4FQOA

Crystal structure of calcium-loaded s100b bound to sbi4211
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structure-Based Discovery of a Novel Pentamidine-Related Inhibitor of the Calcium-Binding Protein S100B.
pubmed doi rcsb
molecule tags Protein binding/inhibitor
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4fqoA00
2WNDA 2L51A 4GGNA 4R1EA 1M45A 4FQOA 1XFZO 4QJ3B 1OSAA 2PRUA 3PLFB 2LMUA 1FF1A 3KO0A 4NDCA 1OMVA 2JT3A 2WORA 3VRPA 3ICBA 2A4JA 4PE1A 2LLUA 3BOWA 1RROA 5BPJA 3WHUB 3NSIA 4I5JA 5DKRA 1DF0A 3CGAA 2JTTA 1RWYA 1B9AA 1B1GA 1XFVO 1GJYA 4E68A 1A03A 1BOCA 1SNLA 3JTDB 4ZCUA 1EH2A 1IJ6A 2SCPA 2BL0C 2LMVA 4YGDB 5I2LA 1DVIA 1XFYO 1WLZA 3O6BA 1LINA 2PALA 3WHTB 1NX0A 1IJ5A 4DUQA 5JOLA 1PVBA 2FCDA 2P6BB 5HKWA 1PVAA 3DVMA 2JC2A 2OTGB 4ICBA 1S1EA 2LAPA 2GGZA 3QRXA 1CFPA 5AXIA 4AQJA 3DF0B 4MEWA 4UPGA 4HREE 2KDHA 2MLFC 4GGFC 1IGVA 2GGMA 1KQMC 1SYMA 2LE9B 1CFFA 1IWQA 4GNKB 2ZKMX 1KK7Y 1NCYA 3I5FB 1CDLA 3O78A 2BKHB 1S3PA 2JU0A 3OX5A 1CTRA 2L50A 3PFVA 2HF5A 1RJVA 3OB1B 1S5GY 1EG4A 4MVFA 4DIRA 4GGFA 2CNPA 2L2EA 3EVRA 1S6IA 1KFUL 2GV5A 4MN0A 2KFGA 1YR5A 4OKHA 2KAXA 3NSOA 1X02A 2DOQA 2EHBA 1CDMA 5I2QA 2E6WA 3PN7B 1TRFA 4P5OE 4GAOA 1LKJA 2MA2A 1F55A 1BR4B 1KWOB 1N65A 1TNPA 2BBMA 1JSAA 3AKBA 1H4BA 1ZFSA 2JNFA 4YI8A 1J1EA 1DJYA 5AFPA 1SR6C 1SRAA 3EVUA 5D69A 2JRFA 1KSOA 4I5NB 3FWBA 1SL7A 5J3XA 1ZMZA 1R6PA 1RTP1 2MBXA 1J7RA 3CR4X 1DJWA 1QV0A 2Q91A 3SG5A 1ALVA 1YVLA 4PE7A 3VRQA 4QJ4B 2JNXA 2CBLA 2MJWB 2AUCA 1QLSA 2FJUB 1NX2A 4M2PA 4MZLA 4AQIA 1JC2A 1SCMC 2LUCA 1NWDA 1S6JA 1XO5A 2OS8C 1OOJA 4PHJA 5AANA 3SIAA 1TNXA 3BYAA 2H2KA 4F0ZB 1JFJA 4OV2A 3TDIA 1S6CA 3GK4X 3IQOA 1J7PA 4C0JA 5TNCA 1KFUS 4PALA 1OE9B 3E3RA 3AAJA 1TIZA 3SJSA 3H4SE 2ZN9A 1J1DA 2LP2A 5AEQA 1IH0A 2COLB 2L4IA 4Q04A 3CR2A 1C7WA 2KAVA 1R2UA 1IQ3A 1B8RA 1NUBA 4ORCB 2F2PA 3EK8A 1XK4C 2HQWA 1E8AA 1AK8A 4A4CA 2M7NA 2KNEA 1B4CA 4L9MA 2EC6B 1CMFA 1QIVA 4GFTA 1KK8C 2Y4QA 4MSPA 2O60A 1YRTB 2JZIA 3SG2A 1YUSA 2WCBA 1QVIZ 2KI4B 5K89A 2H61C 1QX7A 4WQ2A 2JULA 3NSLA 1XK4A 1DJIA 1Q80A 4ZCVA 5KU1A 4JPZB 2KHNA 4DCKA 5D7FA 1EL4A 1LVCD 3JTDC 2I7AA 3O2PA 5CSJA 1AHRA 1DJZA 3SG3A 2B1UA 2NLNA 1YX7A 2MRDA 5DKNA 1EJ3A 4OCIA 1NSHA 2OTGC 1SKTA 2H61A 4I5LB 5I8NA 1Y1XA 1SW8A 1ZUZA 3D0YB 4NDDA 3LL8B 2Y5IA 1BR1B 1G33A 1TCFA 1YUTA 1D1OA 2K2AA 3I5GB 2K7OA 3HX4A 1LXFC 3ZWHA 1L2OB 3CS1A 3JVTB 2LM5A 5HKZA 1QS7A 2KBMA 3I5FC 3BUMB 1CDNA 4ETOA 4P2YB 3AAKA 5AERA 3EK4A 1U5IB 1Y1AA 4GBAA 1UHHA 2K61A 3PSRA 1DJXA 3DF0A 5KTYA 2KGRA 1KK7Z 2BCBA 1XA5A 1YX8A 1UHIA 4OR9B 1UHKA 4MZJA 1NYAA 1WY9A 4N5XA 3IQQA 2M3WA 3BXKA 3PN7C 1TN4A 2LLTA 1CB1A 1S5GZ 4PHKA 1CM4A 3TDUA 1UUSA 3M0WA 1KWOC 4PE0A 2LANA 3OX6A 3FWCA 1IRJA 1QATA 1A75B 1CM1A 2BCXA 1J7QA 2KGBC 3F45A 1QASA 4ORAB 2JWWA 4GPLB 1TNQA 4DS7A 1FI6A 4QJ5B 5B8IB 4CFQA 1SL8A 1V1GA 3KPXA 4N1FA 1FPWA 1KFXL 2M9GA 5GQQC 2IS9A 2PASA 2JPTA 3A8RA 3K21A 1IG5A 1HT9A 1BG1A 1UURA 1K94A 1NIWA 1NCZA 4XJKA 1B8LA 2HPSA 4PDZA 4PE4A 5I2OA 1WRLA 2MAZA 1W7JB 1MHOA 4IL1A 1M31A 5ER5A 3AKAA 1CNPA 3OP0A 2KFHA 3TS5B 4MRYA 5F6TA 1MXEA 1DGVA 1OQPA 1YURA 2CXJA 2NCPA 2QACA 4N1GA 2K7CA 4TNCA 1WLMA 1BLQA 2M0RA 1RECA 1UWOA 2JT8A 1JF2A 1QX5B 3ZNIA 1XVJA 2JT0A 3BQ3A 1QX2A 3C1VA 2FOTA 3OB2B 5ER4X 3SG7A 3KF9A 1GQMA 2D8NA 1BJFA 3EKJA 1CLBA 1V1FA 3BUNB 4JQ0D 1PRWA 3CR5X 2EC6C 1K2HA 3FIAA 2WCFA 3I5HC 1TTXA 2L4HA 2AAOA 4MLWA 2KI4C 4NDBA 1SY9A 1QLKA 1CLLA 1KFXS 1WDCB 2L98A 4PHNA 3EKHA 4D1EA 1K9KA 5PALA 4CPVA 3CZTX 2ZFDA 1J55A 1A2XA 1S26D 2KYCA 1F71A 3RM1A 2K7DA 1KQVA 1B47A 1JFKA 3LK1A 2V53A 2PVBA 4A4BA 1QTXA 1CMGA 2L5XB 1BODA 4DRWA 3I5IB 3NSKA 1DJHA 2K2FA 1XFXO 3IF7A 1Y1UA 4YGEB 2BECA 3OHMB 1YTZC 2JXLA 1OZOA 2M1UA 2BCAA 1SCVA 3EK7A 3KHEA 2ISDA 4MBEA 3I5GC 2LC5A 1L2OC 1UP5A 4YGCB 3JVTC 1B7TZ 1NP8A 2LHIA 4WRIA 1K9UA 1MWNA 3NXAA 1BU3A 1B7TY 1AP4A 3LK0A 4MRXA 2ZRSA 1HQVA 1M63B 2JXCA 2O5GA 4HRGA 4ORBB 1S36A 2WOSA 3D0YA 1NPQA 2LHLA 2CT9A 1WRKA 1XYDA 2KSPA 1M46A 2NCOA 1OMRA 4USLA 2I2RE 2EGDA 1MUXA 1NCXA 2NXQA 5CPVA 2K7BA 1KK8B 2LVVA 2ZNDA 3RLZA 1QV1A 4FTGA 3LLEA 2F3YA 1F54A 1QXPA 1WRZA 2M97A 1U5IA 3BOWB 3KEVA 4YGAA 3PALA 1DJGA 3TUYB 4BY4A 4PCWA 2G2BA 2WC8A 1DF0B 4M2QA 2HQ8A 1BF5A 1PSRA 1W7IB 3GOFA 2KI6D 1IQ5A 1PSBA 1AUIB 4MZKA 4NQGA 1MQ1A 5JJGA 4C0KA 4WQ3A 1F4QA 1F8HA 1Y6WA 2LP3A 1QJTA 1KCYA 1MXLC 1N0YA 2M49B 3CLNA 2LMTA 2BE4A 1OMDA 2OPOA 4YRUA 2KI6C 4YGBB 1MR8A 2SASA 1IKUA 3WXAA 3BUWB 1LA0A 1A75A 3VGOA 2I18A 2ZNEA 3FS7A 4HSZA 2M29A 3VROA 4U8DA 1GGZA 3DD4A 3DVEA 1K8UA 3TS5C 2BL0B 2M1KB 5FYXA 2RGIA 4YBHB 2FCEA 2KAYA 1B8CA 5HLOA 1DMOA 1TNWA 1ODBA 2M7LA 1RK9A 1XFWO 1Y0VH 1SK6D 1K93D 2E30A 2F33A 2LVJA 2LV7A 3TDZA 1F70A 1YUUA 1UHNA 2BBNA 2JQ6A 1A4PA 2LUXA 3SG4A 1CFDA 3BUOB 2BKIB 2HETA 2AMIA 1J7OA 5KSZA 5CSNA 1KQMB 2KYFA 1DT7B 5G08A 1C07A 1JWDA 3D10A 1SBJA 2JTZA 1EXRA 2K0JA 3A4UB 5CSFA 4C0LA 1JUOA 1JF0A 1CKKA 1SL9A 1YVHA 2LVIA 1KSMA 1SPYA 2JOJA 2Q4UA 3GK2A 1G4YR 1PULA 4PHMA 4I5KA 1WDCC 3PATA 2LVKA 3O4YA 1ZACA 1GGWA 4GUKA 1CDPA 1K90D 1SMGA 2I94A 4XJKB 2Y1MA 2LLSA 4HRHA 1C7VA 2NZ0A 2R2IA 3MSEB 2LNKA 3GK1A 2KBIA 1AJ5A 1K95A 3PM8A 3SIBA 3I5IC 1K9PA 3DVJA 4BY5A 2ZRTA 3DVKA 2TN4A 1JBAA 1TOPA 1MF8B 3HCMA 4OVNF 2F2OA 5DKQA 2PMYA 1CFCA 2Y1NA 5HKYA 3EVVA 1SR6B 2KQ6A 2WCEA 2K8MB 1OZSA 1FW4A 1XFUO 4YI9A 3VRNA 3VRRA 3WNXB 1ZOTB 4CLNA 2KFFA 2VRGA 5IBWA 1H8BA 3LCPC 1FI5A 1UHJA 5CSIA 1DTLA 4XYNA 1A29A 2CCMA 3BUXB 1CLMA 1L7ZA 2F8PA 2PSRA 3SG6A 2MHHA 2MLEC 3CTNA 3TZ1A 2ZN8A 1YRUB 1FBVA 1QIWA 4JWQA 1AVSA 1LA3A 2BE6A 1SCMB 1NX3A 2L0PA 2OS8B 4M2OA 1G8IA 4CIDA 2G9BA 1M39A 1N2DA 1VRKA 5HYDA 1PALA 4CFRA 1NX1A 1PK0D 1K96A 1ALWA 2LCPA 1F4OA 3CWGA 3I5HB 2KOTA 1BMOA 1TCOB 1EG3A 1DGUA 1RFJA 2F3ZA 2M8UA 4AOMA 3TUYC 2QPTA 1AJ4A 1BT6A 1QVIY 2KQYA 5HLVA 2CTNA
