4FQOA

Crystal structure of calcium-loaded s100b bound to sbi4211
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Discovery of a Novel Pentamidine-Related Inhibitor of the Calcium-Binding Protein S100B.
pubmed doi rcsb
molecule tags Protein binding/inhibitor
molecule keywords Protein S100-B
total genus 30
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4fqoA00
1JF0A 3SIAA 1AJ4A 4C0LA 2KFHA 1U5IB 2JTZA 1KQMC 2EHBA 5HKYA 2HF5A 2KAXA 3D10A 2LMUA 2NZ0A 1BLQA 3I5HC 2KQYA 2KHNA 1B47A 5D69A 3RM1A 3QRXA 2BCAA 4F0ZB 4GFTA 1A4PA 2VRGA 2LAPA 4AQJA 2K7BA 2CNPA 2MBXA 1SYMA 1BOCA 2WNDA 4M2OA 4L9MA 1NPQA 1B4CA 1EG4A 3EK7A 2LVVA 2PRUA 2GGZA 5F6TA 2HQ8A 3D0YB 3ZWHA 4DS7A 2I18A 1SL7A 1SRAA 1SPYA 4PHNA 1SKTA 2SCPA 1X02A 1M39A 2ZRTA 1XFWO 1A75A 2K61A 3SG5A 1KFUS 5D7FA 2KSPA 4YBHB 5ER5A 2JT3A 3A4UB 2JNXA 1MWNA 4NDBA 1QLKA 1YRUB 2M8UA 2F3YA 1KFXS 1SL8A 4TNCA 1A75B 1K90D 4NQGA 4N1FA 2LMVA 1GGZA 2M29A 4PDZA 1KQVA 4MN0A 4MRXA 1PRWA 2KI4B 1UWOA 1KK7Y 1ZOTB 1MR8A 4QJ5B 4PCWA 1QX7A 2BECA 1SY9A 2KDHA 3IQQA 1J55A 2LLSA 3VRQA 1OMRA 3TZ1A 1NCYA 2FJUB 3PLFB 3SG4A 1DT7B 1L7ZA 1J7RA 1QTXA 2JQ6A 1LVCD 1IJ5A 2FCEA 2M97A 2KNEA 4MZJA 4OKHA 3O4YA 1TNQA 2CT9A 4U8DA 4YGDB 3D0YA 4N5XA 1KFXL 3DF0A 3KHEA 4NDDA 2LVIA 3CTNA 1C7WA 4CPVA 1S3PA 1SMGA 4DUQA 3AKAA 2OPOA 3I5FC 1XVJA 1V1FA 1PULA 5DKQA 2MLFC 1NYAA 1G8IA 3WHTB 3OP0A 2R2IA 3EVVA 4HSZA 2OS8C 3BUOB 1KK7Z 5B8IB 3FWCA 4PHKA 5DKNA 2CTNA 1SL9A 3NSIA 4YGEB 1CDMA 2OTGB 2Q4UA 5I2OA 3JVTC 1GQMA 1NX2A 2AAOA 2QPTA 2SASA 1KSOA 1N65A 2JTTA 3BXKA 3I5IC 4CIDA 2COLB 4I5KA 3GOFA 5KU1A 3M0WA 1B7TZ 4JWQA 2BBMA 4I5LB 1DJGA 1QXPA 2KOTA 2L0PA 1KWOB 3NSKA 3JVTB 1B8RA 1AVSA 5FYXA 2L4HA 2KBIA 4GGNA 3CR2A 1TNWA 4OV2A 4P2YB 5CPVA 4ORCB 3KEVA 1YUTA 1QIWA 4PE1A 4YI8A 1UURA 4AOMA 4NDCA 2BL0B 2CBLA 1K9KA 1Q80A 2NCPA 1S1EA 2BBNA 1FI6A 2D8NA 2KYFA 2WC8A 3EK8A 1B7TY 1M63B 3I5FB 2LC5A 2JXLA 4QJ4B 3GK4X 2K7CA 1IWQA 2KGBC 1WRLA 5JOLA 2I7AA 4DIRA 2KYCA 1YR5A 3TS5B 2JRFA 3SG6A 4YI9A 1ALVA 2L4IA 3KO0A 5ER4X 1QV0A 1AK8A 5HLVA 3GK1A 3K21A 5HLOA 4CFQA 1DTLA 4DRWA 1DJIA 1K9UA 1S6JA 3FIAA 2JT8A 1TCFA 2KI6D 1XFYO 1KSMA 2PSRA 1M45A 2MHHA 1RWYA 2MLEC 1CMFA 2BE4A 3EKJA 3SJSA 2ZKMX 4HRGA 2CXJA 3LLEA 2GV5A 1CTRA 2JWWA 1K94A 1EL4A 1Y6WA 1UUSA 2AMIA 1NX0A 2JOJA 1K9PA 1OMVA 1IH0A 2F33A 1C7VA 5CSFA 4FQOA 2L2EA 3O78A 1FF1A 1F4QA 2IS9A 1BG1A 1DGVA 1K95A 2ZFDA 1K2HA 2ZN8A 1CFCA 1S6IA 1NIWA 2LUXA 2M1KB 2K2AA 2L50A 1YVLA 2LCPA 1ZMZA 4MEWA 1BJFA 1M46A 2LHLA 3VGOA 1SR6C 4MLWA 2EC6B 4GAOA 1AP4A 3WNXB 3EVRA 3I5GC 1TTXA 2Y1NA 4OCIA 2I2RE 1NWDA 1QIVA 2ZNDA 4GGFA 5KTYA 1VRKA 1XFXO 4OR9B 2H2KA 2LVKA 5AXIA 1CM4A 2H61A 2K7DA 2HQWA 1C07A 1G4YR 4XJKA 2KFFA 2F2PA 4PHMA 1JFKA 1R2UA 3I5GB 4BY4A 2EC6C 1SR6B 2LLUA 1J7OA 4C0JA 1YURA 1W7IB 3I5HB 5KSZA 1DJHA 1JBAA 1KQMB 1DVIA 1LINA 4XYNA 1MHOA 3AAKA 1CB1A 4PE0A 1FBVA 1XK4C 3BOWB 1CFDA 1OE9B 2F8PA 3O2PA 3VRNA 1CFPA 1J7QA 3AKBA 1BU3A 3BUXB 3CGAA 3PATA 1UHIA 2BE6A 1QVIZ 1F8HA 3DD4A 1CFFA 2WOSA 4N1GA 1YX7A 1S6CA 3CLNA 3HX4A 4HREE 1DJWA 3TDUA 1TNXA 2M7NA 3WXAA 1YRTB 1EJ3A 2K0JA 2WCFA 3PN7C 4YGAA 1NUBA 5J3XA 1XFUO 1SK6D 2F3ZA 1ZACA 3FWBA 4A4BA 4AQIA 4MSPA 4E68A 1QLSA 2PMYA 3GK2A 3TS5C 4OVNF 1NCZA 1WLMA 4ZCUA 1RROA 2M49B 3WHUB 4UPGA 5I2LA 2MAZA 2AUCA 2JT0A 1A29A 4ORBB 5DKRA 4XJKB 1Y1AA 1PVBA 3BQ3A 5IBWA 1Y0VH 1QV1A 1JFJA 1SBJA 3TDIA 1SCVA 4WQ2A 1DGUA 2BL0C 4WRIA 3DVKA 2WORA 1G33A 3BUMB 2KBMA 3SIBA 1YUUA 1WRKA 1UHHA 2MA2A 5CSNA 3DVEA 1UP5A 1TIZA 1JWDA 2PASA 1AHRA 5HKZA 2MJWB 2CCMA 1KWOC 3O6BA 1JF2A 1OZOA 4IL1A 2GGMA 1AJ5A 3LCPC 1QS7A 2LE9B 1H8BA 1J1DA 1OMDA 2KQ6A 2RGIA 1TOPA 1WDCC 4MBEA 2ZN9A 1YVHA 3I5IB 2P6BB 5I2QA 1NCXA 3CR5X 4PE7A 1ODBA 1XA5A 3E3RA 1SCMB 4USLA 2ZNEA 1J7PA 3SG3A 1F70A 2E6WA 4R1EA 1CDNA 2OTGC 3TUYB 2KI6C 1TNPA 3JTDB 3BYAA 2JULA 3BOWA 2O5GA 5JJGA 4GPLB 1B9AA 2Q91A 1KCYA 3PFVA 5PALA 2LP2A 5AANA 2LVJA 1KK8B 1PALA 1IRJA 2OS8B 1PK0D 1QX2A 3NXAA 1TN4A 3H4SE 5CSJA 3DVJA 4CLNA 3FS7A 1JSAA 2L51A 2WCEA 1K96A 1Y1UA 1SNLA 2M9GA 1WY9A 4MZLA 3TDZA 4QJ3B 2K2FA 2Y5IA 2JZIA 4P5OE 2JXCA 1RTP1 2MRDA 1OQPA 1F71A 2LMTA 1J1EA 1QASA 4DCKA 2JU0A 1CLMA 4MVFA 1JC2A 3DF0B 3EKHA 2PALA 3SG2A 1F54A 1DJYA 1PSRA 1EXRA 1YTZC 2HPSA 1ZUZA 2KI4C 3F45A 1N2DA 2KFGA 5AFPA 2M0RA 1JUOA 1LA0A 1SW8A 1FPWA 1LXFC 4WQ3A 1EH2A 1U5IA 3AAJA 5AERA 4M2QA 3LK0A 5CSIA 4ORAB 5GQQC 4M2PA 1ZFSA 1QJTA 1V1GA 2JPTA 3CWGA 2TN4A 2K8MB 1EG3A 1RJVA 2LUCA 2QACA 1A03A 5I8NA 5K89A 1NX3A 4JPZB 1IQ3A 4D1EA 2LLTA 1TCOB 1CDPA 2KAYA 2LM5A 2V53A 1YUSA 3NSOA 1H4BA 5G08A 1OOJA 1UHKA 3OB2B 1CKKA 4GGFC 2ZRSA 1IJ6A 1UHJA 2PVBA 3OX6A 2L5XB 3IF7A 1KK8C 1F4OA 4ETOA 5TNCA 1CLBA 3BUWB 1XK4A 1MQ1A 1S26D 3JTDC 5HYDA 1S36A 3DVMA 2Y1MA 3TUYC 1QVIY 3CZTX 2LHIA 1IKUA 1B8CA 2H61C 4YRUA 2DOQA 1SCMC 1A2XA 1BT6A 4YGBB 3LK1A 4YGCB 4BY5A 1WLZA 1QATA 1HT9A 1MXEA 1B1GA 3VRRA 1DF0A 2E30A 1BMOA 1OZSA 3PALA 2G9BA 2F2OA 4CFRA 1WDCB 1S5GZ 1D1OA 2JC2A 1WRZA 2LP3A 1DJXA 3OHMB 1NSHA 4PALA 2LV7A 3KF9A 1L2OC 1F55A 4Q04A 2Y4QA 2BCXA 3ZNIA 2NLNA 1AUIB 1TRFA 1RFJA 3PM8A 4GBAA 1LA3A 2G2BA 5AEQA 5BPJA 1K8UA 1FI5A 3VROA 1Y1XA 2BKIB 1LKJA 1UHNA 1DF0B 2BKHB 2KAVA 1W7JB 2LNKA 3MSEB 4PHJA 1HQVA 3OB1B 3PSRA 2L98A 1PVAA 1GGWA 2JNFA 4ICBA 1IGVA 2NCOA 1DJZA 1XO5A 2M1UA 1R6PA 2M3WA 3ICBA 1MXLC 1E8AA 1XFZO 3EK4A 1MF8B 2EGDA 3CS1A 1XFVO 2I94A 1MUXA 1YX8A 2B1UA 4C0KA 4MRYA 1KFUL 1GJYA 1QX5B 1CNPA 1NP8A 3A8RA 2LANA 3IQOA 2HETA 4ZCVA 4I5NB 2ISDA 1PSBA 4GUKA 3OX5A 2O60A 1M31A 4PE4A 1RECA 4MZKA 1K93D 1S5GY 1BF5A 2BCBA 1NX1A 1ALWA 1BR1B 3BUNB 3LL8B 3PN7B 1OSAA 4FTGA 4JQ0D 3RLZA 3NSLA 2K7OA 1CLLA 3CR4X 1RK9A 3SG7A 1BODA 1IQ5A 1BR4B 2FCDA 1N0YA 2NXQA 4I5JA 3VRPA 4GNKB 4A4CA 2KGRA 1CMGA 1IG5A 1DMOA 2M7LA 4HRHA 3HCMA 3KPXA 1CM1A 3EVUA 2WCBA 1B8LA 5HKWA 1XYDA 3C1VA 2A4JA 1FW4A 1CDLA 2FOTA 1L2OB
