1Y6WA

Trapped intermediate of calmodulin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
145
structure length
145
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGCNPTEAELQDMINEVDADGNGTINFPEFLTMMARCMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Trapped Intermediate of Calmodulin: Calcium Regulation of EF-hand Proteins from a New Perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
molecule keywords Calmodulin
total genus 43
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2004-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y6wA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y6wA02
2BL0C 4WQ3A 1OMDA 2Y5IA 2BE6A 3VRNA 3DF0B 1DJZA 1KK8B 5TNCA 4C0JA 1JC2A 1SL9A 1YVLA 1QVIZ 4I5JA 3NSKA 4PCWA 1S5GZ 1A4PA 1JF0A 4FQOA 4ORBB 3MSEB 4HSZA 1S5GY 1WRKA 2HETA 1NYAA 2EGDA 5HLOA 3TS5C 5D69A 3D0YA 2LANA 4I5KA 1DGVA 1B7TY 4N1FA 1S26D 2AUCA 3EKJA 1FBVA 2LC5A 1XFVO 3BYAA 5J3XA 5PALA 3K21A 1EXRA 1XK4A 3D0YB 1SCMB 2LAPA 5HKZA 1XFUO 1DJGA 4QJ5B 2K7OA 1TN4A 1CMGA 2LCPA 1U5IA 1KSOA 2LMUA 4YRUA 2NXQA 2F2OA 4DCKA 1CTRA 1NX2A 2E30A 1NCYA 2OS8C 4MZLA 2KBMA 4XJKA 1DF0A 3LCPC 5DKNA 3EK8A 2EC6B 1JWDA 2LHLA 1CFCA 1E8AA 2FCDA 2E6WA 1R6PA 1H8BA 4IL1A 1F4QA 4U8DA 5AEQA 1GJYA 1LA0A 1QX5B 4NDCA 4MRXA 2H61A 1QLKA 4F0ZB 1PVAA 1PULA 1TCOB 1SYMA 3CTNA 3TS5B 4C0LA 1J55A 1SCMC 2F33A 4MLWA 3RLZA 2MA2A 1QLSA 2JPTA 1L2OC 1OZOA 1SL8A 1AVSA 1FPWA 1WLZA 3M0WA 5I8NA 1UHNA 2K7BA 5HLVA 1B7TZ 1J1EA 1J1DA 2FCEA 3BUWB 1KQMB 2LLSA 2I18A 2WORA 4CFQA 1EJ3A 2M1UA 2BL0B 2Q91A 2K61A 2BKIB 2GGMA 1IQ3A 1MQ1A 3KHEA 2A4JA 1CFFA 3H4SE 1KK8C 1U5IB 3DF0A 4R1EA 5AERA 2F3ZA 1NX1A 1CM1A 1RJVA 2JOJA 2MLFC 2PALA 1QX7A 1YRUB 1S3PA 2F3YA 5BPJA 2OPOA 1M39A 2IS9A 3EVVA 1A03A 2LP3A 3HX4A 2M49B 1WLMA 4USLA 5FYXA 4N5XA 2JQ6A 2NCPA 1IKUA 4YGBB 5KTYA 2M97A 3PN7C 1B8LA 2PRUA 1NSHA 1AK8A 1RFJA 1F8HA 3I5IB 3PN7B 5I2OA 4I5NB 2KGRA 3SG6A 1OMRA 2EHBA 4UPGA 1SMGA 2LVKA 1CDMA 1M46A 1WDCC 1PALA 3EK7A 1CDLA 2LP2A 1KQVA 2ZRTA 3WXAA 5AANA 1BF5A 3TDZA 1YUTA 2ZNDA 3DVJA 