4FQOA

Crystal structure of calcium-loaded s100b bound to sbi4211
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Discovery of a Novel Pentamidine-Related Inhibitor of the Calcium-Binding Protein S100B.
pubmed doi rcsb
molecule keywords Protein S100-B
molecule tags Protein binding/inhibitor
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4fqoA00
2HF5A 2F2PA 3BQ3A 1WLMA 1CMFA 1DTLA 2EC6B 3IQOA 4ETOA 1Y6WA 1F8HA 4E68A 4MZJA 2JQ6A 2NCPA 4NDBA 1QX7A 5HKZA 1U5IA 3O78A 1IRJA 2JT8A 4MBEA 2Y1NA 4MN0A 2HQWA 4PCWA 3BUOB 2F3ZA 5G08A 2MRDA 5AFPA 1LA3A 5D69A 2O5GA 4TNCA 2JXCA 3F45A 5KSZA 2LP2A 1EH2A 1QIVA 3M0WA 4JQ0D 1BU3A 1GGZA 2K7DA 2L4HA 2JPTA 5GQQC 2LUCA 5CSFA 3EVVA 4PALA 2I94A 1KFXS 1MXEA 4I5JA 4I5KA 3VRNA 1K9KA 5AEQA 2KBIA 1JF0A 1TN4A 1CFFA 1WRZA 4Q04A 1XFZO 5IBWA 3PATA 4DCKA 4F0ZB 2P6BB 1LXFC 3TDIA 1FF1A 2BCAA 3ICBA 1OQPA 2M9GA 3VROA 2M49B 1CLMA 1Y0VH 2JXLA 2L5XB 1J7PA 1IGVA 1NCYA 2ZNDA 4CLNA 2FCEA 1XFVO 3FS7A 3PFVA 3JTDB 4PHNA 4N1GA 3PALA 4U8DA 5I8NA 1KCYA 1CLBA 3A4UB 1F4QA 4GPLB 2M97A 1HT9A 3LK1A 1IKUA 1J1DA 2JU0A 1QIWA 3CS1A 3KF9A 2GGMA 2COLB 1MUXA 2KBMA 2PASA 2HETA 1CFPA 1RROA 2LAPA 1BF5A 1NCZA 1NIWA 1FI5A 1QATA 3FWCA 2MLEC 2L50A 2O60A 2LCPA 1EG3A 2M0RA 3TS5C 1IQ5A 1QLSA 2CT9A 1AK8A 4IL1A 2JZIA 2OPOA 3CR2A 1DGVA 3O4YA 1JFJA 4M2PA 4USLA 1QX2A 2JNXA 4HRHA 2CXJA 1S6IA 2KI6C 3I5GC 4D1EA 3EK4A 2B1UA 1C07A 1M31A 1C7WA 1OZSA 5HYDA 2WCBA 1V1GA 5B8IB 1CM1A 1JUOA 3OHMB 3EK8A 4C0KA 2KAVA 1J1EA 2MHHA 2GGZA 2JC2A 1CFCA 2JTZA 3CTNA 3TS5B 1TTXA 3D10A 2ZFDA 1BODA 1CDNA 3LK0A 2KHNA 5BPJA 1K95A 1XK4A 4M2QA 1PVAA 2LMUA 1UHIA 1MXLC 2ZN8A 1DVIA 1SW8A 1RK9A 1N0YA 4MZKA 3I5GB 1J7RA 3D0YB 3TUYC 2BBNA 1QS7A 4QJ3B 4YGEB 1NP8A 2K61A 1QV1A 4QJ5B 5I2OA 2AUCA 1JSAA 4PHMA 1GJYA 3TDZA 1SL9A 2FOTA 1K94A 3TZ1A 1UUSA 1SCMC 3H4SE 1CDPA 2L4IA 2LVKA 1L2OC 2ZN9A 4GUKA 3PSRA 2JULA 1SR6C 1XFUO 1CMGA 3CLNA 3DF0A 2EHBA 3WHUB 2HQ8A 2DOQA 2L2EA 4MLWA 4CFQA 3KHEA 3I5FC 2M1KB 4GGFA 3TUYB 1TRFA 2KSPA 3CGAA 1DJXA 1NPQA 1L7ZA 1DF0B 1A2XA 1R2UA 1XK4C 2I2RE 3EKHA 1QVIZ 3RM1A 1SCMB 2L51A 3E3RA 3VRQA 1LKJA 1L2OB 1IH0A 4M2OA 1H8BA 1K9PA 1SR6B 2H61A 3SJSA 4AOMA 1NCXA 1YR5A 1NX2A 5DKRA 1KFXL 1KK7Y 3AAKA 1SKTA 3I5FB 2FCDA 1CM4A 2KQ6A 2R2IA 4P2YB 2EGDA 1PSRA 1PULA 2OS8C 3LCPC 1YVLA 2PMYA 2PSRA 4MVFA 3FWBA 5CSIA 1NUBA 2ZNEA 2E30A 1IG5A 5ER4X 2JT3A 1TIZA 4YGBB 4ICBA 1B8RA 1J55A 1AHRA 2KFFA 2WCFA 4GGFC 3SG2A 5K89A 3BOWB 3LLEA 2LLSA 1IQ3A 3JTDC 3VRPA 5AANA 1SY9A 4MRXA 4GGNA 3CWGA 1MQ1A 2PVBA 4YRUA 4N1FA 2GV5A 3ZNIA 4OVNF 5AXIA 2MBXA 1IJ6A 1WRKA 1SNLA 3CZTX 4FQOA 1G33A 2M1UA 1QJTA 2OS8B 2TN4A 3BUXB 1Y1AA 1C7VA 2Q91A 1JFKA 2H61C 2JT0A 1XO5A 3DF0B 3K21A 3DVKA 1B9AA 1DGUA 2LM5A 1YVHA 3D0YA 1SYMA 4OCIA 2PRUA 1TNQA 3QRXA 1OMVA 4BY4A 3SIBA 1XFXO 1PALA 4HSZA 1S1EA 1F70A 4ORCB 1SPYA 5HLOA 5FYXA 4AQJA 2KYCA 1JBAA 1SCVA 1OMRA 2BECA 1S36A 4GAOA 1A4PA 2ZRTA 2LLTA 1FBVA 1BMOA 1S5GY 2CNPA 3VRRA 2LHIA 2NLNA 3SG6A 1EG4A 1M46A 1KQMC 2LLUA 3TDUA 1BT6A 2CTNA 1IJ5A 1QV0A 1YURA 2L98A 1X02A 1XVJA 1N65A 1K93D 2KQYA 1AJ5A 1F4OA 1MR8A 1DJZA 1SL7A 3OX5A 1CLLA 4YI8A 3OB2B 1DF0A 4OKHA 1Y1UA 2BKHB 1WLZA 1MWNA 1SMGA 1YUSA 3BUNB 4R1EA 3WNXB 2Y5IA 4NDCA 1S6CA 3MSEB 3SG7A 1LINA 3OP0A 3O6BA 1KQVA 1ZACA 5DKNA 3EK7A 1MF8B 1KQMB 1BOCA 3LL8B 1RWYA 3GOFA 1A29A 2FJUB 2IS9A 4C0LA 5J3XA 1YRUB 1BLQA 1JF2A 3HCMA 1N2DA 3KO0A 1ZUZA 2I7AA 3OX6A 1TCFA 2JRFA 2WNDA 4XJKB 1KFUS 3CR5X 3KEVA 2E6WA 2MA2A 3BOWA 1B1GA 2M7LA 1AJ4A 1KSMA 1UHKA 1E8AA 1WY9A 3EKJA 4DRWA 1QX5B 4BY5A 1UP5A 2LE9B 3PN7B 4NDDA 1NX3A 4XYNA 3NSKA 4A4CA 3SG5A 3BYAA 1V1FA 4YGCB 2OTGC 1SRAA 2AAOA 5TNCA 4DIRA 3VGOA 1NWDA 2WC8A 3I5HC 1XFYO 3DVMA 1CKKA 1M45A 1B7TY 3O2PA 4JWQA 1EL4A 1PRWA 1HQVA 3RLZA 1ALVA 1KWOC 2G9BA 2NZ0A 2AMIA 2BKIB 2WOSA 1FPWA 2M29A 1F71A 5PALA 1QXPA 4YGDB 3HX4A 1CDLA 3OB1B 5JOLA 4CPVA 1W7IB 1XFWO 4PE0A 4L9MA 2K2FA 1KK8C 1DJHA 3GK2A 3PM8A 2OTGB 1Y1XA 1BR4B 2QPTA 3EVRA 1ZFSA 1A75B 3I5HB 3NXAA 4YBHB 2KNEA 4HRGA 3PLFB 2LANA 5KU1A 1KWOB 2KI6D 1WRLA 1CNPA 2KFHA 2QACA 2MAZA 4CFRA 5KTYA 1DT7B 3BUWB 1R6PA 2LMVA 4PE1A 1YUTA 4UPGA 1RECA 1PK0D 5HLVA 3NSLA 1KK8B 1DJIA 2CCMA 1S3PA 2LUXA 4YI9A 4OV2A 2MJWB 1K90D 2SCPA 2L0PA 2KGRA 5I2QA 1K96A 4PE4A 4PHKA 1FI6A 2KFGA 2KYFA 1UHHA 3SG4A 3WHTB 1S6JA 3DD4A 1G4YR 4AQIA 1J7OA 1S26D 2K7BA 4MRYA 1NX0A 1PVBA 4XJKA 2JWWA 1FW4A 2LHLA 3DVEA 1RTP1 1IWQA 1G8IA 2KGBC 4N5XA 1MHOA 2CBLA 1OE9B 1ZOTB 4GNKB 2VRGA 1GGWA 4WQ2A 5CPVA 4GFTA 1RFJA 1TNXA 3FIAA 2A4JA 1JC2A 1RJVA 3EVUA 4I5LB 3AKAA 1W7JB 2WCEA 2F2OA 2I18A 5CSJA 4DUQA 3DVJA 1DJWA 5AERA 1TNPA 2KOTA 3ZWHA 1DJGA 4PDZA 4WRIA 2ISDA 1B8LA 3IF7A 2K7OA 5ER5A 5I2LA 1B7TZ 4CIDA 5HKYA 2NXQA 3NSOA 1QVIY 2KAXA 4A4BA 1XA5A 4NQGA 1EXRA 3GK1A 1K9UA 3AAJA 1CB1A 2JOJA 2BBMA 4GBAA 3A8RA 3BUMB 5DKQA 1KFUL 1BJFA 2MLFC 1F55A 1ALWA 1JWDA 3IQQA 4MSPA 5HKWA 3NSIA 1A75A 1U5IB 1YX8A 2Q4UA 1K8UA 3CR4X 3PN7C 1GQMA 4ZCUA 2JTTA 1DMOA 2F8PA 4ZCVA 1ODBA 1KK7Z 2D8NA 2BL0C 2H2KA 2K2AA 1ZMZA 2KAYA 1UHJA 1CFDA 1D1OA 2K7CA 2M3WA 2KI4C 1NX1A 1NYAA 4FTGA 1OOJA 1QASA 2PALA 4P5OE 1CTRA 1DJYA 1AVSA 2K8MB 2LMTA 2ZKMX 4MEWA 1H4BA 1YX7A 1OSAA 2SASA 3BXKA 2BCXA 2LNKA 4HREE 1B4CA 1SBJA 4OR9B 1WDCC 1SL8A 2NCOA 1B8CA 1PSBA 4MZLA 2BCBA 5F6TA 4PE7A 4JPZB 1K2HA 1UWOA 2G2BA 3JVTC 5D7FA 1AUIB 1OMDA 2BL0B 2LC5A 3I5IC 1NSHA 3AKBA 1J7QA 2KI4B 1BG1A 1UHNA 1B47A 1XYDA 3GK4X 2BE4A 5CSNA 1F54A 2BE6A 2Y4QA 2F33A 1UURA 3SG3A 1TCOB 2JNFA 2LVIA 1CDMA 1Q80A 1YRTB 1A03A 1WDCB 4QJ4B 2M8UA 1EJ3A 2F3YA 1SK6D 4WQ3A 2ZRSA 1OZOA 1TOPA 2EC6C 1QLKA 3C1VA 1BR1B 1LA0A 3JVTB 3WXAA 1M63B 2LVVA 3I5IB 4ORAB 1AP4A 4I5NB 1VRKA 1YUUA 2LV7A 2M7NA 1S5GZ 4C0JA 4ORBB 2Y1MA 1KSOA 5JJGA 2LVJA 2V53A 2HPSA 2K0JA 1QTXA 2KDHA 3KPXA 2WORA 2RGIA 2LP3A 4YGAA 1M39A 3SIAA 4DS7A 1TNWA 1YTZC 1LVCD 4PHJA
