3O6BA

A dual e3 mechanism for rub1 ligation to cdc53: dcn1(p)-cdc53(whb) low resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
195
structure length
195
Chain Sequence
PKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title A dual E3 mechanism for Rub1 ligation to Cdc53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase, cell cycle
total genus 57
structure length 195
sequence length 195
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o6bA01
1ALVA 2LANA 2AMIA 4YGCB 1KSOA 2EC6B 3KF9A 1J7QA 3VGOA 2NCOA 1K90D 2PASA 1KQVA 1J7PA 1DJHA 1SR6C 1JWDA 1SBJA 1K94A 2Y1MA 3CR5X 1QLSA 1ALWA 1NX2A 3DF0A 2M3WA 3BUNB 2JNFA 4XYNA 4PALA 1CMGA 1JF2A 4M2OA 4MLWA 1TTXA 1LVCD 1KK7Y 2L5XB 4P2YB 1QATA 1LXFC 3SIBA 4DS7A 3IF7A 1B8RA 1YUSA 2LVIA 4MVFA 2M97A 1CDNA 1QXPA 2BCXA 2KDHA 2MJWB 4ORCB 1Y1UA 2KYFA 3TUYC 2KI6C 4U8DA 3E3RA 2JNXA 3PSRA 1KCYA 1AHRA 1XK4A 4DCKA 3CLNA 1SKTA 1KWOC 1DJZA 1YURA 1IJ6A 5GQQC 2KAVA 4OKHA 4AOMA 1IGVA 1SCVA 3WHTB 3WXAA 3CR4X 1A29A 4GBAA 3NSKA 1TCFA 4R1EA 3EVVA 1PULA 1JSAA 3CZTX 1IWQA 2FCEA 2EHBA 2M49B 1A4PA 3JTDB 1C7WA 3I5GC 3D0YB 3QRXA 1RECA 4CIDA 2JRFA 2LLUA 1MXEA 1SL9A 1TIZA 1TNXA 1KFUS 1SR6B 3CR2A 1RWYA 4OVNF 5JOLA 1NPQA 3SG3A 4UPGA 3TDZA 1B7TY 1EG3A 3AAJA 1F4QA 1B8LA 2KGRA 1SCMC 1CMFA 1BJFA 3LLEA 1L2OC 2MAZA 1F8HA 3RLZA 4MBEA 2BBMA 2KFGA 3EK4A 1DF0A 1NSHA 4E68A 2KYCA 1UURA 2L2EA 2MBXA 3O4YA 2BE4A 4JWQA 2K7BA 1FF1A 1WRZA 4GGFA 2LHLA 1LINA 4M2PA 2ISDA 1QX7A 1KWOB 3EKJA 3NXAA 2JU0A 1ZUZA 1B9AA 1E8AA 5CSFA 4PE1A 2PRUA 1BR4B 3DVMA 5DKNA 1CM1A 1AK8A 1M45A 3SG6A 1SYMA 1NYAA 5DKRA 3I5HB 3EKHA 2ZFDA 3I5GB 3OP0A 2WC8A 3NSOA 3FS7A 3O78A 1QX5B 1IRJA 4I5JA 1UHIA 1NP8A 2I7AA 1YTZC 1C07A 2EC6C 1KFXS 2KI6D 1MHOA 3PM8A 2ZRSA 3BYAA 3SG2A 4C0LA 4DIRA 1WDCC 2LUCA 3VRQA 1YX7A 1CNPA 2F3YA 4N1FA 1MUXA 5J3XA 2E6WA 1DMOA 2JT3A 2KHNA 1DJYA 2OS8B 3GK4X 1YUTA 3TS5C 1XFUO 3K21A 4MRYA 4P5OE 1F54A 3GOFA 4BY5A 4QJ4B 1HQVA 1KK7Z 1V1FA 1UHHA 1M39A 2FJUB 1UP5A 1QVIY 1XFWO 2F2OA 2LHIA 2WCBA 2ZN9A 3O2PA 3PATA 4CLNA 3EK8A 3SG5A 1JFJA 3D0YA 1BLQA 1Y0VH 5CSIA 5G08A 4A4CA 1S6JA 3IQQA 2ZRTA 4OCIA 1GJYA 5DKQA 1K2HA 1DGVA 1CTRA 3LL8B 1LKJA 4PE7A 1PVAA 4PHJA 3SIAA 1RTP1 1ZOTB 1RK9A 4GNKB 4HRGA 4AQJA 2OTGB 1YRTB 1XFYO 4GFTA 4CPVA 4YRUA 4JPZB 1BODA 1CFCA 1EH2A 3JTDC 5F6TA 1XVJA 3PLFB 1WLZA 1QS7A 1WDCB 1EJ3A 2LAPA 3I5IB 2O60A 2V53A 2F33A 1K95A 1J7RA 3OB2B 1UHKA 1H4BA 1AJ4A 4YGAA 3GK1A 4WQ2A 1FBVA 2LM5A 3KPXA 1WY9A 2JTZA 4L9MA 4NDBA 1GQMA 1MF8B 4USLA 1J1EA 3AKAA 3TS5B 1FI6A 1CLBA 1K9UA 1LA3A 1K96A 1AVSA 1B47A 2K7CA 1PVBA 2BKHB 1SY9A 1EXRA 2K2AA 3PALA 2CT9A 3GK2A 2JPTA 4ICBA 2BBNA 1UHNA 1RROA 2KFHA 4DRWA 1YRUB 2LLTA 2JZIA 1NCYA 1N0YA 5AFPA 1S6CA 1JUOA 1OZOA 2LE9B 4YGEB 1K93D 1JF0A 2LMUA 1RJVA 2JWWA 1NWDA 2KBIA 2SCPA 4HREE 2AUCA 1C7VA 2WCEA 1IH0A 4MZJA 1BU3A 4NQGA 3PFVA 2A4JA 2MRDA 2HQ8A 2ZN8A 5IBWA 2CNPA 1M31A 2K2FA 1A75B 2LNKA 3OX5A 4MEWA 4GAOA 1BR1B 3I5HC 5BPJA 1CLLA 4YI8A 1OOJA 2PALA 1BMOA 3TDIA 1S5GY 3SG4A 1F55A 5CSNA 3DD4A 1R6PA 1Y6WA 5B8IB 1YUUA 1DGUA 3WHUB 3FIAA 1N2DA 1SL7A 2M8UA 4JQ0D 1AJ5A 1PSBA 3BUMB 3VROA 1SNLA 2GGZA 2LV7A 4C0KA 4MZLA 2NXQA 1FW4A 4GPLB 2FOTA 4PE0A 2OS8C 5HKWA 1EL4A 2LP2A 1S3PA 4BY4A 2PVBA 3HX4A 4FTGA 2KOTA 1YVHA 2KNEA 1FPWA 1CDPA 1UHJA 1CDMA 1S6IA 3LK0A 1HT9A 3VRNA 1NX0A 5HKZA 4ORAB 2JC2A 4MZKA 2F3ZA 2Y4QA 2JOJA 1YVLA 3KO0A 2P6BB 1AUIB 5HLOA 1BOCA 1K9KA 1UWOA 1NX1A 1XFXO 2I94A 2I18A 4A4BA 1KSMA 1BG1A 1XFVO 4FQOA 1ZFSA 2B1UA 4I5NB 2K61A 2VRGA 2OTGC 2WORA 1KK8B 1QJTA 1S26D 3BQ3A 1W7JB 3FWCA 5HKYA 2L0PA 1TCOB 2COLB 2JT0A 3BUOB 3EVRA 3ZWHA 1SK6D 3DF0B 4Q04A 1BT6A 2BCBA 2JTTA 4NDCA 2CCMA 1TNQA 2DOQA 3I5IC 1TNWA 4OV2A 3OB1B 4TNCA 1MXLC 1Q80A 2JXLA 4MSPA 4HRHA 2F2PA 2QPTA 2M0RA 1OMDA 2HF5A 1QASA 3LCPC 5KSZA 2KSPA 5TNCA 3F45A 2KQ6A 5I2QA 3TDUA 1EG4A 2MHHA 1W7IB 1G4YR 1A75A 1QV1A 1WRLA 3PN7C 2QACA 4PHMA 4GGNA 3OHMB 2L4HA 5AXIA 3RM1A 4PE4A 1KFXL 5KU1A 1NUBA 2K7DA 1NCXA 1UUSA 1XA5A 1OQPA 4MN0A 1CB1A 4ORBB 2LC5A 2KAYA 1QV0A 2LLSA 3BXKA 3DVKA 2H61C 2L4IA 1NIWA 2R2IA 3KHEA 2L51A 3VRPA 1PK0D 2JT8A 3AKBA 4CFRA 1S5GZ 1ZMZA 2K7OA 3I5FC 5I2LA 1IQ5A 2M29A 1NX3A 3D10A 2K8MB 1IJ5A 3NSLA 1M46A 1CM4A 3BUWB 1B7TZ 3O6BA 2KBMA 1K8UA 1DTLA 1CDLA 1CFDA 1J1DA 2GGMA 2NCPA 3BOWB 4YI9A 1D1OA 5I8NA 1DJIA 2LCPA 1U5IB 5ER4X 2M7LA 3PN7B 2O5GA 1CLMA 1QTXA 1TOPA 1IQ3A 2KFFA 4WQ3A 1B1GA 2OPOA 5HLVA 4C0JA 2LMTA 2K0JA 4YGDB 1J7OA 2G9BA 3IQOA 1JBAA 3M0WA 1Y1AA 2CXJA 3CS1A 4QJ3B 2LVJA 4AQIA 1OE9B 2Q4UA 1YX8A 2Y5IA 3EVUA 2BL0C 1OMRA 1OSAA 1MQ1A 2AAOA 2KQYA 3FWBA 4YBHB 1TRFA 2JQ6A 1B4CA 2BCAA 2GV5A 4D1EA 4I5LB 1OMVA 1F70A 1CFPA 1XO5A 1KK8C 3I5FB 1CKKA 2KI4C 2I2RE 5FYXA 3JVTC 3A8RA 3MSEB 5K89A 1JFKA 3SJSA 1QIWA 1RFJA 2BKIB 2IS9A 2E30A 1V1GA 1SRAA 3HCMA 4XJKB 2NLNA 3H4SE 1R2UA 1M63B 2ZNEA 5AEQA 2ZKMX 1LA0A 2BECA 1A2XA 1NCZA 1WRKA 2EGDA 4I5KA 3CTNA 5CPVA 1QX2A 2JXCA 1QVIZ 4PCWA 5AERA 1XK4C 2CTNA 1OZSA 1DVIA 1KQMC 2WOSA 4CFQA 2MA2A 1MR8A 1XFZO 3WNXB 2BL0B 1KFUL 4ETOA 1PALA 1GGWA 1AP4A 3NSIA 2SASA 1ODBA 3LK1A 4F0ZB 1A03A 1F71A 2LMVA 1XYDA 4DUQA 1N65A 1G8IA 2LP3A 2M9GA 2Y1NA 5AANA 4QJ5B 1ZACA 3SG7A 1G33A 3BOWA 4PDZA 5CSJA 2KAXA 2NZ0A 3OX6A 4WRIA 3DVJA 3TUYB 2CBLA 1U5IA 2KI4B 3JVTB 1S1EA 4ZCUA 1GGZA 1SMGA 2PSRA 2MLEC 1H8BA 4PHKA 1DJXA 1L7ZA 1PSRA 1MWNA 2PMYA 4M2QA 1S36A 3BUXB 1DT7B 5PALA 4NDDA 1X02A 4MRXA 2H61A 3KEVA 1K9PA 3CGAA 4ZCVA 4GGFC 2HQWA 2M1UA 1YR5A 5ER5A 1WLMA 4N1GA 1KQMB 4N5XA 1J55A 1DJGA 2ZNDA 1JC2A 2H2KA 2F8PA 2LVVA 2BE6A 5D7FA 5JJGA 4IL1A 2KGBC 3ZNIA 2MLFC 5I2OA 1CFFA 3CWGA 3DVEA 4OR9B 1SCMB 2L50A 1L2OB 1B8CA 1SW8A 3ICBA 1BF5A 3VRRA 2RGIA 4GUKA 2FCDA 2JULA 1SL8A 2LUXA 2WCFA 1VRKA 1F4OA 4HSZA 3AAKA 4XJKA 1IG5A 1SPYA 3C1VA 4YGBB 1TN4A 5D69A 2HETA 2Q91A 1PRWA 2G2BA 1QIVA 2M7NA 2LVKA 2HPSA 5HYDA 3EK7A 2D8NA 1IKUA 2WNDA 1Y1XA 2TN4A 3TZ1A 1DF0B 2L98A 1DJWA 1FI5A 5KTYA 1QLKA 2M1KB 1TNPA 4PHNA 3A4UB
