 2MLFC 1QX2A 4M2PA 2K0JA 3CTNA 3IF7A 2LVJA 4D1EA 1PALA 3DYEA 3CWGA 5AERA 1C3ZA 1B8RA 3N7HA 3SJSA 2JC2A 1DJGA 5KTYA 1SCMC 4F0ZB 4ZCVA 3EK4A 5JOLA 2ZFDA 1TCFA 2F33A
chains in the Genus database with same CATH topology
3MSEB 4GNKB 1LA0A 4A4CA 2K7BA 3O2PA 2EGDA 1AK8A 4MN0A 2Y1NA 2QPTA 2NLNA 2L50A 3FWBA 2M9GA 1RJVA 1NX3A 1AP4A 4XJKB 2BCXA 2BKIB 1UHNA 2F3ZA 4P5OE 2K61A 3TUYC 1F4QA 1S3PA 1FI5A 1CM4A 2BECA 5ER5A 2KNEA 1BG1A 2I94A 5DKNA 2KFHA 3QRXA 1NCZA 4GAOA 1CFDA 4N5XA 4XJKA 3CR5X 1JF2A 1YR5A 2BE4A 1Y1UA 2M7LA 1A03A 2K7OA 5IBWA 1DJWA 1XYDA 1KFUS 1QV1A 3GOFA 5GQQC 5B8IB 2M29A 4C0JA 5I8NA 1R2UA 2PVBA 1XA5A 2NCOA 3EVVA 2PASA 3NSKA 3BUWB 4JWQA 5D69A 2ZNDA 3AAKA 4YBHB 1CDPA 1YURA 2KSPA 5G08A 3DVEA 1PULA 3SIAA 1TCOB 3VRRA 3RLZA 4MRXA 2A4JA 4M2QA 5CSJA 2R2IA 3SIBA 4AQJA 1J7PA 1MR8A 1NSHA 1OMVA 4YGCB 2K7DA 4ICBA 3E3RA 5DKQA 1UHIA 4OCIA 1A29A 1J7QA 1QIWA 3LK0A 2BBNA 4PCWA 4YI8A 1CB1A 2EHBA 3PLFB 2WC8A 2LP3A 1NIWA 1K95A 2KHNA 5CPVA 4GGFA 2M97A 1IWQA 2O5GA 2ISDA 1V1FA 4JPZB 3WXAA 4GFTA 1UHKA 1DVIA 4I5LB 5HKYA 2LMUA 2JPTA 3SG2A 1NP8A 1QATA 3BQ3A 1FI6A 1XFWO 4USLA 4PE4A 1MQ1A 1YVLA 2Y4QA 3C1VA 2BL0C 3SG6A 1M31A 5DKRA 1KQVA 2OPOA 5ER4X 1JWDA 2K8MB 1Q80A 4ORBB 3TS5C 3I5IB 1B47A 4L9MA 1SL8A 3BUOB 2JXLA 2JT8A 2F3YA 1QVIZ 2JQ6A 5CSNA 1TIZA 3I5GC 1F71A 5AFPA 1EJ3A 2NZ0A 3CS1A 3VRQA 1QIVA 3CR4X 4MEWA 1KQMB 1SMGA 1BLQA 2FJUB 1FBVA 2KAYA 2KI6D 2F8PA 2KFFA 3CZTX 4PHMA 3EK7A 2BCAA 2FCEA 5HLVA 1CLMA 3EVRA 3PN7B 2I18A 4AQIA 2L2EA 1V1GA 4CFQA 1TNWA 5F6TA 2LHIA 2L98A 3PATA 1S5GY 1ZFSA 4NDDA 4I5NB 1UWOA 2GGZA 1OOJA 1Y6WA 2HF5A 1XO5A 4WRIA 4PE1A 3PFVA 4FQOA 2PSRA 1QTXA 4OVNF 1QJTA 1NPQA 1WRZA 1QX7A 3KHEA 2EC6B 1XFUO 3I5FB 1CDMA 1MHOA 1K9KA 2E30A 2JOJA 3FIAA 5FYXA 3RM1A 1DF0B 2OTGC 2PALA 2CXJA 1LXFC 1AHRA 2M3WA 1QV0A 3CR2A 4M2OA 1CDNA 1HQVA 1MXEA 2O60A 1FW4A 1VRKA 2OTGB 3A8RA 4I5JA 3PSRA 1H8BA 3DF0B 4OR9B 1DF0A 4MVFA 1KWOB 3ICBA 4I5KA 1K96A 1DJZA 3LCPC 1DTLA 2CCMA 5KU1A 1F54A 1CFFA 4IL1A 4N1FA 2M8UA 2LNKA 3DF0A 1XFVO 1DMOA 1K9PA 4NDBA 1XFXO 2LVVA 1C7VA 5HLOA 2GV5A 2SASA 2F2OA 4GBAA 1DJYA 3JTDB 1WLZA 2TN4A 1QXPA 5HKZA 3PM8A 2ZN9A 2M1KB 3CGAA 1IQ5A 3NSIA 1KCYA 4BY4A 2LV7A 2Y1MA 1F70A 1AUIB 1KFXL 2AAOA 2KBIA 2QACA 1ZOTB 1QASA 2AUCA 1BU3A 4MZLA 3SG5A 2HQWA 5I2OA 2NXQA 1F8HA 1M46A 1GGWA 1L2OC 3VGOA 4DIRA 1K8UA 3WNXB 1RWYA 1XVJA 5JJGA 1NX2A 1OMDA 1A4PA 1WLMA 3D10A 1L2OB 2H61A 4C0LA 1IRJA 2HETA 3AKBA 1ZACA 4ETOA 1BODA 3O78A 1KK8B 3OP0A 1X02A 4FTGA 1CFPA 1F4OA 4PALA 2WNDA 2KAVA 2KGBC 4YI9A 3WHTB 2JTTA 3OX5A 1B8CA 3D0YB 1CDLA 4GGFC 3TZ1A 3ZNIA 1BOCA 1F55A 2G2BA 2KQ6A 3SG7A 1UP5A 1N0YA 1YUTA 2H2KA 2ZN8A 3AKAA 1WRKA 2K2AA 4DUQA 1JC2A 1JBAA 1BMOA 2CTNA 2FCDA 3D0YA 4YGDB 3EVUA 1ODBA 4PHJA 2JZIA 3GK1A 4MBEA 4UPGA 1EH2A 2M1UA 1SR6B 3LL8B 1C7WA 4MLWA 5TNCA 1IGVA 2BE6A 1JFJA 3KPXA 1H4BA 2M7NA 3CLNA 1M45A 1S5GZ 3LK1A 4E68A 3I5IC 4PHNA 1S26D 1BJFA 2L51A 3F45A 2HQ8A 5I2LA 3NSOA 1GGZA 1SYMA 4ORCB 4TNCA 4XYNA 5KSZA 1DT7B 1ALWA 4HRHA 1SL9A 2BKHB 4PE0A 1KQMC 1SKTA 4CIDA 1QS7A 2SCPA 1SK6D 4ZCUA 1YX8A 1RK9A 1W7IB 1LVCD 2JNFA 2OS8B 4QJ3B 3PN7C 1CNPA 4HREE 1GJYA 1KFUL 2M0RA 2D8NA 1NUBA 1CKKA 1N2DA 1W7JB 2LLTA 1Y1AA 2ZRTA 4QJ4B 2JNXA 3EKHA 1D1OA 2WCBA 1G8IA 1OE9B 1B9AA 2MLEC 3DVMA 4DRWA 4ORAB 2MAZA 3JVTB 1S6CA 1S1EA 4HRGA 2LMTA 4CFRA 1PSRA 2L4HA 1PK0D 2PMYA 2LLSA 2Q91A 2KYCA 3IQOA 2EC6C 5PALA 2DOQA 3I5FC 1S6JA 1YUUA 2LVKA 2WOSA 2BBMA 4WQ3A 1NWDA 1EG4A 1OZOA 1KFXS 2GGMA 1TRFA 3PALA 1B7TY 2B1UA 3LLEA 3I5HB 3TDIA 1ZMZA 3AAJA 1QLSA 1RFJA 1JUOA 1K90D 3BUXB 2MJWB 4C0KA 4DCKA 1FF1A 1UURA 4YRUA 2ZRSA 1IG5A 2KI4C 1KWOC 4MRYA 4MZJA 2I2RE 4YGEB 1MUXA 1NYAA 1S6IA 1WDCB 1YRUB 2JTZA 1IH0A 4GGNA 3VROA 2KI4B 3VRPA 2Y5IA 1IJ5A 1CMFA 1LKJA 4GUKA 1YX7A 3DD4A 1LINA 1YTZC 2JXCA 1JF0A 1J55A 2LAPA 1OMRA 3KEVA 2L0PA 3JTDC 1AJ5A 3EK8A 2ZNEA 3KO0A 3WHUB 2WCEA 1J1EA 1NX0A 1NCYA 3O6BA 1IQ3A 2F2PA 1HT9A 2LANA 2LUXA 2E6WA 4MSPA 3DVJA 