chains in the Genus database with same CATH superfamily
2HF5A 2F2PA 3BQ3A 1WLMA 1CMFA 1DTLA 2EC6B 3IQOA 4ETOA 1Y6WA 1F8HA 4E68A 4MZJA 2JQ6A 2NCPA 4NDBA 1QX7A 5HKZA 1U5IA 3O78A 4F7FA 1IRJA 2JT8A 2K60A 4MBEA 2Y1NA 4MN0A 2HQWA 4PCWA 3BUOB 2KLEA 2F3ZA 5G08A 2MRDA 5AFPA 1LA3A 5D69A 2O5GA 4TNCA 2JXCA 3F45A 5KSZA 1OOGA 2LP2A 1EH2A 2KLDA 1QIVA 3M0WA 4JQ0D 1TWOA 1BU3A 1GGZA 2K7DA 2L4HA 2JPTA 5GQQC 2LUCA 5CSFA 3EVVA 4PALA 2I94A 1KFXS 1MXEA 3NHTA 4I5JA 2BNXA 4I5KA 3VRNA 4JD9A 1K9KA 5AEQA 2KBIA 1JF0A 1TN4A 1CFFA 1WRZA 4Q04A 1XFZO 5IBWA 3PATA 4DCKA 4F0ZB 3O4XA 1OOHA 2QDIA 3L4LA 2P6BB 3RZSA 1LXFC 3TDIA 1FF1A 2BCAA 3ICBA 1OQPA 2M9GA 3VROA 2M49B 1CLMA 1Y0VH 2JXLA 2L5XB 1J7PA 1IGVA 1NCYA 3UO9A 2ZNDA 4CLNA 2FCEA 1XFVO 2WC5A 3FS7A 3JTDB 3PFVA 4PHNA 4N1GA 3PALA 4U8DA 5I8NA 1KCYA 1CLBA 3A4UB 3D76A 1F4QA 4GPLB 3Q8IA 2M97A 1HT9A 2P70A 3LK1A 1IKUA 1J1DA 2JU0A 1QIWA 3CS1A 3KF9A 2GGMA 2COLB 1TUZA 1MUXA 2KBMA 2PASA 2HETA 1CFPA 1RROA 2LAPA 1BF5A 1NCZA 3R1VA 1NIWA 1FI5A 1QATA 3FWCA 2MLEC 2L50A 2O60A 2LCPA 1EG3A 2M0RA 3TS5C 1IQ5A 1QLSA 4OZDA 2CT9A 1AK8A 4IL1A 2JZIA 2OPOA 3B6XA 1DGVA 3CR2A 3O4YA 1JFJA 4M2PA 4USLA 1QX2A 2JNXA 4HRHA 2CXJA 1S6IA 2KI6C 3DY9A 3I5GC 4D1EA 3EK4A 2B1UA 1C07A 1M31A 1C7WA 1OZSA 1P28A 5HYDA 2WCBA 1V1GA 5B8IB 3FE6A 1CM1A 1JUOA 3OHMB 3EK8A 4C0KA 2KAVA 1QWVA 2YGUA 1J1EA 2MHHA 2GGZA 2JC2A 1CFCA 2JTZA 3CTNA 3TS5B 1TTXA 2JPOA 3D10A 2ZFDA 2WCMA 1BODA 1CDNA 3LK0A 1W9ZA 2KHNA 5BPJA 1K95A 1XK4A 3OGNA 3CYZA 4M2QA 1PVAA 2LMUA 1UHIA 1MXLC 2ZN8A 1DVIA 1SW8A 1RK9A 1N0YA 4MZKA 3I5GB 1J7RA 3D0YB 3TUYC 2BBNA 1QS7A 4QJ3B 5FI2A 3R1PA 4YGEB 1NP8A 2K61A 1QV1A 2PQLA 4QJ5B 5I2OA 2AUCA 1JSAA 4PHMA 1GJYA 3TDZA 3S0GA 1SL9A 2FOTA 1K94A 3TZ1A 1UUSA 1SCMC 3H4SE 1C3ZA 1CDPA 2L4IA 2LVKA 1L2OC 2ZN9A 4GUKA 3PSRA 2JULA 1SR6C 1XFUO 1CMGA 3CLNA 3DF0A 2EHBA 3WHUB 2HQ8A 2DOQA 2L2EA 4MLWA 4CFQA 3KHEA 3I5FC 2M1KB 4GGFA 3TUYB 1TRFA 2KSPA 1SSEB 3CGAA 1DJXA 1NPQA 2BAPA 1L7ZA 4IJ7A 2WCHA 1DF0B 1A2XA 1R2UA 1XK4C 2I2RE 3CZ0A 3S0AA 3EKHA 1QVIZ 1C3YA 3RM1A 1SCMB 2L51A 3E3RA 3VRQA 1LKJA 5I94A 1L2OB 1IH0A 4INWA 4M2OA 1H8BA 1K9PA 1SR6B 2H61A 3SJSA 4AOMA 1NCXA 1YR5A 1NX2A 5DKRA 1KFXL 1KK7Y 3AAKA 1SKTA 3I5FB 2FCDA 1CM4A 2KQ6A 2R2IA 4P2YB 2EGDA 1PSRA 1OOFA 1PULA 2OS8C 3LCPC 1YVLA 2PMYA 2PSRA 4MVFA 3SS4A 3FWBA 3D77A 5CSIA 3BFHA 1NUBA 2ZNEA 2E30A 1IG5A 5ER4X 2JT3A 1TIZA 4YGBB 4ICBA 1B8RA 1T14A 1J55A 1AHRA 2KFFA 2WCFA 4GGFC 3SG2A 5K89A 3BOWB 3D75A 3LLEA 2LLSA 1IQ3A 3JTDC 3VRPA 5AANA 1SY9A 4MRXA 4GGNA 3CWGA 1MQ1A 2PVBA 4YRUA 4N1FA 2GV5A 3CZ2A 3ZNIA 4OVNF 5AXIA 2MBXA 1IJ6A 1WRKA 1SNLA 3CZTX 4FQOA 1G33A 2M1UA 1QJTA 2OS8B 2TN4A 2WCJA 1Y1AA 3BUXB 1C7VA 2FJYA 2Q91A 1JFKA 2H61C 2JT0A 1XO5A 3DF0B 3K21A 3DVKA 1B9AA 1DGUA 2LM5A 1YVHA 3D0YA 1SYMA 4OCIA 2PRUA 1TNQA 3BFAA 3QRXA 1OMVA 4BY4A 3SIBA 1XFXO 1PALA 4HSZA 3DYEA 1GM0A 1S1EA 1F70A 4ORCB 1SPYA 5HLOA 5FYXA 4AQJA 2KYCA 1JBAA 1SCVA 1OMRA 2BECA 1S36A 4GAOA 1A4PA 1DELA 2ZRTA 2LLTA 1FBVA 1BMOA 1S5GY 1Z2CB 2CNPA 3SS3A 3VRRA 2LHIA 2NLNA 3OBVA 1EG4A 3SG6A 1M46A 1KQMC 2LLUA 3TDUA 1BT6A 2CTNA 1IJ5A 1QV0A 1YURA 2L98A 1X02A 1XVJA 1N65A 1K93D 2KQYA 1AJ5A 1F4OA 1MR8A 5EL2A 1DJZA 1SL7A 3OX5A 1CLLA 4YI8A 3OB2B 1DF0A 4OKHA 1TUJA 1Y1UA 2BKHB 3NGVA 1WLZA 1MWNA 1SMGA 1YUSA 3BUNB 4R1EA 3WNXB 2Y5IA 4NDCA 1S6CA 3MSEB 3SG7A 5D3OA 1LINA 2WCKA 3OP0A 3FE9A 2L2CA 3O6BA 1KQVA 1ZACA 5DKNA 3EK7A 1MF8B 1KQMB 1BOCA 3LL8B 3S0EA 1RWYA 3GOFA 1A29A 2FJUB 2IS9A 4C0LA 5J3XA 1YRUB 1Z4HA 1BLQA 1JF2A 3HCMA 1N2DA 3KO0A 1ZUZA 2I7AA 3OX6A 1TCFA 2JRFA 2WNDA 4XJKB 1KFUS 3CR5X 3KEVA 2E6WA 3PJIA 2MA2A 3BOWA 1B1GA 1IIOA 2M7LA 1AJ4A 1KSMA 1UHKA 1E8AA 1WY9A 3EKJA 3QMEA 4KYNA 4DRWA 1QX5B 4BY5A 1UP5A 2WC6A 2LE9B 3DXLA 1DC1A 3PN7B 4NDDA 1NX3A 2H8VA 2KPHA 3B87A 3NSKA 4XYNA 4A4CA 3SG5A 3PM2A 3DZTA 3BYAA 3S0DA 1V1FA 4YGCB 2OTGC 5FI6A 1SRAA 1XFRA 2AAOA 5TNCA 4DIRA 3VGOA 3D78A 1NWDA 2WC8A 3I5HC 1XFYO 3DVMA 3N7HA 1M45A 1B7TY 1CKKA 2QEHA 3O2PA 1EL4A 4JWQA 1PRWA 1HQVA 3RLZA 1ALVA 3R72A 1KWOC 2QEOA 2G9BA 2NZ0A 2AMIA 2BKIB 2WOSA 1FPWA 2M29A 1F71A 5PALA 1QXPA 4YGDB 3B86A 3HX4A 3L47A 1CDLA 3OB1B 5JOLA 4CPVA 1W7IB 1XFWO 4PE0A 4L9MA 2K2FA 1KK8C 1DJHA 3GK2A 3PM8A 2OTGB 1Y1XA 1BR4B 1OW4A 2QPTA 3EG5B 3K1EA 3B88A 3EVRA 1ZFSA 1A75B 3I5HB 3NXAA 4YBHB 2KNEA 4HRGA 1LS8A 3PLFB 2LANA 5KU1A 1KWOB 2KI6D 1WRLA 4INXA 1CNPA 2KFHA 2QACA 2MAZA 4CFRA 5KTYA 1DT7B 3BUWB 1R6PA 2LMVA 3L4AA 1YUTA 1DEKA 4PE1A 4UPGA 1RECA 1PK0D 5HLVA 3NSLA 4JKTA 1KK8B 1DJIA 1ORGA 2CCMA 1S3PA 2LUXA 4YI9A 4OV2A 2MJWB 1K90D 2SCPA 3D73A 3D74A 2L0PA 2KGRA 5I2QA 3CABA 1K96A 4PE4A 4PHKA 3S0BA 1FI6A 2KFGA 2KYFA 1UHHA 3SG4A 3WHTB 1S6JA 3DD4A 1G4YR 4AQIA 1J7OA 1S26D 2K7BA 4MRYA 3VB1A 1NX0A 1PVBA 4XJKA 2JWWA 1FW4A 2LHLA 3DVEA 1RTP1 1IWQA 1G8IA 2KGBC 4N5XA 1MHOA 2CBLA 1OE9B 1ZOTB 4GNKB 2VRGA 1GGWA 4WQ2A 5CPVA 4GFTA 1RFJA 1TNXA 3FIAA 2A4JA 1JC2A 1RJVA 3EVUA 4I5LB 3AKAA 1DQEA 1W7JB 2WCEA 2F2OA 2I18A 5CSJA 4DUQA 3DVJA 1DJWA 5AERA 1TNPA 2KOTA 3ZWHA 1DJGA 2WCLA 4PDZA 4WRIA 1B8LA 2PYQA 2ISDA 3IF7A 2K7OA 5ER5A 5I2LA 4ZCVA 5DICA 1B7TZ 4CIDA 2ERBA 