chains in the Genus database with same CATH superfamily
1JF0A 3SIAA 1AJ4A 4C0LA 2KFHA 1U5IB 2JTZA 1KQMC 2EHBA 5HKYA 2HF5A 2KAXA 3D10A 2LMUA 2NZ0A 2WCMA 2WCLA 3I5HC 1BLQA 2KQYA 2KHNA 1B47A 5D69A 3RM1A 3QRXA 2BCAA 4F0ZB 1DEKA 4GFTA 1A4PA 4JD9A 2VRGA 2LAPA 4AQJA 2K7BA 2CNPA 2MBXA 1SYMA 3K1EA 1BOCA 2WNDA 4M2OA 3BFHA 2WC6A 4L9MA 1NPQA 5I94A 1B4CA 1EG4A 3EK7A 2LVVA 2PRUA 2GGZA 5F6TA 3SS5A 1DQEA 2HQ8A 3D0YB 3ZWHA 4DS7A 2I18A 1SL7A 1SRAA 1SPYA 4PHNA 3O4XA 1SKTA 2SCPA 1X02A 1M39A 2ZRTA 1XFWO 1OOFA 1A75A 2K61A 4FQTA 5D3OA 3SG5A 1KFUS 5D7FA 2KSPA 3DZTA 4YBHB 5ER5A 2JT3A 3A4UB 2KPHA 2JNXA 3Q8IA 1MWNA 4NDBA 1QLKA 1YRUB 5FI6A 2M8UA 2F3YA 1KFXS 1SL8A 2QEOA 1A75B 1K90D 4NQGA 3IVTA 4N1FA 4TNCA 2LMVA 1GGZA 2M29A 4PDZA 1KQVA 4MN0A 3BFBA 4MRXA 1PRWA 3D74A 2KI4B 1UWOA 1KK7Y 1ZOTB 1MR8A 4QJ5B 4PCWA 1QX7A 2BECA 1SY9A 2KDHA 3IQQA 5HL1A 1J55A 2LLSA 3VRQA 1OMRA 3TZ1A 1NCYA 2KLDA 1T14A 2FJUB 3EG5B 3PLFB 5EL2A 3SG4A 1L7ZA 1J7RA 1QTXA 2JQ6A 1DT7B 1LVCD 1IJ5A 1OW4A 2FCEA 2KNEA 2M97A 3D76A 4MZJA 3O4YA 4OKHA 1TNQA 2CT9A 3SS3A 3VB1A 4U8DA 4YGDB 3D0YA 4N5XA 1KFXL 3CZ2A 3DF0A 3KHEA 4NDDA 2LVIA 3CTNA 1C7WA 4CPVA 1S3PA 1SMGA 4DUQA 3AKAA 3R1PA 3S0DA 2OPOA 3I5FC 1XVJA 1V1FA 1PULA 5DKQA 2MLFC 1NYAA 1G8IA 3WHTB 3OP0A 2R2IA 4KYNA 5FI7A 3EVVA 4HSZA 2OS8C 3BUOB 1KK7Z 5B8IB 3FWCA 4PHKA 5DKNA 2CTNA 1SL9A 3L47A 3NSIA 4YGEB 1GM0A 2PYQA 3NHTA 1CDMA 2OTGB 2Q4UA 5I2OA 3JVTC 1GQMA 1NX2A 2AAOA 5DICA 2QPTA 2SASA 1KSOA 1N65A 2JTTA 3BXKA 3I5IC 4CIDA 2COLB 4I5KA 3GOFA 3D78A 5KU1A 3M0WA 4JKTA 1B7TZ 4JWQA 2BBMA 3D77A 4I5LB 1DJGA 1QXPA 2KOTA 2L0PA 1KWOB 3NSKA 3JVTB 1B8RA 1AVSA 5FYXA 1OOIX 2L4HA 2KBIA 4GGNA 3CR2A 1TNWA 4OV2A 4P2YB 5CPVA 4ORCB 3KEVA 1YUTA 1QIWA 4PE1A 4YI8A 1UURA 4AOMA 4NDCA 2BL0B 2CBLA 1K9KA 1SSEB 1Q80A 2NCPA 1S1EA 2BBNA 2L2CA 1FI6A 2D8NA 2KYFA 2WC8A 3EK8A 1B7TY 5FI2A 1M63B 2ERBA 2LC5A 3I5FB 2JXLA 4QJ4B 3GK4X 2K7CA 1IWQA 2KGBC 1WRLA 5JOLA 2I7AA 1Z2CB 4DIRA 2KYCA 1YR5A 3TS5B 2JRFA 3SG6A 4YI9A 1ALVA 2L4IA 3SS4A 3KO0A 5ER4X 1QV0A 1AK8A 5HLVA 3GK1A 3K21A 5HLOA 3R72A 1DTLA 4CFQA 1DJIA 2GTEA 1K9UA 1S6JA 3FIAA 4DRWA 2JT8A 3B88A 1TCFA 1OOHA 3B87A 2KI6D 1XFYO 1KSMA 2PSRA 1M45A 2MHHA 1RWYA 2MLEC 1CMFA 2BE4A 3EKJA 3SJSA 2ZKMX 4HRGA 2BNXA 2CXJA 3LLEA 2GV5A 1CTRA 2JWWA 1EL4A 1K94A 3CDNA 1Y6WA 1UUSA 2AMIA 1NX0A 2JOJA 1K9PA 1OMVA 1IH0A 2F33A 3CZ1A 1C7VA 5CSFA 4FQOA 2L2EA 3O78A 1FF1A 1F4QA 2IS9A 1BG1A 1DGVA 1K95A 2ZFDA 1K2HA 2ZN8A 1CFCA 1S6IA 1NIWA 2LUXA 2M1KB 2K2AA 2L50A 2QEVA 1YVLA 2LCPA 1ZMZA 4MEWA 1BJFA 1M46A 2LHLA 3VGOA 1SR6C 4MLWA 2EC6B 3L4AA 4GAOA 1AP4A 3WNXB 3EVRA 3I5GC 1TTXA 2Y1NA 4OCIA 2I2RE 3BJHA 1NWDA 1QIVA 2PQLA 2ZNDA 4GGFA 5KTYA 3S0FA 1VRKA 1XFXO 4OR9B 2H2KA 2LVKA 5AXIA 3V2LA 1CM4A 4IJ7A 2H61A 2WCJA 2K7DA 2HQWA 3D75A 1C07A 1G4YR 4XJKA 2KFFA 2F2PA 4PHMA 1JFKA 1DC1A 1R2UA 3CABA 3I5GB 3BFAA 4BY4A 2EC6C 1SR6B 2LLUA 3FE9A 1J7OA 4C0JA 1YURA 1W7IB 3I5HB 4OZDA 5KSZA 1DJHA 1JBAA 1KQMB 1DVIA 1LINA 4XYNA 1MHOA 3AAKA 1CB1A 1TUJA 4PE0A 3R1OA 1FBVA 1XK4C 3BOWB 1CFDA 2FJYA 1OE9B 2F8PA 3O2PA 3VRNA 1CFPA 1J7QA 3AKBA 1BU3A 3BUXB 3CGAA 3PATA 1UHIA 2BE6A 1QVIZ 1F8HA 3DD4A 1CFFA 2WOSA 4N1GA 1YX7A 1S6CA 3CLNA 3HX4A 4HREE 1DJWA 3TDUA 1TNXA 2M7NA 3WXAA 1YRTB 1EJ3A 2K0JA 2WCFA 3PN7C 4YGAA 1NUBA 5J3XA 1XFUO 3PM2A 1SK6D 2F3ZA 1ZACA 2JPOA 3FWBA 4A4BA 4AQIA 4MSPA 2QEHA 4E68A 1QLSA 2PMYA 3GK2A 1XFRA 4OVNF 3TS5C 1NCZA 1WLMA 4ZCUA 1RROA 2M49B 3WHUB 4UPGA 5I2LA 4F7FA 2MAZA 2AUCA 2JT0A 1A29A 3OBVA 4ORBB 5DKRA 4XJKB 1Y1AA 1PVBA 1OOGA 2YGUA 1Y0VH 2L5YA 3BQ3A 5IBWA 1QV1A 1JFJA 1SBJA 3TDIA 1SCVA 4WQ2A 1DGUA 2BL0C 4WRIA 3DVKA 2WORA 1G33A 3BUMB 2KBMA 2KLEA 3NGVA 3SIBA 1YUUA 2P70A 1WRKA 1UHHA 2MA2A 5CSNA 3DVEA 1UP5A 1TIZA 1JWDA 2PASA 1AHRA 5HKZA 1TUZA 2MJWB 2CCMA 1KWOC 3O6BA 1JF2A 1OZOA 4IL1A 2GGMA 1AJ5A 3LCPC 1QS7A 2BAPA 2LE9B 1H8BA 1TWOA 1J1DA 1OMDA 2KQ6A 2RGIA 1TOPA 1WDCC 4MBEA 2ZN9A 1YVHA 1IIOA 3I5IB 2P6BB 5I2QA 1NCXA 3CR5X 1Z4HA 4PE7A 1ODBA 4INXA 1XA5A 3E3RA 1SCMB 4USLA 2ZNEA 1J7PA 3SG3A 1F70A 2E6WA 4R1EA 1CDNA 2OTGC 3TUYB 2KI6C 1TNPA 3JTDB 3BYAA 2JULA 3BOWA 2O5GA 5JJGA 4GPLB 1B9AA 2Q91A 1KCYA 3PFVA 5PALA 2LP2A 5AANA 2LVJA 1KK8B 1PALA 2WC5A 1IRJA 1W9ZA 2OS8B 1PK0D 1QX2A 3NXAA 1TN4A 3H4SE 5CSJA 3DVJA 4CLNA 3FS7A 1JSAA 2L51A 2P71A 2WCEA 1K96A 1Y1UA 1ORGA 1SNLA 2M9GA 3S0BA 1WY9A 4MZLA 3TDZA 4QJ3B 2K2FA 2Y5IA 2JZIA 4P5OE 2JXCA 1RTP1 2MRDA 1OQPA 1F71A 2LMTA 1J1EA 3B6XA 1QASA 4DCKA 3DY9A 2JU0A 3DXLA 1CLMA 4MVFA 1JC2A 3DF0B 3CYZA 3EKHA 2PALA 3SG2A 1F54A 1DJYA 1PSRA 1EXRA 1YTZC 2QEBA 3L4LA 2HPSA 1ZUZA 2KI4C 3RZSA 3F45A 1N2DA 2KFGA 5AFPA 2M0RA 1JUOA 3PJIA 1LA0A 1SW8A 1FPWA 3NHIA 1LXFC 4WQ3A 1EH2A 1U5IA 3AAJA 5AERA 4M2QA 3LK0A 5CSIA 4ORAB 5GQQC 4M2PA 1ZFSA 1QJTA 1V1GA 2JPTA 3B86A 3CWGA 2TN4A 3FE8A 2K8MB 1EG3A 1RJVA 2LUCA 2QACA 3UNWA 1A03A 5I8NA 3QMEA 5K89A 1NX3A 4JPZB 1IQ3A 4D1EA 2LLTA 1TCOB 1CDPA 2KAYA 2LM5A 2V53A 1YUSA 3NSOA 1H4BA 4PT1A 5G08A 1OOJA 1UHKA 3OB2B 1CKKA 4GGFC 1QWVA 2ZRSA 1IJ6A 1UHJA 2PVBA 3OX6A 2L5XB 3CZ0A 3IF7A 1C3YA 1KK8C 3N7HA 1F4OA 4ETOA 5TNCA 2WCKA 1CLBA 