chains in the Genus database with same CATH superfamily
2WNDA 5DICA 2L51A 4GGNA 4R1EA 1M45A 1C07A 4FQOA 1C3ZA 1XFZO 2K60A 4QJ3B 1OSAA 4JKTA 2PRUA 3PLFB 2LMUA 1FF1A 3KO0A 4NDCA 1OMVA 1QWVA 2JT3A 2WORA 3VRPA 3ICBA 2A4JA 4PE1A 2LLUA 3BOWA 3L4AA 1RROA 5BPJA 3WHUB 3NSIA 4I5JA 5DKRA 5FI7A 1DF0A 3CGAA 2JTTA 1RWYA 1B9AA 1B1GA 1XFVO 1GJYA 4E68A 1A03A 1BOCA 1SSEB 1SNLA 3JTDB 4ZCUA 1EH2A 1IJ6A 2SCPA 2BL0C 2LMVA 3QMEA 4YGDB 5I2LA 1DVIA 1XFYO 1WLZA 3O6BA 1LINA 2PALA 3NHTA 3WHTB 1NX0A 1IJ5A 4DUQA 5JOLA 1PVBA 2FCDA 2P6BB 5HKWA 1PVAA 3DVMA 2JC2A 2OTGB 4ICBA 1S1EA 2LAPA 2GGZA 3QRXA 1CFPA 5AXIA 4AQJA 3D74A 3DF0B 4MEWA 4UPGA 4HREE 2KDHA 2MLFC 3R1VA 1IGVA 4GGFC 2GGMA 1KQMC 1SYMA 2LE9B 1CFFA 1IWQA 4GNKB 2ZKMX 1KK7Y 1NCYA 3I5FB 1CDLA 3O78A 2BKHB 1S3PA 2JU0A 3OX5A 1CTRA 2L50A 3PFVA 2HF5A 2FJYA 1RJVA 3OB1B 5EL2A 1S5GY 1EG4A 3B6XA 4MVFA 2JPOA 4DIRA 4GGFA 2CNPA 2L2EA 3EVRA 3N7HA 1S6IA 1KFUL 2GV5A 4MN0A 2KFGA 1YR5A 4OKHA 2KAXA 3NSOA 1X02A 3O4XA 2DOQA 2EHBA 1CDMA 5I2QA 2E6WA 3PN7B 1TRFA 4P5OE 4GAOA 3D73A 1LKJA 3VB1A 2MA2A 1F55A 1BR4B 1KWOB 1N65A 1TNPA 2BBMA 1JSAA 3AKBA 1H4BA 1IIOA 1ZFSA 2JNFA 4YI8A 1J1EA 1DJYA 4F7FA 5AFPA 2WCLA 1SR6C 2KLEA 1SRAA 3EVUA 5D69A 2JRFA 1KSOA 4I5NB 3FWBA 1OOIX 1SL7A 5J3XA 1ZMZA 2WCJA 1R6PA 1RTP1 2MBXA 1J7RA 3CR4X 1DJWA 1TUZA 1QV0A 2Q91A 3SG5A 1ALVA 1YVLA 3B87A 4PE7A 3VRQA 4QJ4B 2JNXA 2CBLA 2MJWB 2AUCA 1QLSA 2FJUB 1NX2A 4M2PA 4MZLA 1P28A 4AQIA 1JC2A 1SCMC 2LUCA 1NWDA 1S6JA 1XO5A 2OS8C 1OOJA 4PHJA 5AANA 2QEHA 3SIAA 1TNXA 3BYAA 2H2KA 4F0ZB 1JFJA 4OV2A 3TDIA 1S6CA 3GK4X 3IQOA 1J7PA 4C0JA 5TNCA 1KFUS 4PALA 1OE9B 3E3RA 3AAJA 1TIZA 3SJSA 2QEVA 3H4SE 2ZN9A 1J1DA 2LP2A 5AEQA 3UO9A 2COLB 1IH0A 2L4IA 4Q04A 3CR2A 1C7WA 2KAVA 1R2UA 1IQ3A 1B8RA 1NUBA 4ORCB 2F2PA 3EK8A 1XK4C 2HQWA 1E8AA 1AK8A 4A4CA 3V2LA 2M7NA 2KNEA 5FI2A 1B4CA 4L9MA 3R1OA 2QEOA 2EC6B 1CMFA 1QIVA 1XFRA 1KK8C 4GFTA 2Y4QA 4MSPA 2O60A 1YRTB 2JZIA 3SG2A 1YUSA 2WCBA 1QVIZ 2KI4B 5K89A 3NGVA 2H61C 1QX7A 4WQ2A 2JULA 3CZ2A 3NSLA 1XK4A 1DJIA 1Q80A 2WCMA 4ZCVA 5KU1A 4JPZB 2KHNA 4DCKA 5D7FA 1EL4A 1LVCD 3JTDC 1TUJA 2I7AA 3K1EA 3S0FA 3O2PA 5CSJA 1AHRA 1DJZA 3SG3A 2B1UA 2NLNA 1YX7A 2MRDA 5DKNA 3BJHA 1EJ3A 4OCIA 1NSHA 2OTGC 1SKTA 2H61A 2PQLA 4I5LB 5I8NA 1Y1XA 1SW8A 1ZUZA 3D0YB 4NDDA 3LL8B 2KPHA 2Y5IA 3S0AA 1BR1B 1G33A 1TCFA 1YUTA 1D1OA 2K2AA 3I5GB 2K7OA 3HX4A 1LXFC 3ZWHA 1L2OB 3CS1A 3JVTB 2LM5A 5HKZA 1DEKA 1QS7A 2KBMA 3I5FC 3BUMB 1CDNA 4ETOA 1DELA 4P2YB 3AAKA 5AERA 3EG5B 3EK4A 4FQTA 1U5IB 1Y1AA 4GBAA 1UHHA 2K61A 3PSRA 1DJXA 3DF0A 5KTYA 2KGRA 1KK7Z 2BCBA 1XA5A 3DZTA 1YX8A 3L47A 1UHIA 4OR9B 1UHKA 4MZJA 1NYAA 1WY9A 4N5XA 5D3OA 3SS4A 3IQQA 2M3WA 3D78A 3BXKA 4IJ7A 3PN7C 1TN4A 2LLTA 1CB1A 1S5GZ 4PHKA 1CM4A 3FE6A 3TDUA 3BFBA 1UUSA 3M0WA 1KWOC 4PE0A 2LANA 3OX6A 3FWCA 1IRJA 2P71A 1QATA 1A75B 1CM1A 3R1PA 2BCXA 1J7QA 2KGBC 3F45A 1QASA 4ORAB 2JWWA 4GPLB 1TNQA 5FI6A 4DS7A 4QJ5B 5B8IB 1FI6A 4CFQA 1SL8A 1V1GA 3KPXA 4N1FA 3PM2A 1FPWA 2BAPA 3FE8A 1KFXL 2M9GA 3BFAA 5GQQC 2IS9A 2PASA 4OZDA 2JPTA 3A8RA 3K21A 1IG5A 1HT9A 1BG1A 1UURA 1K94A 1NIWA 1NCZA 2L5YA 4XJKA 1B8LA 2HPSA 4PDZA 4PE4A 5I2OA 1WRLA 2MAZA 1W7JB 1MHOA 3DYEA 1M31A 4IL1A 5ER5A 3AKAA 1CNPA 3OP0A 2KFHA 3TS5B 4MRYA 5F6TA 1MXEA 1DGVA 1OQPA 1YURA 2CXJA 2NCPA 2QACA 4N1GA 3R72A 2H8VA 2K7CA 1DC1A 4TNCA 1WLMA 1BLQA 2M0RA 3CYZA 1RECA 1UWOA 2JT8A 2ERBA 1JF2A 1QX5B 1ORGA 3ZNIA 1XVJA 1W9ZA 2JT0A 3BQ3A 1QX2A 3C1VA 2FOTA 3OB2B 5ER4X 3SG7A 3KF9A 1GQMA 2D8NA 1BJFA 3EKJA 4JD9A 1V1FA 3BUNB 1CLBA 4JQ0D 1PRWA 3CR5X 2EC6C 1K2HA 3FIAA 2WCFA 3I5HC 4PT1A 1TTXA 2L4HA 2AAOA 4MLWA 2KI4C 4NDBA 1SY9A 1QLKA 1CLLA 1KFXS 1WDCB 2L98A 3FE9A 3EKHA 4PHNA 3S0DA 1K9KA 4D1EA 5PALA 3S0GA 3CZTX 4CPVA 1OOFA 2ZFDA 1J55A 5HL1A 1A2XA 1S26D 2KYCA 1F71A 3RM1A 2K7DA 1KQVA 1B47A 1JFKA 3LK1A 2V53A 2L2CA 1OW4A 2PVBA 1QTXA 2QEBA 4A4BA 1CMGA 1T14A 2L5XB 1BODA 4DRWA 3I5IB 3NSKA 1DJHA 2K2FA 1XFXO 3S0EA 3IF7A 1Y1UA 4YGEB 1LS8A 2BECA 3L4LA 1YTZC 2JXLA 3OHMB 1OZOA 2M1UA 3CDNA 2BCAA 1SCVA 3EK7A 3KHEA 2ISDA 4MBEA 3I5GC 2LC5A 1L2OC 1UP5A 4YGCB 2WC6A 3JVTC 1B7TZ 1NP8A 3SS5A 2LHIA 4WRIA 1K9UA 1MWNA 3NXAA 1BU3A 1B7TY 1AP4A 3LK0A 4MRXA 3SS3A 2ZRSA 1HQVA 1M63B 2JXCA 2O5GA 3OBVA 2WCHA 4HRGA 4ORBB 1S36A 2WOSA 3D0YA 1NPQA 2LHLA 2CT9A 1WRKA 1XYDA 3UNWA 2KSPA 1M46A 3CZ0A 2NCOA 1OMRA 4USLA 2I2RE 2EGDA 3D76A 1Z4HA 1MUXA 1NCXA 2NXQA 5CPVA 2K7BA 1KK8B 2LVVA 2ZNDA 3RLZA 1QV1A 4FTGA 2KLDA 3LLEA 2F3YA 1F54A 1QXPA 1WRZA 2M97A 1U5IA 3BOWB 3KEVA 4YGAA 3PALA 1DJGA 3TUYB 4BY4A 4PCWA 2G2BA 2WC8A 1DF0B 4M2QA 2HQ8A 1BF5A 1PSRA 1OOHA 1W7IB 3GOFA 2KI6D 1IQ5A 1PSBA 1AUIB 2QDIA 4MZKA 4NQGA 3DXLA 1MQ1A 5JJGA 4C0KA 3Q8IA 4WQ3A 1F4QA 2YGUA 1F8HA 1Y6WA 2LP3A 1QJTA 1KCYA 2PYQA 1MXLC 1N0YA 2M49B 3CLNA 2LMTA 2BE4A 1OMDA 2OPOA 4YRUA 2KI6C 4YGBB 1MR8A 2SASA 1IKUA 3WXAA 3BUWB 1LA0A 1A75A 3VGOA 2I18A 2ZNEA 3FS7A 3IVTA 4HSZA 2M29A 3VROA 4U8DA 1GGZA 3DD4A 1TWOA 3DVEA 1K8UA 3TS5C 2BL0B 2M1KB 4KYNA 5FYXA 2RGIA 4YBHB 2FCEA 2KAYA 1B8CA 5HLOA 1DMOA 1TNWA 1ODBA 2M7LA 5I94A 1RK9A 1XFWO 1Y0VH 1SK6D 1K93D 2E30A 2F33A 2LVJA 2LV7A 3TDZA 1F70A 