5HKYA 2NXQA 3NSOA 1QVIY 2KAXA 4A4BA 1XA5A 4NQGA 1EXRA 3GK1A 1K9UA 3AAJA 1CB1A 2JOJA 2BBMA 3BFBA 4GBAA 3A8RA 3IVTA 3BUMB 5DKQA 1KFUL 1BJFA 2MLFC 1F55A 1ALWA 3CZ1A 1JWDA 3IQQA 4MSPA 5HKWA 3NSIA 1A75A 1U5IB 1YX8A 2Q4UA 3UNWA 1K8UA 4FQTA 3CR4X 3PN7C 1GQMA 4ZCUA 2JTTA 1DMOA 2F8PA 3NHIA 1ODBA 1KK7Z 2D8NA 2BL0C 2H2KA 2K2AA 1ZMZA 2KAYA 1UHJA 3BJHA 1CFDA 1D1OA 2K7CA 2M3WA 2KI4C 1NX1A 1NYAA 4FTGA 1OOJA 1QASA 2PALA 4P5OE 3FE8A 1CTRA 1DJYA 1AVSA 2K8MB 2LMTA 2ZKMX 4MEWA 1H4BA 1YX7A 1OSAA 2SASA 3BXKA 3CDNA 2BCXA 2LNKA 4HREE 1B4CA 1SBJA 4OR9B 1WDCC 1SL8A 2NCOA 1B8CA 1PSBA 4MZLA 2BCBA 5F6TA 4PE7A 4JPZB 1K2HA 1UWOA 2G2BA 2QEVA 3JVTC 5D7FA 1AUIB 1OMDA 2BL0B 2LC5A 3I5IC 1NSHA 3AKBA 1J7QA 2KI4B 1BG1A 1UHNA 1B47A 1XYDA 3GK4X 2BE4A 2QEBA 5CSNA 1F54A 2BE6A 2Y4QA 2F33A 3R1OA 1UURA 3SG3A 1TCOB 2JNFA 2LVIA 1CDMA 1Q80A 1YRTB 1A03A 1WDCB 4QJ4B 2M8UA 1EJ3A 2F3YA 1SK6D 3B7AA 4WQ3A 2ZRSA 1OZOA 1TOPA 2EC6C 1QLKA 3C1VA 1BR1B 3SS5A 1LA0A 3JVTB 2P71A 3WXAA 1M63B 2GTEA 2LVVA 3I5IB 4ORAB 1OOIX 4I5NB 1AP4A 1VRKA 1YUUA 2LV7A 2M7NA 1S5GZ 4C0JA 3S0FA 4ORBB 2Y1MA 1KSOA 3V2LA 5JJGA 2LVJA 2V53A 2HPSA 2K0JA 1QTXA 2KDHA 3KPXA 2WORA 2RGIA 5HL1A 4PT1A 2LP3A 5FI7A 4YGAA 1M39A 3SIAA 4DS7A 1TNWA 1YTZC 1LVCD 2L5YA 4PHJA
chains in the Genus database with same CATH topology
2HF5A 2F2PA 3BQ3A 1WLMA 1CMFA 1DTLA 2EC6B 3IQOA 4ETOA 1Y6WA 1F8HA 4E68A 4MZJA 2JQ6A 2NCPA 4NDBA 1QX7A 5HKZA 1U5IA 3O78A 1IRJA 2JT8A 4MBEA 2Y1NA 4MN0A 2HQWA 4PCWA 3BUOB 2F3ZA 5G08A 2MRDA 5AFPA 1LA3A 5D69A 2O5GA 4TNCA 2JXCA 3F45A 5KSZA 2LP2A 1EH2A 1QIVA 3M0WA 4JQ0D 1BU3A 1GGZA 2K7DA 2L4HA 2JPTA 5GQQC 2LUCA 5CSFA 3EVVA 4PALA 2I94A 1KFXS 1MXEA 4I5JA 4I5KA 3VRNA 1K9KA 5AEQA 2KBIA 1JF0A 1TN4A 1CFFA 1WRZA 4Q04A 1XFZO 5IBWA 3PATA 4DCKA 4F0ZB 2P6BB 1LXFC 3TDIA 1FF1A 2BCAA 3ICBA 1OQPA 2M9GA 3VROA 2M49B 1CLMA 1Y0VH 2JXLA 2L5XB 1J7PA 1IGVA 1NCYA 2ZNDA 4CLNA 2FCEA 1XFVO 3FS7A 3PFVA 3JTDB 4PHNA 4N1GA 3PALA 4U8DA 5I8NA 1KCYA 1CLBA 3A4UB 1F4QA 4GPLB 2M97A 1HT9A 3LK1A 1IKUA 1J1DA 2JU0A 1QIWA 3CS1A 3KF9A 2GGMA 2COLB 1MUXA 2KBMA 2PASA 2HETA 1CFPA 1RROA 2LAPA 1BF5A 1NCZA 1NIWA 1FI5A 1QATA 3FWCA 2MLEC 2L50A 2O60A 2LCPA 1EG3A 2M0RA 3TS5C 1IQ5A 1QLSA 2CT9A 1AK8A 4IL1A 2JZIA 2OPOA 3CR2A 1DGVA 3O4YA 1JFJA 4M2PA 4USLA 1QX2A 2JNXA 4HRHA 2CXJA 1S6IA 2KI6C 3I5GC 4D1EA 3EK4A 2B1UA 1C07A 1M31A 1C7WA 1OZSA 5HYDA 2WCBA 1V1GA 5B8IB 1CM1A 1JUOA 3OHMB 3EK8A 4C0KA 2KAVA 1J1EA 2MHHA 2GGZA 2JC2A 1CFCA 2JTZA 3CTNA 3TS5B 1TTXA 3D10A 2ZFDA 1BODA 1CDNA 3LK0A 2KHNA 5BPJA 1K95A 1XK4A 4M2QA 1PVAA 2LMUA 1UHIA 1MXLC 2ZN8A 1DVIA 1SW8A 1RK9A 1N0YA 4MZKA 3I5GB 1J7RA 3D0YB 3TUYC 2BBNA 1QS7A 4QJ3B 4YGEB 1NP8A 2K61A 1QV1A 4QJ5B 5I2OA 2AUCA 1JSAA 4PHMA 1GJYA 3TDZA 1SL9A 2FOTA 1K94A 3TZ1A 1UUSA 1SCMC 3H4SE 1CDPA 2L4IA 2LVKA 1L2OC 2ZN9A 4GUKA 3PSRA 2JULA 1SR6C 1XFUO 1CMGA 3CLNA 3DF0A 2EHBA 3WHUB 2HQ8A 2DOQA 2L2EA 4MLWA 4CFQA 3KHEA 3I5FC 2M1KB 4GGFA 3TUYB 1TRFA 2KSPA 3CGAA 1DJXA 1NPQA 1L7ZA 1DF0B 1A2XA 1R2UA 1XK4C 2I2RE 3EKHA 1QVIZ 3RM1A 1SCMB 2L51A 3E3RA 3VRQA 1LKJA 1L2OB 1IH0A 4M2OA 1H8BA 1K9PA 1SR6B 2H61A 3SJSA 4AOMA 1NCXA 1YR5A 1NX2A 5DKRA 1KFXL 1KK7Y 3AAKA 1SKTA 3I5FB 2FCDA 1CM4A 2KQ6A 2R2IA 4P2YB 2EGDA 1PSRA 1PULA 2OS8C 3LCPC 1YVLA 2PMYA 2PSRA 4MVFA 3FWBA 5CSIA 1NUBA 2ZNEA 2E30A 1IG5A 5ER4X 2JT3A 1TIZA 4YGBB 4ICBA 1B8RA 1J55A 1AHRA 2KFFA 2WCFA 4GGFC 3SG2A 5K89A 3BOWB 3LLEA 2LLSA 1IQ3A 3JTDC 3VRPA 5AANA 1SY9A 4MRXA 4GGNA 3CWGA 1MQ1A 2PVBA 4YRUA 4N1FA 2GV5A 3ZNIA 4OVNF 5AXIA 2MBXA 1IJ6A 1WRKA 1SNLA 3CZTX 4FQOA 1G33A 2M1UA 1QJTA 2OS8B 2TN4A 3BUXB 1Y1AA 1C7VA 2Q91A 1JFKA 2H61C 2JT0A 1XO5A 3DF0B 3K21A 3DVKA 1B9AA 1DGUA 2LM5A 1YVHA 3D0YA 1SYMA 4OCIA 2PRUA 1TNQA 3QRXA 1OMVA 4BY4A 3SIBA 1XFXO 1PALA 4HSZA 1S1EA 1F70A 4ORCB 1SPYA 5HLOA 5FYXA 4AQJA 2KYCA 1JBAA 1SCVA 1OMRA 2BECA 1S36A 4GAOA 1A4PA 2ZRTA 2LLTA 1FBVA 1BMOA 1S5GY 2CNPA 3VRRA 2LHIA 2NLNA 3SG6A 1EG4A 1M46A 1KQMC 2LLUA 3TDUA 1BT6A 2CTNA 1IJ5A 1QV0A 1YURA 2L98A 1X02A 1XVJA 1N65A 1K93D 2KQYA 1AJ5A 1F4OA 1MR8A 1DJZA 1SL7A 3OX5A 1CLLA 4YI8A 3OB2B 1DF0A 4OKHA 1Y1UA 2BKHB 1WLZA 1MWNA 1SMGA 1YUSA 3BUNB 4R1EA 3WNXB 2Y5IA 4NDCA 1S6CA 3MSEB 3SG7A 1LINA 3OP0A 3O6BA 1KQVA 1ZACA 5DKNA 3EK7A 1MF8B 1KQMB 1BOCA 3LL8B 1RWYA 3GOFA 1A29A 2FJUB 2IS9A 4C0LA 5J3XA 1YRUB 1BLQA 1JF2A 3HCMA 1N2DA 3KO0A 1ZUZA 2I7AA 3OX6A 1TCFA 2JRFA 2WNDA 4XJKB 1KFUS 3CR5X 3KEVA 2E6WA 2MA2A 3BOWA 1B1GA 2M7LA 1AJ4A 1KSMA 1UHKA 1E8AA 1WY9A 3EKJA 4DRWA 1QX5B 4BY5A 1UP5A 2LE9B 3PN7B 4NDDA 1NX3A 4XYNA 3NSKA 4A4CA 3SG5A 3BYAA 1V1FA 4YGCB 2OTGC 1SRAA 2AAOA 5TNCA 4DIRA 3VGOA 1NWDA 2WC8A 3I5HC 1XFYO 3DVMA 1CKKA 1M45A 1B7TY 3O2PA 4JWQA 1EL4A 1PRWA 1HQVA 3RLZA 1ALVA 1KWOC 2G9BA 2NZ0A 2AMIA 2BKIB 2WOSA 1FPWA 2M29A 1F71A 5PALA 1QXPA 4YGDB 3HX4A 1CDLA 3OB1B 5JOLA 4CPVA 1W7IB 1XFWO 4PE0A 4L9MA 2K2FA 1KK8C 1DJHA 3GK2A 3PM8A 2OTGB 1Y1XA 1BR4B 2QPTA 3EVRA 1ZFSA 1A75B 3I5HB 3NXAA 4YBHB 2KNEA 4HRGA 3PLFB 2LANA 5KU1A 1KWOB 2KI6D 1WRLA 1CNPA 2KFHA 2QACA 2MAZA 4CFRA 5KTYA 1DT7B 3BUWB 1R6PA 2LMVA 4PE1A 1YUTA 4UPGA 1RECA 1PK0D 5HLVA 3NSLA 1KK8B 1DJIA 2CCMA 1S3PA 2LUXA 4YI9A 4OV2A 2MJWB 1K90D 2SCPA 2L0PA 2KGRA 5I2QA 1K96A 4PE4A 4PHKA 1FI6A 2KFGA 2KYFA 1UHHA 3SG4A 3WHTB 1S6JA 3DD4A 1G4YR 4AQIA 1J7OA 1S26D 2K7BA 4MRYA 1NX0A 1PVBA 4XJKA 2JWWA 1FW4A 2LHLA 3DVEA 1RTP1 1IWQA 1G8IA 2KGBC 4N5XA 1MHOA 2CBLA 1OE9B 1ZOTB 4GNKB 2VRGA 1GGWA 4WQ2A 5CPVA 4GFTA 1RFJA 1TNXA 3FIAA 2A4JA 1JC2A 