3BUWB 1XK4A 1MQ1A 1S26D 3JTDC 5HYDA 1S36A 3DVMA 2Y1MA 3TUYC 1QVIY 3CZTX 2LHIA 1IKUA 1B8CA 2H61C 3UO9A 2DOQA 1SCMC 1A2XA 1BT6A 4YGBB 3LK1A 4YGCB 4YRUA 4BY5A 1WLZA 1QATA 1HT9A 1MXEA 1B1GA 3VRRA 1DF0A 2E30A 1BMOA 1OZSA 3PALA 2G9BA 2F2OA 4CFRA 1WDCB 1S5GZ 1D1OA 2JC2A 1WRZA 3FE6A 2LP3A 1DJXA 3OHMB 1NSHA 4PALA 2LV7A 3KF9A 1L2OC 1F55A 4Q04A 2Y4QA 2BCXA 3ZNIA 2NLNA 1AUIB 3S0EA 1TRFA 1RFJA 3PM8A 4GBAA 1LA3A 2G2BA 3B7AA 5AEQA 5BPJA 1K8UA 1FI5A 3VROA 2QDIA 1Y1XA 2BKIB 1LKJA 1UHNA 1DF0B 2BKHB 2KAVA 1W7JB 2LNKA 3MSEB 4PHJA 1HQVA 3OB1B 3PSRA 2L98A 1PVAA 1GGWA 2JNFA 4ICBA 1IGVA 2NCOA 1DJZA 1XO5A 2M1UA 1R6PA 2M3WA 3ICBA 1MXLC 1E8AA 1XFZO 3EK4A 1MF8B 2EGDA 3CS1A 3S0AA 1DELA 1XFVO 2I94A 2WCHA 1MUXA 1YX8A 2B1UA 3DYEA 4C0KA 4MRYA 1KFUL 1GJYA 1QX5B 1CNPA 1NP8A 3A8RA 2LANA 3IQOA 2HETA 4ZCVA 4I5NB 2ISDA 1PSBA 4GUKA 1LS8A 3OX5A 2O60A 1M31A 4PE4A 1RECA 4MZKA 1K93D 3S0GA 3OGNA 1P28A 1S5GY 2BCBA 3D73A 1BF5A 1NX1A 1ALWA 3R1VA 1BR1B 3BUNB 3LL8B 3PN7B 1OSAA 4FTGA 4JQ0D 3RLZA 3NSLA 2K7OA 1CLLA 3CR4X 1RK9A 3SG7A 1BODA 1IQ5A 1BR4B 2FCDA 1C3ZA 1N0YA 2NXQA 4I5JA 3VRPA 4GNKB 4A4CA 2KGRA 1CMGA 1IG5A 1DMOA 2M7LA 4HRHA 3HCMA 2H8VA 3KPXA 1CM1A 3EVUA 2WCBA 2K60A 1B8LA 4INWA 5HKWA 1XYDA 3C1VA 2A4JA 1FW4A 1CDLA 2FOTA 1L2OB
chains in the Genus database with same CATH topology
1JF0A 3SIAA 1AJ4A 4C0LA 2KFHA 1U5IB 2JTZA 1KQMC 2EHBA 5HKYA 2HF5A 2KAXA 3D10A 2LMUA 2NZ0A 1BLQA 3I5HC 2KQYA 2KHNA 1B47A 5D69A 3RM1A 3QRXA 2BCAA 4F0ZB 4GFTA 1A4PA 2VRGA 2LAPA 4AQJA 2K7BA 2CNPA 2MBXA 1SYMA 1BOCA 2WNDA 4M2OA 4L9MA 1NPQA 1B4CA 1EG4A 3EK7A 2LVVA 2PRUA 2GGZA 5F6TA 2HQ8A 3D0YB 3ZWHA 4DS7A 2I18A 1SL7A 1SRAA 1SPYA 4PHNA 1SKTA 2SCPA 1X02A 1M39A 2ZRTA 1XFWO 1A75A 2K61A 3SG5A 1KFUS 5D7FA 2KSPA 4YBHB 5ER5A 2JT3A 3A4UB 2JNXA 1MWNA 4NDBA 1QLKA 1YRUB 2M8UA 2F3YA 1KFXS 1SL8A 4TNCA 1A75B 1K90D 4NQGA 4N1FA 2LMVA 1GGZA 2M29A 4PDZA 1KQVA 4MN0A 4MRXA 1PRWA 2KI4B 1UWOA 1KK7Y 1ZOTB 1MR8A 4QJ5B 4PCWA 1QX7A 2BECA 1SY9A 2KDHA 3IQQA 1J55A 2LLSA 3VRQA 1OMRA 3TZ1A 1NCYA 2FJUB 3PLFB 3SG4A 1DT7B 1L7ZA 1J7RA 1QTXA 2JQ6A 1LVCD 1IJ5A 2FCEA 2M97A 2KNEA 4MZJA 4OKHA 3O4YA 1TNQA 2CT9A 4U8DA 4YGDB 3D0YA 4N5XA 1KFXL 3DF0A 3KHEA 4NDDA 2LVIA 3CTNA 1C7WA 4CPVA 1S3PA 1SMGA 4DUQA 3AKAA 2OPOA 3I5FC 1XVJA 1V1FA 1PULA 5DKQA 2MLFC 1NYAA 1G8IA 3WHTB 3OP0A 2R2IA 3EVVA 4HSZA 2OS8C 3BUOB 1KK7Z 5B8IB 3FWCA 4PHKA 5DKNA 2CTNA 1SL9A 3NSIA 4YGEB 1CDMA 2OTGB 2Q4UA 5I2OA 3JVTC 1GQMA 1NX2A 2AAOA 2QPTA 2SASA 1KSOA 1N65A 2JTTA 3BXKA 3I5IC 4CIDA 2COLB 4I5KA 3GOFA 5KU1A 3M0WA 1B7TZ 4JWQA 2BBMA 4I5LB 1DJGA 1QXPA 2KOTA 2L0PA 1KWOB 3NSKA 3JVTB 1B8RA 1AVSA 5FYXA 2L4HA 2KBIA 4GGNA 3CR2A 1TNWA 4OV2A 4P2YB 5CPVA 4ORCB 3KEVA 1YUTA 1QIWA 4PE1A 4YI8A 1UURA 4AOMA 4NDCA 2BL0B 2CBLA 1K9KA 1Q80A 2NCPA 1S1EA 2BBNA 1FI6A 2D8NA 2KYFA 2WC8A 3EK8A 1B7TY 1M63B 3I5FB 2LC5A 2JXLA 4QJ4B 3GK4X 2K7CA 1IWQA 2KGBC 1WRLA 5JOLA 2I7AA 4DIRA 2KYCA 1YR5A 3TS5B 2JRFA 3SG6A 4YI9A 1ALVA 2L4IA 3KO0A 5ER4X 1QV0A 1AK8A 5HLVA 3GK1A 3K21A 5HLOA 4CFQA 1DTLA 4DRWA 1DJIA 1K9UA 1S6JA 3FIAA 2JT8A 1TCFA 2KI6D 1XFYO 1KSMA 2PSRA 1M45A 2MHHA 1RWYA 2MLEC 1CMFA 2BE4A 3EKJA 3SJSA 2ZKMX 4HRGA 2CXJA 3LLEA 2GV5A 1CTRA 2JWWA 1K94A 1EL4A 1Y6WA 1UUSA 2AMIA 1NX0A 2JOJA 1K9PA 1OMVA 1IH0A 2F33A 1C7VA 5CSFA 4FQOA 2L2EA 3O78A 1FF1A 1F4QA 2IS9A 1BG1A 1DGVA 1K95A 2ZFDA 1K2HA 2ZN8A 1CFCA 1S6IA 1NIWA 2LUXA 2M1KB 2K2AA 2L50A 1YVLA 2LCPA 1ZMZA 4MEWA 1BJFA 1M46A 2LHLA 3VGOA 1SR6C 4MLWA 2EC6B 4GAOA 1AP4A 3WNXB 3EVRA 3I5GC 1TTXA 2Y1NA 4OCIA 2I2RE 1NWDA 1QIVA 2ZNDA 4GGFA 5KTYA 1VRKA 1XFXO 4OR9B 2H2KA 2LVKA 5AXIA 1CM4A 2H61A 2K7DA 2HQWA 1C07A 1G4YR 4XJKA 2KFFA 2F2PA 4PHMA 1JFKA 1R2UA 3I5GB 4BY4A 2EC6C 1SR6B 2LLUA 1J7OA 4C0JA 1YURA 1W7IB 3I5HB 5KSZA 1DJHA 1JBAA 1KQMB 1DVIA 1LINA 4XYNA 1MHOA 3AAKA 1CB1A 4PE0A 1FBVA 1XK4C 3BOWB 1CFDA 1OE9B 2F8PA 3O2PA 3VRNA 1CFPA 1J7QA 3AKBA 1BU3A 3BUXB 3CGAA 3PATA 1UHIA 2BE6A 1QVIZ 1F8HA 3DD4A 1CFFA 2WOSA 4N1GA 1YX7A 1S6CA 3CLNA 3HX4A 4HREE 1DJWA 3TDUA 1TNXA 2M7NA 3WXAA 1YRTB 1EJ3A 2K0JA 2WCFA 3PN7C 4YGAA 1NUBA 5J3XA 1XFUO 1SK6D 2F3ZA 1ZACA 3FWBA 4A4BA 4AQIA 4MSPA 4E68A 1QLSA 2PMYA 3GK2A 3TS5C 4OVNF 1NCZA 1WLMA 4ZCUA 1RROA 2M49B 3WHUB 4UPGA 5I2LA 2MAZA 2AUCA 2JT0A 1A29A 4ORBB 5DKRA 4XJKB 1Y1AA 1PVBA 3BQ3A 5IBWA 1Y0VH 1QV1A 1JFJA 1SBJA 3TDIA 1SCVA 4WQ2A 1DGUA 2BL0C 4WRIA 3DVKA 2WORA 1G33A 3BUMB 2KBMA 3SIBA 1YUUA 1WRKA 1UHHA 2MA2A 5CSNA 3DVEA 1UP5A 1TIZA 1JWDA 2PASA 1AHRA 5HKZA 2MJWB 2CCMA 1KWOC 3O6BA 1JF2A 1OZOA 4IL1A 2GGMA 1AJ5A 3LCPC 1QS7A 2LE9B 1H8BA 1J1DA 1OMDA 2KQ6A 2RGIA 1TOPA 1WDCC 4MBEA 2ZN9A 1YVHA 3I5IB 2P6BB 5I2QA 1NCXA 3CR5X 4PE7A 1ODBA 1XA5A 3E3RA 1SCMB 4USLA 2ZNEA 1J7PA 3SG3A 1F70A 2E6WA 4R1EA 1CDNA 2OTGC 3TUYB 2KI6C 1TNPA 3JTDB 3BYAA 2JULA 3BOWA 2O5GA 5JJGA 4GPLB 1B9AA 2Q91A 1KCYA 3PFVA 5PALA 2LP2A 5AANA 2LVJA 1KK8B 1PALA 1IRJA 2OS8B 1PK0D 1QX2A 3NXAA 1TN4A 3H4SE 5CSJA 3DVJA 4CLNA 3FS7A 1JSAA 2L51A 2WCEA 1K96A 1Y1UA 1SNLA 2M9GA 1WY9A 4MZLA 3TDZA 4QJ3B 2K2FA 2Y5IA 2JZIA 4P5OE 2JXCA 1RTP1 2MRDA 1OQPA 1F71A 2LMTA 1J1EA 1QASA 4DCKA 2JU0A 1CLMA 4MVFA 1JC2A 3DF0B 3EKHA 2PALA 3SG2A 1F54A 1DJYA 1PSRA 1EXRA 1YTZC 2HPSA 1ZUZA 2KI4C 3F45A 1N2DA 2KFGA 5AFPA 2M0RA 1JUOA 1LA0A 1SW8A 1FPWA 1LXFC 4WQ3A 1EH2A 1U5IA 3AAJA 5AERA 4M2QA 3LK0A 5CSIA 4ORAB 5GQQC 4M2PA 1ZFSA 1QJTA 1V1GA 2JPTA 3CWGA 2TN4A 2K8MB 1EG3A 1RJVA 2LUCA 2QACA 1A03A 5I8NA 5K89A 1NX3A 4JPZB 1IQ3A 4D1EA 2LLTA 1TCOB 1CDPA 