chains in the Genus database with same CATH superfamily
1ALVA 2LANA 1ORGA 2AMIA 3BJHA 1C3ZA 1KSOA 2EC6B 3KF9A 4YGCB 3UNWA 1J7QA 1C3YA 3S0BA 3VGOA 2NCOA 1K90D 2PASA 3DXLA 1KQVA 3D74A 1J7PA 1DJHA 1SR6C 1JWDA 1SBJA 1K94A 2Y1MA 3CR5X 1QLSA 1ALWA 1NX2A 3DF0A 2M3WA 3BUNB 2JNFA 4XYNA 4PALA 1CMGA 1JF2A 4M2OA 4MLWA 1TTXA 1LVCD 1KK7Y 2L5XB 3OBVA 4P2YB 1QATA 1LXFC 3SIBA 4DS7A 3IF7A 1B8RA 1YUSA 2LVIA 4MVFA 2M97A 1CDNA 1QXPA 2BCXA 2KDHA 2MJWB 4ORCB 3S0GA 1Y1UA 2KYFA 3TUYC 2KI6C 4U8DA 3E3RA 2JNXA 3PSRA 1KCYA 2QEBA 1AHRA 1XK4A 4DCKA 3CLNA 1SKTA 1KWOC 1DJZA 1YURA 1IJ6A 5GQQC 2KAVA 4OKHA 4AOMA 1IGVA 1SCVA 3WHTB 3WXAA 3CR4X 1A29A 4GBAA 3NSKA 1TCFA 4R1EA 3CABA 3EVVA 5FI2A 1PULA 1JSAA 3CZTX 1IWQA 2FCEA 2EHBA 2M49B 1A4PA 2KLEA 3JTDB 2PQLA 1C7WA 3I5GC 3D0YB 3QRXA 1RECA 4CIDA 2JRFA 2LLUA 1MXEA 1SL9A 1TIZA 1TNXA 1KFUS 1SR6B 3CR2A 3QMEA 1RWYA 4OVNF 5JOLA 1NPQA 3SG3A 4UPGA 3TDZA 1B7TY 3FE9A 1EG3A 3AAJA 1F4QA 1B8LA 2KGRA 3D73A 1OW4A 1SCMC 1BJFA 3LLEA 1L2OC 2MAZA 1CMFA 1F8HA 3RLZA 4MBEA 2BBMA 2KFGA 3EK4A 4OZDA 1DF0A 1NSHA 3CZ0A 4E68A 2KYCA 3B7AA 1UURA 2WCKA 2L2EA 2MBXA 3O4YA 2BE4A 4JWQA 2K7BA 1FF1A 1WRZA 4GGFA 2LHLA 1LINA 4M2PA 2ISDA 4JD9A 1QX7A 1KWOB 2L2CA 3EKJA 3NXAA 3BFBA 2JU0A 1ZUZA 1B9AA 1E8AA 1SSEB 3DZTA 5CSFA 4PE1A 2PRUA 1BR4B 3DVMA 5DKNA 1OOFA 1CM1A 1AK8A 3S0EA 1M45A 3SG6A 3CZ1A 1SYMA 1NYAA 5DKRA 3I5HB 3EKHA 2ZFDA 3I5GB 3OP0A 2WC8A 3NSOA 3FS7A 3O78A 1QX5B 1IRJA 4I5JA 1UHIA 1NP8A 2I7AA 1YTZC 1C07A 4KYNA 5DICA 1TWOA 2EC6C 1KFXS 2KI6D 1MHOA 3PM8A 2ZRSA 3BYAA 3SG2A 4C0LA 4DIRA 1WDCC 3D76A 2P70A 2LUCA 3VRQA 1YX7A 1CNPA 2F3YA 2WC6A 3CZ2A 4N1FA 1MUXA 5J3XA 2E6WA 1DMOA 2JT3A 2KHNA 1DJYA 2OS8B 3GK4X 3DYEA 1YUTA 3TS5C 1XFUO 3K21A 4MRYA 4P5OE 3R1OA 1F54A 3GOFA 4BY5A 2WCJA 4QJ4B 2QEOA 1HQVA 1KK7Z 1V1FA 4F7FA 1UHHA 1M39A 2FJUB 1UP5A 1QVIY 1XFWO 2F2OA 2LHIA 2WCBA 2ZN9A 3O2PA 3PATA 1DELA 4CLNA 3VB1A 1XFRA 3EK8A 3SG5A 1JFJA 3D0YA 1BLQA 1Y0VH 5CSIA 5G08A 4A4CA 1P28A 1S6JA 3IQQA 2ZRTA 4OCIA 1GJYA 5DKQA 1K2HA 1DGVA 1CTRA 3IVTA 3LL8B 1LKJA 4PE7A 1PVAA 4PHJA 3SIAA 1RTP1 1ZOTB 1RK9A 4GNKB 4HRGA 4AQJA 2OTGB 1TUZA 1XFYO 1YRTB 4GFTA 4CPVA 4JPZB 4YRUA 1BODA 1CFCA 1EH2A 2KLDA 3JTDC 5F6TA 1XVJA 3PLFB 1WLZA 1QS7A 1WDCB 3SS5A 1EJ3A 2LAPA 3I5IB 2O60A 2V53A 3B87A 2F33A 1K95A 1J7RA 3OB2B 1UHKA 1H4BA 1AJ4A 4YGAA 3GK1A 4WQ2A 4IJ7A 1FBVA 2LM5A 3KPXA 1WY9A 2JTZA 4L9MA 4NDBA 1GQMA 1MF8B 4USLA 1J1EA 3AKAA 3TS5B 1FI6A 1CLBA 1K9UA 1LA3A 3EG5B 1K96A 1AVSA 1B47A 2K7CA 1PVBA 2BKHB 1SY9A 1EXRA 2K2AA 3PALA 2CT9A 3GK2A 2JPTA 4ICBA 2BBNA 2L5YA 1UHNA 1RROA 2KFHA 3CDNA 4DRWA 1YRUB 2LLTA 2JZIA 1NCYA 1N0YA 5AFPA 1S6CA 1JUOA 1OZOA 2LE9B 4YGEB 1K93D 1JF0A 2LMUA 1RJVA 2JWWA 1NWDA 2KBIA 2SCPA 4HREE 2AUCA 1C7VA 2WCEA 2FJYA 1IH0A 4MZJA 3Q8IA 2JPOA 1BU3A 4NQGA 3PFVA 1W9ZA 2A4JA 2MRDA 3K1EA 2HQ8A 2ZN8A 5IBWA 2CNPA 1M31A 2K2FA 1A75B 2LNKA 3OX5A 4MEWA 4GAOA 1BR1B 3D75A 3I5HC 5BPJA 1CLLA 4YI8A 1OOJA 2PALA 1BMOA 3TDIA 3OGNA 1QWVA 1S5GY 3SG4A 1F55A 3N7HA 5CSNA 3DD4A 1R6PA 1Y6WA 5B8IB 1YUUA 1DGUA 5D3OA 3WHUB 3FIAA 1N2DA 1SL7A 2M8UA 4JQ0D 1AJ5A 1PSBA 3BUMB 3VROA 3R72A 1SNLA 2QEVA 2GGZA 2LV7A 4C0KA 4MZLA 2NXQA 3B86A 1FW4A 4GPLB 2FOTA 4PE0A 2OS8C 5HKWA 1EL4A 2BNXA 2LP2A 1Z4HA 1S3PA 4BY4A 2PVBA 3S0AA 3HX4A 4FTGA 2KOTA 1YVHA 2KNEA 1FPWA 1CDPA 2WCMA 1UHJA 1CDMA 1S6IA 3LK0A 1HT9A 3VRNA 1IIOA 1NX0A 5HKZA 4ORAB 2JC2A 4MZKA 2F3ZA 2Y4QA 2JOJA 1YVLA 3KO0A 2P6BB 1AUIB 5HLOA 3B6XA 3SS4A 1BOCA 1K9KA 1UWOA 1NX1A 1XFXO 2I94A 2I18A 4A4BA 1KSMA 1BG1A 1XFVO 4FQOA 1ZFSA 2B1UA 2H8VA 4I5NB 2K61A 2VRGA 3BFAA 2OTGC 2WORA 1KK8B 1QJTA 1S26D 3BQ3A 1W7JB 3FWCA 5HKYA 3S0FA 2L0PA 1TCOB 2COLB 2JT0A 3BUOB 3EVRA 1LS8A 3L4AA 1SK6D 3DF0B 4Q04A 3ZWHA 1BT6A 2BCBA 2JTTA 4NDCA 2CCMA 1TNQA 2DOQA 3I5IC 1TNWA 4OV2A 1T14A 3OB1B 4TNCA 1MXLC 1Q80A 2JXLA 4MSPA 3R1VA 4HRHA 2F2PA 2QPTA 2M0RA 3FE6A 1OMDA 2HF5A 1QASA 4FQTA 3D77A 3LCPC 3PM2A 4PT1A 5KSZA 2KSPA 5TNCA 5FI6A 3F45A 2KQ6A 5I2QA 3TDUA 1EG4A 2MHHA 1W7IB 1G4YR 1A75A 1QV1A 1WRLA 2YGUA 3PN7C 2QACA 2P71A 4PHMA 4GGNA 3OHMB 2L4HA 5AXIA 3RM1A 4PE4A 1KFXL 5KU1A 1NUBA 2K7DA 1NCXA 1UUSA 1XA5A 1OQPA 4MN0A 1CB1A 4ORBB 2LC5A 2KAYA 1QV0A 2LLSA 3BXKA 3DVKA 2H61C 3L4LA 2L4IA 1NIWA 3R1PA 2R2IA 3KHEA 2L51A 3VRPA 1PK0D 2JT8A 3AKBA 4CFRA 1S5GZ 1ZMZA 2K7OA 3I5FC 5I2LA 1IQ5A 2M29A 1NX3A 3D10A 2K8MB 1IJ5A 3NSLA 1M46A 1CM4A 3BUWB 1B7TZ 2GTEA 3O6BA 2KBMA 1K8UA 3D78A 1DTLA 2QDIA 1CDLA 1CFDA 1J1DA 2GGMA 2NCPA 3BOWB 4YI9A 1D1OA 5I8NA 1DJIA 2LCPA 1U5IB 5ER4X 2M7LA 3PN7B 2O5GA 1CLMA 1QTXA 3RZSA 1TOPA 1IQ3A 2KFFA 4WQ3A 1B1GA 4INXA 2OPOA 5HLVA 4C0JA 3NGVA 2LMTA 2K0JA 4YGDB 1J7OA 2G9BA 3IQOA 1JBAA 3M0WA 1Y1AA 2CXJA 3CS1A 4QJ3B 2LVJA 4AQIA 1OE9B 2Q4UA 5I94A 1YX8A 2Y5IA 3EVUA 2BL0C 1OMRA 1OSAA 1MQ1A 2AAOA 2KQYA 3FWBA 4YBHB 1TRFA 2JQ6A 1B4CA 2BCAA 2ERBA 2GV5A 4D1EA 4I5LB 1OMVA 1F70A 1CFPA 2QEHA 1Z2CB 1XO5A 1KK8C 3I5FB 3L47A 1CKKA 2KPHA 2KI4C 2I2RE 5FYXA 3JVTC 3A8RA 3MSEB 3DY9A 5K89A 1JFKA 3SJSA 1QIWA 1RFJA 1DC1A 2BKIB 2IS9A 