1SNLA 1E8AA 1RROA 3FS7A 1S36A 2K7CA 1CTRA 1J1DA 3GK2A 1SCMB 2LVIA 1G33A 2VRGA 1PSBA 2COLB 1OQPA 1SL7A 3OHMB 2JT3A 2H61C 2KDHA 4P2YB 5AANA 2JU0A 4JQ0D 2Q4UA 3O4YA 3SG3A 3OB1B 1CFCA 1LA3A 2IS9A 4A4BA 2KAXA 1AJ4A 2K2FA 1KK7Z 1B1GA 5CSFA 4CLNA 3BOWB 1KK8C 3OX6A 4OKHA 1K2HA 1TN4A 1RTP1 3KF9A 1CM1A 2HPSA 3TUYB 3HX4A 4R1EA 4N1GA 1PVBA 1RECA 1XFZO 1ALVA 2G9BA 3BOWA 1NCXA 3BXKA 1M39A 4WQ2A 2JULA 4DS7A 2BCBA 3M0WA 1BR4B 1TOPA 2ZKMX 1DGVA 1YVHA 3TDUA 1GQMA 1XFYO 3TS5B 1B8LA 1EL4A 2KBMA 1SR6C 3IQQA 3H4SE 1KK7Y 3BUMB 1EXRA 2MHHA 2RGIA 1J7RA 4CPVA 2AMIA 2P6BB 1TTXA 4PHKA 3EKJA 3SG4A 2KYFA 2LE9B 2FOTA 1WY9A 1MWNA 4HSZA 2KOTA 3NXAA 1PRWA 5AEQA 2WCFA 5HYDA 3GK4X 1J7OA 4GPLB 5K89A 2I7AA 1EG3A 4NDCA 5HKWA 3OB2B 1K94A 1B4CA 2OS8C 5J3XA 4QJ5B 2CBLA 1BF5A 3TDZA 1AVSA 4NQGA 2JRFA 5AXIA 2M49B 2LLUA 1B7TZ 1K93D 1NX1A 3HCMA 3VRNA 1CLBA 1DGUA 1BR1B 1KSMA 1R6PA 2JT0A 3NSLA 3ZWHA 2KGRA 2MBXA 3JVTC 1YUSA 2KI6C 2LM5A 1DJIA 5BPJA 1UHJA 1CMGA 4MZKA 1YRTB 1G4YR 1KSOA 2LUCA 3BYAA 2WORA 1PVAA 1WRLA 2JWWA 1JFKA 2L5XB 1TNQA 1TNPA 2MRDA 1DJHA 4Q04A 2BL0B 2LHLA 1SBJA 2KFGA 1QLKA 1JSAA 1MXLC 1U5IB 1ZUZA 1XK4C 1N65A 2LCPA 1SY9A 2V53A 1SCVA 3I5HC 2NCPA 3A4UB 1IJ6A 3DVKA 1A75B 1UHHA 1SRAA 1OZSA 2LP2A 3I5GB 1U5IA 2LC5A 3FWCA 1A2XA 1L7ZA 1Y1XA 4YGAA 2CNPA 4PE7A 1IKUA 1M63B 1Y0VH 1OSAA 1A75A 2CT9A 1WDCC 1K9UA 2MA2A 1FPWA 4U8DA 1XK4A 4OV2A 4YGBB 2L4IA 1MF8B 1SW8A 4AOMA 1CLLA 3BUNB 1DJXA 1UUSA 1QX5B 2LMVA 5CSIA 2PRUA 1TNXA 1QVIY 3K21A 4BY5A 1SPYA 5I2QA 4PDZA 2KQYA 1BT6A 1C07A 5D7FA 2MLFC 1QX2A 4M2PA 2K0JA 3CTNA 3IF7A 2LVJA 4D1EA 1PALA 3CWGA 5AERA 3SJSA 1B8RA 2JC2A 1DJGA 5KTYA 1SCMC 4F0ZB 4ZCVA 3EK4A 5JOLA 2ZFDA 1TCFA 2F33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSE B;  4GNK B;  1LA0 A;  4A4C A;  2K7B A;  3O2P A;  2EGD A;  1AK8 A;  4MN0 A;  2Y1N A;  2QPT A;  2NLN A;  2L50 A;  3FWB A;  2M9G A;  1RJV A;  1NX3 A;  1AP4 A;  4XJK B;  2BCX A;  2BKI B;  1UHN A;  2F3Z A;  4P5O E;  2K61 A;  3TUY C;  1F4Q A;  1S3P A;  1FI5 A;  1CM4 A;  2BEC A;  5ER5 A;  2KNE A;  1BG1 A;  2I94 A;  5DKN A;  2KFH A;  3QRX A;  1NCZ A;  4GAO A;  1CFD A;  4N5X A;  4XJK A;  3CR5 X;  1JF2 A;  1YR5 A;  2BE4 A;  1Y1U A;  2M7L A;  1A03 A;  2K7O A;  5IBW A;  1DJW A;  1XYD A;  1KFU S;  1QV1 A;  3GOF A;  5GQQ C;  5B8I B;  2M29 A;  4C0J A;  5I8N A;  1R2U A;  2PVB A;  1XA5 A;  2NCO A;  3EVV A;  2PAS A;  3NSK A;  3BUW B;  4JWQ A;  5D69 A;  2ZND A;  3AAK A;  4YBH B;  1CDP A;  1YUR A;  2KSP A;  5G08 A;  3DVE A;  1PUL A;  3SIA A;  1TCO B;  3VRR A;  3RLZ A;  4MRX A;  2A4J A;  4M2Q A;  5CSJ A;  2R2I A;  3SIB A;  4AQJ A;  1J7P A;  1MR8 A;  1NSH A;  1OMV A;  4YGC B;  2K7D A;  4ICB A;  3E3R A;  5DKQ A;  1UHI A;  4OCI A;  1A29 A;  1J7Q A;  1QIW A;  3LK0 A;  2BBN A;  4PCW A;  4YI8 A;  1CB1 A;  2EHB A;  3PLF B;  2WC8 A;  2LP3 A;  1NIW A;  1K95 A;  2KHN A;  5CPV A;  4GGF A;  2M97 A;  1IWQ A;  2O5G A;  2ISD A;  1V1F A;  4JPZ B;  3WXA A;  4GFT A;  1UHK A;  1DVI A;  4I5L B;  5HKY A;  2LMU A;  2JPT A;  3SG2 A;  1NP8 A;  1QAT A;  3BQ3 A;  1FI6 A;  1XFW O;  4USL A;  4PE4 A;  1MQ1 A;  1YVL A;  2Y4Q A;  3C1V A;  2BL0 C;  3SG6 A;  1M31 A;  5DKR A;  1KQV A;  2OPO A;  5ER4 X;  1JWD A;  2K8M B;  1Q80 A;  4ORB B;  3TS5 C;  3I5I B;  1B47 A;  4L9M A;  1SL8 A;  3BUO B;  2JXL A;  2JT8 A;  2F3Y A;  1QVI Z;  2JQ6 A;  5CSN A;  1TIZ A;  3I5G C;  1F71 A;  5AFP A;  1EJ3 A;  2NZ0 A;  3CS1 A;  3VRQ A;  1QIV A;  3CR4 X;  4MEW A;  1KQM B;  1SMG A;  1BLQ A;  2FJU B;  1FBV A;  2KAY A;  2KI6 D;  2F8P A;  2KFF A;  3CZT X;  4PHM A;  3EK7 A;  2BCA A;  2FCE A;  5HLV A;  1CLM A;  3EVR A;  3PN7 B;  2I18 A;  4AQI A;  2L2E A;  1V1G A;  4CFQ A;  1TNW A;  5F6T A;  2LHI A;  2L98 A;  3PAT A;  1S5G Y;  1ZFS A;  4NDD A;  4I5N B;  1UWO A;  2GGZ A;  1OOJ A;  1Y6W A;  2HF5 A;  1XO5 A;  4WRI A;  4PE1 A;  3PFV A;  4FQO A;  2PSR A;  1QTX A;  4OVN F;  1QJT A;  1NPQ A;  1WRZ A;  1QX7 A;  