2KAYA 2LM5A 2V53A 1YUSA 3NSOA 1H4BA 5G08A 1OOJA 1UHKA 3OB2B 1CKKA 4GGFC 2ZRSA 1IJ6A 1UHJA 2PVBA 3OX6A 2L5XB 3IF7A 1KK8C 1F4OA 4ETOA 5TNCA 1CLBA 3BUWB 1XK4A 1MQ1A 1S26D 3JTDC 5HYDA 1S36A 3DVMA 2Y1MA 3TUYC 1QVIY 3CZTX 2LHIA 1IKUA 1B8CA 2H61C 4YRUA 2DOQA 1SCMC 1A2XA 1BT6A 4YGBB 3LK1A 4YGCB 4BY5A 1WLZA 1QATA 1HT9A 1MXEA 1B1GA 3VRRA 1DF0A 2E30A 1BMOA 1OZSA 3PALA 2G9BA 2F2OA 4CFRA 1WDCB 1S5GZ 1D1OA 2JC2A 1WRZA 2LP3A 1DJXA 3OHMB 1NSHA 4PALA 2LV7A 3KF9A 1L2OC 1F55A 4Q04A 2Y4QA 2BCXA 3ZNIA 2NLNA 1AUIB 1TRFA 1RFJA 3PM8A 4GBAA 1LA3A 2G2BA 5AEQA 5BPJA 1K8UA 1FI5A 3VROA 1Y1XA 2BKIB 1LKJA 1UHNA 1DF0B 2BKHB 2KAVA 1W7JB 2LNKA 3MSEB 4PHJA 1HQVA 3OB1B 3PSRA 2L98A 1PVAA 1GGWA 2JNFA 4ICBA 1IGVA 2NCOA 1DJZA 1XO5A 2M1UA 1R6PA 2M3WA 3ICBA 1MXLC 1E8AA 1XFZO 3EK4A 1MF8B 2EGDA 3CS1A 1XFVO 2I94A 1MUXA 1YX8A 2B1UA 4C0KA 4MRYA 1KFUL 1GJYA 1QX5B 1CNPA 1NP8A 3A8RA 2LANA 3IQOA 2HETA 4ZCVA 4I5NB 2ISDA 1PSBA 4GUKA 3OX5A 2O60A 1M31A 4PE4A 1RECA 4MZKA 1K93D 1S5GY 1BF5A 2BCBA 1NX1A 1ALWA 1BR1B 3BUNB 3LL8B 3PN7B 1OSAA 4FTGA 4JQ0D 3RLZA 3NSLA 2K7OA 1CLLA 3CR4X 1RK9A 3SG7A 1BODA 1IQ5A 1BR4B 2FCDA 1N0YA 2NXQA 4I5JA 3VRPA 4GNKB 4A4CA 2KGRA 1CMGA 1IG5A 1DMOA 2M7LA 4HRHA 3HCMA 3KPXA 1CM1A 3EVUA 2WCBA 1B8LA 5HKWA 1XYDA 3C1VA 2A4JA 1FW4A 1CDLA 2FOTA 1L2OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JF0 A;  3SIA A;  1AJ4 A;  4C0L A;  2KFH A;  1U5I B;  2JTZ A;  1KQM C;  2EHB A;  5HKY A;  2HF5 A;  2KAX A;  3D10 A;  2LMU A;  2NZ0 A;  1BLQ A;  3I5H C;  2KQY A;  2KHN A;  1B47 A;  5D69 A;  3RM1 A;  3QRX A;  2BCA A;  4F0Z B;  4GFT A;  1A4P A;  2VRG A;  2LAP A;  4AQJ A;  2K7B A;  2CNP A;  2MBX A;  1SYM A;  1BOC A;  2WND A;  4M2O A;  4L9M A;  1NPQ A;  1B4C A;  1EG4 A;  3EK7 A;  2LVV A;  2PRU A;  2GGZ A;  5F6T A;  2HQ8 A;  3D0Y B;  3ZWH A;  4DS7 A;  2I18 A;  1SL7 A;  1SRA A;  1SPY A;  4PHN A;  1SKT A;  2SCP A;  1X02 A;  1M39 A;  2ZRT A;  1XFW O;  1A75 A;  2K61 A;  3SG5 A;  1KFU S;  5D7F A;  2KSP A;  4YBH B;  5ER5 A;  2JT3 A;  3A4U B;  2JNX A;  1MWN A;  4NDB A;  1QLK A;  1YRU B;  2M8U A;  2F3Y A;  1KFX S;  1SL8 A;  4TNC A;  1A75 B;  1K90 D;  4NQG A;  4N1F A;  2LMV A;  1GGZ A;  2M29 A;  4PDZ A;  1KQV A;  4MN0 A;  4MRX A;  1PRW A;  2KI4 B;  1UWO A;  1KK7 Y;  1ZOT B;  1MR8 A;  4QJ5 B;  4PCW A;  1QX7 A;  2BEC A;  1SY9 A;  2KDH A;  3IQQ A;  1J55 A;  2LLS A;  3VRQ A;  1OMR A;  3TZ1 A;  1NCY A;  2FJU B;  3PLF B;  3SG4 A;  1DT7 B;  1L7Z A;  1J7R A;  1QTX A;  2JQ6 A;  1LVC D;  1IJ5 A;  2FCE A;  2M97 A;  2KNE A;  4MZJ A;  4OKH A;  3O4Y A;  1TNQ A;  2CT9 A;  4U8D A;  4YGD B;  3D0Y A;  4N5X A;  1KFX L;  3DF0 A;  3KHE A;  4NDD A;  2LVI A;  3CTN A;  1C7W A;  4CPV A;  1S3P A;  1SMG A;  4DUQ A;  3AKA A;  2OPO A;  3I5F C;  1XVJ A;  1V1F A;  1PUL A;  5DKQ A;  2MLF C;  1NYA A;  1G8I A;  3WHT B;  3OP0 A;  2R2I A;  3EVV A;  4HSZ A;  2OS8 C;  3BUO B;  1KK7 Z;  5B8I B;  3FWC A;  4PHK A;  5DKN A;  2CTN A;  1SL9 A;  3NSI A;  4YGE B;  1CDM A;  2OTG B;  2Q4U A;  5I2O A;  3JVT C;  1GQM A;  1NX2 A;  2AAO A;  2QPT A;  2SAS A;  1KSO A;  1N65 A;  2JTT A;  3BXK A;  3I5I C;  4CID A;  2COL B;  4I5K A;  3GOF A;  5KU1 A;  3M0W A;  1B7T Z;  4JWQ A;  2BBM A;  4I5L B;  1DJG A;  1QXP A;  2KOT A;  2L0P A;  1KWO B;  3NSK A;  3JVT B;  1B8R A;  1AVS A;  5FYX A;  2L4H A;  2KBI A;  4GGN A;  3CR2 A;  1TNW A;  4OV2 A;  4P2Y B;  5CPV A;  4ORC B;  3KEV A;  1YUT A;  1QIW A;  4PE1 A;  4YI8 A;  1UUR A;  4AOM A;  4NDC A;  2BL0 B;  2CBL A;  1K9K A;  1Q80 A;  2NCP A;  1S1E A;  2BBN A;  1FI6 A;  2D8N A;  2KYF A;  2WC8 A;  3EK8 A;  1B7T Y;  1M63 B;  3I5F B;  2LC5 A;  2JXL A;  4QJ4 B;  3GK4 X;  2K7C A;  1IWQ A;  2KGB C;  1WRL A;  5JOL A;  2I7A A;  4DIR A;  2KYC A;  1YR5 A;  3TS5 B;  2JRF A;  3SG6 A;  4YI9 A;  1ALV A;  2L4I A;  3KO0 A;  5ER4 X;  1QV0 A;  1AK8 A;  5HLV A;  3GK1 A;  3K21 A;  5HLO A;  4CFQ A;  1DTL A;  4DRW A;  1DJI A;  1K9U A;  1S6J A;  3FIA A;  2JT8 A;  1TCF A;  2KI6 D;  1XFY O;  1KSM A;  2PSR A;  1M45 A;  2MHH A;  1RWY A;  2MLE C;  1CMF A;  2BE4 A;  3EKJ A;  3SJS A;  2ZKM X;  4HRG A;  2CXJ A;  3LLE A;  2GV5 A;  1CTR A;  2JWW A;  1K94 A;  1EL4 A;  1Y6W A;  1UUS A;  2AMI A;  1NX0 A;  2JOJ A;  1K9P A;  1OMV A;  1IH0 A;  2F33 A;  1C7V A;  5CSF A;  4FQO A;  2L2E A;  3O78 A;  1FF1 A;  1F4Q A;  2IS9 A;  1BG1 A;  1DGV A;  1K95 A;  2ZFD A;  1K2H A;  2ZN8 A;  1CFC A;  1S6I A;  1NIW A;  2LUX A;  2M1K B;  2K2A A;  2L50 A;  1YVL A;  2LCP A;  1ZMZ A;  4MEW A;  1BJF A;  1M46 A;  2LHL A;  3VGO A;  1SR6 C;  4MLW A;  2EC6 B;  4GAO A;  1AP4 A;  3WNX B;  3EVR A;  3I5G C;  1TTX A;  2Y1N A;  4OCI A;  2I2R E;  1NWD A;  1QIV A;  2ZND A;  4GGF A;  5KTY A;  1VRK A;  1XFX O;  4OR9 B;  2H2K A;  2LVK A;  5AXI A;  1CM4 A;  2H61 A;  2K7D A;  2HQW A;  1C07 A;  1G4Y R;  4XJK A;  2KFF A;  2F2P A;  4PHM A;  1JFK A;  1R2U A;  3I5G B;  4BY4 A;  2EC6 C;  1SR6 B;  2LLU A;  1J7O A;  4C0J A;  1YUR A;  1W7I B;  3I5H B;  5KSZ A;  1DJH A;  1JBA A;  1KQM B;  1DVI A;  1LIN A;  4XYN A;  1MHO A;  3AAK A;  1CB1 A;  4PE0 A;  1FBV A;  1XK4 C;  3BOW B;  1CFD A;  1OE9 B;  2F8P A;  3O2P A;  3VRN A;  1CFP A;  1J7Q A;  3AKB A;  1BU3 A;  3BUX B;  3CGA A;  3PAT A;  1UHI A;  2BE6 A;  1QVI Z;  1F8H A;  3DD4 A;  1CFF A;  2WOS A;  4N1G A;  1YX7 A;  1S6C A;  3CLN A;  3HX4 A;  4HRE E;  1DJW A;  3TDU A;  1TNX A;  2M7N A;  3WXA A;  1YRT B;  1EJ3 A;  2K0J A;  2WCF A;  3PN7 C;  4YGA