2E30A 1V1GA 1SRAA 3HCMA 3NHIA 4XJKB 2NLNA 3H4SE 1R2UA 1M63B 2ZNEA 5AEQA 3O4XA 2ZKMX 1LA0A 2BECA 1A2XA 1NCZA 1WRKA 2EGDA 4I5KA 3BFHA 3CTNA 5CPVA 1QX2A 3CYZA 2JXCA 3SS3A 1QVIZ 4PCWA 5AERA 4JKTA 1XK4C 2CTNA 1OZSA 1DVIA 1KQMC 1DEKA 2WOSA 4CFQA 2MA2A 1MR8A 1XFZO 3WNXB 2BL0B 1KFUL 3UO9A 4ETOA 1PALA 3S0DA 1GGWA 1AP4A 3NSIA 2SASA 1ODBA 3LK1A 4F0ZB 1A03A 1F71A 2LMVA 1XYDA 5FI7A 4DUQA 1N65A 1G8IA 2LP3A 2M9GA 2Y1NA 5AANA 4QJ5B 1ZACA 3SG7A 2K60A 1G33A 3BOWA 4PDZA 5CSJA 2KAXA 2NZ0A 3OX6A 4WRIA 3DVJA 3TUYB 2CBLA 1U5IA 2KI4B 3JVTB 1S1EA 4ZCUA 1GGZA 1SMGA 2PSRA 2MLEC 1H8BA 4PHKA 1DJXA 1L7ZA 1PSRA 1MWNA 2PMYA 4M2QA 1S36A 3BUXB 1DT7B 5PALA 3V2LA 4NDDA 1X02A 4MRXA 3FE8A 2H61A 3KEVA 5HL1A 1K9PA 3CGAA 4ZCVA 4GGFC 2HQWA 2M1UA 1YR5A 5ER5A 1WLMA 1TUJA 4N1GA 1KQMB 4N5XA 1J55A 1DJGA 2ZNDA 1JC2A 2H2KA 2F8PA 2LVVA 2BE6A 5D7FA 5JJGA 4IL1A 2KGBC 3ZNIA 2MLFC 5I2OA 1CFFA 3CWGA 3DVEA 3B88A 4OR9B 1SCMB 2L50A 1L2OB 1B8CA 1SW8A 3ICBA 1BF5A 4INWA 2PYQA 2WC5A 3VRRA 2RGIA 4GUKA 2FCDA 2JULA 1SL8A 2LUXA 2WCFA 3PJIA 1VRKA 1GM0A 1F4OA 4HSZA 3AAKA 4XJKA 1IG5A 3NHTA 1SPYA 3C1VA 4YGBB 1TN4A 5D69A 2HETA 1OOHA 2Q91A 1PRWA 2G2BA 2WCLA 1QIVA 2M7NA 2LVKA 2HPSA 5HYDA 3EK7A 1DQEA 2D8NA 1IKUA 2WNDA 5EL2A 1Y1XA 2BAPA 2TN4A 3TZ1A 1DF0B 1OOGA 2L98A 1DJWA 1OOIX 1FI5A 5KTYA 2WCHA 1QLKA 2M1KB 1TNPA 4PHNA 3A4UB
chains in the Genus database with same CATH topology
1ALVA 2LANA 2AMIA 4YGCB 1KSOA 2EC6B 3KF9A 1J7QA 3VGOA 2NCOA 1K90D 2PASA 1KQVA 1J7PA 1DJHA 1SR6C 1JWDA 1SBJA 1K94A 2Y1MA 3CR5X 1QLSA 1ALWA 1NX2A 3DF0A 2M3WA 3BUNB 2JNFA 4XYNA 4PALA 1CMGA 1JF2A 4M2OA 4MLWA 1TTXA 1LVCD 1KK7Y 2L5XB 4P2YB 1QATA 1LXFC 3SIBA 4DS7A 3IF7A 1B8RA 1YUSA 2LVIA 4MVFA 2M97A 1CDNA 1QXPA 2BCXA 2KDHA 2MJWB 4ORCB 1Y1UA 2KYFA 3TUYC 2KI6C 4U8DA 3E3RA 2JNXA 3PSRA 1KCYA 1AHRA 1XK4A 4DCKA 3CLNA 1SKTA 1KWOC 1DJZA 1YURA 1IJ6A 5GQQC 2KAVA 4OKHA 4AOMA 1IGVA 1SCVA 3WHTB 3WXAA 3CR4X 1A29A 4GBAA 3NSKA 1TCFA 4R1EA 3EVVA 1PULA 1JSAA 3CZTX 1IWQA 2FCEA 2EHBA 2M49B 1A4PA 3JTDB 1C7WA 3I5GC 3D0YB 3QRXA 1RECA 4CIDA 2JRFA 2LLUA 1MXEA 1SL9A 1TIZA 1TNXA 1KFUS 1SR6B 3CR2A 1RWYA 4OVNF 5JOLA 1NPQA 3SG3A 4UPGA 3TDZA 1B7TY 1EG3A 3AAJA 1F4QA 1B8LA 2KGRA 1SCMC 1CMFA 1BJFA 3LLEA 1L2OC 2MAZA 1F8HA 3RLZA 4MBEA 2BBMA 2KFGA 3EK4A 1DF0A 1NSHA 4E68A 2KYCA 1UURA 2L2EA 2MBXA 3O4YA 2BE4A 4JWQA 2K7BA 1FF1A 1WRZA 4GGFA 2LHLA 1LINA 4M2PA 2ISDA 1QX7A 1KWOB 3EKJA 3NXAA 2JU0A 1ZUZA 1B9AA 1E8AA 5CSFA 4PE1A 2PRUA 1BR4B 3DVMA 5DKNA 1CM1A 1AK8A 1M45A 3SG6A 1SYMA 1NYAA 5DKRA 3I5HB 3EKHA 2ZFDA 3I5GB 3OP0A 2WC8A 3NSOA 3FS7A 3O78A 1QX5B 1IRJA 4I5JA 1UHIA 1NP8A 2I7AA 1YTZC 1C07A 2EC6C 1KFXS 2KI6D 1MHOA 3PM8A 2ZRSA 3BYAA 3SG2A 4C0LA 4DIRA 1WDCC 2LUCA 3VRQA 1YX7A 1CNPA 2F3YA 4N1FA 1MUXA 5J3XA 2E6WA 1DMOA 2JT3A 2KHNA 1DJYA 2OS8B 3GK4X 1YUTA 3TS5C 1XFUO 3K21A 4MRYA 4P5OE 1F54A 3GOFA 4BY5A 4QJ4B 1HQVA 1KK7Z 1V1FA 1UHHA 1M39A 2FJUB 1UP5A 1QVIY 1XFWO 2F2OA 2LHIA 2WCBA 2ZN9A 3O2PA 3PATA 4CLNA 3EK8A 3SG5A 1JFJA 3D0YA 1BLQA 1Y0VH 5CSIA 5G08A 4A4CA 1S6JA 3IQQA 2ZRTA 4OCIA 1GJYA 5DKQA 1K2HA 1DGVA 1CTRA 3LL8B 1LKJA 4PE7A 1PVAA 4PHJA 3SIAA 1RTP1 1ZOTB 1RK9A 4GNKB 4HRGA 4AQJA 2OTGB 1YRTB 1XFYO 4GFTA 4CPVA 4YRUA 4JPZB 1BODA 1CFCA 1EH2A 3JTDC 5F6TA 1XVJA 3PLFB 1WLZA 1QS7A 1WDCB 1EJ3A 2LAPA 3I5IB 2O60A 2V53A 2F33A 1K95A 1J7RA 3OB2B 1UHKA 1H4BA 1AJ4A 4YGAA 3GK1A 4WQ2A 1FBVA 2LM5A 3KPXA 1WY9A 2JTZA 4L9MA 4NDBA 1GQMA 1MF8B 4USLA 1J1EA 3AKAA 3TS5B 1FI6A 1CLBA 1K9UA 1LA3A 1K96A 1AVSA 1B47A 2K7CA 1PVBA 2BKHB 1SY9A 1EXRA 2K2AA 3PALA 2CT9A 3GK2A 2JPTA 4ICBA 2BBNA 1UHNA 1RROA 2KFHA 4DRWA 1YRUB 2LLTA 2JZIA 1NCYA 1N0YA 5AFPA 1S6CA 1JUOA 1OZOA 2LE9B 4YGEB 1K93D 1JF0A 2LMUA 1RJVA 2JWWA 1NWDA 2KBIA 2SCPA 4HREE 2AUCA 1C7VA 2WCEA 1IH0A 4MZJA 1BU3A 4NQGA 3PFVA 2A4JA 2MRDA 2HQ8A 2ZN8A 5IBWA 2CNPA 1M31A 2K2FA 1A75B 2LNKA 3OX5A 4MEWA 4GAOA 1BR1B 3I5HC 5BPJA 1CLLA 4YI8A 1OOJA 2PALA 1BMOA 3TDIA 1S5GY 3SG4A 1F55A 5CSNA 3DD4A 1R6PA 1Y6WA 5B8IB 1YUUA 1DGUA 3WHUB 3FIAA 1N2DA 1SL7A 2M8UA 4JQ0D 1AJ5A 1PSBA 3BUMB 3VROA 1SNLA 2GGZA 2LV7A 4C0KA 4MZLA 2NXQA 1FW4A 4GPLB 2FOTA 4PE0A 2OS8C 5HKWA 1EL4A 2LP2A 1S3PA 4BY4A 2PVBA 3HX4A 4FTGA 2KOTA 1YVHA 2KNEA 1FPWA 1CDPA 1UHJA 1CDMA 1S6IA 3LK0A 1HT9A 3VRNA 1NX0A 5HKZA 4ORAB 2JC2A 4MZKA 2F3ZA 2Y4QA 2JOJA 1YVLA 3KO0A 2P6BB 1AUIB 5HLOA 1BOCA 1K9KA 1UWOA 1NX1A 1XFXO 2I94A 2I18A 4A4BA 1KSMA 1BG1A 1XFVO 4FQOA 1ZFSA 2B1UA 4I5NB 2K61A 2VRGA 2OTGC 2WORA 1KK8B 1QJTA 1S26D 3BQ3A 1W7JB 3FWCA 5HKYA 2L0PA 1TCOB 2COLB 2JT0A 3BUOB 3EVRA 3ZWHA 1SK6D 3DF0B 4Q04A 1BT6A 2BCBA 2JTTA 4NDCA 2CCMA 1TNQA 2DOQA 3I5IC 1TNWA 4OV2A 3OB1B 4TNCA 1MXLC 1Q80A 2JXLA 4MSPA 4HRHA 2F2PA 2QPTA 2M0RA 1OMDA 2HF5A 1QASA 3LCPC 5KSZA 2KSPA 5TNCA 3F45A 2KQ6A 5I2QA 3TDUA 1EG4A 2MHHA 1W7IB 1G4YR 1A75A 1QV1A 1WRLA 3PN7C 2QACA 4PHMA 4GGNA 3OHMB 2L4HA 5AXIA 3RM1A 4PE4A 1KFXL 5KU1A 1NUBA 2K7DA 1NCXA 1UUSA 1XA5A 1OQPA 4MN0A 1CB1A 4ORBB 2LC5A 2KAYA 1QV0A 2LLSA 3BXKA 3DVKA 2H61C 2L4IA 1NIWA 2R2IA 3KHEA 2L51A 3VRPA 1PK0D 2JT8A 3AKBA 4CFRA 1S5GZ 1ZMZA 2K7OA 3I5FC 5I2LA 1IQ5A 2M29A 1NX3A 3D10A 2K8MB 1IJ5A 3NSLA 1M46A 1CM4A 3BUWB 1B7TZ 3O6BA 2KBMA 1K8UA 1DTLA 1CDLA 1CFDA 1J1DA 2GGMA 2NCPA 3BOWB 4YI9A 1D1OA 5I8NA 1DJIA 2LCPA 1U5IB 5ER4X 2M7LA 3PN7B 2O5GA 1CLMA 1QTXA 1TOPA 1IQ3A 2KFFA 4WQ3A 1B1GA 2OPOA 5HLVA 4C0JA 2LMTA 2K0JA 4YGDB 1J7OA 2G9BA 3IQOA 1JBAA 3M0WA 1Y1AA 2CXJA 3CS1A 4QJ3B 2LVJA 4AQIA 1OE9B 2Q4UA 1YX8A 2Y5IA 3EVUA 2BL0C 1OMRA 