1RJVA 3EVUA 4I5LB 3AKAA 1W7JB 2WCEA 2F2OA 2I18A 5CSJA 4DUQA 3DVJA 1DJWA 5AERA 1TNPA 2KOTA 3ZWHA 1DJGA 4PDZA 4WRIA 2ISDA 1B8LA 3IF7A 2K7OA 5ER5A 5I2LA 1B7TZ 4CIDA 5HKYA 2NXQA 3NSOA 1QVIY 2KAXA 4A4BA 1XA5A 4NQGA 1EXRA 3GK1A 1K9UA 3AAJA 1CB1A 2JOJA 2BBMA 4GBAA 3A8RA 3BUMB 5DKQA 1KFUL 1BJFA 2MLFC 1F55A 1ALWA 1JWDA 3IQQA 4MSPA 5HKWA 3NSIA 1A75A 1U5IB 1YX8A 2Q4UA 1K8UA 3CR4X 3PN7C 1GQMA 4ZCUA 2JTTA 1DMOA 2F8PA 4ZCVA 1ODBA 1KK7Z 2D8NA 2BL0C 2H2KA 2K2AA 1ZMZA 2KAYA 1UHJA 1CFDA 1D1OA 2K7CA 2M3WA 2KI4C 1NX1A 1NYAA 4FTGA 1OOJA 1QASA 2PALA 4P5OE 1CTRA 1DJYA 1AVSA 2K8MB 2LMTA 2ZKMX 4MEWA 1H4BA 1YX7A 1OSAA 2SASA 3BXKA 2BCXA 2LNKA 4HREE 1B4CA 1SBJA 4OR9B 1WDCC 1SL8A 2NCOA 1B8CA 1PSBA 4MZLA 2BCBA 5F6TA 4PE7A 4JPZB 1K2HA 1UWOA 2G2BA 3JVTC 5D7FA 1AUIB 1OMDA 2BL0B 2LC5A 3I5IC 1NSHA 3AKBA 1J7QA 2KI4B 1BG1A 1UHNA 1B47A 1XYDA 3GK4X 2BE4A 5CSNA 1F54A 2BE6A 2Y4QA 2F33A 1UURA 3SG3A 1TCOB 2JNFA 2LVIA 1CDMA 1Q80A 1YRTB 1A03A 1WDCB 4QJ4B 2M8UA 1EJ3A 2F3YA 1SK6D 4WQ3A 2ZRSA 1OZOA 1TOPA 2EC6C 1QLKA 3C1VA 1BR1B 1LA0A 3JVTB 3WXAA 1M63B 2LVVA 3I5IB 4ORAB 1AP4A 4I5NB 1VRKA 1YUUA 2LV7A 2M7NA 1S5GZ 4C0JA 4ORBB 2Y1MA 1KSOA 5JJGA 2LVJA 2V53A 2HPSA 2K0JA 1QTXA 2KDHA 3KPXA 2WORA 2RGIA 2LP3A 4YGAA 1M39A 3SIAA 4DS7A 1TNWA 1YTZC 1LVCD 4PHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF5 A;  2F2P A;  3BQ3 A;  1WLM A;  1CMF A;  1DTL A;  2EC6 B;  3IQO A;  4ETO A;  1Y6W A;  1F8H A;  4E68 A;  4MZJ A;  2JQ6 A;  2NCP A;  4NDB A;  1QX7 A;  5HKZ A;  1U5I A;  3O78 A;  1IRJ A;  2JT8 A;  4MBE A;  2Y1N A;  4MN0 A;  2HQW A;  4PCW A;  3BUO B;  2F3Z A;  5G08 A;  2MRD A;  5AFP A;  1LA3 A;  5D69 A;  2O5G A;  4TNC A;  2JXC A;  3F45 A;  5KSZ A;  2LP2 A;  1EH2 A;  1QIV A;  3M0W A;  4JQ0 D;  1BU3 A;  1GGZ A;  2K7D A;  2L4H A;  2JPT A;  5GQQ C;  2LUC A;  5CSF A;  3EVV A;  4PAL A;  2I94 A;  1KFX S;  1MXE A;  4I5J A;  4I5K A;  3VRN A;  1K9K A;  5AEQ A;  2KBI A;  1JF0 A;  1TN4 A;  1CFF A;  1WRZ A;  4Q04 A;  1XFZ O;  5IBW A;  3PAT A;  4DCK A;  4F0Z B;  2P6B B;  1LXF C;  3TDI A;  1FF1 A;  2BCA A;  3ICB A;  1OQP A;  2M9G A;  3VRO A;  2M49 B;  1CLM A;  1Y0V H;  2JXL A;  2L5X B;  1J7P A;  1IGV A;  1NCY A;  2ZND A;  4CLN A;  2FCE A;  1XFV O;  3FS7 A;  3PFV A;  3JTD B;  4PHN A;  4N1G A;  3PAL A;  4U8D A;  5I8N A;  1KCY A;  1CLB A;  3A4U B;  1F4Q A;  4GPL B;  2M97 A;  1HT9 A;  3LK1 A;  1IKU A;  1J1D A;  2JU0 A;  1QIW A;  3CS1 A;  3KF9 A;  2GGM A;  2COL B;  1MUX A;  2KBM A;  2PAS A;  2HET A;  1CFP A;  1RRO A;  2LAP A;  1BF5 A;  1NCZ A;  1NIW A;  1FI5 A;  1QAT A;  3FWC A;  2MLE C;  2L50 A;  2O60 A;  2LCP A;  1EG3 A;  2M0R A;  3TS5 C;  1IQ5 A;  1QLS A;  2CT9 A;  1AK8 A;  4IL1 A;  2JZI A;  2OPO A;  3CR2 A;  1DGV A;  3O4Y A;  1JFJ A;  4M2P A;  4USL A;  1QX2 A;  2JNX A;  4HRH A;  2CXJ A;  1S6I A;  2KI6 C;  3I5G C;  4D1E A;  3EK4 A;  2B1U A;  1C07 A;  1M31 A;  1C7W A;  1OZS A;  5HYD A;  2WCB A;  1V1G A;  5B8I B;  1CM1 A;  1JUO A;  3OHM B;  3EK8 A;  4C0K A;  2KAV A;  1J1E A;  2MHH A;  2GGZ A;  2JC2 A;  1CFC A;  2JTZ A;  3CTN A;  3TS5 B;  1TTX A;  3D10 A;  2ZFD A;  1BOD A;  1CDN A;  3LK0 A;  2KHN A;  5BPJ A;  1K95 A;  1XK4 A;  4M2Q A;  1PVA A;  2LMU A;  1UHI A;  1MXL C;  2ZN8 A;  1DVI A;  1SW8 A;  1RK9 A;  1N0Y A;  4MZK A;  3I5G B;  1J7R A;  3D0Y B;  3TUY C;  2BBN A;  1QS7 A;  4QJ3 B;  4YGE B;  1NP8 A;  2K61 A;  1QV1 A;  4QJ5 B;  5I2O A;  2AUC A;  1JSA A;  4PHM A;  1GJY A;  3TDZ A;  1SL9 A;  2FOT A;  1K94 A;  3TZ1 A;  1UUS A;  1SCM C;  3H4S E;  1CDP A;  2L4I A;  2LVK A;  1L2O C;  2ZN9 A;  4GUK A;  3PSR A;  2JUL A;  1SR6 C;  1XFU O;  1CMG A;  3CLN A;  3DF0 A;  2EHB A;  3WHU B;  2HQ8 A;  2DOQ A;  2L2E A;  4MLW A;  4CFQ A;  3KHE A;  3I5F C;  2M1K B;  4GGF A;  3TUY B;  1TRF A;  2KSP A;  3CGA A;  1DJX A;  1NPQ A;  1L7Z A;  1DF0 B;  1A2X A;  1R2U A;  1XK4 C;  2I2R E;  3EKH A;  1QVI Z;  3RM1 A;  1SCM B;  2L51 A;  3E3R A;  3VRQ A;  1LKJ A;  1L2O B;  1IH0 A;  4M2O A;  1H8B A;  1K9P A;  1SR6 B;  2H61 A;  3SJS A;  4AOM A;  1NCX A;  1YR5 A;  1NX2 A;  5DKR A;  1KFX L;  1KK7 Y;  3AAK A;  1SKT A;  3I5F B;  2FCD A;  1CM4 A;  2KQ6 A;  2R2I A;  4P2Y B;  2EGD A;  1PSR A;  1PUL A;  2OS8 C;  3LCP C;  1YVL A;  2PMY A;  2PSR A;  4MVF A;  3FWB A;  5CSI A;  1NUB A;  2ZNE A;  2E30 A;  1IG5 A;  5ER4 X;  2JT3 A;  1TIZ A;  4YGB B;  4ICB A;  1B8R A;  1J55 A;  1AHR A;  2KFF A;  2WCF A;  4GGF C;  3SG2 A;  5K89 A;  3BOW B;  3LLE A;  2LLS A;  1IQ3 A;  3JTD C;  3VRP A;  5AAN A;  1SY9 A;  4MRX A;  4GGN A;  3CWG A;  1MQ1 A;  2PVB A;  4YRU A;  4N1F A;  2GV5 A;  3ZNI A;  4OVN F;  5AXI A;  2MBX A;  1IJ6 A;  1WRK A;  1SNL A;  3CZT X;  4FQO A;  1G33 A;  2M1U A;  1QJT A;  2OS8 B;  2TN4 A;  3BUX B;  1Y1A A;  1C7V A;  2Q91 A;  1JFK A;  2H61 C;  2JT0 A;  1XO5 A;  3DF0 B;  3K21 A;  3DVK A;  1B9A A;  1DGU A;  2LM5 A;  1YVH A;  3D0Y A;  1SYM A;  4OCI A;  2PRU A;  1TNQ A;  3QRX A;  1OMV A;  4BY4 A;  3SIB A;  1XFX O;  1PAL A;  4HSZ A;  1S1E A;  1F70 A;  4ORC B;  1SPY A;  5HLO A;  5FYX A;  4AQJ A;  2KYC A;  1JBA A;  1SCV A;  1OMR A;  2BEC A;  1S36 A;  4GAO A;  1A4P A;  2ZRT A;  2LLT A;  1FBV A;  1BMO A;  1S5G Y;  2CNP A;  3VRR A;  2LHI A;  2NLN A;  3SG6 A;  1EG4 A;  1M46 A;  1KQM C;  2LLU A;  3TDU A;  1BT6 A;  2CTN A;  1IJ5 A;  1QV0 A;  1YUR A;  2L98 A;  1X02 A;  1XVJ A;  1N65 A;  1K93 D;  2KQY A;  1AJ5 A;  1F4O A;  1MR8 A;  1DJZ A;  1SL7 A;  3OX5 