A;  1NUB A;  5J3X A;  1XFU O;  1SK6 D;  2F3Z A;  1ZAC A;  3FWB A;  4A4B A;  4AQI A;  4MSP A;  4E68 A;  1QLS A;  2PMY A;  3GK2 A;  3TS5 C;  4OVN F;  1NCZ A;  1WLM A;  4ZCU A;  1RRO A;  2M49 B;  3WHU B;  4UPG A;  5I2L A;  2MAZ A;  2AUC A;  2JT0 A;  1A29 A;  4ORB B;  5DKR A;  4XJK B;  1Y1A A;  1PVB A;  3BQ3 A;  5IBW A;  1Y0V H;  1QV1 A;  1JFJ A;  1SBJ A;  3TDI A;  1SCV A;  4WQ2 A;  1DGU A;  2BL0 C;  4WRI A;  3DVK A;  2WOR A;  1G33 A;  3BUM B;  2KBM A;  3SIB A;  1YUU A;  1WRK A;  1UHH A;  2MA2 A;  5CSN A;  3DVE A;  1UP5 A;  1TIZ A;  1JWD A;  2PAS A;  1AHR A;  5HKZ A;  2MJW B;  2CCM A;  1KWO C;  3O6B A;  1JF2 A;  1OZO A;  4IL1 A;  2GGM A;  1AJ5 A;  3LCP C;  1QS7 A;  2LE9 B;  1H8B A;  1J1D A;  1OMD A;  2KQ6 A;  2RGI A;  1TOP A;  1WDC C;  4MBE A;  2ZN9 A;  1YVH A;  3I5I B;  2P6B B;  5I2Q A;  1NCX A;  3CR5 X;  4PE7 A;  1ODB A;  1XA5 A;  3E3R A;  1SCM B;  4USL A;  2ZNE A;  1J7P A;  3SG3 A;  1F70 A;  2E6W A;  4R1E A;  1CDN A;  2OTG C;  3TUY B;  2KI6 C;  1TNP A;  3JTD B;  3BYA A;  2JUL A;  3BOW A;  2O5G A;  5JJG A;  4GPL B;  1B9A A;  2Q91 A;  1KCY A;  3PFV A;  5PAL A;  2LP2 A;  5AAN A;  2LVJ A;  1KK8 B;  1PAL A;  1IRJ A;  2OS8 B;  1PK0 D;  1QX2 A;  3NXA A;  1TN4 A;  3H4S E;  5CSJ A;  3DVJ A;  4CLN A;  3FS7 A;  1JSA A;  2L51 A;  2WCE A;  1K96 A;  1Y1U A;  1SNL A;  2M9G A;  1WY9 A;  4MZL A;  3TDZ A;  4QJ3 B;  2K2F A;  2Y5I A;  2JZI A;  4P5O E;  2JXC A;  1RTP 1;  2MRD A;  1OQP A;  1F71 A;  2LMT A;  1J1E A;  1QAS A;  4DCK A;  2JU0 A;  1CLM A;  4MVF A;  1JC2 A;  3DF0 B;  3EKH A;  2PAL A;  3SG2 A;  1F54 A;  1DJY A;  1PSR A;  1EXR A;  1YTZ C;  2HPS A;  1ZUZ A;  2KI4 C;  3F45 A;  1N2D A;  2KFG A;  5AFP A;  2M0R A;  1JUO A;  1LA0 A;  1SW8 A;  1FPW A;  1LXF C;  4WQ3 A;  1EH2 A;  1U5I A;  3AAJ A;  5AER A;  4M2Q A;  3LK0 A;  5CSI A;  4ORA B;  5GQQ C;  4M2P A;  1ZFS A;  1QJT A;  1V1G A;  2JPT A;  3CWG A;  2TN4 A;  2K8M B;  1EG3 A;  1RJV A;  2LUC A;  2QAC A;  1A03 A;  5I8N A;  5K89 A;  1NX3 A;  4JPZ B;  1IQ3 A;  4D1E A;  2LLT A;  1TCO B;  1CDP A;  2KAY A;  2LM5 A;  2V53 A;  1YUS A;  3NSO A;  1H4B A;  5G08 A;  1OOJ A;  1UHK A;  3OB2 B;  1CKK A;  4GGF C;  2ZRS A;  1IJ6 A;  1UHJ A;  2PVB A;  3OX6 A;  2L5X B;  3IF7 A;  1KK8 C;  1F4O A;  4ETO A;  5TNC A;  1CLB A;  3BUW B;  1XK4 A;  1MQ1 A;  1S26 D;  3JTD C;  5HYD A;  1S36 A;  3DVM A;  2Y1M A;  3TUY C;  1QVI Y;  3CZT X;  2LHI A;  1IKU A;  1B8C A;  2H61 C;  4YRU A;  2DOQ A;  1SCM C;  1A2X A;  1BT6 A;  4YGB B;  3LK1 A;  4YGC B;  4BY5 A;  1WLZ A;  1QAT A;  1HT9 A;  1MXE A;  1B1G A;  3VRR A;  1DF0 A;  2E30 A;  1BMO A;  1OZS A;  3PAL A;  2G9B A;  2F2O A;  4CFR A;  1WDC B;  1S5G Z;  1D1O A;  2JC2 A;  1WRZ A;  2LP3 A;  1DJX A;  3OHM B;  1NSH A;  4PAL A;  2LV7 A;  3KF9 A;  1L2O C;  1F55 A;  4Q04 A;  2Y4Q A;  2BCX A;  3ZNI A;  2NLN A;  1AUI B;  1TRF A;  1RFJ A;  3PM8 A;  4GBA A;  1LA3 A;  2G2B A;  5AEQ A;  5BPJ A;  1K8U A;  1FI5 A;  3VRO A;  1Y1X A;  2BKI B;  1LKJ A;  1UHN A;  1DF0 B;  2BKH B;  2KAV A;  1W7J B;  2LNK A;  3MSE B;  4PHJ A;  1HQV A;  3OB1 B;  3PSR A;  2L98 A;  1PVA A;  1GGW A;  2JNF A;  4ICB A;  1IGV A;  2NCO A;  1DJZ A;  1XO5 A;  2M1U A;  1R6P A;  2M3W A;  3ICB A;  1MXL C;  1E8A A;  1XFZ O;  3EK4 A;  1MF8 B;  2EGD A;  3CS1 A;  1XFV O;  2I94 A;  1MUX A;  1YX8 A;  2B1U A;  4C0K A;  4MRY A;  1KFU L;  1GJY A;  1QX5 B;  1CNP A;  1NP8 A;  3A8R A;  2LAN A;  3IQO A;  2HET A;  4ZCV A;  4I5N B;  2ISD A;  1PSB A;  4GUK A;  3OX5 A;  2O60 A;  1M31 A;  4PE4 A;  1REC A;  4MZK A;  1K93 D;  1S5G Y;  1BF5 A;  2BCB A;  1NX1 A;  1ALW A;  1BR1 B;  3BUN B;  3LL8 B;  3PN7 B;  1OSA A;  4FTG A;  4JQ0 D;  3RLZ A;  3NSL A;  2K7O A;  1CLL A;  3CR4 X;  1RK9 A;  3SG7 A;  1BOD A;  1IQ5 A;  1BR4 B;  2FCD A;  1N0Y A;  2NXQ A;  4I5J A;  3VRP A;  4GNK B;  4A4C A;  2KGR A;  1CMG A;  1IG5 A;  1DMO A;  2M7L A;  4HRH A;  3HCM A;  3KPX A;  1CM1 A;  3EVU A;  2WCB A;  1B8L A;  5HKW A;  1XYD A;  3C1V A;  2A4J A;  1FW4 A;  1CDL A;  2FOT A;  1L2O B; 
#chains in the Genus database with same CATH topology
 1JF0 A;  3SIA A;  1AJ4 A;  4C0L A;  2KFH A;  1U5I B;  2JTZ A;  1KQM C;  2EHB A;  5HKY A;  2HF5 A;  2KAX A;  3D10 A;  2LMU A;  2NZ0 A;  2WCM A;  2WCL A;  3I5H C;  1BLQ A;  2KQY A;  2KHN A;  1B47 A;  5D69 A;  3RM1 A;  3QRX A;  2BCA A;  4F0Z B;  1DEK A;  4GFT A;  1A4P A;  4JD9 A;  2VRG A;  2LAP A;  4AQJ A;  2K7B A;  2CNP A;  2MBX A;  1SYM A;  3K1E A;  1BOC A;  2WND A;  4M2O A;  3BFH A;  2WC6 A;  4L9M A;  1NPQ A;  5I94 A;  1B4C A;  1EG4 A;  3EK7 A;  2LVV A;  2PRU A;  2GGZ A;  5F6T A;  3SS5 A;  1DQE A;  2HQ8 A;  3D0Y B;  3ZWH A;  4DS7 A;  2I18 A;  1SL7 A;  1SRA A;  1SPY A;  4PHN A;  3O4X A;  1SKT A;  2SCP A;  1X02 A;  1M39 A;  2ZRT A;  1XFW O;  1OOF A;  1A75 A;  2K61 A;  4FQT A;  5D3O A;  3SG5 A;  1KFU S;  5D7F A;  2KSP A;  3DZT A;  4YBH B;  5ER5 A;  2JT3 A;  3A4U B;  2KPH A;  2JNX A;  3Q8I A;  1MWN A;  4NDB A;  1QLK A;  1YRU B;  5FI6 A;  2M8U A;  2F3Y A;  1KFX S;  1SL8 A;  2QEO A;  1A75 B;  1K90 D;  4NQG A;  3IVT A;  4N1F A;  4TNC A;  2LMV A;  1GGZ A;  2M29 A;  4PDZ A;  1KQV A;  4MN0 A;  3BFB A;  4MRX A;  1PRW A;  3D74 A;  2KI4 B;  1UWO A;  1KK7 Y;  1ZOT B;  1MR8 A;  4QJ5 B;  4PCW A;  1QX7 A;  2BEC A;  1SY9 A;  2KDH A;  3IQQ A;  5HL1 A;  1J55 A;  2LLS A;  3VRQ A;  1OMR A;  3TZ1 A;  1NCY A;  2KLD A;  1T14 A;  2FJU B;  3EG5 B;  3PLF B;  5EL2 A;  3SG4 