3KHE A;  2EC6 B;  1XFU O;  3I5F B;  1CDM A;  1MHO A;  1K9K A;  2E30 A;  2JOJ A;  3FIA A;  5FYX A;  3RM1 A;  1DF0 B;  2OTG C;  2PAL A;  2CXJ A;  1LXF C;  1AHR A;  2M3W A;  1QV0 A;  3CR2 A;  4M2O A;  1CDN A;  1HQV A;  1MXE A;  2O60 A;  1FW4 A;  1VRK A;  2OTG B;  3A8R A;  4I5J A;  3PSR A;  1H8B A;  3DF0 B;  4OR9 B;  1DF0 A;  4MVF A;  1KWO B;  3ICB A;  4I5K A;  1K96 A;  1DJZ A;  3LCP C;  1DTL A;  2CCM A;  5KU1 A;  1F54 A;  1CFF A;  4IL1 A;  4N1F A;  2M8U A;  2LNK A;  3DF0 A;  1XFV O;  1DMO A;  1K9P A;  4NDB A;  1XFX O;  2LVV A;  1C7V A;  5HLO A;  2GV5 A;  2SAS A;  2F2O A;  4GBA A;  1DJY A;  3JTD B;  1WLZ A;  2TN4 A;  1QXP A;  5HKZ A;  3PM8 A;  2ZN9 A;  2M1K B;  3CGA A;  1IQ5 A;  3NSI A;  1KCY A;  4BY4 A;  2LV7 A;  2Y1M A;  1F70 A;  1AUI B;  1KFX L;  2AAO A;  2KBI A;  2QAC A;  1ZOT B;  1QAS A;  2AUC A;  1BU3 A;  4MZL A;  3SG5 A;  2HQW A;  5I2O A;  2NXQ A;  1F8H A;  1M46 A;  1GGW A;  1L2O C;  3VGO A;  4DIR A;  1K8U A;  3WNX B;  1RWY A;  1XVJ A;  5JJG A;  1NX2 A;  1OMD A;  1A4P A;  1WLM A;  3D10 A;  1L2O B;  2H61 A;  4C0L A;  1IRJ A;  2HET A;  3AKB A;  1ZAC A;  4ETO A;  1BOD A;  3O78 A;  1KK8 B;  3OP0 A;  1X02 A;  4FTG A;  1CFP A;  1F4O A;  4PAL A;  2WND A;  2KAV A;  2KGB C;  4YI9 A;  3WHT B;  2JTT A;  3OX5 A;  1B8C A;  3D0Y B;  1CDL A;  4GGF C;  3TZ1 A;  3ZNI A;  1BOC A;  1F55 A;  2G2B A;  2KQ6 A;  3SG7 A;  1UP5 A;  1N0Y A;  1YUT A;  2H2K A;  2ZN8 A;  3AKA A;  1WRK A;  2K2A A;  4DUQ A;  1JC2 A;  1JBA A;  1BMO A;  2CTN A;  2FCD A;  3D0Y A;  4YGD B;  3EVU A;  1ODB A;  4PHJ A;  2JZI A;  3GK1 A;  4MBE A;  4UPG A;  1EH2 A;  2M1U A;  1SR6 B;  3LL8 B;  1C7W A;  4MLW A;  5TNC A;  1IGV A;  2BE6 A;  1JFJ A;  3KPX A;  1H4B A;  2M7N A;  3CLN A;  1M45 A;  1S5G Z;  3LK1 A;  4E68 A;  3I5I C;  4PHN A;  1S26 D;  1BJF A;  2L51 A;  3F45 A;  2HQ8 A;  5I2L A;  3NSO A;  1GGZ A;  1SYM A;  4ORC B;  4TNC A;  4XYN A;  5KSZ A;  1DT7 B;  1ALW A;  4HRH A;  1SL9 A;  2BKH B;  4PE0 A;  1KQM C;  1SKT A;  4CID A;  1QS7 A;  2SCP A;  1SK6 D;  4ZCU A;  1YX8 A;  1RK9 A;  1W7I B;  1LVC D;  2JNF A;  2OS8 B;  4QJ3 B;  3PN7 C;  1CNP A;  4HRE E;  1GJY A;  1KFU L;  2M0R A;  2D8N A;  1NUB A;  1CKK A;  1N2D A;  1W7J B;  2LLT A;  1Y1A A;  2ZRT A;  4QJ4 B;  2JNX A;  3EKH A;  1D1O A;  2WCB A;  1G8I A;  1OE9 B;  1B9A A;  2MLE C;  3DVM A;  4DRW A;  4ORA B;  2MAZ A;  3JVT B;  1S6C A;  1S1E A;  4HRG A;  2LMT A;  4CFR A;  1PSR A;  2L4H A;  1PK0 D;  2PMY A;  2LLS A;  2Q91 A;  2KYC A;  3IQO A;  2EC6 C;  5PAL A;  2DOQ A;  3I5F C;  1S6J A;  1YUU A;  2LVK A;  2WOS A;  2BBM A;  4WQ3 A;  1NWD A;  1EG4 A;  1OZO A;  1KFX S;  2GGM A;  1TRF A;  3PAL A;  1B7T Y;  2B1U A;  3LLE A;  3I5H B;  3TDI A;  1ZMZ A;  3AAJ A;  1QLS A;  1RFJ A;  1JUO A;  1K90 D;  3BUX B;  2MJW B;  4C0K A;  4DCK A;  1FF1 A;  1UUR A;  4YRU A;  2ZRS A;  1IG5 A;  2KI4 C;  1KWO C;  4MRY A;  4MZJ A;  2I2R E;  4YGE B;  1MUX A;  1NYA A;  1S6I A;  1WDC B;  1YRU B;  2JTZ A;  1IH0 A;  4GGN A;  3VRO A;  2KI4 B;  3VRP A;  2Y5I A;  1IJ5 A;  1CMF A;  1LKJ A;  4GUK A;  1YX7 A;  3DD4 A;  1LIN A;  1YTZ C;  2JXC A;  1JF0 A;  1J55 A;  2LAP A;  1OMR A;  3KEV A;  2L0P A;  3JTD C;  1AJ5 A;  3EK8 A;  2ZNE A;  3KO0 A;  3WHU B;  2WCE A;  1J1E A;  1NX0 A;  1NCY A;  3O6B A;  1IQ3 A;  2F2P A;  1HT9 A;  2LAN A;  2LUX A;  2E6W A;  4MSP A;  3DVJ A;  1SNL A;  1E8A A;  1RRO A;  3FS7 A;  1S36 A;  2K7C A;  1CTR A;  1J1D A;  3GK2 A;  1SCM B;  2LVI A;  1G33 A;  2VRG A;  1PSB A;  2COL B;  1OQP A;  1SL7 A;  3OHM B;  2JT3 A;  2H61 C;  2KDH A;  4P2Y B;  5AAN A;  2JU0 A;  4JQ0 D;  2Q4U A;  3O4Y A;  3SG3 A;  3OB1 B;  1CFC A;  1LA3 A;  2IS9 A;  4A4B A;  2KAX A;  1AJ4 A;  2K2F A;  1KK7 Z;  1B1G A;  5CSF A;  4CLN A;  3BOW B;  1KK8 C;  3OX6 A;  4OKH A;  1K2H A;  1TN4 A;  1RTP 1;  3KF9 A;  1CM1 A;  2HPS A;  3TUY B;  3HX4 A;  4R1E A;  4N1G A;  1PVB A;  1REC A;  1XFZ O;  1ALV A;  2G9B A;  