1NCZA 5IBWA 1UUSA 1JFJA 4GGFC 1YX8A 3E3RA 1WRLA 1YVHA 1QJTA 1IG5A 3AKAA 4HRHA 3WHUB 3VROA 3BUOB 2TN4A 1A29A 1IWQA 1Y1XA 1XFZO 3VRRA 3BQ3A 1BOCA 2KYCA 4XJKB 2KBIA 3WNXB 3DVEA 1FI6A 2KFHA 1DGUA 1YR5A 2COLB 3KF9A 1BR4B 1TIZA 2G2BA 1IH0A 5HYDA 2QPTA 1UURA 5K89A 1ODBA 2JULA 4ETOA 1JBAA 1MHOA 2K7CA 2BKHB 4GPLB 1S6IA 3A8RA 1DJHA 3SJSA 1SPYA 2KFGA 2KYFA 3HCMA 5I2QA 1RWYA 2JXCA 1NUBA 1G4YR 2JWWA 1W7IB 2L4HA 3FS7A 1UHKA 1B9AA 1K93D 2KFFA 2P6BB 3LLEA 1CLBA 2BBMA 2LE9B 1AJ4A 2M8UA 4CPVA 1BLQA 3I5FB 1GGWA 2M0RA 1AHRA 3NSLA 3FWBA 1C7VA 1YURA 4E68A 5F6TA 2I7AA 2H61C 1SL7A 2CBLA 2ZNEA 4MVFA 1KSMA 2NZ0A 4MN0A 3BUMB 4PE4A 1KCYA 2KGBC 3EKHA 1D1OA 1SCVA 1Y1UA 3DVMA 3BXKA 2H2KA 4AOMA 5AXIA 1EL4A 1OZSA 1WDCB 4ORAB 2V53A 1UHIA 3NSIA 3PLFB 2LMTA 1BT6A 2F8PA 1GQMA 2LV7A 3BUNB 3DD4A 4NQGA 1XFYO 2MHHA 3SG3A 2NLNA 2F2PA 2ZN9A 1RECA 3AAJA 5D7FA 1TCFA 4ORCB 1LKJA 1DJYA 3WHTB 4XYNA 1HT9A 3VRPA 4JWQA 2LVJA 3TUYB 4A4BA 1UHJA 2M3WA 1JUOA 3ICBA 3OX5A 1LA3A 5KSZA 2Y4QA 1F55A 2KI4C 2LMVA 5ER4X 1QV0A 3I5IC 2KSPA 2PSRA 4TNCA 1WRZA 1KQMC 4PALA 3CWGA 1SNLA 1YTZC 2JTZA 4DUQA 3IQOA 3TDUA 2CXJA 1SR6B 4ICBA 3BUXB 1B8RA 2LLTA 1DF0B 1Y1AA 2KAYA 1EH2A 4GGFA 2K8MB 4FTGA 3OB2B 1TTXA 1A75B 5JOLA 1MF8B 3EVRA 2BECA 5JJGA 1BG1A 1LXFC 2AAOA 1V1GA 4YGDB 1CB1A 2BCAA 2PVBA 2LUXA 4WRIA 3A4UB 3BOWB 1MXEA 2JU0A 1TNXA 1N65A 1YUSA 3I5FC 1CDNA 2M29A 1YX7A 2JZIA 1PVBA 2MAZA 4PE1A 1SRAA 2LVIA 2ZFDA 4OV2A 4BY4A 1MXLC 2K0JA 1MUXA 4P2YB 1BODA 3CR4X 2KDHA 3VRQA 1LINA 1PK0D 2OS8B 3FIAA 1K95A 4MEWA 1KFUL 3CGAA 2LLUA 4GGNA 1JF2A 1KFXL 1F71A 2Q4UA 1MWNA 1NPQA 2WCFA 1KFUS 1OOJA 1ZUZA 3CS1A 4GFTA 2LM5A 2PASA 3ZWHA 2GGZA 2PMYA 2KAXA 4MBEA 3PFVA 1C07A 2HQ8A 1M63B 1NCXA 1J7OA 1ZFSA 3JVTB 3OP0A 1UWOA 2Y1NA 2MJWB 4PDZA 1QTXA 4AQJA 1HQVA 1K9KA 2VRGA 3AKBA 4N1GA 1QATA 1L2OB 2L0PA 2KNEA 3EK4A 2WOSA 4ZCUA 1FW4A 1S6JA 1TNQA 3CR2A 4OCIA 3SG4A 4PHMA 2WNDA 1KWOC 5HKYA 1S1EA 3KO0A 1DT7B 1ALWA 1V1FA 1ZMZA 2L50A 5GQQC 3JTDC 1UHHA 1S36A 4QJ4B 3GK4X 3JTDB 1JSAA 4CIDA 2L51A 2OTGB 1GGZA 3PALA 3ZNIA 1VRKA 