A;  1L7Z A;  1J7R A;  1QTX A;  2JQ6 A;  1DT7 B;  1LVC D;  1IJ5 A;  1OW4 A;  2FCE A;  2KNE A;  2M97 A;  3D76 A;  4MZJ A;  3O4Y A;  4OKH A;  1TNQ A;  2CT9 A;  3SS3 A;  3VB1 A;  4U8D A;  4YGD B;  3D0Y A;  4N5X A;  1KFX L;  3CZ2 A;  3DF0 A;  3KHE A;  4NDD A;  2LVI A;  3CTN A;  1C7W A;  4CPV A;  1S3P A;  1SMG A;  4DUQ A;  3AKA A;  3R1P A;  3S0D A;  2OPO A;  3I5F C;  1XVJ A;  1V1F A;  1PUL A;  5DKQ A;  2MLF C;  1NYA A;  1G8I A;  3WHT B;  3OP0 A;  2R2I A;  4KYN A;  5FI7 A;  3EVV A;  4HSZ A;  2OS8 C;  3BUO B;  1KK7 Z;  5B8I B;  3FWC A;  4PHK A;  5DKN A;  2CTN A;  1SL9 A;  3L47 A;  3NSI A;  4YGE B;  1GM0 A;  2PYQ A;  3NHT A;  1CDM A;  2OTG B;  2Q4U A;  5I2O A;  3JVT C;  1GQM A;  1NX2 A;  2AAO A;  5DIC A;  2QPT A;  2SAS A;  1KSO A;  1N65 A;  2JTT A;  3BXK A;  3I5I C;  4CID A;  2COL B;  4I5K A;  3GOF A;  3D78 A;  5KU1 A;  3M0W A;  4JKT A;  1B7T Z;  4JWQ A;  2BBM A;  3D77 A;  4I5L B;  1DJG A;  1QXP A;  2KOT A;  2L0P A;  1KWO B;  3NSK A;  3JVT B;  1B8R A;  1AVS A;  5FYX A;  1OOI X;  2L4H A;  2KBI A;  4GGN A;  3CR2 A;  1TNW A;  4OV2 A;  4P2Y B;  5CPV A;  4ORC B;  3KEV A;  1YUT A;  1QIW A;  4PE1 A;  4YI8 A;  1UUR A;  4AOM A;  4NDC A;  2BL0 B;  2CBL A;  1K9K A;  1SSE B;  1Q80 A;  2NCP A;  1S1E A;  2BBN A;  2L2C A;  1FI6 A;  2D8N A;  2KYF A;  2WC8 A;  3EK8 A;  1B7T Y;  5FI2 A;  1M63 B;  2ERB A;  2LC5 A;  3I5F B;  2JXL A;  4QJ4 B;  3GK4 X;  2K7C A;  1IWQ A;  2KGB C;  1WRL A;  5JOL A;  2I7A A;  1Z2C B;  4DIR A;  2KYC A;  1YR5 A;  3TS5 B;  2JRF A;  3SG6 A;  4YI9 A;  1ALV A;  2L4I A;  3SS4 A;  3KO0 A;  5ER4 X;  1QV0 A;  1AK8 A;  5HLV A;  3GK1 A;  3K21 A;  5HLO A;  3R72 A;  1DTL A;  4CFQ A;  1DJI A;  2GTE A;  1K9U A;  1S6J A;  3FIA A;  4DRW A;  2JT8 A;  3B88 A;  1TCF A;  1OOH A;  3B87 A;  2KI6 D;  1XFY O;  1KSM A;  2PSR A;  1M45 A;  2MHH A;  1RWY A;  2MLE C;  1CMF A;  2BE4 A;  3EKJ A;  3SJS A;  2ZKM X;  4HRG A;  2BNX A;  2CXJ A;  3LLE A;  2GV5 A;  1CTR A;  2JWW A;  1EL4 A;  1K94 A;  3CDN A;  1Y6W A;  1UUS A;  2AMI A;  1NX0 A;  2JOJ A;  1K9P A;  1OMV A;  1IH0 A;  2F33 A;  3CZ1 A;  1C7V A;  5CSF A;  4FQO A;  2L2E A;  3O78 A;  1FF1 A;  1F4Q A;  2IS9 A;  1BG1 A;  1DGV A;  1K95 A;  2ZFD A;  1K2H A;  2ZN8 A;  1CFC A;  1S6I A;  1NIW A;  2LUX A;  2M1K B;  2K2A A;  2L50 A;  2QEV A;  1YVL A;  2LCP A;  1ZMZ A;  4MEW A;  1BJF A;  1M46 A;  2LHL A;  3VGO A;  1SR6 C;  4MLW A;  2EC6 B;  3L4A A;  4GAO A;  1AP4 A;  3WNX B;  3EVR A;  3I5G C;  1TTX A;  2Y1N A;  4OCI A;  2I2R E;  3BJH A;  1NWD A;  1QIV A;  2PQL A;  2ZND A;  4GGF A;  5KTY A;  3S0F A;  1VRK A;  1XFX O;  4OR9 B;  2H2K A;  2LVK A;  5AXI A;  3V2L A;  1CM4 A;  4IJ7 A;  2H61 A;  2WCJ A;  2K7D A;  2HQW A;  3D75 A;  1C07 A;  1G4Y R;  4XJK A;  2KFF A;  2F2P A;  4PHM A;  1JFK A;  1DC1 A;  1R2U A;  3CAB A;  3I5G B;  3BFA A;  4BY4 A;  2EC6 C;  1SR6 B;  2LLU A;  3FE9 A;  1J7O A;  4C0J A;  1YUR A;  1W7I B;  3I5H B;  4OZD A;  5KSZ A;  1DJH A;  1JBA A;  1KQM B;  1DVI A;  1LIN A;  4XYN A;  1MHO A;  3AAK A;  1CB1 A;  1TUJ A;  4PE0 A;  3R1O A;  1FBV A;  1XK4 C;  3BOW B;  1CFD A;  2FJY A;  1OE9 B;  2F8P A;  3O2P A;  3VRN A;  1CFP A;  1J7Q A;  3AKB A;  1BU3 A;  3BUX B;  3CGA A;  3PAT A;  1UHI A;  2BE6 A;  1QVI Z;  1F8H A;  3DD4 A;  1CFF A;  2WOS A;  4N1G A;  1YX7 A;  1S6C A;  3CLN A;  3HX4 A;  4HRE E;  1DJW A;  3TDU A;  1TNX A;  2M7N A;  3WXA A;  1YRT B;  1EJ3 A;  2K0J A;  2WCF A;  3PN7 C;  4YGA A;  1NUB A;  5J3X A;  1XFU O;  3PM2 A;  1SK6 D;  2F3Z A;  1ZAC A;  2JPO A;  3FWB A;  4A4B A;  4AQI A;  4MSP A;  2QEH A;  4E68 A;  1QLS A;  2PMY A;  3GK2 A;  1XFR A;  4OVN F;  3TS5 C;  1NCZ A;  1WLM A;  4ZCU A;  1RRO A;  2M49 B;  3WHU B;  4UPG A;  5I2L A;  4F7F A;  2MAZ A;  2AUC A;  2JT0 A;  1A29 A;  3OBV A;  4ORB B;  5DKR A;  4XJK B;  1Y1A A;  1PVB A;  1OOG A;  2YGU A;  1Y0V H;  2L5Y A;  3BQ3 A;  5IBW A;  1QV1 A;  1JFJ A;  1SBJ A;  3TDI A;  1SCV A;  4WQ2 A;  1DGU A;  2BL0 C;  4WRI A;  3DVK A;  2WOR A;  1G33 A;  3BUM B;  2KBM A;  2KLE A;  3NGV A;  3SIB A;  1YUU A;  2P70 A;  1WRK A;  1UHH A;  2MA2 A;  5CSN A;  3DVE A;  1UP5 A;  1TIZ A;  1JWD A;  2PAS A;  1AHR A;  5HKZ A;  1TUZ A;  2MJW B;  2CCM A;  1KWO C;  3O6B A;  1JF2 A;  1OZO A;  4IL1 A;  2GGM A;  1AJ5 A;  3LCP C;  1QS7 A;  2BAP A;  2LE9 B;  1H8B A;  1TWO A;  1J1D A;  1OMD A;  2KQ6 A;  2RGI A;  1TOP A;  1WDC C;  4MBE A;  2ZN9 A;  1YVH A;  1IIO A;  3I5I B;  2P6B B;  5I2Q A;  1NCX A;  3CR5 X;  1Z4H A;  4PE7 A;  1ODB A;  4INX A;  1XA5 A;  3E3R A;  1SCM B;  4USL A;  2ZNE A;  1J7P A;  3SG3 A;  1F70 A;  2E6W A;  4R1E A;  1CDN A;  2OTG C;  3TUY B;  2KI6 C;  1TNP A;  3JTD B;  3BYA A;  2JUL A;  3BOW A;  2O5G A;  5JJG A;  4GPL B;  1B9A A;  2Q91 A;  1KCY A;  3PFV A;  5PAL A;  2LP2 A;  5AAN A;  2LVJ A;  1KK8 B;  1PAL A;  2WC5 A;  1IRJ A;  1W9Z A;  2OS8 B;  1PK0 D;  1QX2 A;  3NXA A;  1TN4 A;  3H4S E;  5CSJ A;  3DVJ A;  4CLN A;  3FS7 A;  1JSA A;  2L51 A;  2P71 A;  2WCE A;  1K96 A;  1Y1U A;  1ORG A;  1SNL A;  2M9G A;  3S0B A;  1WY9 A;  4MZL A;  3TDZ A;  4QJ3 B;  2K2F A;  2Y5I A;  2JZI A;  4P5O E;  2JXC A;  1RTP 1;  2MRD A;  1OQP A;  1F71 A;  2LMT A;  1J1E A;  3B6X A;  1QAS A;  4DCK A;  3DY9 A;  2JU0 A;  3DXL A;  1CLM A;  4MVF A;  1JC2 A;  3DF0 B;  3CYZ A;  3EKH A;  2PAL A;  3SG2 A;  1F54 A;  1DJY A;  1PSR A;  1EXR A;  1YTZ C;  2QEB A;  3L4L A;  2HPS A;  1ZUZ A;  2KI4 C;  3RZS A;  3F45 A;  