1OSAA 1MQ1A 2AAOA 2KQYA 3FWBA 4YBHB 1TRFA 2JQ6A 1B4CA 2BCAA 2GV5A 4D1EA 4I5LB 1OMVA 1F70A 1CFPA 1XO5A 1KK8C 3I5FB 1CKKA 2KI4C 2I2RE 5FYXA 3JVTC 3A8RA 3MSEB 5K89A 1JFKA 3SJSA 1QIWA 1RFJA 2BKIB 2IS9A 2E30A 1V1GA 1SRAA 3HCMA 4XJKB 2NLNA 3H4SE 1R2UA 1M63B 2ZNEA 5AEQA 2ZKMX 1LA0A 2BECA 1A2XA 1NCZA 1WRKA 2EGDA 4I5KA 3CTNA 5CPVA 1QX2A 2JXCA 1QVIZ 4PCWA 5AERA 1XK4C 2CTNA 1OZSA 1DVIA 1KQMC 2WOSA 4CFQA 2MA2A 1MR8A 1XFZO 3WNXB 2BL0B 1KFUL 4ETOA 1PALA 1GGWA 1AP4A 3NSIA 2SASA 1ODBA 3LK1A 4F0ZB 1A03A 1F71A 2LMVA 1XYDA 4DUQA 1N65A 1G8IA 2LP3A 2M9GA 2Y1NA 5AANA 4QJ5B 1ZACA 3SG7A 1G33A 3BOWA 4PDZA 5CSJA 2KAXA 2NZ0A 3OX6A 4WRIA 3DVJA 3TUYB 2CBLA 1U5IA 2KI4B 3JVTB 1S1EA 4ZCUA 1GGZA 1SMGA 2PSRA 2MLEC 1H8BA 4PHKA 1DJXA 1L7ZA 1PSRA 1MWNA 2PMYA 4M2QA 1S36A 3BUXB 1DT7B 5PALA 4NDDA 1X02A 4MRXA 2H61A 3KEVA 1K9PA 3CGAA 4ZCVA 4GGFC 2HQWA 2M1UA 1YR5A 5ER5A 1WLMA 4N1GA 1KQMB 4N5XA 1J55A 1DJGA 2ZNDA 1JC2A 2H2KA 2F8PA 2LVVA 2BE6A 5D7FA 5JJGA 4IL1A 2KGBC 3ZNIA 2MLFC 5I2OA 1CFFA 3CWGA 3DVEA 4OR9B 1SCMB 2L50A 1L2OB 1B8CA 1SW8A 3ICBA 1BF5A 3VRRA 2RGIA 4GUKA 2FCDA 2JULA 1SL8A 2LUXA 2WCFA 1VRKA 1F4OA 4HSZA 3AAKA 4XJKA 1IG5A 1SPYA 3C1VA 4YGBB 1TN4A 5D69A 2HETA 2Q91A 1PRWA 2G2BA 1QIVA 2M7NA 2LVKA 2HPSA 5HYDA 3EK7A 2D8NA 1IKUA 2WNDA 1Y1XA 2TN4A 3TZ1A 1DF0B 2L98A 1DJWA 1FI5A 5KTYA 1QLKA 2M1KB 1TNPA 4PHNA 3A4UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALV A;  2LAN A;  2AMI A;  4YGC B;  1KSO A;  2EC6 B;  3KF9 A;  1J7Q A;  3VGO A;  2NCO A;  1K90 D;  2PAS A;  1KQV A;  1J7P A;  1DJH A;  1SR6 C;  1JWD A;  1SBJ A;  1K94 A;  2Y1M A;  3CR5 X;  1QLS A;  1ALW A;  1NX2 A;  3DF0 A;  2M3W A;  3BUN B;  2JNF A;  4XYN A;  4PAL A;  1CMG A;  1JF2 A;  4M2O A;  4MLW A;  1TTX A;  1LVC D;  1KK7 Y;  2L5X B;  4P2Y B;  1QAT A;  1LXF C;  3SIB A;  4DS7 A;  3IF7 A;  1B8R A;  1YUS A;  2LVI A;  4MVF A;  2M97 A;  1CDN A;  1QXP A;  2BCX A;  2KDH A;  2MJW B;  4ORC B;  1Y1U A;  2KYF A;  3TUY C;  2KI6 C;  4U8D A;  3E3R A;  2JNX A;  3PSR A;  1KCY A;  1AHR A;  1XK4 A;  4DCK A;  3CLN A;  1SKT A;  1KWO C;  1DJZ A;  1YUR A;  1IJ6 A;  5GQQ C;  2KAV A;  4OKH A;  4AOM A;  1IGV A;  1SCV A;  3WHT B;  3WXA A;  3CR4 X;  1A29 A;  4GBA A;  3NSK A;  1TCF A;  4R1E A;  3EVV A;  1PUL A;  1JSA A;  3CZT X;  1IWQ A;  2FCE A;  2EHB A;  2M49 B;  1A4P A;  3JTD B;  1C7W A;  3I5G C;  3D0Y B;  3QRX A;  1REC A;  4CID A;  2JRF A;  2LLU A;  1MXE A;  1SL9 A;  1TIZ A;  1TNX A;  1KFU S;  1SR6 B;  3CR2 A;  1RWY A;  4OVN F;  5JOL A;  1NPQ A;  3SG3 A;  4UPG A;  3TDZ A;  1B7T Y;  1EG3 A;  3AAJ A;  1F4Q A;  1B8L A;  2KGR A;  1SCM C;  1CMF A;  1BJF A;  3LLE A;  1L2O C;  2MAZ A;  1F8H A;  3RLZ A;  4MBE A;  2BBM A;  2KFG A;  3EK4 A;  1DF0 A;  1NSH A;  4E68 A;  2KYC A;  1UUR A;  2L2E A;  2MBX A;  3O4Y A;  2BE4 A;  4JWQ A;  2K7B A;  1FF1 A;  1WRZ A;  4GGF A;  2LHL A;  1LIN A;  4M2P A;  2ISD A;  1QX7 A;  1KWO B;  3EKJ A;  3NXA A;  2JU0 A;  1ZUZ A;  1B9A A;  1E8A A;  5CSF A;  4PE1 A;  2PRU A;  1BR4 B;  3DVM A;  5DKN A;  1CM1 A;  1AK8 A;  1M45 A;  3SG6 A;  1SYM A;  1NYA A;  5DKR A;  3I5H B;  3EKH A;  2ZFD A;  3I5G B;  3OP0 A;  2WC8 A;  3NSO A;  3FS7 A;  3O78 A;  1QX5 B;  1IRJ A;  4I5J A;  1UHI A;  1NP8 A;  2I7A A;  1YTZ C;  1C07 A;  2EC6 C;  1KFX S;  2KI6 D;  1MHO A;  3PM8 A;  2ZRS A;  3BYA A;  3SG2 A;  4C0L A;  4DIR A;  1WDC C;  2LUC A;  3VRQ A;  1YX7 A;  1CNP A;  2F3Y A;  4N1F A;  1MUX A;  5J3X A;  2E6W A;  1DMO A;  2JT3 A;  2KHN A;  1DJY A;  2OS8 B;  3GK4 X;  1YUT A;  3TS5 C;  1XFU O;  3K21 A;  4MRY A;  4P5O E;  1F54 A;  3GOF A;  4BY5 A;  4QJ4 B;  1HQV A;  1KK7 Z;  1V1F A;  1UHH A;  1M39 A;  2FJU B;  1UP5 A;  1QVI Y;  1XFW O;  2F2O A;  2LHI A;  2WCB A;  2ZN9 A;  3O2P A;  3PAT A;  4CLN A;  3EK8 A;  3SG5 A;  1JFJ A;  3D0Y A;  1BLQ A;  1Y0V H;  5CSI A;  5G08 A;  4A4C A;  1S6J A;  3IQQ A;  2ZRT A;  4OCI A;  1GJY A;  5DKQ A;  1K2H A;  1DGV A;  1CTR A;  3LL8 B;  1LKJ A;  4PE7 A;  1PVA A;  4PHJ A;  3SIA A;  1RTP 1;  1ZOT B;  1RK9 A;  4GNK B;  4HRG A;  4AQJ A;  2OTG B;  1YRT B;  1XFY O;  4GFT A;  4CPV A;  4YRU A;  4JPZ B;  1BOD A;  1CFC A;  1EH2 A;  3JTD C;  5F6T A;  1XVJ A;  3PLF B;  1WLZ A;  1QS7 A;  1WDC B;  1EJ3 A;  2LAP A;  3I5I B;  2O60 A;  2V53 A;  2F33 A;  1K95 A;  1J7R A;  3OB2 B;  1UHK A;  1H4B A;  1AJ4 A;  4YGA A;  3GK1 A;  4WQ2 A;  1FBV A;  2LM5 A;  3KPX A;  1WY9 A;  2JTZ A;  4L9M A;  4NDB A;  1GQM A;  1MF8 B;  4USL A;  1J1E A;  3AKA A;  3TS5 B;  1FI6 A;  1CLB A;  1K9U A;  1LA3 A;  1K96 A;  1AVS A;  1B47 A;  2K7C A;  1PVB A;  2BKH B;  1SY9 A;  1EXR A;  2K2A A;  3PAL A;  2CT9 A;  3GK2 A;  2JPT A;  4ICB A;  2BBN A;  1UHN A;  1RRO A;  2KFH A;  4DRW A;  1YRU B;  2LLT A;  2JZI A;  1NCY A;  1N0Y A;  5AFP A;  1S6C A;  1JUO A;  1OZO A;  2LE9 B;  4YGE B;  1K93 D;  1JF0 A;  2LMU A;  1RJV A;  2JWW A;  1NWD A;  2KBI A;  2SCP A;  4HRE E;  2AUC A;  1C7V A;  2WCE A;  1IH0 A;  4MZJ A;  1BU3 A;  4NQG A;  3PFV A;  2A4J A;  2MRD A;  2HQ8 A;  2ZN8 A;  5IBW A;  2CNP A;  1M31 A;  2K2F A;  1A75 B;  2LNK A;  3OX5 A;  4MEW A;  4GAO A;  1BR1 B;  3I5H C;  5BPJ A;  1CLL A;  4YI8 A;  1OOJ A;  2PAL A;  1BMO A;  3TDI A;  1S5G Y;  3SG4 A;  1F55 A;  5CSN A;  3DD4 A;  1R6P A;  1Y6W A;  5B8I B;  1YUU A;  1DGU A;  3WHU B;  3FIA A;  1N2D A;  1SL7 A;  2M8U A;  4JQ0 D;  1AJ5 A;  1PSB A;  3BUM B;  3VRO A;  1SNL A;  2GGZ A;  2LV7 A;  4C0K A;  4MZL A;  2NXQ A;  1FW4 A;  4GPL B;  2FOT