1YUUA 1UHNA 2BBNA 2JQ6A 1A4PA 2LUXA 3SG4A 1CFDA 1C3YA 3BUOB 2BKIB 2HETA 2AMIA 1J7OA 5KSZA 5CSNA 1KQMB 2GTEA 2KYFA 3CZ1A 5G08A 1DT7B 3D10A 1SBJA 2JTZA 1EXRA 2K0JA 3A4UB 4INWA 1JWDA 5CSFA 4C0LA 1JUOA 1JF0A 1CKKA 3NHIA 1SL9A 1YVHA 2LVIA 1KSMA 1SPYA 2JOJA 2Q4UA 3D75A 3D77A 3GK2A 1G4YR 1PULA 4PHMA 4I5KA 1WDCC 3PATA 2LVKA 3O4YA 1ZACA 1GGWA 4GUKA 1CDPA 1K90D 1SMGA 2I94A 4XJKB 2Y1MA 2LLSA 4HRHA 2BNXA 2NZ0A 2R2IA 3MSEB 1C7VA 2LNKA 3GK1A 2KBIA 1AJ5A 1K95A 3PM8A 3SIBA 3I5IC 1K9PA 3DVJA 4BY5A 4INXA 2ZRTA 3DVKA 2TN4A 3S0BA 1JBAA 3PJIA 1TOPA 1MF8B 3HCMA 4OVNF 1OOGA 2P70A 1Z2CB 2F2OA 5DKQA 2PMYA 1CFCA 3B7AA 2Y1NA 5HKYA 3EVVA 1SR6B 2KQ6A 2WCEA 3BFHA 1DQEA 2K8MB 1OZSA 1FW4A 1XFUO 4YI9A 3RZSA 3VRNA 3VRRA 3WNXB 1ZOTB 4CLNA 2KFFA 3OGNA 2VRGA 5IBWA 1H8BA 3B86A 3LCPC 1UHJA 5CSIA 1DTLA 4XYNA 2WCKA 1FI5A 1A29A 2CCMA 3BUXB 1CLMA 1L7ZA 2F8PA 2PSRA 3SG6A 2MHHA 2MLEC 3CTNA 3TZ1A 2ZN8A 1YRUB 1FBVA 1QIWA 4JWQA 1AVSA 1LA3A 1GM0A 2BE6A 1SCMB 1NX3A 2L0PA 2OS8B 4M2OA 1G8IA 4CIDA 2G9BA 3B88A 1M39A 1N2DA 1VRKA 5HYDA 1PALA 4CFRA 1NX1A 3DY9A 1PK0D 1K96A 1ALWA 2LCPA 1F4OA 3CWGA 3I5HB 2KOTA 1BMOA 1TCOB 1EG3A 1DGUA 1RFJA 2F3ZA 2M8UA 3CABA 4AOMA 3TUYC 2QPTA 1AJ4A 1BT6A 2WC5A 1QVIY 2KQYA 5HLVA 2CTNA
chains in the Genus database with same CATH topology
2WNDA 2L51A 4GGNA 4R1EA 1M45A 4FQOA 1XFZO 4QJ3B 1OSAA 2PRUA 3PLFB 2LMUA 1FF1A 3KO0A 4NDCA 1OMVA 2JT3A 2WORA 3VRPA 3ICBA 2A4JA 4PE1A 2LLUA 3BOWA 1RROA 5BPJA 3WHUB 3NSIA 4I5JA 5DKRA 1DF0A 3CGAA 2JTTA 1RWYA 1B9AA 1B1GA 1XFVO 1GJYA 4E68A 1A03A 1BOCA 1SNLA 3JTDB 4ZCUA 1EH2A 1IJ6A 2SCPA 2BL0C 2LMVA 4YGDB 5I2LA 1DVIA 1XFYO 1WLZA 3O6BA 1LINA 2PALA 3WHTB 1NX0A 1IJ5A 4DUQA 5JOLA 1PVBA 2FCDA 2P6BB 5HKWA 1PVAA 3DVMA 2JC2A 2OTGB 4ICBA 1S1EA 2LAPA 2GGZA 3QRXA 1CFPA 5AXIA 4AQJA 3DF0B 4MEWA 4UPGA 4HREE 2KDHA 2MLFC 4GGFC 1IGVA 2GGMA 1KQMC 1SYMA 2LE9B 1CFFA 1IWQA 4GNKB 2ZKMX 1KK7Y 1NCYA 3I5FB 1CDLA 3O78A 2BKHB 1S3PA 2JU0A 3OX5A 1CTRA 2L50A 3PFVA 2HF5A 1RJVA 3OB1B 1S5GY 1EG4A 4MVFA 4DIRA 4GGFA 2CNPA 2L2EA 3EVRA 1S6IA 1KFUL 2GV5A 4MN0A 2KFGA 1YR5A 4OKHA 2KAXA 3NSOA 1X02A 2DOQA 2EHBA 1CDMA 5I2QA 2E6WA 3PN7B 1TRFA 4P5OE 4GAOA 1LKJA 2MA2A 1F55A 1BR4B 1KWOB 1N65A 1TNPA 2BBMA 1JSAA 3AKBA 1H4BA 1ZFSA 2JNFA 4YI8A 1J1EA 1DJYA 5AFPA 1SR6C 1SRAA 3EVUA 5D69A 2JRFA 1KSOA 4I5NB 3FWBA 1SL7A 5J3XA 1ZMZA 1R6PA 1RTP1 2MBXA 1J7RA 3CR4X 1DJWA 1QV0A 2Q91A 3SG5A 1ALVA 1YVLA 4PE7A 3VRQA 4QJ4B 2JNXA 2CBLA 2MJWB 2AUCA 1QLSA 2FJUB 1NX2A 4M2PA 4MZLA 4AQIA 1JC2A 1SCMC 2LUCA 1NWDA 1S6JA 1XO5A 2OS8C 1OOJA 4PHJA 5AANA 3SIAA 1TNXA 3BYAA 2H2KA 4F0ZB 1JFJA 4OV2A 3TDIA 1S6CA 3GK4X 3IQOA 1J7PA 4C0JA 5TNCA 1KFUS 4PALA 1OE9B 3E3RA 3AAJA 1TIZA 3SJSA 3H4SE 2ZN9A 1J1DA 2LP2A 5AEQA 1IH0A 2COLB 2L4IA 4Q04A 3CR2A 1C7WA 2KAVA 1R2UA 1IQ3A 1B8RA 1NUBA 4ORCB 2F2PA 3EK8A 1XK4C 2HQWA 1E8AA 1AK8A 4A4CA 2M7NA 2KNEA 1B4CA 4L9MA 2EC6B 1CMFA 1QIVA 4GFTA 1KK8C 2Y4QA 4MSPA 2O60A 1YRTB 2JZIA 3SG2A 1YUSA 2WCBA 1QVIZ 2KI4B 5K89A 2H61C 1QX7A 4WQ2A 2JULA 3NSLA 1XK4A 1DJIA 1Q80A 4ZCVA 5KU1A 4JPZB 2KHNA 4DCKA 5D7FA 1EL4A 1LVCD 3JTDC 2I7AA 3O2PA 5CSJA 1AHRA 1DJZA 3SG3A 2B1UA 2NLNA 1YX7A 2MRDA 5DKNA 1EJ3A 4OCIA 1NSHA 2OTGC 1SKTA 2H61A 4I5LB 5I8NA 1Y1XA 1SW8A 1ZUZA 3D0YB 4NDDA 3LL8B 2Y5IA 1BR1B 1G33A 1TCFA 1YUTA 1D1OA 2K2AA 3I5GB 2K7OA 3HX4A 1LXFC 3ZWHA 1L2OB 3CS1A 3JVTB 2LM5A 5HKZA 1QS7A 2KBMA 3I5FC 3BUMB 1CDNA 4ETOA 4P2YB 3AAKA 5AERA 3EK4A 1U5IB 1Y1AA 4GBAA 1UHHA 2K61A 3PSRA 1DJXA 3DF0A 5KTYA 2KGRA 1KK7Z 2BCBA 1XA5A 1YX8A 1UHIA 4OR9B 1UHKA 4MZJA 1NYAA 1WY9A 4N5XA 3IQQA 2M3WA 3BXKA 3PN7C 1TN4A 2LLTA 1CB1A 1S5GZ 4PHKA 1CM4A 3TDUA 1UUSA 3M0WA 1KWOC 4PE0A 2LANA 3OX6A 3FWCA 1IRJA 1QATA 1A75B 1CM1A 2BCXA 1J7QA 2KGBC 3F45A 1QASA 4ORAB 2JWWA 4GPLB 1TNQA 4DS7A 1FI6A 4QJ5B 5B8IB 4CFQA 1SL8A 1V1GA 3KPXA 4N1FA 1FPWA 1KFXL 2M9GA 5GQQC 2IS9A 2PASA 2JPTA 3A8RA 3K21A 1IG5A 1HT9A 1BG1A 1UURA 1K94A 1NIWA 1NCZA 4XJKA 1B8LA 2HPSA 4PDZA 4PE4A 5I2OA 1WRLA 2MAZA 1W7JB 1MHOA 4IL1A 1M31A 5ER5A 3AKAA 1CNPA 3OP0A 2KFHA 3TS5B 4MRYA 5F6TA 1MXEA 1DGVA 1OQPA 1YURA 2CXJA 2NCPA 2QACA 4N1GA 2K7CA 4TNCA 1WLMA 1BLQA 2M0RA 1RECA 1UWOA 2JT8A 1JF2A 1QX5B 3ZNIA 1XVJA 2JT0A 3BQ3A 1QX2A 3C1VA 2FOTA 3OB2B 5ER4X 3SG7A 3KF9A 1GQMA 2D8NA 1BJFA 3EKJA 1CLBA 1V1FA 3BUNB 4JQ0D 1PRWA 3CR5X 2EC6C 1K2HA 3FIAA 2WCFA 3I5HC 1TTXA 2L4HA 2AAOA 4MLWA 2KI4C 4NDBA 1SY9A 1QLKA 1CLLA 1KFXS 1WDCB 2L98A 4PHNA 3EKHA 4D1EA 1K9KA 5PALA 4CPVA 3CZTX 2ZFDA 1J55A 1A2XA 1S26D 2KYCA 1F71A 3RM1A 2K7DA 1KQVA 1B47A 1JFKA 3LK1A 2V53A 2PVBA 4A4BA 1QTXA 1CMGA 2L5XB 1BODA 4DRWA 3I5IB 3NSKA 1DJHA 2K2FA 1XFXO 3IF7A 1Y1UA 4YGEB 2BECA 3OHMB 1YTZC 2JXLA 1OZOA 2M1UA 2BCAA 1SCVA 3EK7A 3KHEA 2ISDA 4MBEA 3I5GC 2LC5A 1L2OC 1UP5A 4YGCB 3JVTC 1B7TZ 1NP8A 2LHIA 4WRIA 1K9UA 1MWNA 3NXAA 1BU3A 1B7TY 1AP4A 3LK0A 4MRXA 2ZRSA 1HQVA 1M63B 2JXCA 2O5GA 4HRGA 4ORBB 1S36A 2WOSA 3D0YA 1NPQA 2LHLA 2CT9A 1WRKA 1XYDA 2KSPA 1M46A 2NCOA 1OMRA 4USLA 2I2RE 2EGDA 1MUXA 1NCXA 2NXQA 5CPVA 2K7BA 1KK8B 2LVVA 2ZNDA 3RLZA 1QV1A 4FTGA 3LLEA 2F3YA 1F54A 1QXPA 1WRZA 2M97A 1U5IA 3BOWB 3KEVA 4YGAA 3PALA 1DJGA 3TUYB 4BY4A 4PCWA 2G2BA 2WC8A 1DF0B 4M2QA 2HQ8A 1BF5A 1PSRA 1W7IB 3GOFA 2KI6D 1IQ5A 1PSBA 1AUIB 4MZKA 4NQGA 1MQ1A 5JJGA 4C0KA 4WQ3A 1F4QA 1F8HA 1Y6WA 2LP3A 1QJTA 1KCYA 1MXLC 1N0YA 2M49B 3CLNA 2LMTA 2BE4A 1OMDA 2OPOA 4YRUA 2KI6C 4YGBB 1MR8A 2SASA 1IKUA 3WXAA 3BUWB 1LA0A 1A75A 3VGOA 2I18A 2ZNEA 3FS7A 4HSZA 2M29A 