1N2D A;  2KFG A;  5AFP A;  2M0R A;  1JUO A;  3PJI A;  1LA0 A;  1SW8 A;  1FPW A;  3NHI A;  1LXF C;  4WQ3 A;  1EH2 A;  1U5I A;  3AAJ A;  5AER A;  4M2Q A;  3LK0 A;  5CSI A;  4ORA B;  5GQQ C;  4M2P A;  1ZFS A;  1QJT A;  1V1G A;  2JPT A;  3B86 A;  3CWG A;  2TN4 A;  3FE8 A;  2K8M B;  1EG3 A;  1RJV A;  2LUC A;  2QAC A;  3UNW A;  1A03 A;  5I8N A;  3QME A;  5K89 A;  1NX3 A;  4JPZ B;  1IQ3 A;  4D1E A;  2LLT A;  1TCO B;  1CDP A;  2KAY A;  2LM5 A;  2V53 A;  1YUS A;  3NSO A;  1H4B A;  4PT1 A;  5G08 A;  1OOJ A;  1UHK A;  3OB2 B;  1CKK A;  4GGF C;  1QWV A;  2ZRS A;  1IJ6 A;  1UHJ A;  2PVB A;  3OX6 A;  2L5X B;  3CZ0 A;  3IF7 A;  1C3Y A;  1KK8 C;  3N7H A;  1F4O A;  4ETO A;  5TNC A;  2WCK A;  1CLB A;  3BUW B;  1XK4 A;  1MQ1 A;  1S26 D;  3JTD C;  5HYD A;  1S36 A;  3DVM A;  2Y1M A;  3TUY C;  1QVI Y;  3CZT X;  2LHI A;  1IKU A;  1B8C A;  2H61 C;  3UO9 A;  2DOQ A;  1SCM C;  1A2X A;  1BT6 A;  4YGB B;  3LK1 A;  4YGC B;  4YRU A;  4BY5 A;  1WLZ A;  1QAT A;  1HT9 A;  1MXE A;  1B1G A;  3VRR A;  1DF0 A;  2E30 A;  1BMO A;  1OZS A;  3PAL A;  2G9B A;  2F2O A;  4CFR A;  1WDC B;  1S5G Z;  1D1O A;  2JC2 A;  1WRZ A;  3FE6 A;  2LP3 A;  1DJX A;  3OHM B;  1NSH A;  4PAL A;  2LV7 A;  3KF9 A;  1L2O C;  1F55 A;  4Q04 A;  2Y4Q A;  2BCX A;  3ZNI A;  2NLN A;  1AUI B;  3S0E A;  1TRF A;  1RFJ A;  3PM8 A;  4GBA A;  1LA3 A;  2G2B A;  3B7A A;  5AEQ A;  5BPJ A;  1K8U A;  1FI5 A;  3VRO A;  2QDI A;  1Y1X A;  2BKI B;  1LKJ A;  1UHN A;  1DF0 B;  2BKH B;  2KAV A;  1W7J B;  2LNK A;  3MSE B;  4PHJ A;  1HQV A;  3OB1 B;  3PSR A;  2L98 A;  1PVA A;  1GGW A;  2JNF A;  4ICB A;  1IGV A;  2NCO A;  1DJZ A;  1XO5 A;  2M1U A;  1R6P A;  2M3W A;  3ICB A;  1MXL C;  1E8A A;  1XFZ O;  3EK4 A;  1MF8 B;  2EGD A;  3CS1 A;  3S0A A;  1DEL A;  1XFV O;  2I94 A;  2WCH A;  1MUX A;  1YX8 A;  2B1U A;  3DYE A;  4C0K A;  4MRY A;  1KFU L;  1GJY A;  1QX5 B;  1CNP A;  1NP8 A;  3A8R A;  2LAN A;  3IQO A;  2HET A;  4ZCV A;  4I5N B;  2ISD A;  1PSB A;  4GUK A;  1LS8 A;  3OX5 A;  2O60 A;  1M31 A;  4PE4 A;  1REC A;  4MZK A;  1K93 D;  3S0G A;  3OGN A;  1P28 A;  1S5G Y;  2BCB A;  3D73 A;  1BF5 A;  1NX1 A;  1ALW A;  3R1V A;  1BR1 B;  3BUN B;  3LL8 B;  3PN7 B;  1OSA A;  4FTG A;  4JQ0 D;  3RLZ A;  3NSL A;  2K7O A;  1CLL A;  3CR4 X;  1RK9 A;  3SG7 A;  1BOD A;  1IQ5 A;  1BR4 B;  2FCD A;  1C3Z A;  1N0Y A;  2NXQ A;  4I5J A;  3VRP A;  4GNK B;  4A4C A;  2KGR A;  1CMG A;  1IG5 A;  1DMO A;  2M7L A;  4HRH A;  3HCM A;  2H8V A;  3KPX A;  1CM1 A;  3EVU A;  2WCB A;  2K60 A;  1B8L A;  4INW A;  5HKW A;  1XYD A;  3C1V A;  2A4J A;  1FW4 A;  1CDL A;  2FOT A;  1L2O B; 
#chains in the Genus database with same CATH homology
 1JF0 A;  3SIA A;  1AJ4 A;  4C0L A;  2KFH A;  1U5I B;  2JTZ A;  1KQM C;  2EHB A;  5HKY A;  2HF5 A;  2KAX A;  3D10 A;  2LMU A;  2NZ0 A;  1BLQ A;  3I5H C;  2KQY A;  2KHN A;  1B47 A;  5D69 A;  3RM1 A;  3QRX A;  2BCA A;  4F0Z B;  4GFT A;  1A4P A;  2VRG A;  2LAP A;  4AQJ A;  2K7B A;  2CNP A;  2MBX A;  1SYM A;  1BOC A;  2WND A;  4M2O A;  4L9M A;  1NPQ A;  1B4C A;  1EG4 A;  3EK7 A;  2LVV A;  2PRU A;  2GGZ A;  5F6T A;  2HQ8 A;  3D0Y B;  3ZWH A;  4DS7 A;  2I18 A;  1SL7 A;  1SRA A;  1SPY A;  4PHN A;  1SKT A;  2SCP A;  1X02 A;  1M39 A;  2ZRT A;  1XFW O;  1A75 A;  2K61 A;  3SG5 A;  1KFU S;  5D7F A;  2KSP A;  4YBH B;  5ER5 A;  2JT3 A;  3A4U B;  2JNX A;  1MWN A;  4NDB A;  1QLK A;  1YRU B;  2M8U A;  2F3Y A;  1KFX S;  1SL8 A;  4TNC A;  1A75 B;  1K90 D;  4NQG A;  4N1F A;  2LMV A;  1GGZ A;  2M29 A;  4PDZ A;  1KQV A;  4MN0 A;  4MRX A;  1PRW A;  2KI4 B;  1UWO A;  1KK7 Y;  1ZOT B;  1MR8 A;  4QJ5 B;  4PCW A;  1QX7 A;  2BEC A;  1SY9 A;  2KDH A;  3IQQ A;  1J55 A;  2LLS A;  3VRQ A;  1OMR A;  3TZ1 A;  1NCY A;  2FJU B;  3PLF B;  3SG4 A;  1DT7 B;  1L7Z A;  1J7R A;  1QTX A;  2JQ6 A;  1LVC D;  1IJ5 A;  2FCE A;  2M97 A;  2KNE A;  4MZJ A;  4OKH A;  3O4Y A;  1TNQ A;  2CT9 A;  4U8D A;  4YGD B;  3D0Y A;  4N5X A;  1KFX L;  3DF0 A;  3KHE A;  4NDD A;  2LVI A;  3CTN A;  1C7W A;  4CPV A;  1S3P A;  1SMG A;  4DUQ A;  3AKA A;  2OPO A;  3I5F C;  1XVJ A;  1V1F A;  1PUL A;  5DKQ A;  2MLF C;  1NYA A;  1G8I A;  3WHT B;  3OP0 A;  2R2I A;  3EVV A;  4HSZ A;  2OS8 C;  3BUO B;  1KK7 Z;  5B8I B;  3FWC A;  4PHK A;  5DKN A;  2CTN A;  1SL9 A;  3NSI A;  4YGE B;  1CDM A;  2OTG B;  2Q4U A;  5I2O A;  3JVT C;  1GQM A;  1NX2 A;  2AAO A;  2QPT A;  2SAS A;  1KSO A;  1N65 A;  2JTT A;  3BXK A;  3I5I C;  4CID A;  2COL B;  4I5K A;  3GOF A;  5KU1 A;  3M0W A;  1B7T Z;  4JWQ A;  2BBM A;  4I5L B;  1DJG A;  1QXP A;  2KOT A;  2L0P A;  1KWO B;  3NSK A;  3JVT B;  1B8R A;  1AVS A;  5FYX A;  2L4H A;  2KBI A;  4GGN A;  3CR2 A;  1TNW A;  4OV2 A;  4P2Y B;  5CPV A;  4ORC B;  3KEV A;  1YUT A;  1QIW A;  4PE1 A;  4YI8 A;  1UUR A;  4AOM A;  4NDC A;  2BL0 B;  2CBL A;  1K9K A;  1Q80 A;  2NCP A;  1S1E A;  2BBN A;  1FI6 A;  2D8N A;  2KYF A;  2WC8 A;  3EK8 A;  1B7T Y;  1M63 B;  3I5F B;  2LC5 A;  2JXL A;  4QJ4 B;  3GK4 X;  2K7C A;  1IWQ A;  2KGB C;  1WRL A;  5JOL A;  2I7A A;  4DIR A;  2KYC A;  1YR5 A;  3TS5 B;  2JRF A;  3SG6 A;  4YI9 A;  1ALV A;  2L4I A;  3KO0 A;  5ER4 X;  1QV0 A;  1AK8 A;  5HLV A;  3GK1 A;  3K21 A;  5HLO A;  4CFQ A;  1DTL A;  4DRW A;  1DJI A;  1K9U A;  1S6J A;  3FIA A;  2JT8 A;  1TCF A;  2KI6 D;  1XFY O;  1KSM A;  2PSR A;  1M45 A;  2MHH A;  1RWY A;  2MLE C;  1CMF A;  2BE4 A;  3EKJ A;  3SJS A;  2ZKM X;  