A;  1CLL A;  4YI8 A;  3OB2 B;  1DF0 A;  4OKH A;  1Y1U A;  2BKH B;  1WLZ A;  1MWN A;  1SMG A;  1YUS A;  3BUN B;  4R1E A;  3WNX B;  2Y5I A;  4NDC A;  1S6C A;  3MSE B;  3SG7 A;  1LIN A;  3OP0 A;  3O6B A;  1KQV A;  1ZAC A;  5DKN A;  3EK7 A;  1MF8 B;  1KQM B;  1BOC A;  3LL8 B;  1RWY A;  3GOF A;  1A29 A;  2FJU B;  2IS9 A;  4C0L A;  5J3X A;  1YRU B;  1BLQ A;  1JF2 A;  3HCM A;  1N2D A;  3KO0 A;  1ZUZ A;  2I7A A;  3OX6 A;  1TCF A;  2JRF A;  2WND A;  4XJK B;  1KFU S;  3CR5 X;  3KEV A;  2E6W A;  2MA2 A;  3BOW A;  1B1G A;  2M7L A;  1AJ4 A;  1KSM A;  1UHK A;  1E8A A;  1WY9 A;  3EKJ A;  4DRW A;  1QX5 B;  4BY5 A;  1UP5 A;  2LE9 B;  3PN7 B;  4NDD A;  1NX3 A;  4XYN A;  3NSK A;  4A4C A;  3SG5 A;  3BYA A;  1V1F A;  4YGC B;  2OTG C;  1SRA A;  2AAO A;  5TNC A;  4DIR A;  3VGO A;  1NWD A;  2WC8 A;  3I5H C;  1XFY O;  3DVM A;  1CKK A;  1M45 A;  1B7T Y;  3O2P A;  4JWQ A;  1EL4 A;  1PRW A;  1HQV A;  3RLZ A;  1ALV A;  1KWO C;  2G9B A;  2NZ0 A;  2AMI A;  2BKI B;  2WOS A;  1FPW A;  2M29 A;  1F71 A;  5PAL A;  1QXP A;  4YGD B;  3HX4 A;  1CDL A;  3OB1 B;  5JOL A;  4CPV A;  1W7I B;  1XFW O;  4PE0 A;  4L9M A;  2K2F A;  1KK8 C;  1DJH A;  3GK2 A;  3PM8 A;  2OTG B;  1Y1X A;  1BR4 B;  2QPT A;  3EVR A;  1ZFS A;  1A75 B;  3I5H B;  3NXA A;  4YBH B;  2KNE A;  4HRG A;  3PLF B;  2LAN A;  5KU1 A;  1KWO B;  2KI6 D;  1WRL A;  1CNP A;  2KFH A;  2QAC A;  2MAZ A;  4CFR A;  5KTY A;  1DT7 B;  3BUW B;  1R6P A;  2LMV A;  4PE1 A;  1YUT A;  4UPG A;  1REC A;  1PK0 D;  5HLV A;  3NSL A;  1KK8 B;  1DJI A;  2CCM A;  1S3P A;  2LUX A;  4YI9 A;  4OV2 A;  2MJW B;  1K90 D;  2SCP A;  2L0P A;  2KGR A;  5I2Q A;  1K96 A;  4PE4 A;  4PHK A;  1FI6 A;  2KFG A;  2KYF A;  1UHH A;  3SG4 A;  3WHT B;  1S6J A;  3DD4 A;  1G4Y R;  4AQI A;  1J7O A;  1S26 D;  2K7B A;  4MRY A;  1NX0 A;  1PVB A;  4XJK A;  2JWW A;  1FW4 A;  2LHL A;  3DVE A;  1RTP 1;  1IWQ A;  1G8I A;  2KGB C;  4N5X A;  1MHO A;  2CBL A;  1OE9 B;  1ZOT B;  4GNK B;  2VRG A;  1GGW A;  4WQ2 A;  5CPV A;  4GFT A;  1RFJ A;  1TNX A;  3FIA A;  2A4J A;  1JC2 A;  1RJV A;  3EVU A;  4I5L B;  3AKA A;  1W7J B;  2WCE A;  2F2O A;  2I18 A;  5CSJ A;  4DUQ A;  3DVJ A;  1DJW A;  5AER A;  1TNP A;  2KOT A;  3ZWH A;  1DJG A;  4PDZ A;  4WRI A;  2ISD A;  1B8L A;  3IF7 A;  2K7O A;  5ER5 A;  5I2L A;  1B7T Z;  4CID A;  5HKY A;  2NXQ A;  3NSO A;  1QVI Y;  2KAX A;  4A4B A;  1XA5 A;  4NQG A;  1EXR A;  3GK1 A;  1K9U A;  3AAJ A;  1CB1 A;  2JOJ A;  2BBM A;  4GBA A;  3A8R A;  3BUM B;  5DKQ A;  1KFU L;  1BJF A;  2MLF C;  1F55 A;  1ALW A;  1JWD A;  3IQQ A;  4MSP A;  5HKW A;  3NSI A;  1A75 A;  1U5I B;  1YX8 A;  2Q4U A;  1K8U A;  3CR4 X;  3PN7 C;  1GQM A;  4ZCU A;  2JTT A;  1DMO A;  2F8P A;  4ZCV A;  1ODB A;  1KK7 Z;  2D8N A;  2BL0 C;  2H2K A;  2K2A A;  1ZMZ A;  2KAY A;  1UHJ A;  1CFD A;  1D1O A;  2K7C A;  2M3W A;  2KI4 C;  1NX1 A;  1NYA A;  4FTG A;  1OOJ A;  1QAS A;  2PAL A;  4P5O E;  1CTR A;  1DJY A;  1AVS A;  2K8M B;  2LMT A;  2ZKM X;  4MEW A;  1H4B A;  1YX7 A;  1OSA A;  2SAS A;  3BXK A;  2BCX A;  2LNK A;  4HRE E;  1B4C A;  1SBJ A;  4OR9 B;  1WDC C;  1SL8 A;  2NCO A;  1B8C A;  1PSB A;  4MZL A;  2BCB A;  5F6T A;  4PE7 A;  4JPZ B;  1K2H A;  1UWO A;  2G2B A;  3JVT C;  5D7F A;  1AUI B;  1OMD A;  2BL0 B;  2LC5 A;  3I5I C;  1NSH A;  3AKB A;  1J7Q A;  2KI4 B;  1BG1 A;  1UHN A;  1B47 A;  1XYD A;  3GK4 X;  2BE4 A;  5CSN A;  1F54 A;  2BE6 A;  2Y4Q A;  2F33 A;  1UUR A;  3SG3 A;  1TCO B;  2JNF A;  2LVI A;  1CDM A;  1Q80 A;  1YRT B;  1A03 A;  1WDC B;  4QJ4 B;  2M8U A;  1EJ3 A;  2F3Y A;  1SK6 D;  4WQ3 A;  2ZRS A;  1OZO A;  1TOP A;  2EC6 C;  1QLK A;  3C1V A;  1BR1 B;  1LA0 A;  3JVT B;  3WXA A;  1M63 B;  2LVV A;  3I5I B;  4ORA B;  1AP4 A;  4I5N B;  1VRK A;  1YUU A;  2LV7 A;  2M7N A;  1S5G Z;  4C0J A;  4ORB B;  2Y1M A;  1KSO A;  5JJG A;  2LVJ A;  2V53 A;  2HPS A;  2K0J A;  1QTX A;  2KDH A;  3KPX A;  2WOR A;  2RGI A;  2LP3 A;  4YGA A;  1M39 A;  3SIA A;  4DS7 A;  1TNW A;  1YTZ C;  1LVC D;  4PHJ A; 
#chains in the Genus database with same CATH topology
 2HF5 A;  2F2P A;  3BQ3 A;  1WLM A;  1CMF A;  1DTL A;  2EC6 B;  3IQO A;  4ETO A;  1Y6W A;  1F8H A;  4E68 A;  4MZJ A;  2JQ6 A;  2NCP A;  4NDB A;  1QX7 A;  5HKZ A;  1U5I A;  3O78 A;  4F7F A;  1IRJ A;  2JT8 A;  2K60 A;  4MBE A;  2Y1N A;  4MN0 A;  2HQW A;  4PCW A;  3BUO B;  2KLE A;  2F3Z A;  5G08 A;  2MRD A;  5AFP A;  1LA3 A;  5D69 A;  2O5G A;  4TNC A;  2JXC A;  3F45 A;  5KSZ A;  1OOG A;  2LP2 A;  1EH2 A;  2KLD A;  1QIV A;  3M0W A;  4JQ0 D;  1TWO A;  1BU3 A;  1GGZ A;  2K7D A;  2L4H A;  2JPT A;  5GQQ C;  2LUC A;  5CSF A;  3EVV A;  4PAL A;  2I94 A;  1KFX S;  1MXE A;  3NHT A;  4I5J A;  2BNX A;  4I5K A;  3VRN A;  4JD9 A;  1K9K A;  5AEQ A;  2KBI A;  1JF0 A;  1TN4 A;  1CFF A;  1WRZ A;  4Q04 A;  1XFZ O;  5IBW A;  3PAT A;  4DCK A;  4F0Z B;  3O4X A;  1OOH A;  2QDI A;  3L4L A;  2P6B B;  3RZS A;  1LXF C;  3TDI A;  1FF1 A;  2BCA A;  3ICB A;  1OQP A;  2M9G A;  3VRO A;  2M49 B;  1CLM A;  1Y0V H;  2JXL A;  2L5X B;  1J7P A;  1IGV A;  1NCY A;  3UO9 A;  2ZND A;  4CLN A;  2FCE A;  1XFV O;  2WC5 A;  3FS7 A;  3JTD B;  3PFV A;  4PHN A;  4N1G A;  3PAL A;  4U8D A;  5I8N A;  1KCY A;  1CLB A;  3A4U B;  3D76 A;  1F4Q A;  4GPL B;  3Q8I A;  2M97 A;  1HT9 A;  2P70 A;  3LK1 A;  1IKU A;  1J1D A;  2JU0 A;  1QIW A;  3CS1 A;  3KF9 A;  2GGM A;  2COL B;  1TUZ A;  1MUX A;  2KBM A;  2PAS A;  