3VROA 4U8DA 1GGZA 3DD4A 3DVEA 1K8UA 3TS5C 2BL0B 2M1KB 5FYXA 2RGIA 4YBHB 2FCEA 2KAYA 1B8CA 5HLOA 1DMOA 1TNWA 1ODBA 2M7LA 1RK9A 1XFWO 1Y0VH 1SK6D 1K93D 2E30A 2F33A 2LVJA 2LV7A 3TDZA 1F70A 1YUUA 1UHNA 2BBNA 2JQ6A 1A4PA 2LUXA 3SG4A 1CFDA 3BUOB 2BKIB 2HETA 2AMIA 1J7OA 5KSZA 5CSNA 1KQMB 2KYFA 1DT7B 5G08A 1C07A 1JWDA 3D10A 1SBJA 2JTZA 1EXRA 2K0JA 3A4UB 5CSFA 4C0LA 1JUOA 1JF0A 1CKKA 1SL9A 1YVHA 2LVIA 1KSMA 1SPYA 2JOJA 2Q4UA 3GK2A 1G4YR 1PULA 4PHMA 4I5KA 1WDCC 3PATA 2LVKA 3O4YA 1ZACA 1GGWA 4GUKA 1CDPA 1K90D 1SMGA 2I94A 4XJKB 2Y1MA 2LLSA 4HRHA 1C7VA 2NZ0A 2R2IA 3MSEB 2LNKA 3GK1A 2KBIA 1AJ5A 1K95A 3PM8A 3SIBA 3I5IC 1K9PA 3DVJA 4BY5A 2ZRTA 3DVKA 2TN4A 1JBAA 1TOPA 1MF8B 3HCMA 4OVNF 2F2OA 5DKQA 2PMYA 1CFCA 2Y1NA 5HKYA 3EVVA 1SR6B 2KQ6A 2WCEA 2K8MB 1OZSA 1FW4A 1XFUO 4YI9A 3VRNA 3VRRA 3WNXB 1ZOTB 4CLNA 2KFFA 2VRGA 5IBWA 1H8BA 3LCPC 1FI5A 1UHJA 5CSIA 1DTLA 4XYNA 1A29A 2CCMA 3BUXB 1CLMA 1L7ZA 2F8PA 2PSRA 3SG6A 2MHHA 2MLEC 3CTNA 3TZ1A 2ZN8A 1YRUB 1FBVA 1QIWA 4JWQA 1AVSA 1LA3A 2BE6A 1SCMB 1NX3A 2L0PA 2OS8B 4M2OA 1G8IA 4CIDA 2G9BA 1M39A 1N2DA 1VRKA 5HYDA 1PALA 4CFRA 1NX1A 1PK0D 1K96A 1ALWA 2LCPA 1F4OA 3CWGA 3I5HB 2KOTA 1BMOA 1TCOB 1EG3A 1DGUA 1RFJA 2F3ZA 2M8UA 4AOMA 3TUYC 2QPTA 1AJ4A 1BT6A 1QVIY 2KQYA 5HLVA 2CTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WND A;  2L51 A;  4GGN A;  4R1E A;  1M45 A;  4FQO A;  1XFZ O;  4QJ3 B;  1OSA A;  2PRU A;  3PLF B;  2LMU A;  1FF1 A;  3KO0 A;  4NDC A;  1OMV A;  2JT3 A;  2WOR A;  3VRP A;  3ICB A;  2A4J A;  4PE1 A;  2LLU A;  3BOW A;  1RRO A;  5BPJ A;  3WHU B;  3NSI A;  4I5J A;  5DKR A;  1DF0 A;  3CGA A;  2JTT A;  1RWY A;  1B9A A;  1B1G A;  1XFV O;  1GJY A;  4E68 A;  1A03 A;  1BOC A;  1SNL A;  3JTD B;  4ZCU A;  1EH2 A;  1IJ6 A;  2SCP A;  2BL0 C;  2LMV A;  4YGD B;  5I2L A;  1DVI A;  1XFY O;  1WLZ A;  3O6B A;  1LIN A;  2PAL A;  3WHT B;  1NX0 A;  1IJ5 A;  4DUQ A;  5JOL A;  1PVB A;  2FCD A;  2P6B B;  5HKW A;  1PVA A;  3DVM A;  2JC2 A;  2OTG B;  4ICB A;  1S1E A;  2LAP A;  2GGZ A;  3QRX A;  1CFP A;  5AXI A;  4AQJ A;  3DF0 B;  4MEW A;  4UPG A;  4HRE E;  2KDH A;  2MLF C;  4GGF C;  1IGV A;  2GGM A;  1KQM C;  1SYM A;  2LE9 B;  1CFF A;  1IWQ A;  4GNK B;  2ZKM X;  1KK7 Y;  1NCY A;  3I5F B;  1CDL A;  3O78 A;  2BKH B;  1S3P A;  2JU0 A;  3OX5 A;  1CTR A;  2L50 A;  3PFV A;  2HF5 A;  1RJV A;  3OB1 B;  1S5G Y;  1EG4 A;  4MVF A;  4DIR A;  4GGF A;  2CNP A;  2L2E A;  3EVR A;  1S6I A;  1KFU L;  2GV5 A;  4MN0 A;  2KFG A;  1YR5 A;  4OKH A;  2KAX A;  3NSO A;  1X02 A;  2DOQ A;  2EHB A;  1CDM A;  5I2Q A;  2E6W A;  3PN7 B;  1TRF A;  4P5O E;  4GAO A;  1LKJ A;  2MA2 A;  1F55 A;  1BR4 B;  1KWO B;  1N65 A;  1TNP A;  2BBM A;  1JSA A;  3AKB A;  1H4B A;  1ZFS A;  2JNF A;  4YI8 A;  1J1E A;  1DJY A;  5AFP A;  1SR6 C;  1SRA A;  3EVU A;  5D69 A;  2JRF A;  1KSO A;  4I5N B;  3FWB A;  1SL7 A;  5J3X A;  1ZMZ A;  1R6P A;  1RTP 1;  2MBX A;  1J7R A;  3CR4 X;  1DJW A;  1QV0 A;  2Q91 A;  3SG5 A;  1ALV A;  1YVL A;  4PE7 A;  3VRQ A;  4QJ4 B;  2JNX A;  2CBL A;  2MJW B;  2AUC A;  1QLS A;  2FJU B;  1NX2 A;  4M2P A;  4MZL A;  4AQI A;  1JC2 A;  1SCM C;  2LUC A;  1NWD A;  1S6J A;  1XO5 A;  2OS8 C;  1OOJ A;  4PHJ A;  5AAN A;  3SIA A;  1TNX A;  3BYA A;  2H2K A;  4F0Z B;  1JFJ A;  4OV2 A;  3TDI A;  1S6C A;  3GK4 X;  3IQO A;  1J7P A;  4C0J A;  5TNC A;  1KFU S;  4PAL A;  1OE9 B;  3E3R A;  3AAJ A;  1TIZ A;  3SJS A;  3H4S E;  2ZN9 A;  1J1D A;  2LP2 A;  5AEQ A;  1IH0 A;  2COL B;  2L4I A;  4Q04 A;  3CR2 A;  1C7W A;  2KAV A;  1R2U A;  1IQ3 A;  1B8R A;  1NUB A;  4ORC B;  2F2P A;  3EK8 A;  1XK4 C;  2HQW A;  1E8A A;  1AK8 A;  4A4C A;  2M7N A;  2KNE A;  1B4C A;  4L9M A;  2EC6 B;  1CMF A;  1QIV A;  4GFT A;  1KK8 C;  2Y4Q A;  4MSP A;  2O60 A;  1YRT B;  2JZI A;  3SG2 A;  1YUS A;  2WCB A;  1QVI Z;  2KI4 B;  5K89 A;  2H61 C;  1QX7 A;  4WQ2 A;  2JUL A;  3NSL A;  1XK4 A;  1DJI A;  1Q80 A;  4ZCV A;  5KU1 A;  4JPZ B;  2KHN A;  4DCK A;  5D7F A;  1EL4 A;  1LVC D;  3JTD C;  2I7A A;  3O2P A;  5CSJ A;  1AHR A;  1DJZ A;  3SG3 A;  2B1U A;  2NLN A;  1YX7 A;  2MRD A;  5DKN A;  1EJ3 A;  4OCI A;  1NSH A;  2OTG C;  1SKT A;  2H61 A;  4I5L B;  5I8N A;  1Y1X A;  1SW8 A;  1ZUZ A;  3D0Y B;  4NDD A;  3LL8 B;  2Y5I A;  1BR1 B;  1G33 A;  1TCF A;  1YUT A;  1D1O A;  2K2A A;  3I5G B;  2K7O A;  3HX4 A;  1LXF C;  3ZWH A;  1L2O B;  3CS1 A;  3JVT B;  2LM5 A;  5HKZ A;  1QS7 A;  2KBM A;  3I5F C;  3BUM B;  1CDN A;  4ETO A;  4P2Y B;  3AAK A;  5AER A;  3EK4 A;  1U5I B;  1Y1A A;  4GBA A;  1UHH A;  2K61 A;  3PSR A;  1DJX A;  3DF0 A;  5KTY A;  2KGR A;  1KK7 Z;  2BCB A;  1XA5 A;  1YX8 A;  1UHI A;  4OR9 B;  1UHK A;  4MZJ A;  1NYA A;  1WY9 A;  4N5X A;  3IQQ A;  2M3W A;  3BXK A;  3PN7 C;  1TN4 A;  2LLT A;  1CB1 A;  1S5G Z;  4PHK A;  1CM4 A;  3TDU A;  1UUS A;  3M0W A;  1KWO C;  4PE0 A;  2LAN A;  3OX6 A;  3FWC A;  1IRJ A;  1QAT A;  1A75 B;  1CM1 A;  2BCX A;  1J7Q A;  2KGB C;  3F45 A;  1QAS A;  4ORA B;  2JWW A;  4GPL B;  1TNQ A;  4DS7 A;  1FI6 A;  4QJ5 B;  5B8I B;  4CFQ A;  1SL8 A;  1V1G A;  3KPX A;  4N1F A;  1FPW A;  1KFX L;  2M9G A;  5GQQ C;  2IS9 A;  2PAS A;  2JPT A;  3A8R A;  3K21 A;  1IG5 A;  1HT9 A;  1BG1 A;  1UUR A;  1K94 A;  1NIW A;  1NCZ A;  4XJK A;  1B8L A;  2HPS A;  4PDZ A;  4PE4 A;  5I2O A;  1WRL A;  2MAZ A;  1W7J B;  1MHO A;  4IL1 A;  1M31 A;  5ER5 A;  3AKA A;  1CNP A;  3OP0 A;  2KFH A;  3TS5 B;  4MRY A;  5F6T