A;  4PE0 A;  2OS8 C;  5HKW A;  1EL4 A;  2LP2 A;  1S3P A;  4BY4 A;  2PVB A;  3HX4 A;  4FTG A;  2KOT A;  1YVH A;  2KNE A;  1FPW A;  1CDP A;  1UHJ A;  1CDM A;  1S6I A;  3LK0 A;  1HT9 A;  3VRN A;  1NX0 A;  5HKZ A;  4ORA B;  2JC2 A;  4MZK A;  2F3Z A;  2Y4Q A;  2JOJ A;  1YVL A;  3KO0 A;  2P6B B;  1AUI B;  5HLO A;  1BOC A;  1K9K A;  1UWO A;  1NX1 A;  1XFX O;  2I94 A;  2I18 A;  4A4B A;  1KSM A;  1BG1 A;  1XFV O;  4FQO A;  1ZFS A;  2B1U A;  4I5N B;  2K61 A;  2VRG A;  2OTG C;  2WOR A;  1KK8 B;  1QJT A;  1S26 D;  3BQ3 A;  1W7J B;  3FWC A;  5HKY A;  2L0P A;  1TCO B;  2COL B;  2JT0 A;  3BUO B;  3EVR A;  3ZWH A;  1SK6 D;  3DF0 B;  4Q04 A;  1BT6 A;  2BCB A;  2JTT A;  4NDC A;  2CCM A;  1TNQ A;  2DOQ A;  3I5I C;  1TNW A;  4OV2 A;  3OB1 B;  4TNC A;  1MXL C;  1Q80 A;  2JXL A;  4MSP A;  4HRH A;  2F2P A;  2QPT A;  2M0R A;  1OMD A;  2HF5 A;  1QAS A;  3LCP C;  5KSZ A;  2KSP A;  5TNC A;  3F45 A;  2KQ6 A;  5I2Q A;  3TDU A;  1EG4 A;  2MHH A;  1W7I B;  1G4Y R;  1A75 A;  1QV1 A;  1WRL A;  3PN7 C;  2QAC A;  4PHM A;  4GGN A;  3OHM B;  2L4H A;  5AXI A;  3RM1 A;  4PE4 A;  1KFX L;  5KU1 A;  1NUB A;  2K7D A;  1NCX A;  1UUS A;  1XA5 A;  1OQP A;  4MN0 A;  1CB1 A;  4ORB B;  2LC5 A;  2KAY A;  1QV0 A;  2LLS A;  3BXK A;  3DVK A;  2H61 C;  2L4I A;  1NIW A;  2R2I A;  3KHE A;  2L51 A;  3VRP A;  1PK0 D;  2JT8 A;  3AKB A;  4CFR A;  1S5G Z;  1ZMZ A;  2K7O A;  3I5F C;  5I2L A;  1IQ5 A;  2M29 A;  1NX3 A;  3D10 A;  2K8M B;  1IJ5 A;  3NSL A;  1M46 A;  1CM4 A;  3BUW B;  1B7T Z;  3O6B A;  2KBM A;  1K8U A;  1DTL A;  1CDL A;  1CFD A;  1J1D A;  2GGM A;  2NCP A;  3BOW B;  4YI9 A;  1D1O A;  5I8N A;  1DJI A;  2LCP A;  1U5I B;  5ER4 X;  2M7L A;  3PN7 B;  2O5G A;  1CLM A;  1QTX A;  1TOP A;  1IQ3 A;  2KFF A;  4WQ3 A;  1B1G A;  2OPO A;  5HLV A;  4C0J A;  2LMT A;  2K0J A;  4YGD B;  1J7O A;  2G9B A;  3IQO A;  1JBA A;  3M0W A;  1Y1A A;  2CXJ A;  3CS1 A;  4QJ3 B;  2LVJ A;  4AQI A;  1OE9 B;  2Q4U A;  1YX8 A;  2Y5I A;  3EVU A;  2BL0 C;  1OMR A;  1OSA A;  1MQ1 A;  2AAO A;  2KQY A;  3FWB A;  4YBH B;  1TRF A;  2JQ6 A;  1B4C A;  2BCA A;  2GV5 A;  4D1E A;  4I5L B;  1OMV A;  1F70 A;  1CFP A;  1XO5 A;  1KK8 C;  3I5F B;  1CKK A;  2KI4 C;  2I2R E;  5FYX A;  3JVT C;  3A8R A;  3MSE B;  5K89 A;  1JFK A;  3SJS A;  1QIW A;  1RFJ A;  2BKI B;  2IS9 A;  2E30 A;  1V1G A;  1SRA A;  3HCM A;  4XJK B;  2NLN A;  3H4S E;  1R2U A;  1M63 B;  2ZNE A;  5AEQ A;  2ZKM X;  1LA0 A;  2BEC A;  1A2X A;  1NCZ A;  1WRK A;  2EGD A;  4I5K A;  3CTN A;  5CPV A;  1QX2 A;  2JXC A;  1QVI Z;  4PCW A;  5AER A;  1XK4 C;  2CTN A;  1OZS A;  1DVI A;  1KQM C;  2WOS A;  4CFQ A;  2MA2 A;  1MR8 A;  1XFZ O;  3WNX B;  2BL0 B;  1KFU L;  4ETO A;  1PAL A;  1GGW A;  1AP4 A;  3NSI A;  2SAS A;  1ODB A;  3LK1 A;  4F0Z B;  1A03 A;  1F71 A;  2LMV A;  1XYD A;  4DUQ A;  1N65 A;  1G8I A;  2LP3 A;  2M9G A;  2Y1N A;  5AAN A;  4QJ5 B;  1ZAC A;  3SG7 A;  1G33 A;  3BOW A;  4PDZ A;  5CSJ A;  2KAX A;  2NZ0 A;  3OX6 A;  4WRI A;  3DVJ A;  3TUY B;  2CBL A;  1U5I A;  2KI4 B;  3JVT B;  1S1E A;  4ZCU A;  1GGZ A;  1SMG A;  2PSR A;  2MLE C;  1H8B A;  4PHK A;  1DJX A;  1L7Z A;  1PSR A;  1MWN A;  2PMY A;  4M2Q A;  1S36 A;  3BUX B;  1DT7 B;  5PAL A;  4NDD A;  1X02 A;  4MRX A;  2H61 A;  3KEV A;  1K9P A;  3CGA A;  4ZCV A;  4GGF C;  2HQW A;  2M1U A;  1YR5 A;  5ER5 A;  1WLM A;  4N1G A;  1KQM B;  4N5X A;  1J55 A;  1DJG A;  2ZND A;  1JC2 A;  2H2K A;  2F8P A;  2LVV A;  2BE6 A;  5D7F A;  5JJG A;  4IL1 A;  2KGB C;  3ZNI A;  2MLF C;  5I2O A;  1CFF A;  3CWG A;  3DVE A;  4OR9 B;  1SCM B;  2L50 A;  1L2O B;  1B8C A;  1SW8 A;  3ICB A;  1BF5 A;  3VRR A;  2RGI A;  4GUK A;  2FCD A;  2JUL A;  1SL8 A;  2LUX A;  2WCF A;  1VRK A;  1F4O A;  4HSZ A;  3AAK A;  4XJK A;  1IG5 A;  1SPY A;  3C1V A;  4YGB B;  1TN4 A;  5D69 A;  2HET A;  2Q91 A;  1PRW A;  2G2B A;  1QIV A;  2M7N A;  2LVK A;  2HPS A;  5HYD A;  3EK7 A;  2D8N A;  1IKU A;  2WND A;  1Y1X A;  2TN4 A;  3TZ1 A;  1DF0 B;  2L98 A;  1DJW A;  1FI5 A;  5KTY A;  1QLK A;  2M1K B;  1TNP A;  4PHN A;  3A4U B; 
#chains in the Genus database with same CATH topology
 1ALV A;  2LAN A;  1ORG A;  2AMI A;  3BJH A;  1C3Z A;  1KSO A;  2EC6 B;  3KF9 A;  4YGC B;  3UNW A;  1J7Q A;  1C3Y A;  3S0B A;  3VGO A;  2NCO A;  1K90 D;  2PAS A;  3DXL A;  1KQV A;  3D74 A;  1J7P A;  1DJH A;  1SR6 C;  1JWD A;  1SBJ A;  1K94 A;  2Y1M A;  3CR5 X;  1QLS A;  1ALW A;  1NX2 A;  3DF0 A;  2M3W A;  3BUN B;  2JNF A;  4XYN A;  4PAL A;  1CMG A;  1JF2 A;  4M2O A;  4MLW A;  1TTX A;  1LVC D;  1KK7 Y;  2L5X B;  3OBV A;  4P2Y B;  1QAT A;  1LXF C;  3SIB A;  4DS7 A;  3IF7 A;  1B8R A;  1YUS A;  2LVI A;  4MVF A;  2M97 A;  1CDN A;  1QXP A;  2BCX A;  2KDH A;  2MJW B;  4ORC B;  3S0G A;  1Y1U A;  2KYF A;  3TUY C;  2KI6 C;  4U8D A;  3E3R A;  2JNX A;  3PSR A;  1KCY A;  2QEB A;  1AHR A;  1XK4 A;  4DCK A;  3CLN A;  1SKT A;  1KWO C;  1DJZ A;  1YUR A;  1IJ6 A;  5GQQ C;  2KAV A;  4OKH A;  4AOM A;  1IGV A;  1SCV A;  3WHT B;  3WXA A;  3CR4 X;  1A29 A;  4GBA A;  3NSK A;  1TCF A;  4R1E A;  3CAB A;  3EVV A;  5FI2 A;  1PUL A;  1JSA A;  3CZT X;  1IWQ A;  2FCE A;  2EHB A;  2M49 B;  1A4P A;  2KLE A;  3JTD B;  2PQL A;  1C7W A;  3I5G C;  3D0Y B;  3QRX A;  1REC A;  4CID A;  2JRF A;  2LLU A;  1MXE A;  1SL9 A;  1TIZ A;  1TNX A;  1KFU S;  1SR6 B;  3CR2 A;  3QME A;  1RWY A;  4OVN F;  5JOL A;  1NPQ A;  3SG3 A;  4UPG A;  3TDZ A;  1B7T Y;  3FE9 