4HRG A;  2CXJ A;  3LLE A;  2GV5 A;  1CTR A;  2JWW A;  1K94 A;  1EL4 A;  1Y6W A;  1UUS A;  2AMI A;  1NX0 A;  2JOJ A;  1K9P A;  1OMV A;  1IH0 A;  2F33 A;  1C7V A;  5CSF A;  4FQO A;  2L2E A;  3O78 A;  1FF1 A;  1F4Q A;  2IS9 A;  1BG1 A;  1DGV A;  1K95 A;  2ZFD A;  1K2H A;  2ZN8 A;  1CFC A;  1S6I A;  1NIW A;  2LUX A;  2M1K B;  2K2A A;  2L50 A;  1YVL A;  2LCP A;  1ZMZ A;  4MEW A;  1BJF A;  1M46 A;  2LHL A;  3VGO A;  1SR6 C;  4MLW A;  2EC6 B;  4GAO A;  1AP4 A;  3WNX B;  3EVR A;  3I5G C;  1TTX A;  2Y1N A;  4OCI A;  2I2R E;  1NWD A;  1QIV A;  2ZND A;  4GGF A;  5KTY A;  1VRK A;  1XFX O;  4OR9 B;  2H2K A;  2LVK A;  5AXI A;  1CM4 A;  2H61 A;  2K7D A;  2HQW A;  1C07 A;  1G4Y R;  4XJK A;  2KFF A;  2F2P A;  4PHM A;  1JFK A;  1R2U A;  3I5G B;  4BY4 A;  2EC6 C;  1SR6 B;  2LLU A;  1J7O A;  4C0J A;  1YUR A;  1W7I B;  3I5H B;  5KSZ A;  1DJH A;  1JBA A;  1KQM B;  1DVI A;  1LIN A;  4XYN A;  1MHO A;  3AAK A;  1CB1 A;  4PE0 A;  1FBV A;  1XK4 C;  3BOW B;  1CFD A;  1OE9 B;  2F8P A;  3O2P A;  3VRN A;  1CFP A;  1J7Q A;  3AKB A;  1BU3 A;  3BUX B;  3CGA A;  3PAT A;  1UHI A;  2BE6 A;  1QVI Z;  1F8H A;  3DD4 A;  1CFF A;  2WOS A;  4N1G A;  1YX7 A;  1S6C A;  3CLN A;  3HX4 A;  4HRE E;  1DJW A;  3TDU A;  1TNX A;  2M7N A;  3WXA A;  1YRT B;  1EJ3 A;  2K0J A;  2WCF A;  3PN7 C;  4YGA A;  1NUB A;  5J3X A;  1XFU O;  1SK6 D;  2F3Z A;  1ZAC A;  3FWB A;  4A4B A;  4AQI A;  4MSP A;  4E68 A;  1QLS A;  2PMY A;  3GK2 A;  3TS5 C;  4OVN F;  1NCZ A;  1WLM A;  4ZCU A;  1RRO A;  2M49 B;  3WHU B;  4UPG A;  5I2L A;  2MAZ A;  2AUC A;  2JT0 A;  1A29 A;  4ORB B;  5DKR A;  4XJK B;  1Y1A A;  1PVB A;  3BQ3 A;  5IBW A;  1Y0V H;  1QV1 A;  1JFJ A;  1SBJ A;  3TDI A;  1SCV A;  4WQ2 A;  1DGU A;  2BL0 C;  4WRI A;  3DVK A;  2WOR A;  1G33 A;  3BUM B;  2KBM A;  3SIB A;  1YUU A;  1WRK A;  1UHH A;  2MA2 A;  5CSN A;  3DVE A;  1UP5 A;  1TIZ A;  1JWD A;  2PAS A;  1AHR A;  5HKZ A;  2MJW B;  2CCM A;  1KWO C;  3O6B A;  1JF2 A;  1OZO A;  4IL1 A;  2GGM A;  1AJ5 A;  3LCP C;  1QS7 A;  2LE9 B;  1H8B A;  1J1D A;  1OMD A;  2KQ6 A;  2RGI A;  1TOP A;  1WDC C;  4MBE A;  2ZN9 A;  1YVH A;  3I5I B;  2P6B B;  5I2Q A;  1NCX A;  3CR5 X;  4PE7 A;  1ODB A;  1XA5 A;  3E3R A;  1SCM B;  4USL A;  2ZNE A;  1J7P A;  3SG3 A;  1F70 A;  2E6W A;  4R1E A;  1CDN A;  2OTG C;  3TUY B;  2KI6 C;  1TNP A;  3JTD B;  3BYA A;  2JUL A;  3BOW A;  2O5G A;  5JJG A;  4GPL B;  1B9A A;  2Q91 A;  1KCY A;  3PFV A;  5PAL A;  2LP2 A;  5AAN A;  2LVJ A;  1KK8 B;  1PAL A;  1IRJ A;  2OS8 B;  1PK0 D;  1QX2 A;  3NXA A;  1TN4 A;  3H4S E;  5CSJ A;  3DVJ A;  4CLN A;  3FS7 A;  1JSA A;  2L51 A;  2WCE A;  1K96 A;  1Y1U A;  1SNL A;  2M9G A;  1WY9 A;  4MZL A;  3TDZ A;  4QJ3 B;  2K2F A;  2Y5I A;  2JZI A;  4P5O E;  2JXC A;  1RTP 1;  2MRD A;  1OQP A;  1F71 A;  2LMT A;  1J1E A;  1QAS A;  4DCK A;  2JU0 A;  1CLM A;  4MVF A;  1JC2 A;  3DF0 B;  3EKH A;  2PAL A;  3SG2 A;  1F54 A;  1DJY A;  1PSR A;  1EXR A;  1YTZ C;  2HPS A;  1ZUZ A;  2KI4 C;  3F45 A;  1N2D A;  2KFG A;  5AFP A;  2M0R A;  1JUO A;  1LA0 A;  1SW8 A;  1FPW A;  1LXF C;  4WQ3 A;  1EH2 A;  1U5I A;  3AAJ A;  5AER A;  4M2Q A;  3LK0 A;  5CSI A;  4ORA B;  5GQQ C;  4M2P A;  1ZFS A;  1QJT A;  1V1G A;  2JPT A;  3CWG A;  2TN4 A;  2K8M B;  1EG3 A;  1RJV A;  2LUC A;  2QAC A;  1A03 A;  5I8N A;  5K89 A;  1NX3 A;  4JPZ B;  1IQ3 A;  4D1E A;  2LLT A;  1TCO B;  1CDP A;  2KAY A;  2LM5 A;  2V53 A;  1YUS A;  3NSO A;  1H4B A;  5G08 A;  1OOJ A;  1UHK A;  3OB2 B;  1CKK A;  4GGF C;  2ZRS A;  1IJ6 A;  1UHJ A;  2PVB A;  3OX6 A;  2L5X B;  3IF7 A;  1KK8 C;  1F4O A;  4ETO A;  5TNC A;  1CLB A;  3BUW B;  1XK4 A;  1MQ1 A;  1S26 D;  3JTD C;  5HYD A;  1S36 A;  3DVM A;  2Y1M A;  3TUY C;  1QVI Y;  3CZT X;  2LHI A;  1IKU A;  1B8C A;  2H61 C;  4YRU A;  2DOQ A;  1SCM C;  1A2X A;  1BT6 A;  4YGB B;  3LK1 A;  4YGC B;  4BY5 A;  1WLZ A;  1QAT A;  1HT9 A;  1MXE A;  1B1G A;  3VRR A;  1DF0 A;  2E30 A;  1BMO A;  1OZS A;  3PAL A;  2G9B A;  2F2O A;  4CFR A;  1WDC B;  1S5G Z;  1D1O A;  2JC2 A;  1WRZ A;  2LP3 A;  1DJX A;  3OHM B;  1NSH A;  4PAL A;  2LV7 A;  3KF9 A;  1L2O C;  1F55 A;  4Q04 A;  2Y4Q A;  2BCX A;  3ZNI A;  2NLN A;  1AUI B;  1TRF A;  1RFJ A;  3PM8 A;  4GBA A;  1LA3 A;  2G2B A;  5AEQ A;  5BPJ A;  1K8U A;  1FI5 A;  3VRO A;  1Y1X A;  2BKI B;  1LKJ A;  1UHN A;  1DF0 B;  2BKH B;  2KAV A;  1W7J B;  2LNK A;  3MSE B;  4PHJ A;  1HQV A;  3OB1 B;  3PSR A;  2L98 A;  1PVA A;  1GGW A;  2JNF A;  4ICB A;  1IGV A;  2NCO A;  1DJZ A;  1XO5 A;  2M1U A;  1R6P A;  2M3W A;  3ICB A;  1MXL C;  1E8A A;  1XFZ O;  3EK4 A;  1MF8 B;  2EGD A;  3CS1 A;  1XFV O;  2I94 A;  1MUX A;  1YX8 A;  2B1U A;  4C0K A;  4MRY A;  1KFU L;  1GJY A;  1QX5 B;  1CNP A;  1NP8 A;  3A8R A;  2LAN A;  3IQO A;  2HET A;  4ZCV A;  4I5N B;  2ISD A;  1PSB A;  4GUK A;  3OX5 A;  2O60 A;  1M31 A;  4PE4 A;  1REC A;  4MZK A;  1K93 D;  1S5G Y;  1BF5 A;  2BCB A;  1NX1 A;  1ALW A;  1BR1 B;  3BUN B;  3LL8 B;  3PN7 B;  1OSA A;  4FTG A;  4JQ0 D;  3RLZ A;  3NSL A;  2K7O A;  1CLL A;  3CR4 X;  1RK9 A;  3SG7 A;  1BOD A;  1IQ5 A;  1BR4 B;  2FCD A;  1N0Y A;  2NXQ A;  4I5J A;  3VRP A;  4GNK B;  4A4C A;  2KGR A;  1CMG A;  1IG5 A;  1DMO A;  2M7L A;  4HRH A;  3HCM A;  3KPX A;  1CM1 A;  3EVU A;  2WCB A;  1B8L A;  5HKW A;  1XYD A;  3C1V A;  2A4J A;  1FW4 A;  1CDL A;  2FOT A;  1L2O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...