3BOW A;  1NCX A;  3BXK A;  1M39 A;  4WQ2 A;  2JUL A;  4DS7 A;  2BCB A;  3M0W A;  1BR4 B;  1TOP A;  2ZKM X;  1DGV A;  1YVH A;  3TDU A;  1GQM A;  1XFY O;  3TS5 B;  1B8L A;  1EL4 A;  2KBM A;  1SR6 C;  3IQQ A;  3H4S E;  1KK7 Y;  3BUM B;  1EXR A;  2MHH A;  2RGI A;  1J7R A;  4CPV A;  2AMI A;  2P6B B;  1TTX A;  4PHK A;  3EKJ A;  3SG4 A;  2KYF A;  2LE9 B;  2FOT A;  1WY9 A;  1MWN A;  4HSZ A;  2KOT A;  3NXA A;  1PRW A;  5AEQ A;  2WCF A;  5HYD A;  3GK4 X;  1J7O A;  4GPL B;  5K89 A;  2I7A A;  1EG3 A;  4NDC A;  5HKW A;  3OB2 B;  1K94 A;  1B4C A;  2OS8 C;  5J3X A;  4QJ5 B;  2CBL A;  1BF5 A;  3TDZ A;  1AVS A;  4NQG A;  2JRF A;  5AXI A;  2M49 B;  2LLU A;  1B7T Z;  1K93 D;  1NX1 A;  3HCM A;  3VRN A;  1CLB A;  1DGU A;  1BR1 B;  1KSM A;  1R6P A;  2JT0 A;  3NSL A;  3ZWH A;  2KGR A;  2MBX A;  3JVT C;  1YUS A;  2KI6 C;  2LM5 A;  1DJI A;  5BPJ A;  1UHJ A;  1CMG A;  4MZK A;  1YRT B;  1G4Y R;  1KSO A;  2LUC A;  3BYA A;  2WOR A;  1PVA A;  1WRL A;  2JWW A;  1JFK A;  2L5X B;  1TNQ A;  1TNP A;  2MRD A;  1DJH A;  4Q04 A;  2BL0 B;  2LHL A;  1SBJ A;  2KFG A;  1QLK A;  1JSA A;  1MXL C;  1U5I B;  1ZUZ A;  1XK4 C;  1N65 A;  2LCP A;  1SY9 A;  2V53 A;  1SCV A;  3I5H C;  2NCP A;  3A4U B;  1IJ6 A;  3DVK A;  1A75 B;  1UHH A;  1SRA A;  1OZS A;  2LP2 A;  3I5G B;  1U5I A;  2LC5 A;  3FWC A;  1A2X A;  1L7Z A;  1Y1X A;  4YGA A;  2CNP A;  4PE7 A;  1IKU A;  1M63 B;  1Y0V H;  1OSA A;  1A75 A;  2CT9 A;  1WDC C;  1K9U A;  2MA2 A;  1FPW A;  4U8D A;  1XK4 A;  4OV2 A;  4YGB B;  2L4I A;  1MF8 B;  1SW8 A;  4AOM A;  1CLL A;  3BUN B;  1DJX A;  1UUS A;  1QX5 B;  2LMV A;  5CSI A;  2PRU A;  1TNX A;  1QVI Y;  3K21 A;  4BY5 A;  1SPY A;  5I2Q A;  4PDZ A;  2KQY A;  1BT6 A;  1C07 A;  5D7F A;  2MLF C;  1QX2 A;  4M2P A;  2K0J A;  3CTN A;  3IF7 A;  2LVJ A;  4D1E A;  1PAL A;  3CWG A;  5AER A;  3SJS A;  1B8R A;  2JC2 A;  1DJG A;  5KTY A;  1SCM C;  4F0Z B;  4ZCV A;  3EK4 A;  5JOL A;  2ZFD A;  1TCF A;  2F33 A; 
#chains in the Genus database with same CATH topology
 3MSE B;  2WCJ A;  1LA0 A;  4GNK B;  4A4C A;  2K7B A;  3O2P A;  2EGD A;  1AK8 A;  3OGN A;  4MN0 A;  2Y1N A;  3V2L A;  4JKT A;  2QPT A;  2NLN A;  4OZD A;  2FJY A;  2L50 A;  3FWB A;  2M9G A;  1RJV A;  1XFR A;  1NX3 A;  1AP4 A;  4XJK B;  2BCX A;  2BKI B;  1UHN A;  2F3Z A;  3PJI A;  4P5O E;  3L47 A;  2K61 A;  3TUY C;  1F4Q A;  1S3P A;  1FI5 A;  1CM4 A;  2BEC A;  1Z4H A;  5ER5 A;  2KNE A;  1BG1 A;  2I94 A;  5DKN A;  2KFH A;  3QRX A;  1NCZ A;  3OBV A;  4GAO A;  2QEV A;  1CFD A;  4N5X A;  4XJK A;  3CR5 X;  3K1E A;  1JF2 A;  1OOI X;  3RZS A;  1YR5 A;  2BE4 A;  4INX A;  1Y1U A;  2M7L A;  1A03 A;  2K7O A;  5IBW A;  1DJW A;  1XYD A;  1KFU S;  1QV1 A;  3BFH A;  3GOF A;  5GQQ C;  5B8I B;  2M29 A;  4C0J A;  5I8N A;  1R2U A;  2PVB A;  1XA5 A;  2NCO A;  3EVV A;  2PAS A;  3NSK A;  3BUW B;  3D74 A;  4JWQ A;  5D69 A;  2ZND A;  3AAK A;  4YBH B;  1CDP A;  1YUR A;  2KSP A;  5G08 A;  3DVE A;  1OOF A;  1PUL A;  1TCO B;  3SIA A;  3VRR A;  4KYN A;  3RLZ A;  4MRX A;  2A4J A;  4M2Q A;  5CSJ A;  2R2I A;  3SIB A;  4AQJ A;  1J7P A;  1T14 A;  1MR8 A;  1NSH A;  1OMV A;  3SS3 A;  4YGC B;  2K7D A;  4ICB A;  3BFB A;  3E3R A;  5DKQ A;  1UHI A;  4OCI A;  2WCM A;  1A29 A;  1J7Q A;  1QIW A;  3LK0 A;  2BBN A;  4PCW A;  4YI8 A;  1CB1 A;  2EHB A;  3PLF B;  2WC8 A;  2JPO A;  2LP3 A;  1NIW A;  1K95 A;  2KHN A;  5CPV A;  4GGF A;  2M97 A;  1IWQ A;  2O5G A;  2ISD A;  1V1F A;  4JPZ B;  3WXA A;  4GFT A;  1UHK A;  3UNW A;  1DVI A;  4I5L B;  5HKY A;  2LMU A;  2JPT A;  3SG2 A;  1NP8 A;  1QAT A;  3BQ3 A;  1FI6 A;  1XFW O;  4USL A;  4PE4 A;  1MQ1 A;  1YVL A;  2Y4Q A;  3C1V A;  2BL0 C;  3SG6 A;  4IJ7 A;  1M31 A;  5DKR A;  1KQV A;  2OPO A;  5ER4 X;  1JWD A;  2K8M B;  1Q80 A;  4ORB B;  3TS5 C;  3B6X A;  1QWV A;  1B47 A;  3I5I B;  1SL8 A;  3BUO B;  4L9M A;  2JXL A;  2JT8 A;  2F3Y A;  1QVI Z;  2JQ6 A;  5CSN A;  