A;  1EG3 A;  3AAJ A;  1F4Q A;  1B8L A;  2KGR A;  3D73 A;  1OW4 A;  1SCM C;  1BJF A;  3LLE A;  1L2O C;  2MAZ A;  1CMF A;  1F8H A;  3RLZ A;  4MBE A;  2BBM A;  2KFG A;  3EK4 A;  4OZD A;  1DF0 A;  1NSH A;  3CZ0 A;  4E68 A;  2KYC A;  3B7A A;  1UUR A;  2WCK A;  2L2E A;  2MBX A;  3O4Y A;  2BE4 A;  4JWQ A;  2K7B A;  1FF1 A;  1WRZ A;  4GGF A;  2LHL A;  1LIN A;  4M2P A;  2ISD A;  4JD9 A;  1QX7 A;  1KWO B;  2L2C A;  3EKJ A;  3NXA A;  3BFB A;  2JU0 A;  1ZUZ A;  1B9A A;  1E8A A;  1SSE B;  3DZT A;  5CSF A;  4PE1 A;  2PRU A;  1BR4 B;  3DVM A;  5DKN A;  1OOF A;  1CM1 A;  1AK8 A;  3S0E A;  1M45 A;  3SG6 A;  3CZ1 A;  1SYM A;  1NYA A;  5DKR A;  3I5H B;  3EKH A;  2ZFD A;  3I5G B;  3OP0 A;  2WC8 A;  3NSO A;  3FS7 A;  3O78 A;  1QX5 B;  1IRJ A;  4I5J A;  1UHI A;  1NP8 A;  2I7A A;  1YTZ C;  1C07 A;  4KYN A;  5DIC A;  1TWO A;  2EC6 C;  1KFX S;  2KI6 D;  1MHO A;  3PM8 A;  2ZRS A;  3BYA A;  3SG2 A;  4C0L A;  4DIR A;  1WDC C;  3D76 A;  2P70 A;  2LUC A;  3VRQ A;  1YX7 A;  1CNP A;  2F3Y A;  2WC6 A;  3CZ2 A;  4N1F A;  1MUX A;  5J3X A;  2E6W A;  1DMO A;  2JT3 A;  2KHN A;  1DJY A;  2OS8 B;  3GK4 X;  3DYE A;  1YUT A;  3TS5 C;  1XFU O;  3K21 A;  4MRY A;  4P5O E;  3R1O A;  1F54 A;  3GOF A;  4BY5 A;  2WCJ A;  4QJ4 B;  2QEO A;  1HQV A;  1KK7 Z;  1V1F A;  4F7F A;  1UHH A;  1M39 A;  2FJU B;  1UP5 A;  1QVI Y;  1XFW O;  2F2O A;  2LHI A;  2WCB A;  2ZN9 A;  3O2P A;  3PAT A;  1DEL A;  4CLN A;  3VB1 A;  1XFR A;  3EK8 A;  3SG5 A;  1JFJ A;  3D0Y A;  1BLQ A;  1Y0V H;  5CSI A;  5G08 A;  4A4C A;  1P28 A;  1S6J A;  3IQQ A;  2ZRT A;  4OCI A;  1GJY A;  5DKQ A;  1K2H A;  1DGV A;  1CTR A;  3IVT A;  3LL8 B;  1LKJ A;  4PE7 A;  1PVA A;  4PHJ A;  3SIA A;  1RTP 1;  1ZOT B;  1RK9 A;  4GNK B;  4HRG A;  4AQJ A;  2OTG B;  1TUZ A;  1XFY O;  1YRT B;  4GFT A;  4CPV A;  4JPZ B;  4YRU A;  1BOD A;  1CFC A;  1EH2 A;  2KLD A;  3JTD C;  5F6T A;  1XVJ A;  3PLF B;  1WLZ A;  1QS7 A;  1WDC B;  3SS5 A;  1EJ3 A;  2LAP A;  3I5I B;  2O60 A;  2V53 A;  3B87 A;  2F33 A;  1K95 A;  1J7R A;  3OB2 B;  1UHK A;  1H4B A;  1AJ4 A;  4YGA A;  3GK1 A;  4WQ2 A;  4IJ7 A;  1FBV A;  2LM5 A;  3KPX A;  1WY9 A;  2JTZ A;  4L9M A;  4NDB A;  1GQM A;  1MF8 B;  4USL A;  1J1E A;  3AKA A;  3TS5 B;  1FI6 A;  1CLB A;  1K9U A;  1LA3 A;  3EG5 B;  1K96 A;  1AVS A;  1B47 A;  2K7C A;  1PVB A;  2BKH B;  1SY9 A;  1EXR A;  2K2A A;  3PAL A;  2CT9 A;  3GK2 A;  2JPT A;  4ICB A;  2BBN A;  2L5Y A;  1UHN A;  1RRO A;  2KFH A;  3CDN A;  4DRW A;  1YRU B;  2LLT A;  2JZI A;  1NCY A;  1N0Y A;  5AFP A;  1S6C A;  1JUO A;  1OZO A;  2LE9 B;  4YGE B;  1K93 D;  1JF0 A;  2LMU A;  1RJV A;  2JWW A;  1NWD A;  2KBI A;  2SCP A;  4HRE E;  2AUC A;  1C7V A;  2WCE A;  2FJY A;  1IH0 A;  4MZJ A;  3Q8I A;  2JPO A;  1BU3 A;  4NQG A;  3PFV A;  1W9Z A;  2A4J A;  2MRD A;  3K1E A;  2HQ8 A;  2ZN8 A;  5IBW A;  2CNP A;  1M31 A;  2K2F A;  1A75 B;  2LNK A;  3OX5 A;  4MEW A;  4GAO A;  1BR1 B;  3D75 A;  3I5H C;  5BPJ A;  1CLL A;  4YI8 A;  1OOJ A;  2PAL A;  1BMO A;  3TDI A;  3OGN A;  1QWV A;  1S5G Y;  3SG4 A;  1F55 A;  3N7H A;  5CSN A;  3DD4 A;  1R6P A;  1Y6W A;  5B8I B;  1YUU A;  1DGU A;  5D3O A;  3WHU B;  3FIA A;  1N2D A;  1SL7 A;  2M8U A;  4JQ0 D;  1AJ5 A;  1PSB A;  3BUM B;  3VRO A;  3R72 A;  1SNL A;  2QEV A;  2GGZ A;  2LV7 A;  4C0K A;  4MZL A;  2NXQ A;  3B86 A;  1FW4 A;  4GPL B;  2FOT A;  4PE0 A;  2OS8 C;  5HKW A;  1EL4 A;  2BNX A;  2LP2 A;  1Z4H A;  1S3P A;  4BY4 A;  2PVB A;  3S0A A;  3HX4 A;  4FTG A;  2KOT A;  1YVH A;  2KNE A;  1FPW A;  1CDP A;  2WCM A;  1UHJ A;  1CDM A;  1S6I A;  3LK0 A;  1HT9 A;  3VRN A;  1IIO A;  1NX0 A;  5HKZ A;  4ORA B;  2JC2 A;  4MZK A;  2F3Z A;  2Y4Q A;  2JOJ A;  1YVL A;  3KO0 A;  2P6B B;  1AUI B;  5HLO A;  3B6X A;  3SS4 A;  1BOC A;  1K9K A;  1UWO A;  1NX1 A;  1XFX O;  2I94 A;  2I18 A;  4A4B A;  1KSM A;  1BG1 A;  1XFV O;  4FQO A;  1ZFS A;  2B1U A;  2H8V A;  4I5N B;  2K61 A;  2VRG A;  3BFA A;  2OTG C;  2WOR A;  1KK8 B;  1QJT A;  1S26 D;  3BQ3 A;  1W7J B;  3FWC A;  5HKY A;  3S0F A;  2L0P A;  1TCO B;  2COL B;  2JT0 A;  3BUO B;  3EVR A;  1LS8 A;  3L4A A;  1SK6 D;  3DF0 B;  4Q04 A;  3ZWH A;  1BT6 A;  2BCB A;  2JTT A;  4NDC A;  2CCM A;  1TNQ A;  2DOQ A;  3I5I C;  1TNW A;  4OV2 A;  1T14 A;  3OB1 B;  4TNC A;  1MXL C;  1Q80 A;  2JXL A;  4MSP A;  3R1V A;  4HRH A;  2F2P A;  2QPT A;  2M0R A;  3FE6 A;  1OMD A;  2HF5 A;  1QAS A;  4FQT A;  3D77 A;  3LCP C;  3PM2 A;  4PT1 A;  5KSZ A;  2KSP A;  5TNC A;  5FI6 A;  3F45 A;  2KQ6 A;  5I2Q A;  3TDU A;  1EG4 A;  2MHH A;  1W7I B;  1G4Y R;  1A75 A;  1QV1 A;  1WRL A;  2YGU A;  3PN7 C;  2QAC A;  2P71 A;  4PHM A;  4GGN A;  3OHM B;  2L4H A;  5AXI A;  3RM1 A;  4PE4 A;  1KFX L;  5KU1 A;  1NUB A;  2K7D A;  1NCX A;  1UUS A;  1XA5 A;  1OQP A;  4MN0 A;  1CB1 A;  4ORB B;  2LC5 A;  2KAY A;  1QV0 A;  2LLS A;  3BXK A;  3DVK A;  2H61 C;  3L4L A;  2L4I A;  1NIW A;  3R1P A;  2R2I A;  3KHE A;  2L51 A;  3VRP A;  1PK0 D;  2JT8 A;  3AKB A;  4CFR A;  1S5G Z;  1ZMZ A;  2K7O A;  3I5F C;  5I2L A;  1IQ5 A;  2M29 A;  1NX3 A;  3D10 A;  2K8M B;  1IJ5 A;  3NSL A;  1M46 A;  1CM4 A;  3BUW B;  1B7T Z;  2GTE A;  3O6B A;  2KBM A;  1K8U A;  3D78 A;  1DTL A;  2QDI A;  1CDL A;  1CFD A;  1J1D A;  2GGM A;  2NCP A;  3BOW B;  4YI9 A;  1D1O A;  5I8N A;  1DJI A;  2LCP A;  1U5I B;  5ER4 X;  2M7L A;  3PN7 B;  2O5G A;  1CLM A;  1QTX A;  3RZS A;  1TOP A;  1IQ3 A;  2KFF A;  4WQ3 A;  1B1G