A;  1MXE A;  1DGV A;  1OQP A;  1YUR A;  2CXJ A;  2NCP A;  2QAC A;  4N1G A;  2K7C A;  4TNC A;  1WLM A;  1BLQ A;  2M0R A;  1REC A;  1UWO A;  2JT8 A;  1JF2 A;  1QX5 B;  3ZNI A;  1XVJ A;  2JT0 A;  3BQ3 A;  1QX2 A;  3C1V A;  2FOT A;  3OB2 B;  5ER4 X;  3SG7 A;  3KF9 A;  1GQM A;  2D8N A;  1BJF A;  3EKJ A;  1CLB A;  1V1F A;  3BUN B;  4JQ0 D;  1PRW A;  3CR5 X;  2EC6 C;  1K2H A;  3FIA A;  2WCF A;  3I5H C;  1TTX A;  2L4H A;  2AAO A;  4MLW A;  2KI4 C;  4NDB A;  1SY9 A;  1QLK A;  1CLL A;  1KFX S;  1WDC B;  2L98 A;  4PHN A;  3EKH A;  4D1E A;  1K9K A;  5PAL A;  4CPV A;  3CZT X;  2ZFD A;  1J55 A;  1A2X A;  1S26 D;  2KYC A;  1F71 A;  3RM1 A;  2K7D A;  1KQV A;  1B47 A;  1JFK A;  3LK1 A;  2V53 A;  2PVB A;  4A4B A;  1QTX A;  1CMG A;  2L5X B;  1BOD A;  4DRW A;  3I5I B;  3NSK A;  1DJH A;  2K2F A;  1XFX O;  3IF7 A;  1Y1U A;  4YGE B;  2BEC A;  3OHM B;  1YTZ C;  2JXL A;  1OZO A;  2M1U A;  2BCA A;  1SCV A;  3EK7 A;  3KHE A;  2ISD A;  4MBE A;  3I5G C;  2LC5 A;  1L2O C;  1UP5 A;  4YGC B;  3JVT C;  1B7T Z;  1NP8 A;  2LHI A;  4WRI A;  1K9U A;  1MWN A;  3NXA A;  1BU3 A;  1B7T Y;  1AP4 A;  3LK0 A;  4MRX A;  2ZRS A;  1HQV A;  1M63 B;  2JXC A;  2O5G A;  4HRG A;  4ORB B;  1S36 A;  2WOS A;  3D0Y A;  1NPQ A;  2LHL A;  2CT9 A;  1WRK A;  1XYD A;  2KSP A;  1M46 A;  2NCO A;  1OMR A;  4USL A;  2I2R E;  2EGD A;  1MUX A;  1NCX A;  2NXQ A;  5CPV A;  2K7B A;  1KK8 B;  2LVV A;  2ZND A;  3RLZ A;  1QV1 A;  4FTG A;  3LLE A;  2F3Y A;  1F54 A;  1QXP A;  1WRZ A;  2M97 A;  1U5I A;  3BOW B;  3KEV A;  4YGA A;  3PAL A;  1DJG A;  3TUY B;  4BY4 A;  4PCW A;  2G2B A;  2WC8 A;  1DF0 B;  4M2Q A;  2HQ8 A;  1BF5 A;  1PSR A;  1W7I B;  3GOF A;  2KI6 D;  1IQ5 A;  1PSB A;  1AUI B;  4MZK A;  4NQG A;  1MQ1 A;  5JJG A;  4C0K A;  4WQ3 A;  1F4Q A;  1F8H A;  1Y6W A;  2LP3 A;  1QJT A;  1KCY A;  1MXL C;  1N0Y A;  2M49 B;  3CLN A;  2LMT A;  2BE4 A;  1OMD A;  2OPO A;  4YRU A;  2KI6 C;  4YGB B;  1MR8 A;  2SAS A;  1IKU A;  3WXA A;  3BUW B;  1LA0 A;  1A75 A;  3VGO A;  2I18 A;  2ZNE A;  3FS7 A;  4HSZ A;  2M29 A;  3VRO A;  4U8D A;  1GGZ A;  3DD4 A;  3DVE A;  1K8U A;  3TS5 C;  2BL0 B;  2M1K B;  5FYX A;  2RGI A;  4YBH B;  2FCE A;  2KAY A;  1B8C A;  5HLO A;  1DMO A;  1TNW A;  1ODB A;  2M7L A;  1RK9 A;  1XFW O;  1Y0V H;  1SK6 D;  1K93 D;  2E30 A;  2F33 A;  2LVJ A;  2LV7 A;  3TDZ A;  1F70 A;  1YUU A;  1UHN A;  2BBN A;  2JQ6 A;  1A4P A;  2LUX A;  3SG4 A;  1CFD A;  3BUO B;  2BKI B;  2HET A;  2AMI A;  1J7O A;  5KSZ A;  5CSN A;  1KQM B;  2KYF A;  1DT7 B;  5G08 A;  1C07 A;  1JWD A;  3D10 A;  1SBJ A;  2JTZ A;  1EXR A;  2K0J A;  3A4U B;  5CSF A;  4C0L A;  1JUO A;  1JF0 A;  1CKK A;  1SL9 A;  1YVH A;  2LVI A;  1KSM A;  1SPY A;  2JOJ A;  2Q4U A;  3GK2 A;  1G4Y R;  1PUL A;  4PHM A;  4I5K A;  1WDC C;  3PAT A;  2LVK A;  3O4Y A;  1ZAC A;  1GGW A;  4GUK A;  1CDP A;  1K90 D;  1SMG A;  2I94 A;  4XJK B;  2Y1M A;  2LLS A;  4HRH A;  1C7V A;  2NZ0 A;  2R2I A;  3MSE B;  2LNK A;  3GK1 A;  2KBI A;  1AJ5 A;  1K95 A;  3PM8 A;  3SIB A;  3I5I C;  1K9P A;  3DVJ A;  4BY5 A;  2ZRT A;  3DVK A;  2TN4 A;  1JBA A;  1TOP A;  1MF8 B;  3HCM A;  4OVN F;  2F2O A;  5DKQ A;  2PMY A;  1CFC A;  2Y1N A;  5HKY A;  3EVV A;  1SR6 B;  2KQ6 A;  2WCE A;  2K8M B;  1OZS A;  1FW4 A;  1XFU O;  4YI9 A;  3VRN A;  3VRR A;  3WNX B;  1ZOT B;  4CLN A;  2KFF A;  2VRG A;  5IBW A;  1H8B A;  3LCP C;  1FI5 A;  1UHJ A;  5CSI A;  1DTL A;  4XYN A;  1A29 A;  2CCM A;  3BUX B;  1CLM A;  1L7Z A;  2F8P A;  2PSR A;  3SG6 A;  2MHH A;  2MLE C;  3CTN A;  3TZ1 A;  2ZN8 A;  1YRU B;  1FBV A;  1QIW A;  4JWQ A;  1AVS A;  1LA3 A;  2BE6 A;  1SCM B;  1NX3 A;  2L0P A;  2OS8 B;  4M2O A;  1G8I A;  4CID A;  2G9B A;  1M39 A;  1N2D A;  1VRK A;  5HYD A;  1PAL A;  4CFR A;  1NX1 A;  1PK0 D;  1K96 A;  1ALW A;  2LCP A;  1F4O A;  3CWG A;  3I5H B;  2KOT A;  1BMO A;  1TCO B;  1EG3 A;  1DGU A;  1RFJ A;  2F3Z A;  2M8U A;  4AOM A;  3TUY C;  2QPT A;  1AJ4 A;  1BT6 A;  1QVI Y;  2KQY A;  5HLV A;  2CTN A; 
#chains in the Genus database with same CATH topology
 2WND A;  5DIC A;  2L51 A;  4GGN A;  4R1E A;  1M45 A;  1C07 A;  4FQO A;  1C3Z A;  1XFZ O;  2K60 A;  4QJ3 B;  1OSA A;  4JKT A;  2PRU A;  3PLF B;  2LMU A;  1FF1 A;  3KO0 A;  4NDC A;  1OMV A;  1QWV A;  2JT3 A;  2WOR A;  3VRP A;  3ICB A;  2A4J A;  4PE1 A;  2LLU A;  3BOW A;  3L4A A;  1RRO A;  5BPJ A;  3WHU B;  3NSI A;  4I5J A;  5DKR A;  5FI7 A;  1DF0 A;  3CGA A;  2JTT A;  1RWY A;  1B9A A;  1B1G A;  1XFV O;  1GJY A;  4E68 A;  1A03 A;  1BOC A;  1SSE B;  1SNL A;  3JTD B;  4ZCU A;  1EH2 A;  1IJ6 A;  2SCP A;  2BL0 C;  2LMV A;  3QME A;  4YGD B;  5I2L A;  1DVI A;  1XFY O;  1WLZ A;  3O6B A;  1LIN A;  2PAL A;  3NHT A;  3WHT B;  1NX0 A;  1IJ5 A;  4DUQ A;  5JOL A;  1PVB A;  2FCD A;  2P6B B;  5HKW A;  1PVA A;  3DVM A;  2JC2 A;  2OTG B;  4ICB A;  1S1E A;  2LAP A;  2GGZ A;  3QRX A;  1CFP A;  5AXI A;  4AQJ A;  3D74 A;  3DF0 B;  4MEW A;  4UPG A;  4HRE E;  2KDH A;  2MLF C;  3R1V A;  1IGV A;  4GGF C;  2GGM A;  1KQM C;  1SYM A;  2LE9 B;  1CFF A;  1IWQ A;  4GNK B;  2ZKM X;  1KK7 Y;  1NCY A;  3I5F B;  1CDL A;  3O78 A;  2BKH B;  1S3P A;  2JU0 A;  3OX5 A;  1CTR A;  2L50 A;  3PFV A;  2HF5 A;  2FJY A;  1RJV A;  3OB1 B;  5EL2 A;  1S5G Y;  1EG4 A;  3B6X A;  4MVF A;  2JPO A;  4DIR A;  4GGF A;  2CNP A;  2L2E A;  3EVR A;  3N7H A;  1S6I A;  1KFU L;  2GV5 A;  4MN0 A;  2KFG A;  1YR5 A;  4OKH