2HET A;  1CFP A;  1RRO A;  2LAP A;  1BF5 A;  1NCZ A;  3R1V A;  1NIW A;  1FI5 A;  1QAT A;  3FWC A;  2MLE C;  2L50 A;  2O60 A;  2LCP A;  1EG3 A;  2M0R A;  3TS5 C;  1IQ5 A;  1QLS A;  4OZD A;  2CT9 A;  1AK8 A;  4IL1 A;  2JZI A;  2OPO A;  3B6X A;  1DGV A;  3CR2 A;  3O4Y A;  1JFJ A;  4M2P A;  4USL A;  1QX2 A;  2JNX A;  4HRH A;  2CXJ A;  1S6I A;  2KI6 C;  3DY9 A;  3I5G C;  4D1E A;  3EK4 A;  2B1U A;  1C07 A;  1M31 A;  1C7W A;  1OZS A;  1P28 A;  5HYD A;  2WCB A;  1V1G A;  5B8I B;  3FE6 A;  1CM1 A;  1JUO A;  3OHM B;  3EK8 A;  4C0K A;  2KAV A;  1QWV A;  2YGU A;  1J1E A;  2MHH A;  2GGZ A;  2JC2 A;  1CFC A;  2JTZ A;  3CTN A;  3TS5 B;  1TTX A;  2JPO A;  3D10 A;  2ZFD A;  2WCM A;  1BOD A;  1CDN A;  3LK0 A;  1W9Z A;  2KHN A;  5BPJ A;  1K95 A;  1XK4 A;  3OGN A;  3CYZ A;  4M2Q A;  1PVA A;  2LMU A;  1UHI A;  1MXL C;  2ZN8 A;  1DVI A;  1SW8 A;  1RK9 A;  1N0Y A;  4MZK A;  3I5G B;  1J7R A;  3D0Y B;  3TUY C;  2BBN A;  1QS7 A;  4QJ3 B;  5FI2 A;  3R1P A;  4YGE B;  1NP8 A;  2K61 A;  1QV1 A;  2PQL A;  4QJ5 B;  5I2O A;  2AUC A;  1JSA A;  4PHM A;  1GJY A;  3TDZ A;  3S0G A;  1SL9 A;  2FOT A;  1K94 A;  3TZ1 A;  1UUS A;  1SCM C;  3H4S E;  1C3Z A;  1CDP A;  2L4I A;  2LVK A;  1L2O C;  2ZN9 A;  4GUK A;  3PSR A;  2JUL A;  1SR6 C;  1XFU O;  1CMG A;  3CLN A;  3DF0 A;  2EHB A;  3WHU B;  2HQ8 A;  2DOQ A;  2L2E A;  4MLW A;  4CFQ A;  3KHE A;  3I5F C;  2M1K B;  4GGF A;  3TUY B;  1TRF A;  2KSP A;  1SSE B;  3CGA A;  1DJX A;  1NPQ A;  2BAP A;  1L7Z A;  4IJ7 A;  2WCH A;  1DF0 B;  1A2X A;  1R2U A;  1XK4 C;  2I2R E;  3CZ0 A;  3S0A A;  3EKH A;  1QVI Z;  1C3Y A;  3RM1 A;  1SCM B;  2L51 A;  3E3R A;  3VRQ A;  1LKJ A;  5I94 A;  1L2O B;  1IH0 A;  4INW A;  4M2O A;  1H8B A;  1K9P A;  1SR6 B;  2H61 A;  3SJS A;  4AOM A;  1NCX A;  1YR5 A;  1NX2 A;  5DKR A;  1KFX L;  1KK7 Y;  3AAK A;  1SKT A;  3I5F B;  2FCD A;  1CM4 A;  2KQ6 A;  2R2I A;  4P2Y B;  2EGD A;  1PSR A;  1OOF A;  1PUL A;  2OS8 C;  3LCP C;  1YVL A;  2PMY A;  2PSR A;  4MVF A;  3SS4 A;  3FWB A;  3D77 A;  5CSI A;  3BFH A;  1NUB A;  2ZNE A;  2E30 A;  1IG5 A;  5ER4 X;  2JT3 A;  1TIZ A;  4YGB B;  4ICB A;  1B8R A;  1T14 A;  1J55 A;  1AHR A;  2KFF A;  2WCF A;  4GGF C;  3SG2 A;  5K89 A;  3BOW B;  3D75 A;  3LLE A;  2LLS A;  1IQ3 A;  3JTD C;  3VRP A;  5AAN A;  1SY9 A;  4MRX A;  4GGN A;  3CWG A;  1MQ1 A;  2PVB A;  4YRU A;  4N1F A;  2GV5 A;  3CZ2 A;  3ZNI A;  4OVN F;  5AXI A;  2MBX A;  1IJ6 A;  1WRK A;  1SNL A;  3CZT X;  4FQO A;  1G33 A;  2M1U A;  1QJT A;  2OS8 B;  2TN4 A;  2WCJ A;  1Y1A A;  3BUX B;  1C7V A;  2FJY A;  2Q91 A;  1JFK A;  2H61 C;  2JT0 A;  1XO5 A;  3DF0 B;  3K21 A;  3DVK A;  1B9A A;  1DGU A;  2LM5 A;  1YVH A;  3D0Y A;  1SYM A;  4OCI A;  2PRU A;  1TNQ A;  3BFA A;  3QRX A;  1OMV A;  4BY4 A;  3SIB A;  1XFX O;  1PAL A;  4HSZ A;  3DYE A;  1GM0 A;  1S1E A;  1F70 A;  4ORC B;  1SPY A;  5HLO A;  5FYX A;  4AQJ A;  2KYC A;  1JBA A;  1SCV A;  1OMR A;  2BEC A;  1S36 A;  4GAO A;  1A4P A;  1DEL A;  2ZRT A;  2LLT A;  1FBV A;  1BMO A;  1S5G Y;  1Z2C B;  2CNP A;  3SS3 A;  3VRR A;  2LHI A;  2NLN A;  3OBV A;  1EG4 A;  3SG6 A;  1M46 A;  1KQM C;  2LLU A;  3TDU A;  1BT6 A;  2CTN A;  1IJ5 A;  1QV0 A;  1YUR A;  2L98 A;  1X02 A;  1XVJ A;  1N65 A;  1K93 D;  2KQY A;  1AJ5 A;  1F4O A;  1MR8 A;  5EL2 A;  1DJZ A;  1SL7 A;  3OX5 A;  1CLL A;  4YI8 A;  3OB2 B;  1DF0 A;  4OKH A;  1TUJ A;  1Y1U A;  2BKH B;  3NGV A;  1WLZ A;  1MWN A;  1SMG A;  1YUS A;  3BUN B;  4R1E A;  3WNX B;  2Y5I A;  4NDC A;  1S6C A;  3MSE B;  3SG7 A;  5D3O A;  1LIN A;  2WCK A;  3OP0 A;  3FE9 A;  2L2C A;  3O6B A;  1KQV A;  1ZAC A;  5DKN A;  3EK7 A;  1MF8 B;  1KQM B;  1BOC A;  3LL8 B;  3S0E A;  1RWY A;  3GOF A;  1A29 A;  2FJU B;  2IS9 A;  4C0L A;  5J3X A;  1YRU B;  1Z4H A;  1BLQ A;  1JF2 A;  3HCM A;  1N2D A;  3KO0 A;  1ZUZ A;  2I7A A;  3OX6 A;  1TCF A;  2JRF A;  2WND A;  4XJK B;  1KFU S;  3CR5 X;  3KEV A;  2E6W A;  3PJI A;  2MA2 A;  3BOW A;  1B1G A;  1IIO A;  2M7L A;  1AJ4 A;  1KSM A;  1UHK A;  1E8A A;  1WY9 A;  3EKJ A;  3QME A;  4KYN A;  4DRW A;  1QX5 B;  4BY5 A;  1UP5 A;  2WC6 A;  2LE9 B;  3DXL A;  1DC1 A;  3PN7 B;  4NDD A;  1NX3 A;  2H8V A;  2KPH A;  3B87 A;  3NSK A;  4XYN A;  4A4C A;  3SG5 A;  3PM2 A;  3DZT A;  3BYA A;  3S0D A;  1V1F A;  4YGC B;  2OTG C;  5FI6 A;  1SRA A;  1XFR A;  2AAO A;  5TNC A;  4DIR A;  3VGO A;  3D78 A;  1NWD A;  2WC8 A;  3I5H C;  1XFY O;  3DVM A;  3N7H A;  1M45 A;  1B7T Y;  1CKK A;  2QEH A;  3O2P A;  1EL4 A;  4JWQ A;  1PRW A;  1HQV A;  3RLZ A;  1ALV A;  3R72 A;  1KWO C;  2QEO A;  2G9B A;  2NZ0 A;  2AMI A;  2BKI B;  2WOS A;  1FPW A;  2M29 A;  1F71 A;  5PAL A;  1QXP A;  4YGD B;  3B86 A;  3HX4 A;  3L47 A;  1CDL A;  3OB1 B;  5JOL A;  4CPV A;  1W7I B;  1XFW O;  4PE0 A;  4L9M A;  2K2F A;  1KK8 C;  1DJH A;  3GK2 A;  3PM8 A;  2OTG B;  1Y1X A;  1BR4 B;  1OW4 A;  2QPT A;  3EG5 B;  3K1E A;  3B88 A;  3EVR A;  1ZFS A;  1A75 B;  3I5H B;  3NXA A;  4YBH B;  2KNE A;  4HRG A;  1LS8 A;  3PLF B;  2LAN A;  5KU1 A;  1KWO B;  2KI6 D;  1WRL A;  4INX A;  1CNP A;  2KFH A;  2QAC A;  2MAZ A;  4CFR A;  5KTY A;  1DT7 B;  3BUW B;  1R6P A;  2LMV A;  3L4A A;  1YUT A;  1DEK A;  4PE1 A;  4UPG A;  1REC A;  1PK0 D;  5HLV A;  3NSL A;  4JKT A;  1KK8 B;  1DJI A;  1ORG A;  2CCM A;  1S3P A;  2LUX A;  4YI9 A;  4OV2 A;  2MJW B;  1K90 D;  2SCP A;  3D73 A;  3D74 A;  2L0P A;  2KGR A;  5I2Q A;  3CAB A;  1K96 