3CZ2 A;  1TIZ A;  3I5G C;  1F71 A;  5AFP A;  1EJ3 A;  2NZ0 A;  3CS1 A;  3VRQ A;  1QIV A;  3CR4 X;  4MEW A;  1TUJ A;  1KQM B;  1SMG A;  2H8V A;  2FJU B;  1BLQ A;  1DEK A;  1FBV A;  2KAY A;  2KI6 D;  2F8P A;  2KFF A;  3CZT X;  1C3Y A;  2K60 A;  4PHM A;  1IIO A;  3EK7 A;  2BCA A;  2FCE A;  5HLV A;  5HL1 A;  1CLM A;  3EVR A;  3PN7 B;  2I18 A;  4AQI A;  2L2E A;  1V1G A;  3NHI A;  4CFQ A;  1TNW A;  5F6T A;  2LHI A;  2L98 A;  3PAT A;  3BJH A;  1S5G Y;  1ZFS A;  4NDD A;  4I5N B;  1UWO A;  2GGZ A;  1OOJ A;  1Y6W A;  2HF5 A;  1XO5 A;  3O4X A;  4WRI A;  2QDI A;  4PE1 A;  3PFV A;  4PT1 A;  4FQO A;  2PSR A;  1QTX A;  4OVN F;  1QJT A;  1NPQ A;  1WRZ A;  1QX7 A;  3KHE A;  2EC6 B;  1XFU O;  3I5F B;  1CDM A;  1MHO A;  1K9K A;  2BAP A;  2E30 A;  2JOJ A;  3CZ1 A;  3FIA A;  5FYX A;  3SS4 A;  3RM1 A;  1DF0 B;  2OTG C;  2PAL A;  2CXJ A;  1LXF C;  1AHR A;  2M3W A;  1QV0 A;  3CR2 A;  4M2O A;  1CDN A;  1HQV A;  1MXE A;  2O60 A;  1FW4 A;  1VRK A;  2OTG B;  2QEB A;  3A8R A;  4I5J A;  3UO9 A;  3PSR A;  1H8B A;  3DF0 B;  4OR9 B;  2PYQ A;  1DF0 A;  4MVF A;  1KWO B;  3ICB A;  4I5K A;  1K96 A;  1DJZ A;  3LCP C;  1DTL A;  2CCM A;  5KU1 A;  1F54 A;  1CFF A;  4IL1 A;  4N1F A;  2M8U A;  2LNK A;  3DF0 A;  1XFV O;  1DMO A;  1K9P A;  4NDB A;  1XFX O;  2LVV A;  1C7V A;  5HLO A;  2GV5 A;  2SAS A;  3DXL A;  2F2O A;  4GBA A;  1DJY A;  3JTD B;  1WLZ A;  3Q8I A;  2TN4 A;  1QXP A;  5HKZ A;  3PM8 A;  2ZN9 A;  3FE8 A;  2M1K B;  3CGA A;  3R1O A;  1IQ5 A;  3NSI A;  1KCY A;  4BY4 A;  2LV7 A;  2Y1M A;  1F70 A;  1AUI B;  1KFX L;  2AAO A;  2KBI A;  2QAC A;  1ZOT B;  5FI6 A;  1SSE B;  4F7F A;  2L5Y A;  1QAS A;  2AUC A;  1BU3 A;  4MZL A;  3SG5 A;  2HQW A;  5I2O A;  2NXQ A;  1F8H A;  1M46 A;  1GGW A;  1L2O C;  3VGO A;  4DIR A;  1K8U A;  3WNX B;  1RWY A;  1XVJ A;  5JJG A;  1NX2 A;  1OMD A;  1A4P A;  1WLM A;  3D10 A;  1L2O B;  2H61 A;  2P70 A;  4C0L A;  1IRJ A;  2HET A;  3AKB A;  1ZAC A;  3S0E A;  4ETO A;  1BOD A;  3O78 A;  1KK8 B;  3D78 A;  1X02 A;  3OP0 A;  4FTG A;  1CFP A;  1F4O A;  4PAL A;  2WND A;  2KAV A;  2KGB C;  4YI9 A;  3WHT B;  1DC1 A;  2JTT A;  3OX5 A;  1B8C A;  3D0Y B;  1CDL A;  4GGF C;  3TZ1 A;  3ZNI A;  1DEL A;  1BOC A;  1F55 A;  2G2B A;  2KQ6 A;  3SG7 A;  1UP5 A;  1N0Y A;  1YUT A;  2H2K A;  2ZN8 A;  3AKA A;  1WRK A;  2K2A A;  4DUQ A;  1JC2 A;  1JBA A;  3B86 A;  1BMO A;  2CTN A;  2FCD A;  3D0Y A;  4YGD B;  3EVU A;  1ODB A;  4PHJ A;  2JZI A;  3GK1 A;  4MBE A;  2WCH A;  3SS5 A;  4UPG A;  1EH2 A;  2M1U A;  1SR6 B;  3LL8 B;  1C7W A;  4MLW A;  5TNC A;  1IGV A;  2BE6 A;  3S0G A;  1JFJ A;  3KPX A;  1H4B A;  2M7N A;  3B7A A;  3CLN A;  1M45 A;  1S5G Z;  3LK1 A;  4E68 A;  3I5I C;  3FE9 A;  4PHN A;  1S26 D;  3CDN A;  1BJF A;  2L51 A;  3F45 A;  2HQ8 A;  3D73 A;  5I2L A;  3NSO A;  1GGZ A;  1SYM A;  4ORC B;  4TNC A;  4XYN A;  5KSZ A;  1ORG A;  1ALW A;  1DT7 B;  4HRH A;  1SL9 A;  2BKH B;  4PE0 A;  1KQM C;  1SKT A;  4CID A;  1QS7 A;  3QME A;  2SCP A;  1SK6 D;  4ZCU A;  1YX8 A;  1RK9 A;  1W7I B;  1LVC D;  2JNF A;  2OS8 B;  4QJ3 B;  3PN7 C;  1CNP A;  4HRE E;  1GJY A;  1KFU L;  2M0R A;  2D8N A;  1NUB A;  1CKK A;  1N2D A;  1W7J B;  2KLE A;  2LLT A;  1Y1A A;  2ZRT A;  4QJ4 B;  2JNX A;  3EKH A;  1D1O A;  2WCB A;  5FI7 A;  1G8I A;  1OE9 B;  1B9A A;  2MLE C;  3DVM A;  4DRW A;  2WC6 A;  4ORA B;  2MAZ A;  5EL2 A;  3JVT B;  3EG5 B;  1S6C A;  1S1E A;  4HRG A;  4JD9 A;  2LMT A;  4CFR A;  1PSR A;  2L4H A;  3R1V A;  3S0F A;  1PK0 D;  2PMY A;  2LLS A;  2Q91 A;  5D3O A;  2KPH A;  2KYC A;  3IQO A;  2EC6 C;  5PAL A;  2DOQ A;  3I5F C;  1S6J A;  1YUU A;  2LVK A;  2WOS A;  2BBM A;  4WQ3 A;  1NWD A;  1EG4 A;  1OZO A;  1KFX S;  2GGM A;  1TRF A;  3PAL A;  1B7T Y;  2B1U A;  3LLE A;  3I5H B;  3VB1 A;  3TDI A;  1TUZ A;  1ZMZ A;  3AAJ A;  1QLS A;  1RFJ A;  1JUO A;  1K90 D;  3BUX B;  2MJW B;  3CYZ A;  4C0K A;  4DCK A;  1FF1 A;  