A;  4INX A;  2OPO A;  5HLV A;  4C0J A;  3NGV A;  2LMT A;  2K0J A;  4YGD B;  1J7O A;  2G9B A;  3IQO A;  1JBA A;  3M0W A;  1Y1A A;  2CXJ A;  3CS1 A;  4QJ3 B;  2LVJ A;  4AQI A;  1OE9 B;  2Q4U A;  5I94 A;  1YX8 A;  2Y5I A;  3EVU A;  2BL0 C;  1OMR A;  1OSA A;  1MQ1 A;  2AAO A;  2KQY A;  3FWB A;  4YBH B;  1TRF A;  2JQ6 A;  1B4C A;  2BCA A;  2ERB A;  2GV5 A;  4D1E A;  4I5L B;  1OMV A;  1F70 A;  1CFP A;  2QEH A;  1Z2C B;  1XO5 A;  1KK8 C;  3I5F B;  3L47 A;  1CKK A;  2KPH A;  2KI4 C;  2I2R E;  5FYX A;  3JVT C;  3A8R A;  3MSE B;  3DY9 A;  5K89 A;  1JFK A;  3SJS A;  1QIW A;  1RFJ A;  1DC1 A;  2BKI B;  2IS9 A;  2E30 A;  1V1G A;  1SRA A;  3HCM A;  3NHI A;  4XJK B;  2NLN A;  3H4S E;  1R2U A;  1M63 B;  2ZNE A;  5AEQ A;  3O4X A;  2ZKM X;  1LA0 A;  2BEC A;  1A2X A;  1NCZ A;  1WRK A;  2EGD A;  4I5K A;  3BFH A;  3CTN A;  5CPV A;  1QX2 A;  3CYZ A;  2JXC A;  3SS3 A;  1QVI Z;  4PCW A;  5AER A;  4JKT A;  1XK4 C;  2CTN A;  1OZS A;  1DVI A;  1KQM C;  1DEK A;  2WOS A;  4CFQ A;  2MA2 A;  1MR8 A;  1XFZ O;  3WNX B;  2BL0 B;  1KFU L;  3UO9 A;  4ETO A;  1PAL A;  3S0D A;  1GGW A;  1AP4 A;  3NSI A;  2SAS A;  1ODB A;  3LK1 A;  4F0Z B;  1A03 A;  1F71 A;  2LMV A;  1XYD A;  5FI7 A;  4DUQ A;  1N65 A;  1G8I A;  2LP3 A;  2M9G A;  2Y1N A;  5AAN A;  4QJ5 B;  1ZAC A;  3SG7 A;  2K60 A;  1G33 A;  3BOW A;  4PDZ A;  5CSJ A;  2KAX A;  2NZ0 A;  3OX6 A;  4WRI A;  3DVJ A;  3TUY B;  2CBL A;  1U5I A;  2KI4 B;  3JVT B;  1S1E A;  4ZCU A;  1GGZ A;  1SMG A;  2PSR A;  2MLE C;  1H8B A;  4PHK A;  1DJX A;  1L7Z A;  1PSR A;  1MWN A;  2PMY A;  4M2Q A;  1S36 A;  3BUX B;  1DT7 B;  5PAL A;  3V2L A;  4NDD A;  1X02 A;  4MRX A;  3FE8 A;  2H61 A;  3KEV A;  5HL1 A;  1K9P A;  3CGA A;  4ZCV A;  4GGF C;  2HQW A;  2M1U A;  1YR5 A;  5ER5 A;  1WLM A;  1TUJ A;  4N1G A;  1KQM B;  4N5X A;  1J55 A;  1DJG A;  2ZND A;  1JC2 A;  2H2K A;  2F8P A;  2LVV A;  2BE6 A;  5D7F A;  5JJG A;  4IL1 A;  2KGB C;  3ZNI A;  2MLF C;  5I2O A;  1CFF A;  3CWG A;  3DVE A;  3B88 A;  4OR9 B;  1SCM B;  2L50 A;  1L2O B;  1B8C A;  1SW8 A;  3ICB A;  1BF5 A;  4INW A;  2PYQ A;  2WC5 A;  3VRR A;  2RGI A;  4GUK A;  2FCD A;  2JUL A;  1SL8 A;  2LUX A;  2WCF A;  3PJI A;  1VRK A;  1GM0 A;  1F4O A;  4HSZ A;  3AAK A;  4XJK A;  1IG5 A;  3NHT A;  1SPY A;  3C1V A;  4YGB B;  1TN4 A;  5D69 A;  2HET A;  1OOH A;  2Q91 A;  1PRW A;  2G2B A;  2WCL A;  1QIV A;  2M7N A;  2LVK A;  2HPS A;  5HYD A;  3EK7 A;  1DQE A;  2D8N A;  1IKU A;  2WND A;  5EL2 A;  1Y1X A;  2BAP A;  2TN4 A;  3TZ1 A;  1DF0 B;  1OOG A;  2L98 A;  1DJW A;  1OOI X;  1FI5 A;  5KTY A;  2WCH A;  1QLK A;  2M1K B;  1TNP A;  4PHN A;  3A4U B; 
#chains in the Genus database with same CATH homology
 1ALV A;  2LAN A;  2AMI A;  4YGC B;  1KSO A;  2EC6 B;  3KF9 A;  1J7Q A;  3VGO A;  2NCO A;  1K90 D;  2PAS A;  1KQV A;  1J7P A;  1DJH A;  1SR6 C;  1JWD A;  1SBJ A;  1K94 A;  2Y1M A;  3CR5 X;  1QLS A;  1ALW A;  1NX2 A;  3DF0 A;  2M3W A;  3BUN B;  2JNF A;  4XYN A;  4PAL A;  1CMG A;  1JF2 A;  4M2O A;  4MLW A;  1TTX A;  1LVC D;  1KK7 Y;  2L5X B;  4P2Y B;  1QAT A;  1LXF C;  3SIB A;  4DS7 A;  3IF7 A;  1B8R A;  1YUS A;  2LVI A;  4MVF A;  2M97 A;  1CDN A;  1QXP A;  2BCX A;  2KDH A;  2MJW B;  4ORC B;  1Y1U A;  2KYF A;  3TUY C;  2KI6 C;  4U8D A;  3E3R A;  2JNX A;  3PSR A;  1KCY A;  1AHR A;  1XK4 A;  4DCK A;  3CLN A;  1SKT A;  1KWO C;  1DJZ A;  1YUR A;  1IJ6 A;  5GQQ C;  2KAV A;  4OKH A;  4AOM A;  1IGV A;  1SCV A;  3WHT B;  3WXA A;  3CR4 X;  1A29 A;  4GBA A;  3NSK A;  1TCF A;  4R1E A;  3EVV A;  1PUL A;  1JSA A;  3CZT X;  1IWQ A;  2FCE A;  2EHB A;  2M49 B;  1A4P A;  3JTD B;  1C7W A;  3I5G C;  3D0Y B;  3QRX A;  1REC A;  4CID A;  2JRF A;  2LLU A;  1MXE A;  1SL9 A;  1TIZ A;  1TNX A;  1KFU S;  1SR6 B;  3CR2 A;  1RWY A;  4OVN F;  5JOL A;  1NPQ A;  3SG3 A;  4UPG A;  3TDZ A;  1B7T Y;  1EG3 A;  3AAJ A;  1F4Q A;  1B8L A;  2KGR A;  1SCM C;  1CMF A;  1BJF A;  3LLE A;  1L2O C;  2MAZ A;  1F8H A;  3RLZ A;  4MBE A;  2BBM A;  2KFG A;  3EK4 A;  1DF0 A;  1NSH A;  4E68 A;  2KYC A;  1UUR A;  2L2E A;  2MBX A;  3O4Y A;  2BE4 A;  4JWQ A;  2K7B A;  1FF1 A;  1WRZ A;  4GGF A;  2LHL A;  1LIN A;  4M2P A;  2ISD A;  1QX7 A;  1KWO B;  3EKJ A;  3NXA A;  2JU0 A;  1ZUZ A;  1B9A A;  1E8A A;  5CSF A;  4PE1 A;  2PRU A;  1BR4 B;  3DVM A;  5DKN A;  1CM1 A;  1AK8 A;  1M45 A;  3SG6 A;  1SYM A;  1NYA A;  5DKR A;  3I5H B;  3EKH A;  2ZFD A;  3I5G B;  3OP0 A;  2WC8 A;  3NSO A;  3FS7 A;  3O78 A;  1QX5 B;  1IRJ A;  4I5J A;  1UHI A;  1NP8 A;  2I7A A;  1YTZ C;  1C07 A;  2EC6 C;  1KFX S;  2KI6 D;  1MHO A;  3PM8 A;  2ZRS A;  3BYA A;  3SG2 A;  4C0L A;  4DIR A;  1WDC C;  2LUC A;  3VRQ A;  1YX7 A;  1CNP A;  2F3Y A;  4N1F A;  1MUX A;  5J3X A;  2E6W A;  1DMO A;  2JT3 A;  2KHN A;  1DJY A;  2OS8 B;  3GK4 X;  1YUT A;  3TS5 C;  1XFU O;  3K21 A;  4MRY A;  4P5O E;  1F54 A;  3GOF A;  4BY5 A;  4QJ4 B;  1HQV A;  1KK7 Z;  1V1F A;  1UHH A;  1M39 A;  2FJU B;  1UP5 A;  1QVI Y;  1XFW O;  2F2O A;  2LHI A;  2WCB A;  2ZN9 A;  3O2P A;  3PAT A;  4CLN A;  3EK8 A;  3SG5 A;  1JFJ A;  3D0Y A;  1BLQ A;  1Y0V H;  5CSI A;  5G08 A;  4A4C A;  1S6J A;  3IQQ A;  2ZRT A;  4OCI A;  1GJY A;  5DKQ A;  1K2H A;  1DGV A;  1CTR A;  3LL8 B;  1LKJ A;  4PE7 A;  1PVA A;  4PHJ A;  3SIA A;  1RTP 1;  1ZOT B;  1RK9 A;  4GNK B;  4HRG A;  4AQJ A;  2OTG B;  1YRT B;  1XFY O;  4GFT A;  4CPV A;  4YRU A;  4JPZ B;  1BOD A;  1CFC A;  1EH2 