A;  2KAX A;  3NSO A;  1X02 A;  3O4X A;  2DOQ A;  2EHB A;  1CDM A;  5I2Q A;  2E6W A;  3PN7 B;  1TRF A;  4P5O E;  4GAO A;  3D73 A;  1LKJ A;  3VB1 A;  2MA2 A;  1F55 A;  1BR4 B;  1KWO B;  1N65 A;  1TNP A;  2BBM A;  1JSA A;  3AKB A;  1H4B A;  1IIO A;  1ZFS A;  2JNF A;  4YI8 A;  1J1E A;  1DJY A;  4F7F A;  5AFP A;  2WCL A;  1SR6 C;  2KLE A;  1SRA A;  3EVU A;  5D69 A;  2JRF A;  1KSO A;  4I5N B;  3FWB A;  1OOI X;  1SL7 A;  5J3X A;  1ZMZ A;  2WCJ A;  1R6P A;  1RTP 1;  2MBX A;  1J7R A;  3CR4 X;  1DJW A;  1TUZ A;  1QV0 A;  2Q91 A;  3SG5 A;  1ALV A;  1YVL A;  3B87 A;  4PE7 A;  3VRQ A;  4QJ4 B;  2JNX A;  2CBL A;  2MJW B;  2AUC A;  1QLS A;  2FJU B;  1NX2 A;  4M2P A;  4MZL A;  1P28 A;  4AQI A;  1JC2 A;  1SCM C;  2LUC A;  1NWD A;  1S6J A;  1XO5 A;  2OS8 C;  1OOJ A;  4PHJ A;  5AAN A;  2QEH A;  3SIA A;  1TNX A;  3BYA A;  2H2K A;  4F0Z B;  1JFJ A;  4OV2 A;  3TDI A;  1S6C A;  3GK4 X;  3IQO A;  1J7P A;  4C0J A;  5TNC A;  1KFU S;  4PAL A;  1OE9 B;  3E3R A;  3AAJ A;  1TIZ A;  3SJS A;  2QEV A;  3H4S E;  2ZN9 A;  1J1D A;  2LP2 A;  5AEQ A;  3UO9 A;  2COL B;  1IH0 A;  2L4I A;  4Q04 A;  3CR2 A;  1C7W A;  2KAV A;  1R2U A;  1IQ3 A;  1B8R A;  1NUB A;  4ORC B;  2F2P A;  3EK8 A;  1XK4 C;  2HQW A;  1E8A A;  1AK8 A;  4A4C A;  3V2L A;  2M7N A;  2KNE A;  5FI2 A;  1B4C A;  4L9M A;  3R1O A;  2QEO A;  2EC6 B;  1CMF A;  1QIV A;  1XFR A;  1KK8 C;  4GFT A;  2Y4Q A;  4MSP A;  2O60 A;  1YRT B;  2JZI A;  3SG2 A;  1YUS A;  2WCB A;  1QVI Z;  2KI4 B;  5K89 A;  3NGV A;  2H61 C;  1QX7 A;  4WQ2 A;  2JUL A;  3CZ2 A;  3NSL A;  1XK4 A;  1DJI A;  1Q80 A;  2WCM A;  4ZCV A;  5KU1 A;  4JPZ B;  2KHN A;  4DCK A;  5D7F A;  1EL4 A;  1LVC D;  3JTD C;  1TUJ A;  2I7A A;  3K1E A;  3S0F A;  3O2P A;  5CSJ A;  1AHR A;  1DJZ A;  3SG3 A;  2B1U A;  2NLN A;  1YX7 A;  2MRD A;  5DKN A;  3BJH A;  1EJ3 A;  4OCI A;  1NSH A;  2OTG C;  1SKT A;  2H61 A;  2PQL A;  4I5L B;  5I8N A;  1Y1X A;  1SW8 A;  1ZUZ A;  3D0Y B;  4NDD A;  3LL8 B;  2KPH A;  2Y5I A;  3S0A A;  1BR1 B;  1G33 A;  1TCF A;  1YUT A;  1D1O A;  2K2A A;  3I5G B;  2K7O A;  3HX4 A;  1LXF C;  3ZWH A;  1L2O B;  3CS1 A;  3JVT B;  2LM5 A;  5HKZ A;  1DEK A;  1QS7 A;  2KBM A;  3I5F C;  3BUM B;  1CDN A;  4ETO A;  1DEL A;  4P2Y B;  3AAK A;  5AER A;  3EG5 B;  3EK4 A;  4FQT A;  1U5I B;  1Y1A A;  4GBA A;  1UHH A;  2K61 A;  3PSR A;  1DJX A;  3DF0 A;  5KTY A;  2KGR A;  1KK7 Z;  2BCB A;  1XA5 A;  3DZT A;  1YX8 A;  3L47 A;  1UHI A;  4OR9 B;  1UHK A;  4MZJ A;  1NYA A;  1WY9 A;  4N5X A;  5D3O A;  3SS4 A;  3IQQ A;  2M3W A;  3D78 A;  3BXK A;  4IJ7 A;  3PN7 C;  1TN4 A;  2LLT A;  1CB1 A;  1S5G Z;  4PHK A;  1CM4 A;  3FE6 A;  3TDU A;  3BFB A;  1UUS A;  3M0W A;  1KWO C;  4PE0 A;  2LAN A;  3OX6 A;  3FWC A;  1IRJ A;  2P71 A;  1QAT A;  1A75 B;  1CM1 A;  3R1P A;  2BCX A;  1J7Q A;  2KGB C;  3F45 A;  1QAS A;  4ORA B;  2JWW A;  4GPL B;  1TNQ A;  5FI6 A;  4DS7 A;  4QJ5 B;  5B8I B;  1FI6 A;  4CFQ A;  1SL8 A;  1V1G A;  3KPX A;  4N1F A;  3PM2 A;  1FPW A;  2BAP A;  3FE8 A;  1KFX L;  2M9G A;  3BFA A;  5GQQ C;  2IS9 A;  2PAS A;  4OZD A;  2JPT A;  3A8R A;  3K21 A;  1IG5 A;  1HT9 A;  1BG1 A;  1UUR A;  1K94 A;  1NIW A;  1NCZ A;  2L5Y A;  4XJK A;  1B8L A;  2HPS A;  4PDZ A;  4PE4 A;  5I2O A;  1WRL A;  2MAZ A;  1W7J B;  1MHO A;  3DYE A;  1M31 A;  4IL1 A;  5ER5 A;  3AKA A;  1CNP A;  3OP0 A;  2KFH A;  3TS5 B;  4MRY A;  5F6T A;  1MXE A;  1DGV A;  1OQP A;  1YUR A;  2CXJ A;  2NCP A;  2QAC A;  4N1G A;  3R72 A;  2H8V A;  2K7C A;  1DC1 A;  4TNC A;  1WLM A;  1BLQ A;  2M0R A;  3CYZ A;  1REC A;  1UWO A;  2JT8 A;  2ERB A;  1JF2 A;  1QX5 B;  1ORG A;  3ZNI A;  1XVJ A;  1W9Z A;  2JT0 A;  3BQ3 A;  1QX2 A;  3C1V A;  2FOT A;  3OB2 B;  5ER4 X;  3SG7 A;  3KF9 A;  1GQM A;  2D8N A;  1BJF A;  3EKJ A;  4JD9 A;  1V1F A;  3BUN B;  1CLB A;  4JQ0 D;  1PRW A;  3CR5 X;  2EC6 C;  1K2H A;  3FIA A;  2WCF A;  3I5H C;  4PT1 A;  1TTX A;  2L4H A;  2AAO A;  4MLW A;  2KI4 C;  4NDB A;  1SY9 A;  1QLK A;  1CLL A;  1KFX S;  1WDC B;  2L98 A;  3FE9 A;  3EKH A;  4PHN A;  3S0D A;  1K9K A;  4D1E A;  5PAL A;  3S0G A;  3CZT X;  4CPV A;  1OOF A;  2ZFD A;  1J55 A;  5HL1 A;  1A2X A;  1S26 D;  2KYC A;  1F71 A;  3RM1 A;  2K7D A;  1KQV A;  1B47 A;  1JFK A;  3LK1 A;  2V53 A;  2L2C A;  1OW4 A;  2PVB A;  1QTX A;  2QEB A;  4A4B A;  1CMG A;  1T14 A;  2L5X B;  1BOD A;  4DRW A;  3I5I B;  3NSK A;  1DJH A;  2K2F A;  1XFX O;  3S0E A;  3IF7 A;  1Y1U A;  4YGE B;  1LS8 A;  2BEC A;  3L4L A;  1YTZ C;  2JXL A;  3OHM B;  1OZO A;  2M1U A;  3CDN A;  2BCA A;  1SCV A;  3EK7 A;  3KHE A;  2ISD A;  4MBE A;  3I5G C;  2LC5 A;  1L2O C;  1UP5 A;  4YGC B;  2WC6 A;  3JVT C;  1B7T Z;  1NP8 A;  3SS5 A;  2LHI A;  4WRI A;  1K9U A;  1MWN A;  3NXA A;  1BU3 A;  1B7T Y;  1AP4 A;  3LK0 A;  4MRX A;  3SS3 A;  2ZRS A;  1HQV A;  1M63 B;  2JXC A;  2O5G A;  3OBV A;  2WCH A;  4HRG A;  4ORB B;  1S36 A;  2WOS A;  3D0Y A;  1NPQ A;  2LHL A;  2CT9 A;  1WRK A;  1XYD A;  3UNW A;  2KSP A;  1M46 A;  3CZ0 A;  2NCO A;  1OMR A;  4USL A;  2I2R E;  2EGD A;  3D76 A;  1Z4H A;  1MUX A;  1NCX A;  2NXQ A;  5CPV A;  2K7B A;  1KK8 B;  2LVV A;  2ZND A;  3RLZ A;  1QV1 A;  4FTG A;  2KLD A;  3LLE A;  2F3Y A;  1F54 A;  1QXP A;  1WRZ A;  2M97 A;  1U5I A;  3BOW B;  3KEV A;  4YGA A;  3PAL A;  1DJG A;  3TUY B;  4BY4 A;  4PCW A;  2G2B A;  2WC8 A;  1DF0 B;  4M2Q A;  2HQ8 A;  1BF5 A;  1PSR A;  1OOH A;  1W7I B;  3GOF A;  