1UUR A;  4YRU A;  2ZRS A;  1IG5 A;  2KI4 C;  1KWO C;  3B87 A;  4MRY A;  4MZJ A;  2I2R E;  3L4L A;  1MUX A;  4YGE B;  1NYA A;  1S6I A;  1WDC B;  1YRU B;  2JTZ A;  1IH0 A;  4GGN A;  3VRO A;  2KI4 B;  3VRP A;  2Y5I A;  1IJ5 A;  1CMF A;  1LKJ A;  1OOH A;  1YX7 A;  4GUK A;  3NHT A;  2P71 A;  3DD4 A;  1LIN A;  3IVT A;  5FI2 A;  1YTZ C;  2JXC A;  1JF0 A;  1J55 A;  2LAP A;  1OMR A;  3KEV A;  2L0P A;  3JTD C;  3NGV A;  1AJ5 A;  3EK8 A;  2ZNE A;  3KO0 A;  3WHU B;  2WC5 A;  2WCE A;  1J1E A;  2ERB A;  3S0D A;  1NX0 A;  1NCY A;  3O6B A;  1IQ3 A;  2F2P A;  1HT9 A;  2LAN A;  3FE6 A;  2LUX A;  2E6W A;  4MSP A;  3DVJ A;  1SNL A;  1E8A A;  1RRO A;  3FS7 A;  1S36 A;  3R1P A;  2K7C A;  1CTR A;  1J1D A;  1LS8 A;  1SCM B;  2LVI A;  3GK2 A;  1G33 A;  3D77 A;  2VRG A;  1PSB A;  2COL B;  1OQP A;  1SL7 A;  3OHM B;  2JT3 A;  2H61 C;  2KDH A;  4P2Y B;  5AAN A;  2JU0 A;  4JQ0 D;  2Q4U A;  3O4Y A;  3SG3 A;  3OB1 B;  1CFC A;  1LA3 A;  2IS9 A;  4A4B A;  2KAX A;  3CAB A;  1AJ4 A;  2K2F A;  1KK7 Z;  1B1G A;  5CSF A;  4CLN A;  3BOW B;  1KK8 C;  3OX6 A;  4OKH A;  1K2H A;  1TN4 A;  1RTP 1;  3KF9 A;  1CM1 A;  2HPS A;  3TUY B;  3HX4 A;  2WCL A;  4R1E A;  1GM0 A;  4N1G A;  1PVB A;  1REC A;  1XFZ O;  1ALV A;  2G9B A;  3BOW A;  1NCX A;  3BXK A;  1M39 A;  4WQ2 A;  2JUL A;  4DS7 A;  2BCB A;  3M0W A;  1BR4 B;  1TOP A;  2ZKM X;  1DGV A;  1YVH A;  3TDU A;  1GQM A;  1XFY O;  3TS5 B;  1B8L A;  1EL4 A;  5I94 A;  2KBM A;  2QEH A;  1SR6 C;  3IQQ A;  3H4S E;  1KK7 Y;  4INW A;  3D75 A;  3BUM B;  1EXR A;  3DZT A;  2MHH A;  2RGI A;  3R72 A;  1J7R A;  4CPV A;  2KLD A;  5DIC A;  3B88 A;  2AMI A;  2P6B B;  3PM2 A;  1TTX A;  4PHK A;  3EKJ A;  3SG4 A;  2KYF A;  2LE9 B;  2FOT A;  1WY9 A;  1DQE A;  1MWN A;  4HSZ A;  2KOT A;  3NXA A;  1PRW A;  5AEQ A;  2WCF A;  3BFA A;  5HYD A;  3GK4 X;  1J7O A;  4GPL B;  5K89 A;  1OW4 A;  1EG3 A;  2I7A A;  4FQT A;  4NDC A;  5HKW A;  3OB2 B;  1K94 A;  1B4C A;  3CZ0 A;  2OS8 C;  5J3X A;  4QJ5 B;  2CBL A;  1BF5 A;  1P28 A;  3TDZ A;  3L4A A;  1AVS A;  4NQG A;  2BNX A;  2JRF A;  5AXI A;  2M49 B;  2LLU A;  1B7T Z;  1K93 D;  1NX1 A;  3HCM A;  3S0B A;  3VRN A;  1CLB A;  1DGU A;  1BR1 B;  1KSM A;  1R6P A;  2JT0 A;  3NSL A;  3ZWH A;  2KGR A;  2MBX A;  3JVT C;  1YUS A;  1Z2C B;  2KI6 C;  2LM5 A;  1DJI A;  5BPJ A;  1UHJ A;  1CMG A;  4MZK A;  1YRT B;  1G4Y R;  1KSO A;  2LUC A;  3BYA A;  2WOR A;  1PVA A;  1WRL A;  2JWW A;  1JFK A;  2L5X B;  1TNQ A;  1TNP A;  2MRD A;  1DJH A;  2YGU A;  2BL0 B;  4Q04 A;  2LHL A;  1SBJ A;  2KFG A;  1QLK A;  1JSA A;  1MXL C;  1U5I B;  1ZUZ A;  1XK4 C;  1N65 A;  2LCP A;  1SY9 A;  2V53 A;  1SCV A;  3I5H C;  2NCP A;  3A4U B;  1IJ6 A;  3DVK A;  1A75 B;  1UHH A;  3S0A A;  1SRA A;  1OZS A;  2LP2 A;  3I5G B;  1TWO A;  1U5I A;  2LC5 A;  1W9Z A;  2WCK A;  1A2X A;  1L7Z A;  1Y1X A;  3FWC A;  2CNP A;  4YGA A;  2GTE A;  4PE7 A;  1IKU A;  1M63 B;  1Y0V H;  1OOG A;  1A75 A;  1OSA A;  2CT9 A;  3D76 A;  1WDC C;  1K9U A;  2MA2 A;  1FPW A;  4U8D A;  1XK4 A;  4OV2 A;  4YGB B;  2L4I A;  1MF8 B;  1SW8 A;  2L2C A;  4AOM A;  1CLL A;  3BUN B;  1DJX A;  3DY9 A;  1UUS A;  1QX5 B;  2LMV A;  5CSI A;  2PRU A;  1TNX A;  1QVI Y;  2PQL A;  3K21 A;  4BY5 A;  1SPY A;  5I2Q A;  4PDZ A;  2KQY A;  2QEO A;  1BT6 A;  1C07 A;  5D7F A;  2MLF C;  1QX2 A;  4M2P A;  2K0J A;  3CTN A;  3IF7 A;  2LVJ A;  4D1E A;  1PAL A;  3DYE A;  3CWG A;  5AER A;  1C3Z A;  1B8R A;  3N7H A;  3SJS A;  2JC2 A;  1DJG A;  5KTY A;  1SCM C;  4F0Z B;  4ZCV A;  3EK4 A;  5JOL A;  2ZFD A;  1TCF A;  2F33 A; 
#chains in the Genus database with same CATH homology