A;  4PE4 A;  4PHK A;  3S0B A;  1FI6 A;  2KFG A;  2KYF A;  1UHH A;  3SG4 A;  3WHT B;  1S6J A;  3DD4 A;  1G4Y R;  4AQI A;  1J7O A;  1S26 D;  2K7B A;  4MRY A;  3VB1 A;  1NX0 A;  1PVB A;  4XJK A;  2JWW A;  1FW4 A;  2LHL A;  3DVE A;  1RTP 1;  1IWQ A;  1G8I A;  2KGB C;  4N5X A;  1MHO A;  2CBL A;  1OE9 B;  1ZOT B;  4GNK B;  2VRG A;  1GGW A;  4WQ2 A;  5CPV A;  4GFT A;  1RFJ A;  1TNX A;  3FIA A;  2A4J A;  1JC2 A;  1RJV A;  3EVU A;  4I5L B;  3AKA A;  1DQE A;  1W7J B;  2WCE A;  2F2O A;  2I18 A;  5CSJ A;  4DUQ A;  3DVJ A;  1DJW A;  5AER A;  1TNP A;  2KOT A;  3ZWH A;  1DJG A;  2WCL A;  4PDZ A;  4WRI A;  1B8L A;  2PYQ A;  2ISD A;  3IF7 A;  2K7O A;  5ER5 A;  5I2L A;  4ZCV A;  5DIC A;  1B7T Z;  4CID A;  2ERB A;  5HKY A;  2NXQ A;  3NSO A;  1QVI Y;  2KAX A;  4A4B A;  1XA5 A;  4NQG A;  1EXR A;  3GK1 A;  1K9U A;  3AAJ A;  1CB1 A;  2JOJ A;  2BBM A;  3BFB A;  4GBA A;  3A8R A;  3IVT A;  3BUM B;  5DKQ A;  1KFU L;  1BJF A;  2MLF C;  1F55 A;  1ALW A;  3CZ1 A;  1JWD A;  3IQQ A;  4MSP A;  5HKW A;  3NSI A;  1A75 A;  1U5I B;  1YX8 A;  2Q4U A;  3UNW A;  1K8U A;  4FQT A;  3CR4 X;  3PN7 C;  1GQM A;  4ZCU A;  2JTT A;  1DMO A;  2F8P A;  3NHI A;  1ODB A;  1KK7 Z;  2D8N A;  2BL0 C;  2H2K A;  2K2A A;  1ZMZ A;  2KAY A;  1UHJ A;  3BJH A;  1CFD A;  1D1O A;  2K7C A;  2M3W A;  2KI4 C;  1NX1 A;  1NYA A;  4FTG A;  1OOJ A;  1QAS A;  2PAL A;  4P5O E;  3FE8 A;  1CTR A;  1DJY A;  1AVS A;  2K8M B;  2LMT A;  2ZKM X;  4MEW A;  1H4B A;  1YX7 A;  1OSA A;  2SAS A;  3BXK A;  3CDN A;  2BCX A;  2LNK A;  4HRE E;  1B4C A;  1SBJ A;  4OR9 B;  1WDC C;  1SL8 A;  2NCO A;  1B8C A;  1PSB A;  4MZL A;  2BCB A;  5F6T A;  4PE7 A;  4JPZ B;  1K2H A;  1UWO A;  2G2B A;  2QEV A;  3JVT C;  5D7F A;  1AUI B;  1OMD A;  2BL0 B;  2LC5 A;  3I5I C;  1NSH A;  3AKB A;  1J7Q A;  2KI4 B;  1BG1 A;  1UHN A;  1B47 A;  1XYD A;  3GK4 X;  2BE4 A;  2QEB A;  5CSN A;  1F54 A;  2BE6 A;  2Y4Q A;  2F33 A;  3R1O A;  1UUR A;  3SG3 A;  1TCO B;  2JNF A;  2LVI A;  1CDM A;  1Q80 A;  1YRT B;  1A03 A;  1WDC B;  4QJ4 B;  2M8U A;  1EJ3 A;  2F3Y A;  1SK6 D;  3B7A A;  4WQ3 A;  2ZRS A;  1OZO A;  1TOP A;  2EC6 C;  1QLK A;  3C1V A;  1BR1 B;  3SS5 A;  1LA0 A;  3JVT B;  2P71 A;  3WXA A;  1M63 B;  2GTE A;  2LVV A;  3I5I B;  4ORA B;  1OOI X;  4I5N B;  1AP4 A;  1VRK A;  1YUU A;  2LV7 A;  2M7N A;  1S5G Z;  4C0J A;  3S0F A;  4ORB B;  2Y1M A;  1KSO A;  3V2L A;  5JJG A;  2LVJ A;  2V53 A;  2HPS A;  2K0J A;  1QTX A;  2KDH A;  3KPX A;  2WOR A;  2RGI A;  5HL1 A;  4PT1 A;  2LP3 A;  5FI7 A;  4YGA A;  1M39 A;  3SIA A;  4DS7 A;  1TNW A;  1YTZ C;  1LVC D;  2L5Y A;  4PHJ A; 
#chains in the Genus database with same CATH homology
 2HF5 A;  2F2P A;  3BQ3 A;  1WLM A;  1CMF A;  1DTL A;  2EC6 B;  3IQO A;  4ETO A;  1Y6W A;  1F8H A;  4E68 A;  4MZJ A;  2JQ6 A;  2NCP A;  4NDB A;  1QX7 A;  5HKZ A;  1U5I A;  3O78 A;  1IRJ A;  2JT8 A;  4MBE A;  2Y1N A;  4MN0 A;  2HQW A;  4PCW A;  3BUO B;  2F3Z A;  5G08 A;  2MRD A;  5AFP A;  1LA3 A;  5D69 A;  2O5G A;  4TNC A;  2JXC A;  3F45 A;  5KSZ A;  2LP2 A;  1EH2 A;  1QIV A;  3M0W A;  4JQ0 D;  1BU3 A;  1GGZ A;  2K7D A;  2L4H A;  2JPT A;  5GQQ C;  2LUC A;  5CSF A;  3EVV A;  4PAL A;  2I94 A;  1KFX S;  1MXE A;  4I5J A;  4I5K A;  3VRN A;  1K9K A;  5AEQ A;  2KBI A;  1JF0 A;  1TN4 A;  1CFF A;  1WRZ A;  4Q04 A;  1XFZ O;  5IBW A;  3PAT A;  4DCK A;  4F0Z B;  2P6B B;  1LXF C;  3TDI A;  1FF1 A;  2BCA A;  3ICB A;  1OQP A;  2M9G A;  3VRO A;  2M49 B;  1CLM A;  1Y0V H;  2JXL A;  2L5X B;  1J7P A;  1IGV A;  1NCY A;  2ZND A;  4CLN A;  2FCE A;  1XFV O;  3FS7 A;  3PFV A;  3JTD B;  4PHN A;  4N1G A;  3PAL A;  4U8D A;  5I8N A;  1KCY A;  1CLB A;  3A4U B;  1F4Q A;  4GPL B;  2M97 A;  1HT9 A;  3LK1 A;  1IKU A;  1J1D A;  2JU0 A;  1QIW A;  3CS1 A;  3KF9 A;  2GGM A;  2COL B;  1MUX A;  2KBM A;  2PAS A;  2HET A;  1CFP A;  1RRO A;  2LAP A;  1BF5 A;  1NCZ A;  1NIW A;  1FI5 A;  1QAT A;  3FWC A;  2MLE C;  2L50 A;  2O60 A;  2LCP A;  1EG3 A;  2M0R A;  3TS5 C;  1IQ5 A;  1QLS A;  2CT9 A;  1AK8 A;  4IL1 A;  2JZI A;  2OPO A;  3CR2 A;  1DGV A;  3O4Y A;  1JFJ A;  4M2P A;  4USL A;  1QX2 A;  2JNX A;  4HRH A;  2CXJ A;  1S6I A;  2KI6 C;  3I5G C;  4D1E A;  3EK4 A;  2B1U A;  1C07 A;  1M31 A;  1C7W A;  1OZS A;  5HYD A;  2WCB A;  1V1G A;  5B8I B;  1CM1 A;  1JUO A;  3OHM B;  3EK8 A;  4C0K A;  2KAV A;  1J1E A;  2MHH A;  2GGZ A;  2JC2 A;  1CFC A;  2JTZ A;  3CTN A;  3TS5 B;  1TTX A;  3D10 A;  2ZFD A;  1BOD A;  1CDN A;  3LK0 A;  2KHN A;  5BPJ A;  1K95 A;  1XK4 A;  4M2Q A;  1PVA A;  2LMU A;  1UHI A;  1MXL C;  2ZN8 A;  1DVI A;  1SW8 A;  1RK9 A;  1N0Y A;  4MZK A;  3I5G B;  1J7R A;  3D0Y B;  3TUY C;  2BBN A;  1QS7 A;  4QJ3 B;  4YGE B;  1NP8 A;  2K61 A;  1QV1 A;  4QJ5 B;  5I2O A;  2AUC A;  1JSA A;  4PHM A;  1GJY A;  3TDZ A;  1SL9 A;  2FOT A;  1K94 A;  3TZ1 A;  1UUS A;  1SCM C;  3H4S E;  1CDP A;  2L4I A;  2LVK A;  1L2O C;  2ZN9 A;  4GUK A;  3PSR A;  2JUL A;  1SR6 C;  1XFU O;  1CMG A;  3CLN A;  3DF0 A;  2EHB A;  3WHU B;  2HQ8 A;  2DOQ A;  2L2E A;  4MLW A;  4CFQ A;  3KHE A;  3I5F C;  2M1K B;  4GGF A;  3TUY B;  1TRF A;  2KSP A;  3CGA A;  1DJX A;  1NPQ A;  1L7Z A;  1DF0 B;  1A2X A;  1R2U A;  1XK4 C;  2I2R E;  3EKH A;  1QVI Z;  3RM1 A;  1SCM B;  2L51 A;  3E3R A;  3VRQ A;  1LKJ A;  1L2O B;  1IH0 A;  4M2O A;  1H8B A;  1K9P A;  1SR6 B;  2H61 A;  3SJS A;  4AOM A;  1NCX A;  1YR5 A;  1NX2 A;  5DKR A;  