2KI6 D;  1IQ5 A;  1PSB A;  1AUI B;  2QDI A;  4MZK A;  4NQG A;  3DXL A;  1MQ1 A;  5JJG A;  4C0K A;  3Q8I A;  4WQ3 A;  1F4Q A;  2YGU A;  1F8H A;  1Y6W A;  2LP3 A;  1QJT A;  1KCY A;  2PYQ A;  1MXL C;  1N0Y A;  2M49 B;  3CLN A;  2LMT A;  2BE4 A;  1OMD A;  2OPO A;  4YRU A;  2KI6 C;  4YGB B;  1MR8 A;  2SAS A;  1IKU A;  3WXA A;  3BUW B;  1LA0 A;  1A75 A;  3VGO A;  2I18 A;  2ZNE A;  3FS7 A;  3IVT A;  4HSZ A;  2M29 A;  3VRO A;  4U8D A;  1GGZ A;  3DD4 A;  1TWO A;  3DVE A;  1K8U A;  3TS5 C;  2BL0 B;  2M1K B;  4KYN A;  5FYX A;  2RGI A;  4YBH B;  2FCE A;  2KAY A;  1B8C A;  5HLO A;  1DMO A;  1TNW A;  1ODB A;  2M7L A;  5I94 A;  1RK9 A;  1XFW O;  1Y0V H;  1SK6 D;  1K93 D;  2E30 A;  2F33 A;  2LVJ A;  2LV7 A;  3TDZ A;  1F70 A;  1YUU A;  1UHN A;  2BBN A;  2JQ6 A;  1A4P A;  2LUX A;  3SG4 A;  1CFD A;  1C3Y A;  3BUO B;  2BKI B;  2HET A;  2AMI A;  1J7O A;  5KSZ A;  5CSN A;  1KQM B;  2GTE A;  2KYF A;  3CZ1 A;  5G08 A;  1DT7 B;  3D10 A;  1SBJ A;  2JTZ A;  1EXR A;  2K0J A;  3A4U B;  4INW A;  1JWD A;  5CSF A;  4C0L A;  1JUO A;  1JF0 A;  1CKK A;  3NHI A;  1SL9 A;  1YVH A;  2LVI A;  1KSM A;  1SPY A;  2JOJ A;  2Q4U A;  3D75 A;  3D77 A;  3GK2 A;  1G4Y R;  1PUL A;  4PHM A;  4I5K A;  1WDC C;  3PAT A;  2LVK A;  3O4Y A;  1ZAC A;  1GGW A;  4GUK A;  1CDP A;  1K90 D;  1SMG A;  2I94 A;  4XJK B;  2Y1M A;  2LLS A;  4HRH A;  2BNX A;  2NZ0 A;  2R2I A;  3MSE B;  1C7V A;  2LNK A;  3GK1 A;  2KBI A;  1AJ5 A;  1K95 A;  3PM8 A;  3SIB A;  3I5I C;  1K9P A;  3DVJ A;  4BY5 A;  4INX A;  2ZRT A;  3DVK A;  2TN4 A;  3S0B A;  1JBA A;  3PJI A;  1TOP A;  1MF8 B;  3HCM A;  4OVN F;  1OOG A;  2P70 A;  1Z2C B;  2F2O A;  5DKQ A;  2PMY A;  1CFC A;  3B7A A;  2Y1N A;  5HKY A;  3EVV A;  1SR6 B;  2KQ6 A;  2WCE A;  3BFH A;  1DQE A;  2K8M B;  1OZS A;  1FW4 A;  1XFU O;  4YI9 A;  3RZS A;  3VRN A;  3VRR A;  3WNX B;  1ZOT B;  4CLN A;  2KFF A;  3OGN A;  2VRG A;  5IBW A;  1H8B A;  3B86 A;  3LCP C;  1UHJ A;  5CSI A;  1DTL A;  4XYN A;  2WCK A;  1FI5 A;  1A29 A;  2CCM A;  3BUX B;  1CLM A;  1L7Z A;  2F8P A;  2PSR A;  3SG6 A;  2MHH A;  2MLE C;  3CTN A;  3TZ1 A;  2ZN8 A;  1YRU B;  1FBV A;  1QIW A;  4JWQ A;  1AVS A;  1LA3 A;  1GM0 A;  2BE6 A;  1SCM B;  1NX3 A;  2L0P A;  2OS8 B;  4M2O A;  1G8I A;  4CID A;  2G9B A;  3B88 A;  1M39 A;  1N2D A;  1VRK A;  5HYD A;  1PAL A;  4CFR A;  1NX1 A;  3DY9 A;  1PK0 D;  1K96 A;  1ALW A;  2LCP A;  1F4O A;  3CWG A;  3I5H B;  2KOT A;  1BMO A;  1TCO B;  1EG3 A;  1DGU A;  1RFJ A;  2F3Z A;  2M8U A;  3CAB A;  4AOM A;  3TUY C;  2QPT A;  1AJ4 A;  1BT6 A;  2WC5 A;  1QVI Y;  2KQY A;  5HLV A;  2CTN A; 
#chains in the Genus database with same CATH homology
 2WND A;  2L51 A;  4GGN A;  4R1E A;  1M45 A;  4FQO A;  1XFZ O;  4QJ3 B;  1OSA A;  2PRU A;  3PLF B;  2LMU A;  1FF1 A;  3KO0 A;  4NDC A;  1OMV A;  2JT3 A;  2WOR A;  3VRP A;  3ICB A;  2A4J A;  4PE1 A;  2LLU A;  3BOW A;  1RRO A;  5BPJ A;  3WHU B;  3NSI A;  4I5J A;  5DKR A;  1DF0 A;  3CGA A;  2JTT A;  1RWY A;  1B9A A;  1B1G A;  1XFV O;  1GJY A;  4E68 A;  1A03 A;  1BOC A;  1SNL A;  3JTD B;  4ZCU A;  1EH2 A;  1IJ6 A;  2SCP A;  2BL0 C;  2LMV A;  4YGD B;  5I2L A;  1DVI A;  1XFY O;  1WLZ A;  3O6B A;  1LIN A;  2PAL A;  3WHT B;  1NX0 A;  1IJ5 A;  4DUQ A;  5JOL A;  1PVB A;  2FCD A;  2P6B B;  5HKW A;  1PVA A;  3DVM A;  2JC2 A;  2OTG B;  4ICB A;  1S1E A;  2LAP A;  2GGZ A;  3QRX A;  1CFP A;  5AXI A;  4AQJ A;  3DF0 B;  4MEW A;  4UPG A;  4HRE E;  2KDH A;  2MLF C;  4GGF C;  1IGV A;  2GGM A;  1KQM C;  1SYM A;  2LE9 B;  1CFF A;  1IWQ A;  4GNK B;  2ZKM X;  1KK7 Y;  1NCY A;  3I5F B;  1CDL A;  3O78 A;  2BKH B;  1S3P A;  2JU0 A;  3OX5 A;  1CTR A;  2L50 A;  3PFV A;  2HF5 A;  1RJV A;  3OB1 B;  1S5G Y;  1EG4 A;  4MVF A;  4DIR A;  4GGF A;  2CNP A;  2L2E A;  3EVR A;  1S6I A;  1KFU L;  2GV5 A;  4MN0 A;  2KFG A;  1YR5 A;  4OKH A;  2KAX A;  3NSO A;  1X02 A;  2DOQ A;  2EHB A;  1CDM A;  5I2Q A;  2E6W A;  3PN7 B;  1TRF A;  4P5O E;  4GAO A;  1LKJ A;  2MA2 A;  1F55 A;  1BR4 B;  1KWO B;  1N65 A;  1TNP A;  2BBM A;  1JSA A;  3AKB A;  1H4B A;  1ZFS A;  2JNF A;  4YI8 A;  1J1E A;  1DJY A;  5AFP A;  1SR6 C;  1SRA A;  3EVU A;  5D69 A;  2JRF A;  1KSO A;  4I5N B;  3FWB A;  1SL7 A;  5J3X A;  1ZMZ A;  1R6P A;  1RTP 1;  2MBX A;  1J7R A;  3CR4 X;  1DJW A;  1QV0 A;  2Q91 A;  3SG5 A;  1ALV A;  1YVL A;  4PE7 A;  3VRQ A;  4QJ4 B;  2JNX A;  2CBL A;  2MJW B;  2AUC A;  1QLS A;  2FJU B;  1NX2 A;  4M2P A;  4MZL A;  4AQI A;  1JC2 A;  1SCM C;  2LUC A;  1NWD A;  1S6J A;  1XO5 A;  2OS8 C;  1OOJ A;  4PHJ A;  5AAN A;  3SIA A;  1TNX A;  3BYA A;  2H2K A;  4F0Z B;  1JFJ A;  4OV2 A;  3TDI A;  1S6C A;  3GK4 X;  3IQO A;  1J7P A;  4C0J A;  5TNC A;  1KFU S;  4PAL A;  1OE9 B;  3E3R A;  3AAJ A;  1TIZ A;  3SJS A;  3H4S E;  2ZN9 A;  1J1D A;  2LP2 A;  5AEQ A;  1IH0 A;  2COL B;  2L4I A;  4Q04 A;  3CR2 A;  1C7W A;  2KAV A;  1R2U A;  1IQ3 A;  1B8R A;  1NUB A;  4ORC B;  2F2P A;  3EK8 A;  1XK4 C;  2HQW A;  1E8A A;  1AK8 A;  4A4C A;  2M7N A;  2KNE A;  1B4C A;  4L9M A;  2EC6 B;  1CMF A;  1QIV A;  4GFT A;  1KK8 C;  2Y4Q A;  4MSP A;  2O60 A;  1YRT B;  2JZI A;  3SG2 A;  1YUS A;  2WCB A;  1QVI Z;  2KI4 B;  5K89 A;  2H61 C;  1QX7 A;  4WQ2 A;  2JUL A;  3NSL A;  1XK4 A;  1DJI A;  1Q80 A;  4ZCV A;  5KU1 A;  4JPZ B;  2KHN A;  4DCK A;  5D7F A;  1EL4 A;  1LVC D;  3JTD C;  2I7A A;  3O2P A;  5CSJ A;  1AHR A;  1DJZ A;  3SG3 A;  