 3MSE B;  4GNK B;  1LA0 A;  4A4C A;  2K7B A;  3O2P A;  2EGD A;  1AK8 A;  4MN0 A;  2Y1N A;  2QPT A;  2NLN A;  2L50 A;  3FWB A;  2M9G A;  1RJV A;  1NX3 A;  1AP4 A;  4XJK B;  2BCX A;  2BKI B;  1UHN A;  2F3Z A;  4P5O E;  2K61 A;  3TUY C;  1F4Q A;  1S3P A;  1FI5 A;  1CM4 A;  2BEC A;  5ER5 A;  2KNE A;  1BG1 A;  2I94 A;  5DKN A;  2KFH A;  3QRX A;  1NCZ A;  4GAO A;  1CFD A;  4N5X A;  4XJK A;  3CR5 X;  1JF2 A;  1YR5 A;  2BE4 A;  1Y1U A;  2M7L A;  1A03 A;  2K7O A;  5IBW A;  1DJW A;  1XYD A;  1KFU S;  1QV1 A;  3GOF A;  5GQQ C;  5B8I B;  2M29 A;  4C0J A;  5I8N A;  1R2U A;  2PVB A;  1XA5 A;  2NCO A;  3EVV A;  2PAS A;  3NSK A;  3BUW B;  4JWQ A;  5D69 A;  2ZND A;  3AAK A;  4YBH B;  1CDP A;  1YUR A;  2KSP A;  5G08 A;  3DVE A;  1PUL A;  3SIA A;  1TCO B;  3VRR A;  3RLZ A;  4MRX A;  2A4J A;  4M2Q A;  5CSJ A;  2R2I A;  3SIB A;  4AQJ A;  1J7P A;  1MR8 A;  1NSH A;  1OMV A;  4YGC B;  2K7D A;  4ICB A;  3E3R A;  5DKQ A;  1UHI A;  4OCI A;  1A29 A;  1J7Q A;  1QIW A;  3LK0 A;  2BBN A;  4PCW A;  4YI8 A;  1CB1 A;  2EHB A;  3PLF B;  2WC8 A;  2LP3 A;  1NIW A;  1K95 A;  2KHN A;  5CPV A;  4GGF A;  2M97 A;  1IWQ A;  2O5G A;  2ISD A;  1V1F A;  4JPZ B;  3WXA A;  4GFT A;  1UHK A;  1DVI A;  4I5L B;  5HKY A;  2LMU A;  2JPT A;  3SG2 A;  1NP8 A;  1QAT A;  3BQ3 A;  1FI6 A;  1XFW O;  4USL A;  4PE4 A;  1MQ1 A;  1YVL A;  2Y4Q A;  3C1V A;  2BL0 C;  3SG6 A;  1M31 A;  5DKR A;  1KQV A;  2OPO A;  5ER4 X;  1JWD A;  2K8M B;  1Q80 A;  4ORB B;  3TS5 C;  3I5I B;  1B47 A;  4L9M A;  1SL8 A;  3BUO B;  2JXL A;  2JT8 A;  2F3Y A;  1QVI Z;  2JQ6 A;  5CSN A;  1TIZ A;  3I5G C;  1F71 A;  5AFP A;  1EJ3 A;  2NZ0 A;  3CS1 A;  3VRQ A;  1QIV A;  3CR4 X;  4MEW A;  1KQM B;  1SMG A;  1BLQ A;  2FJU B;  1FBV A;  2KAY A;  2KI6 D;  2F8P A;  2KFF A;  3CZT X;  4PHM A;  3EK7 A;  2BCA A;  2FCE A;  5HLV A;  1CLM A;  3EVR A;  3PN7 B;  2I18 A;  4AQI A;  2L2E A;  1V1G A;  4CFQ A;  1TNW A;  5F6T A;  2LHI A;  2L98 A;  3PAT A;  1S5G Y;  1ZFS A;  4NDD A;  4I5N B;  1UWO A;  2GGZ A;  1OOJ A;  1Y6W A;  2HF5 A;  1XO5 A;  4WRI A;  4PE1 A;  3PFV A;  4FQO A;  2PSR A;  1QTX A;  4OVN F;  1QJT A;  1NPQ A;  1WRZ A;  1QX7 A;  3KHE A;  2EC6 B;  1XFU O;  3I5F B;  1CDM A;  1MHO A;  1K9K A;  2E30 A;  2JOJ A;  3FIA A;  5FYX A;  3RM1 A;  1DF0 B;  2OTG C;  2PAL A;  2CXJ A;  1LXF C;  1AHR A;  2M3W A;  1QV0 A;  3CR2 A;  4M2O A;  1CDN A;  1HQV A;  1MXE A;  2O60 A;  1FW4 A;  1VRK A;  2OTG B;  3A8R A;  4I5J A;  3PSR A;  1H8B A;  3DF0 B;  4OR9 B;  1DF0 A;  4MVF A;  1KWO B;  3ICB A;  4I5K A;  1K96 A;  1DJZ A;  3LCP C;  1DTL A;  2CCM A;  5KU1 A;  1F54 A;  1CFF A;  4IL1 A;  4N1F A;  2M8U A;  2LNK A;  3DF0 A;  1XFV O;  1DMO A;  1K9P A;  4NDB A;  1XFX O;  2LVV A;  1C7V A;  5HLO A;  2GV5 A;  2SAS A;  2F2O A;  4GBA A;  1DJY A;  3JTD B;  1WLZ A;  2TN4 A;  1QXP A;  5HKZ A;  3PM8 A;  2ZN9 A;  2M1K B;  3CGA A;  1IQ5 A;  3NSI A;  1KCY A;  4BY4 A;  2LV7 A;  2Y1M A;  1F70 A;  1AUI B;  1KFX L;  2AAO A;  2KBI A;  2QAC A;  1ZOT B;  1QAS A;  2AUC A;  1BU3 A;  4MZL A;  3SG5 A;  2HQW A;  5I2O A;  2NXQ A;  1F8H A;  1M46 A;  1GGW A;  1L2O C;  3VGO A;  4DIR A;  1K8U A;  3WNX B;  1RWY A;  1XVJ A;  5JJG A;  1NX2 A;  1OMD A;  1A4P A;  1WLM A;  3D10 A;  1L2O B;  2H61 A;  4C0L A;  1IRJ A;  2HET A;  3AKB A;  1ZAC A;  4ETO A;  1BOD A;  3O78 A;  1KK8 B;  3OP0 A;  1X02 A;  4FTG A;  1CFP A;  1F4O A;  4PAL A;  2WND A;  2KAV A;  2KGB C;  4YI9 A;  3WHT B;  2JTT A;  3OX5 A;  1B8C A;  3D0Y B;  1CDL A;  4GGF C;  3TZ1 A;  3ZNI A;  1BOC A;  1F55 A;  2G2B A;  2KQ6 A;  3SG7 A;  1UP5 A;  1N0Y A;  1YUT A;  2H2K A;  2ZN8 A;  3AKA A;  1WRK A;  2K2A A;  4DUQ A;  1JC2 A;  1JBA A;  1BMO A;  2CTN A;  2FCD A;  3D0Y A;  4YGD B;  3EVU A;  1ODB A;  4PHJ A;  2JZI A;  3GK1 A;  4MBE A;  4UPG A;  1EH2 A;  2M1U A;  1SR6 B;  3LL8 B;  1C7W A;  4MLW A;  5TNC A;  1IGV A;  2BE6 A;  1JFJ A;  3KPX A;  1H4B A;  2M7N A;  3CLN A;  1M45 A;  1S5G Z;  3LK1 A;  4E68 A;  3I5I C;  4PHN A;  1S26 D;  1BJF A;  2L51 A;  3F45 A;  2HQ8 A;  5I2L A;  3NSO A;  1GGZ A;  1SYM A;  4ORC B;  4TNC A;  4XYN A;  5KSZ A;  1DT7 B;  1ALW A;  4HRH A;  1SL9 A;  2BKH B;  4PE0 A;  1KQM C;  1SKT A;  4CID A;  1QS7 A;  2SCP