A;  3JTD C;  5F6T A;  1XVJ A;  3PLF B;  1WLZ A;  1QS7 A;  1WDC B;  1EJ3 A;  2LAP A;  3I5I B;  2O60 A;  2V53 A;  2F33 A;  1K95 A;  1J7R A;  3OB2 B;  1UHK A;  1H4B A;  1AJ4 A;  4YGA A;  3GK1 A;  4WQ2 A;  1FBV A;  2LM5 A;  3KPX A;  1WY9 A;  2JTZ A;  4L9M A;  4NDB A;  1GQM A;  1MF8 B;  4USL A;  1J1E A;  3AKA A;  3TS5 B;  1FI6 A;  1CLB A;  1K9U A;  1LA3 A;  1K96 A;  1AVS A;  1B47 A;  2K7C A;  1PVB A;  2BKH B;  1SY9 A;  1EXR A;  2K2A A;  3PAL A;  2CT9 A;  3GK2 A;  2JPT A;  4ICB A;  2BBN A;  1UHN A;  1RRO A;  2KFH A;  4DRW A;  1YRU B;  2LLT A;  2JZI A;  1NCY A;  1N0Y A;  5AFP A;  1S6C A;  1JUO A;  1OZO A;  2LE9 B;  4YGE B;  1K93 D;  1JF0 A;  2LMU A;  1RJV A;  2JWW A;  1NWD A;  2KBI A;  2SCP A;  4HRE E;  2AUC A;  1C7V A;  2WCE A;  1IH0 A;  4MZJ A;  1BU3 A;  4NQG A;  3PFV A;  2A4J A;  2MRD A;  2HQ8 A;  2ZN8 A;  5IBW A;  2CNP A;  1M31 A;  2K2F A;  1A75 B;  2LNK A;  3OX5 A;  4MEW A;  4GAO A;  1BR1 B;  3I5H C;  5BPJ A;  1CLL A;  4YI8 A;  1OOJ A;  2PAL A;  1BMO A;  3TDI A;  1S5G Y;  3SG4 A;  1F55 A;  5CSN A;  3DD4 A;  1R6P A;  1Y6W A;  5B8I B;  1YUU A;  1DGU A;  3WHU B;  3FIA A;  1N2D A;  1SL7 A;  2M8U A;  4JQ0 D;  1AJ5 A;  1PSB A;  3BUM B;  3VRO A;  1SNL A;  2GGZ A;  2LV7 A;  4C0K A;  4MZL A;  2NXQ A;  1FW4 A;  4GPL B;  2FOT A;  4PE0 A;  2OS8 C;  5HKW A;  1EL4 A;  2LP2 A;  1S3P A;  4BY4 A;  2PVB A;  3HX4 A;  4FTG A;  2KOT A;  1YVH A;  2KNE A;  1FPW A;  1CDP A;  1UHJ A;  1CDM A;  1S6I A;  3LK0 A;  1HT9 A;  3VRN A;  1NX0 A;  5HKZ A;  4ORA B;  2JC2 A;  4MZK A;  2F3Z A;  2Y4Q A;  2JOJ A;  1YVL A;  3KO0 A;  2P6B B;  1AUI B;  5HLO A;  1BOC A;  1K9K A;  1UWO A;  1NX1 A;  1XFX O;  2I94 A;  2I18 A;  4A4B A;  1KSM A;  1BG1 A;  1XFV O;  4FQO A;  1ZFS A;  2B1U A;  4I5N B;  2K61 A;  2VRG A;  2OTG C;  2WOR A;  1KK8 B;  1QJT A;  1S26 D;  3BQ3 A;  1W7J B;  3FWC A;  5HKY A;  2L0P A;  1TCO B;  2COL B;  2JT0 A;  3BUO B;  3EVR A;  3ZWH A;  1SK6 D;  3DF0 B;  4Q04 A;  1BT6 A;  2BCB A;  2JTT A;  4NDC A;  2CCM A;  1TNQ A;  2DOQ A;  3I5I C;  1TNW A;  4OV2 A;  3OB1 B;  4TNC A;  1MXL C;  1Q80 A;  2JXL A;  4MSP A;  4HRH A;  2F2P A;  2QPT A;  2M0R A;  1OMD A;  2HF5 A;  1QAS A;  3LCP C;  5KSZ A;  2KSP A;  5TNC A;  3F45 A;  2KQ6 A;  5I2Q A;  3TDU A;  1EG4 A;  2MHH A;  1W7I B;  1G4Y R;  1A75 A;  1QV1 A;  1WRL A;  3PN7 C;  2QAC A;  4PHM A;  4GGN A;  3OHM B;  2L4H A;  5AXI A;  3RM1 A;  4PE4 A;  1KFX L;  5KU1 A;  1NUB A;  2K7D A;  1NCX A;  1UUS A;  1XA5 A;  1OQP A;  4MN0 A;  1CB1 A;  4ORB B;  2LC5 A;  2KAY A;  1QV0 A;  2LLS A;  3BXK A;  3DVK A;  2H61 C;  2L4I A;  1NIW A;  2R2I A;  3KHE A;  2L51 A;  3VRP A;  1PK0 D;  2JT8 A;  3AKB A;  4CFR A;  1S5G Z;  1ZMZ A;  2K7O A;  3I5F C;  5I2L A;  1IQ5 A;  2M29 A;  1NX3 A;  3D10 A;  2K8M B;  1IJ5 A;  3NSL A;  1M46 A;  1CM4 A;  3BUW B;  1B7T Z;  3O6B A;  2KBM A;  1K8U A;  1DTL A;  1CDL A;  1CFD A;  1J1D A;  2GGM A;  2NCP A;  3BOW B;  4YI9 A;  1D1O A;  5I8N A;  1DJI A;  2LCP A;  1U5I B;  5ER4 X;  2M7L A;  3PN7 B;  2O5G A;  1CLM A;  1QTX A;  1TOP A;  1IQ3 A;  2KFF A;  4WQ3 A;  1B1G A;  2OPO A;  5HLV A;  4C0J A;  2LMT A;  2K0J A;  4YGD B;  1J7O A;  2G9B A;  3IQO A;  1JBA A;  3M0W A;  1Y1A A;  2CXJ A;  3CS1 A;  4QJ3 B;  2LVJ A;  4AQI A;  1OE9 B;  2Q4U A;  1YX8 A;  2Y5I A;  3EVU A;  2BL0 C;  1OMR A;  1OSA A;  1MQ1 A;  2AAO A;  2KQY A;  3FWB A;  4YBH B;  1TRF A;  2JQ6 A;  1B4C A;  2BCA A;  2GV5 A;  4D1E A;  4I5L B;  1OMV A;  1F70 A;  1CFP A;  1XO5 A;  1KK8 C;  3I5F B;  1CKK A;  2KI4 C;  2I2R E;  5FYX A;  3JVT C;  3A8R A;  3MSE B;  5K89 A;  1JFK A;  3SJS A;  1QIW A;  1RFJ A;  2BKI B;  2IS9 A;  2E30 A;  1V1G A;  1SRA A;  3HCM A;  4XJK B;  2NLN A;  3H4S E;  1R2U A;  1M63 B;  2ZNE A;  5AEQ A;  2ZKM X;  1LA0 A;  2BEC A;  1A2X A;  1NCZ A;  1WRK A;  2EGD A;  4I5K A;  3CTN A;  5CPV A;  1QX2 A;  2JXC A;  1QVI Z;  4PCW A;  5AER A;  1XK4 C;  2CTN A;  1OZS A;  1DVI A;  1KQM C;  2WOS A;  4CFQ A;  2MA2 A;  1MR8 A;  1XFZ O;  3WNX B;  2BL0 B;  1KFU L;  4ETO A;  1PAL A;  1GGW A;  1AP4 A;  3NSI A;  2SAS A;  1ODB A;  3LK1 A;  4F0Z B;  1A03 A;  1F71 A;  2LMV A;  1XYD A;  4DUQ A;  1N65 A;  1G8I A;  2LP3 A;  2M9G A;  2Y1N A;  5AAN A;  4QJ5 B;  1ZAC A;  3SG7 A;  1G33 A;  3BOW A;  4PDZ A;  5CSJ A;  2KAX A;  2NZ0 A;  3OX6 A;  4WRI A;  3DVJ A;  3TUY B;  2CBL A;  1U5I A;  2KI4 B;  3JVT B;  1S1E A;  4ZCU A;  1GGZ A;  1SMG A;  2PSR A;  2MLE C;  1H8B A;  4PHK A;  1DJX A;  1L7Z A;  1PSR A;  1MWN A;  2PMY A;  4M2Q A;  1S36 A;  3BUX B;  1DT7 B;  5PAL A;  4NDD A;  1X02 A;  4MRX A;  2H61 A;  3KEV A;  1K9P A;  3CGA A;  4ZCV A;  4GGF C;  2HQW A;  2M1U A;  1YR5 A;  5ER5 A;  1WLM A;  4N1G A;  1KQM B;  4N5X A;  1J55 A;  1DJG A;  2ZND A;  1JC2 A;  2H2K A;  2F8P A;  2LVV A;  2BE6 A;  5D7F A;  5JJG A;  4IL1 A;  2KGB C;  3ZNI A;  2MLF C;  5I2O A;  1CFF A;  3CWG A;  3DVE A;  4OR9 B;  1SCM B;  2L50 A;  1L2O B;  1B8C A;  1SW8 A;  3ICB A;  1BF5 A;  3VRR A;  2RGI A;  4GUK A;  2FCD A;  2JUL A;  1SL8 A;  2LUX A;  2WCF A;  1VRK A;  1F4O A;  4HSZ A;  3AAK A;  4XJK A;  1IG5 A;  1SPY A;  3C1V A;  4YGB B;  1TN4 A;  5D69 A;  2HET A;  2Q91 A;  1PRW A;  2G2B A;  1QIV A;  2M7N A;  2LVK A;  2HPS A;  5HYD A;  3EK7 A;  2D8N A;  1IKU A;  2WND A;  1Y1X A;  2TN4 A;  3TZ1 A;  1DF0 B;  2L98 A;  1DJW A;  1FI5 A;  5KTY A;  1QLK A;  2M1K B;  1TNP A;  4PHN A;  3A4U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...