2B1U A;  2NLN A;  1YX7 A;  2MRD A;  5DKN A;  1EJ3 A;  4OCI A;  1NSH A;  2OTG C;  1SKT A;  2H61 A;  4I5L B;  5I8N A;  1Y1X A;  1SW8 A;  1ZUZ A;  3D0Y B;  4NDD A;  3LL8 B;  2Y5I A;  1BR1 B;  1G33 A;  1TCF A;  1YUT A;  1D1O A;  2K2A A;  3I5G B;  2K7O A;  3HX4 A;  1LXF C;  3ZWH A;  1L2O B;  3CS1 A;  3JVT B;  2LM5 A;  5HKZ A;  1QS7 A;  2KBM A;  3I5F C;  3BUM B;  1CDN A;  4ETO A;  4P2Y B;  3AAK A;  5AER A;  3EK4 A;  1U5I B;  1Y1A A;  4GBA A;  1UHH A;  2K61 A;  3PSR A;  1DJX A;  3DF0 A;  5KTY A;  2KGR A;  1KK7 Z;  2BCB A;  1XA5 A;  1YX8 A;  1UHI A;  4OR9 B;  1UHK A;  4MZJ A;  1NYA A;  1WY9 A;  4N5X A;  3IQQ A;  2M3W A;  3BXK A;  3PN7 C;  1TN4 A;  2LLT A;  1CB1 A;  1S5G Z;  4PHK A;  1CM4 A;  3TDU A;  1UUS A;  3M0W A;  1KWO C;  4PE0 A;  2LAN A;  3OX6 A;  3FWC A;  1IRJ A;  1QAT A;  1A75 B;  1CM1 A;  2BCX A;  1J7Q A;  2KGB C;  3F45 A;  1QAS A;  4ORA B;  2JWW A;  4GPL B;  1TNQ A;  4DS7 A;  1FI6 A;  4QJ5 B;  5B8I B;  4CFQ A;  1SL8 A;  1V1G A;  3KPX A;  4N1F A;  1FPW A;  1KFX L;  2M9G A;  5GQQ C;  2IS9 A;  2PAS A;  2JPT A;  3A8R A;  3K21 A;  1IG5 A;  1HT9 A;  1BG1 A;  1UUR A;  1K94 A;  1NIW A;  1NCZ A;  4XJK A;  1B8L A;  2HPS A;  4PDZ A;  4PE4 A;  5I2O A;  1WRL A;  2MAZ A;  1W7J B;  1MHO A;  4IL1 A;  1M31 A;  5ER5 A;  3AKA A;  1CNP A;  3OP0 A;  2KFH A;  3TS5 B;  4MRY A;  5F6T A;  1MXE A;  1DGV A;  1OQP A;  1YUR A;  2CXJ A;  2NCP A;  2QAC A;  4N1G A;  2K7C A;  4TNC A;  1WLM A;  1BLQ A;  2M0R A;  1REC A;  1UWO A;  2JT8 A;  1JF2 A;  1QX5 B;  3ZNI A;  1XVJ A;  2JT0 A;  3BQ3 A;  1QX2 A;  3C1V A;  2FOT A;  3OB2 B;  5ER4 X;  3SG7 A;  3KF9 A;  1GQM A;  2D8N A;  1BJF A;  3EKJ A;  1CLB A;  1V1F A;  3BUN B;  4JQ0 D;  1PRW A;  3CR5 X;  2EC6 C;  1K2H A;  3FIA A;  2WCF A;  3I5H C;  1TTX A;  2L4H A;  2AAO A;  4MLW A;  2KI4 C;  4NDB A;  1SY9 A;  1QLK A;  1CLL A;  1KFX S;  1WDC B;  2L98 A;  4PHN A;  3EKH A;  4D1E A;  1K9K A;  5PAL A;  4CPV A;  3CZT X;  2ZFD A;  1J55 A;  1A2X A;  1S26 D;  2KYC A;  1F71 A;  3RM1 A;  2K7D A;  1KQV A;  1B47 A;  1JFK A;  3LK1 A;  2V53 A;  2PVB A;  4A4B A;  1QTX A;  1CMG A;  2L5X B;  1BOD A;  4DRW A;  3I5I B;  3NSK A;  1DJH A;  2K2F A;  1XFX O;  3IF7 A;  1Y1U A;  4YGE B;  2BEC A;  3OHM B;  1YTZ C;  2JXL A;  1OZO A;  2M1U A;  2BCA A;  1SCV A;  3EK7 A;  3KHE A;  2ISD A;  4MBE A;  3I5G C;  2LC5 A;  1L2O C;  1UP5 A;  4YGC B;  3JVT C;  1B7T Z;  1NP8 A;  2LHI A;  4WRI A;  1K9U A;  1MWN A;  3NXA A;  1BU3 A;  1B7T Y;  1AP4 A;  3LK0 A;  4MRX A;  2ZRS A;  1HQV A;  1M63 B;  2JXC A;  2O5G A;  4HRG A;  4ORB B;  1S36 A;  2WOS A;  3D0Y A;  1NPQ A;  2LHL A;  2CT9 A;  1WRK A;  1XYD A;  2KSP A;  1M46 A;  2NCO A;  1OMR A;  4USL A;  2I2R E;  2EGD A;  1MUX A;  1NCX A;  2NXQ A;  5CPV A;  2K7B A;  1KK8 B;  2LVV A;  2ZND A;  3RLZ A;  1QV1 A;  4FTG A;  3LLE A;  2F3Y A;  1F54 A;  1QXP A;  1WRZ A;  2M97 A;  1U5I A;  3BOW B;  3KEV A;  4YGA A;  3PAL A;  1DJG A;  3TUY B;  4BY4 A;  4PCW A;  2G2B A;  2WC8 A;  1DF0 B;  4M2Q A;  2HQ8 A;  1BF5 A;  1PSR A;  1W7I B;  3GOF A;  2KI6 D;  1IQ5 A;  1PSB A;  1AUI B;  4MZK A;  4NQG A;  1MQ1 A;  5JJG A;  4C0K A;  4WQ3 A;  1F4Q A;  1F8H A;  1Y6W A;  2LP3 A;  1QJT A;  1KCY A;  1MXL C;  1N0Y A;  2M49 B;  3CLN A;  2LMT A;  2BE4 A;  1OMD A;  2OPO A;  4YRU A;  2KI6 C;  4YGB B;  1MR8 A;  2SAS A;  1IKU A;  3WXA A;  3BUW B;  1LA0 A;  1A75 A;  3VGO A;  2I18 A;  2ZNE A;  3FS7 A;  4HSZ A;  2M29 A;  3VRO A;  4U8D A;  1GGZ A;  3DD4 A;  3DVE A;  1K8U A;  3TS5 C;  2BL0 B;  2M1K B;  5FYX A;  2RGI A;  4YBH B;  2FCE A;  2KAY A;  1B8C A;  5HLO A;  1DMO A;  1TNW A;  1ODB A;  2M7L A;  1RK9 A;  1XFW O;  1Y0V H;  1SK6 D;  1K93 D;  2E30 A;  2F33 A;  2LVJ A;  2LV7 A;  3TDZ A;  1F70 A;  1YUU A;  1UHN A;  2BBN A;  2JQ6 A;  1A4P A;  2LUX A;  3SG4 A;  1CFD A;  3BUO B;  2BKI B;  2HET A;  2AMI A;  1J7O A;  5KSZ A;  5CSN A;  1KQM B;  2KYF A;  1DT7 B;  5G08 A;  1C07 A;  1JWD A;  3D10 A;  1SBJ A;  2JTZ A;  1EXR A;  2K0J A;  3A4U B;  5CSF A;  4C0L A;  1JUO A;  1JF0 A;  1CKK A;  1SL9 A;  1YVH A;  2LVI A;  1KSM A;  1SPY A;  2JOJ A;  2Q4U A;  3GK2 A;  1G4Y R;  1PUL A;  4PHM A;  4I5K A;  1WDC C;  3PAT A;  2LVK A;  3O4Y A;  1ZAC A;  1GGW A;  4GUK A;  1CDP A;  1K90 D;  1SMG A;  2I94 A;  4XJK B;  2Y1M A;  2LLS A;  4HRH A;  1C7V A;  2NZ0 A;  2R2I A;  3MSE B;  2LNK A;  3GK1 A;  2KBI A;  1AJ5 A;  1K95 A;  3PM8 A;  3SIB A;  3I5I C;  1K9P A;  3DVJ A;  4BY5 A;  2ZRT A;  3DVK A;  2TN4 A;  1JBA A;  1TOP A;  1MF8 B;  3HCM A;  4OVN F;  2F2O A;  5DKQ A;  2PMY A;  1CFC A;  2Y1N A;  5HKY A;  3EVV A;  1SR6 B;  2KQ6 A;  2WCE A;  2K8M B;  1OZS A;  1FW4 A;  1XFU O;  4YI9 A;  3VRN A;  3VRR A;  3WNX B;  1ZOT B;  4CLN A;  2KFF A;  2VRG A;  5IBW A;  1H8B A;  3LCP C;  1FI5 A;  1UHJ A;  5CSI A;  1DTL A;  4XYN A;  1A29 A;  2CCM A;  3BUX B;  1CLM A;  1L7Z A;  2F8P A;  2PSR A;  3SG6 A;  2MHH A;  2MLE C;  3CTN A;  3TZ1 A;  2ZN8 A;  1YRU B;  1FBV A;  1QIW A;  4JWQ A;  1AVS A;  1LA3 A;  2BE6 A;  1SCM B;  1NX3 A;  2L0P A;  2OS8 B;  4M2O A;  1G8I A;  4CID A;  2G9B A;  1M39 A;  1N2D A;  1VRK A;  5HYD A;  1PAL A;  4CFR A;  1NX1 A;  1PK0 D;  1K96 A;  1ALW A;  2LCP A;  1F4O A;  3CWG A;  3I5H B;  2KOT A;  1BMO A;  1TCO B;  1EG3 A;  1DGU A;  1RFJ A;  2F3Z A;  2M8U A;  4AOM A;  3TUY C;  2QPT A;  1AJ4 A;  1BT6 A;  1QVI Y;  2KQY A;  5HLV A;  2CTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...