A;  1SK6 D;  4ZCU A;  1YX8 A;  1RK9 A;  1W7I B;  1LVC D;  2JNF A;  2OS8 B;  4QJ3 B;  3PN7 C;  1CNP A;  4HRE E;  1GJY A;  1KFU L;  2M0R A;  2D8N A;  1NUB A;  1CKK A;  1N2D A;  1W7J B;  2LLT A;  1Y1A A;  2ZRT A;  4QJ4 B;  2JNX A;  3EKH A;  1D1O A;  2WCB A;  1G8I A;  1OE9 B;  1B9A A;  2MLE C;  3DVM A;  4DRW A;  4ORA B;  2MAZ A;  3JVT B;  1S6C A;  1S1E A;  4HRG A;  2LMT A;  4CFR A;  1PSR A;  2L4H A;  1PK0 D;  2PMY A;  2LLS A;  2Q91 A;  2KYC A;  3IQO A;  2EC6 C;  5PAL A;  2DOQ A;  3I5F C;  1S6J A;  1YUU A;  2LVK A;  2WOS A;  2BBM A;  4WQ3 A;  1NWD A;  1EG4 A;  1OZO A;  1KFX S;  2GGM A;  1TRF A;  3PAL A;  1B7T Y;  2B1U A;  3LLE A;  3I5H B;  3TDI A;  1ZMZ A;  3AAJ A;  1QLS A;  1RFJ A;  1JUO A;  1K90 D;  3BUX B;  2MJW B;  4C0K A;  4DCK A;  1FF1 A;  1UUR A;  4YRU A;  2ZRS A;  1IG5 A;  2KI4 C;  1KWO C;  4MRY A;  4MZJ A;  2I2R E;  4YGE B;  1MUX A;  1NYA A;  1S6I A;  1WDC B;  1YRU B;  2JTZ A;  1IH0 A;  4GGN A;  3VRO A;  2KI4 B;  3VRP A;  2Y5I A;  1IJ5 A;  1CMF A;  1LKJ A;  4GUK A;  1YX7 A;  3DD4 A;  1LIN A;  1YTZ C;  2JXC A;  1JF0 A;  1J55 A;  2LAP A;  1OMR A;  3KEV A;  2L0P A;  3JTD C;  1AJ5 A;  3EK8 A;  2ZNE A;  3KO0 A;  3WHU B;  2WCE A;  1J1E A;  1NX0 A;  1NCY A;  3O6B A;  1IQ3 A;  2F2P A;  1HT9 A;  2LAN A;  2LUX A;  2E6W A;  4MSP A;  3DVJ A;  1SNL A;  1E8A A;  1RRO A;  3FS7 A;  1S36 A;  2K7C A;  1CTR A;  1J1D A;  3GK2 A;  1SCM B;  2LVI A;  1G33 A;  2VRG A;  1PSB A;  2COL B;  1OQP A;  1SL7 A;  3OHM B;  2JT3 A;  2H61 C;  2KDH A;  4P2Y B;  5AAN A;  2JU0 A;  4JQ0 D;  2Q4U A;  3O4Y A;  3SG3 A;  3OB1 B;  1CFC A;  1LA3 A;  2IS9 A;  4A4B A;  2KAX A;  1AJ4 A;  2K2F A;  1KK7 Z;  1B1G A;  5CSF A;  4CLN A;  3BOW B;  1KK8 C;  3OX6 A;  4OKH A;  1K2H A;  1TN4 A;  1RTP 1;  3KF9 A;  1CM1 A;  2HPS A;  3TUY B;  3HX4 A;  4R1E A;  4N1G A;  1PVB A;  1REC A;  1XFZ O;  1ALV A;  2G9B A;  3BOW A;  1NCX A;  3BXK A;  1M39 A;  4WQ2 A;  2JUL A;  4DS7 A;  2BCB A;  3M0W A;  1BR4 B;  1TOP A;  2ZKM X;  1DGV A;  1YVH A;  3TDU A;  1GQM A;  1XFY O;  3TS5 B;  1B8L A;  1EL4 A;  2KBM A;  1SR6 C;  3IQQ A;  3H4S E;  1KK7 Y;  3BUM B;  1EXR A;  2MHH A;  2RGI A;  1J7R A;  4CPV A;  2AMI A;  2P6B B;  1TTX A;  4PHK A;  3EKJ A;  3SG4 A;  2KYF A;  2LE9 B;  2FOT A;  1WY9 A;  1MWN A;  4HSZ A;  2KOT A;  3NXA A;  1PRW A;  5AEQ A;  2WCF A;  5HYD A;  3GK4 X;  1J7O A;  4GPL B;  5K89 A;  2I7A A;  1EG3 A;  4NDC A;  5HKW A;  3OB2 B;  1K94 A;  1B4C A;  2OS8 C;  5J3X A;  4QJ5 B;  2CBL A;  1BF5 A;  3TDZ A;  1AVS A;  4NQG A;  2JRF A;  5AXI A;  2M49 B;  2LLU A;  1B7T Z;  1K93 D;  1NX1 A;  3HCM A;  3VRN A;  1CLB A;  1DGU A;  1BR1 B;  1KSM A;  1R6P A;  2JT0 A;  3NSL A;  3ZWH A;  2KGR A;  2MBX A;  3JVT C;  1YUS A;  2KI6 C;  2LM5 A;  1DJI A;  5BPJ A;  1UHJ A;  1CMG A;  4MZK A;  1YRT B;  1G4Y R;  1KSO A;  2LUC A;  3BYA A;  2WOR A;  1PVA A;  1WRL A;  2JWW A;  1JFK A;  2L5X B;  1TNQ A;  1TNP A;  2MRD A;  1DJH A;  4Q04 A;  2BL0 B;  2LHL A;  1SBJ A;  2KFG A;  1QLK A;  1JSA A;  1MXL C;  1U5I B;  1ZUZ A;  1XK4 C;  1N65 A;  2LCP A;  1SY9 A;  2V53 A;  1SCV A;  3I5H C;  2NCP A;  3A4U B;  1IJ6 A;  3DVK A;  1A75 B;  1UHH A;  1SRA A;  1OZS A;  2LP2 A;  3I5G B;  1U5I A;  2LC5 A;  3FWC A;  1A2X A;  1L7Z A;  1Y1X A;  4YGA A;  2CNP A;  4PE7 A;  1IKU A;  1M63 B;  1Y0V H;  1OSA A;  1A75 A;  2CT9 A;  1WDC C;  1K9U A;  2MA2 A;  1FPW A;  4U8D A;  1XK4 A;  4OV2 A;  4YGB B;  2L4I A;  1MF8 B;  1SW8 A;  4AOM A;  1CLL A;  3BUN B;  1DJX A;  1UUS A;  1QX5 B;  2LMV A;  5CSI A;  2PRU A;  1TNX A;  1QVI Y;  3K21 A;  4BY5 A;  1SPY A;  5I2Q A;  4PDZ A;  2KQY A;  1BT6 A;  1C07 A;  5D7F A;  2MLF C;  1QX2 A;  4M2P A;  2K0J A;  3CTN A;  3IF7 A;  2LVJ A;  4D1E A;  1PAL A;  3CWG A;  5AER A;  3SJS A;  1B8R A;  2JC2 A;  1DJG A;  5KTY A;  1SCM C;  4F0Z B;  4ZCV A;  3EK4 A;  5JOL A;  2ZFD A;  1TCF A;  2F33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...