1KFX L;  1KK7 Y;  3AAK A;  1SKT A;  3I5F B;  2FCD A;  1CM4 A;  2KQ6 A;  2R2I A;  4P2Y B;  2EGD A;  1PSR A;  1PUL A;  2OS8 C;  3LCP C;  1YVL A;  2PMY A;  2PSR A;  4MVF A;  3FWB A;  5CSI A;  1NUB A;  2ZNE A;  2E30 A;  1IG5 A;  5ER4 X;  2JT3 A;  1TIZ A;  4YGB B;  4ICB A;  1B8R A;  1J55 A;  1AHR A;  2KFF A;  2WCF A;  4GGF C;  3SG2 A;  5K89 A;  3BOW B;  3LLE A;  2LLS A;  1IQ3 A;  3JTD C;  3VRP A;  5AAN A;  1SY9 A;  4MRX A;  4GGN A;  3CWG A;  1MQ1 A;  2PVB A;  4YRU A;  4N1F A;  2GV5 A;  3ZNI A;  4OVN F;  5AXI A;  2MBX A;  1IJ6 A;  1WRK A;  1SNL A;  3CZT X;  4FQO A;  1G33 A;  2M1U A;  1QJT A;  2OS8 B;  2TN4 A;  3BUX B;  1Y1A A;  1C7V A;  2Q91 A;  1JFK A;  2H61 C;  2JT0 A;  1XO5 A;  3DF0 B;  3K21 A;  3DVK A;  1B9A A;  1DGU A;  2LM5 A;  1YVH A;  3D0Y A;  1SYM A;  4OCI A;  2PRU A;  1TNQ A;  3QRX A;  1OMV A;  4BY4 A;  3SIB A;  1XFX O;  1PAL A;  4HSZ A;  1S1E A;  1F70 A;  4ORC B;  1SPY A;  5HLO A;  5FYX A;  4AQJ A;  2KYC A;  1JBA A;  1SCV A;  1OMR A;  2BEC A;  1S36 A;  4GAO A;  1A4P A;  2ZRT A;  2LLT A;  1FBV A;  1BMO A;  1S5G Y;  2CNP A;  3VRR A;  2LHI A;  2NLN A;  3SG6 A;  1EG4 A;  1M46 A;  1KQM C;  2LLU A;  3TDU A;  1BT6 A;  2CTN A;  1IJ5 A;  1QV0 A;  1YUR A;  2L98 A;  1X02 A;  1XVJ A;  1N65 A;  1K93 D;  2KQY A;  1AJ5 A;  1F4O A;  1MR8 A;  1DJZ A;  1SL7 A;  3OX5 A;  1CLL A;  4YI8 A;  3OB2 B;  1DF0 A;  4OKH A;  1Y1U A;  2BKH B;  1WLZ A;  1MWN A;  1SMG A;  1YUS A;  3BUN B;  4R1E A;  3WNX B;  2Y5I A;  4NDC A;  1S6C A;  3MSE B;  3SG7 A;  1LIN A;  3OP0 A;  3O6B A;  1KQV A;  1ZAC A;  5DKN A;  3EK7 A;  1MF8 B;  1KQM B;  1BOC A;  3LL8 B;  1RWY A;  3GOF A;  1A29 A;  2FJU B;  2IS9 A;  4C0L A;  5J3X A;  1YRU B;  1BLQ A;  1JF2 A;  3HCM A;  1N2D A;  3KO0 A;  1ZUZ A;  2I7A A;  3OX6 A;  1TCF A;  2JRF A;  2WND A;  4XJK B;  1KFU S;  3CR5 X;  3KEV A;  2E6W A;  2MA2 A;  3BOW A;  1B1G A;  2M7L A;  1AJ4 A;  1KSM A;  1UHK A;  1E8A A;  1WY9 A;  3EKJ A;  4DRW A;  1QX5 B;  4BY5 A;  1UP5 A;  2LE9 B;  3PN7 B;  4NDD A;  1NX3 A;  4XYN A;  3NSK A;  4A4C A;  3SG5 A;  3BYA A;  1V1F A;  4YGC B;  2OTG C;  1SRA A;  2AAO A;  5TNC A;  4DIR A;  3VGO A;  1NWD A;  2WC8 A;  3I5H C;  1XFY O;  3DVM A;  1CKK A;  1M45 A;  1B7T Y;  3O2P A;  4JWQ A;  1EL4 A;  1PRW A;  1HQV A;  3RLZ A;  1ALV A;  1KWO C;  2G9B A;  2NZ0 A;  2AMI A;  2BKI B;  2WOS A;  1FPW A;  2M29 A;  1F71 A;  5PAL A;  1QXP A;  4YGD B;  3HX4 A;  1CDL A;  3OB1 B;  5JOL A;  4CPV A;  1W7I B;  1XFW O;  4PE0 A;  4L9M A;  2K2F A;  1KK8 C;  1DJH A;  3GK2 A;  3PM8 A;  2OTG B;  1Y1X A;  1BR4 B;  2QPT A;  3EVR A;  1ZFS A;  1A75 B;  3I5H B;  3NXA A;  4YBH B;  2KNE A;  4HRG A;  3PLF B;  2LAN A;  5KU1 A;  1KWO B;  2KI6 D;  1WRL A;  1CNP A;  2KFH A;  2QAC A;  2MAZ A;  4CFR A;  5KTY A;  1DT7 B;  3BUW B;  1R6P A;  2LMV A;  4PE1 A;  1YUT A;  4UPG A;  1REC A;  1PK0 D;  5HLV A;  3NSL A;  1KK8 B;  1DJI A;  2CCM A;  1S3P A;  2LUX A;  4YI9 A;  4OV2 A;  2MJW B;  1K90 D;  2SCP A;  2L0P A;  2KGR A;  5I2Q A;  1K96 A;  4PE4 A;  4PHK A;  1FI6 A;  2KFG A;  2KYF A;  1UHH A;  3SG4 A;  3WHT B;  1S6J A;  3DD4 A;  1G4Y R;  4AQI A;  1J7O A;  1S26 D;  2K7B A;  4MRY A;  1NX0 A;  1PVB A;  4XJK A;  2JWW A;  1FW4 A;  2LHL A;  3DVE A;  1RTP 1;  1IWQ A;  1G8I A;  2KGB C;  4N5X A;  1MHO A;  2CBL A;  1OE9 B;  1ZOT B;  4GNK B;  2VRG A;  1GGW A;  4WQ2 A;  5CPV A;  4GFT A;  1RFJ A;  1TNX A;  3FIA A;  2A4J A;  1JC2 A;  1RJV A;  3EVU A;  4I5L B;  3AKA A;  1W7J B;  2WCE A;  2F2O A;  2I18 A;  5CSJ A;  4DUQ A;  3DVJ A;  1DJW A;  5AER A;  1TNP A;  2KOT A;  3ZWH A;  1DJG A;  4PDZ A;  4WRI A;  2ISD A;  1B8L A;  3IF7 A;  2K7O A;  5ER5 A;  5I2L A;  1B7T Z;  4CID A;  5HKY A;  2NXQ A;  3NSO A;  1QVI Y;  2KAX A;  4A4B A;  1XA5 A;  4NQG A;  1EXR A;  3GK1 A;  1K9U A;  3AAJ A;  1CB1 A;  2JOJ A;  2BBM A;  4GBA A;  3A8R A;  3BUM B;  5DKQ A;  1KFU L;  1BJF A;  2MLF C;  1F55 A;  1ALW A;  1JWD A;  3IQQ A;  4MSP A;  5HKW A;  3NSI A;  1A75 A;  1U5I B;  1YX8 A;  2Q4U A;  1K8U A;  3CR4 X;  3PN7 C;  1GQM A;  4ZCU A;  2JTT A;  1DMO A;  2F8P A;  4ZCV A;  1ODB A;  1KK7 Z;  2D8N A;  2BL0 C;  2H2K A;  2K2A A;  1ZMZ A;  2KAY A;  1UHJ A;  1CFD A;  1D1O A;  2K7C A;  2M3W A;  2KI4 C;  1NX1 A;  1NYA A;  4FTG A;  1OOJ A;  1QAS A;  2PAL A;  4P5O E;  1CTR A;  1DJY A;  1AVS A;  2K8M B;  2LMT A;  2ZKM X;  4MEW A;  1H4B A;  1YX7 A;  1OSA A;  2SAS A;  3BXK A;  2BCX A;  2LNK A;  4HRE E;  1B4C A;  1SBJ A;  4OR9 B;  1WDC C;  1SL8 A;  2NCO A;  1B8C A;  1PSB A;  4MZL A;  2BCB A;  5F6T A;  4PE7 A;  4JPZ B;  1K2H A;  1UWO A;  2G2B A;  3JVT C;  5D7F A;  1AUI B;  1OMD A;  2BL0 B;  2LC5 A;  3I5I C;  1NSH A;  3AKB A;  1J7Q A;  2KI4 B;  1BG1 A;  1UHN A;  1B47 A;  1XYD A;  3GK4 X;  2BE4 A;  5CSN A;  1F54 A;  2BE6 A;  2Y4Q A;  2F33 A;  1UUR A;  3SG3 A;  1TCO B;  2JNF A;  2LVI A;  1CDM A;  1Q80 A;  1YRT B;  1A03 A;  1WDC B;  4QJ4 B;  2M8U A;  1EJ3 A;  2F3Y A;  1SK6 D;  4WQ3 A;  2ZRS A;  1OZO A;  1TOP A;  2EC6 C;  1QLK A;  3C1V A;  1BR1 B;  1LA0 A;  3JVT B;  3WXA A;  1M63 B;  2LVV A;  3I5I B;  4ORA B;  1AP4 A;  4I5N B;  1VRK A;  1YUU A;  2LV7 A;  2M7N A;  1S5G Z;  4C0J A;  4ORB B;  2Y1M A;  1KSO A;  5JJG A;  2LVJ A;  2V53 A;  2HPS A;  2K0J A;  1QTX A;  2KDH A;  3KPX A;  2WOR A;  2RGI A;  2LP3 A;  4YGA A;  1M39 A;  3SIA A;  4DS7 A;  1TNW A;  1YTZ C;  1LVC D;  4PHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...