1CDPA 3I5HC 3SIBA 5KU1A 1OE9B 1CM4A 2RGIA 2KQYA 1S6CA 1KK7Z 3AAKA 1BMOA 1CKKA 2JC2A 2KQ6A 1G8IA 2JNXA 1F54A 1CFDA 1Y0VH 3PM8A 3I5GC 1CLLA 3TUYC 2LUCA 1XK4C 1XFWO 2WCBA 2NCOA 3IQQA 3O2PA 1QIWA 2HQWA 2K2FA 2KI4B 3BOWA 2M7LA 2I94A 1DJWA 2WC8A 3GOFA 4YGEB 1XFXO 4OR9B 2FJUB 2SASA 1CNPA 1AJ5A 4A4CA 2CT9A 2JT0A 1BR1B 1G33A 1Y6WA 2CCMA 3LL8B 4DIRA 1KWOB 1DMOA 2BCBA 2M1KB 2SCPA 1K9PA 4QJ3B 2FOTA 1B1GA 5B8IB 2JT8A 4DS7A 3PATA 3VGOA 1DJIA 3O78A 1SR6C 5CSNA 1SKTA 3GK1A 1QV1A 1EG3A 1H4BA 1IGVA 2L98A 3I5GB 1X02A 2CTNA 2OTGC 4JQ0D 2LHIA 1SK6D 2MBXA 2CNPA 1K90D 1UP5A 4PHJA 2BBNA 2L5XB 4GBAA 4GAOA 3TDIA 2L4IA 2JXLA 1MR8A 2O5GA 3SIAA 1CLMA 1IQ5A 3QRXA 2ISDA 2KI6D 3LK1A 1W7JB 2JTTA 4NDDA 4PHKA 2DOQA 1CMFA 2LNKA 2M7NA 5DKRA 4GNKB 3SG7A 1K94A 4M2PA 2G9BA 3O4YA 1A2XA 2K7DA 1J7PA 1PSBA 3CLNA 1QX2A 4YGCB 5CSIA 1N2DA 2JRFA 2K2AA 1SY9A 3SG2A 4BY5A 1A75A 4YGAA 3KPXA 1QS7A 5ER5A 2M9GA 3SG5A 2AMIA 1AUIB 1K9UA 1QASA 2Y1MA 3DVKA 1BJFA 4HREE 4OVNF 1K2HA 1R2UA 2D8NA 5HKWA 1PRWA 4Q04A 1J7QA 1M31A 1NP8A 1IJ6A 1EG4A 1PSRA 1XVJA 2O60A 4M2QA 3TZ1A 4YBHB 1B4CA 1L7ZA 3NXAA 2I2RE 3JVTC 2KI6C 4WQ2A 4CFRA 1B8CA 1YUUA 2JT3A 1XYDA 2QACA 2ZN8A 5CSJA 1RTP1 4I5LB 5DKQA 2EC6C 1F4OA 4DRWA 1K96A 1N0YA 1NIWA 1TOPA 1KK7Y 3FWCA 3KEVA 4ZCVA 1QVIY 1SBJA 1WY9A 4P5OE 4NDBA 5I2LA 1NX0A 2HF5A 3I5HB 1IJ5A 1FI5A 1XO5A 2MLEC 1ALVA 3F45A 1AP4A 2KHNA 2HPSA 3RM1A 1XA5A 3LK0A 1NWDA 3OB1B 1K8UA 1BU3A 1OMVA 3O6BA 1JFKA 1F70A 4JPZB 5G08A 4HRGA 1DJXA 1LVCD 1DVIA 4L9MA 2JNFA 4MZJA 1TNWA 4GUKA 1FF1A 1KFXS 3EVUA 2WCEA 4MSPA 1Q80A 4YI8A 4C0KA 4PHNA 1CFPA 1QIVA 1TNPA 1DTLA 2MRDA 3GK2A 1ZOTB 1B47A 4OKHA 2ZRSA 5CSFA 5AFPA 1OQPA 3CR5X 3OHMB 4MZKA 1OSAA 2BE4A 2ZKMX 3D10A 4AQIA 4PE7A 4PE0A 3C1VA 3CZTX 3OX6A 1ZACA 3PSRA 1SW8A 2LVVA 2BCXA 1TRFA 1RROA 1YRTB 4M2OA 1NX3A 1M45A 2GV5A 1J7RA 2L2EA 4MRYA 2B1UA 4D1EA 1RK9A 1QXPA 4YI9A 3IF7A 2KOTA 1C7WA 4CLNA 1IRJA 2R2IA 2KAVA 5CPVA 3NSOA
chains in the Genus database with same CATH superfamily
2BL0C 4WQ3A 1OMDA 2Y5IA 2BE6A 3VRNA 3DF0B 1DJZA 4KYNA 1KK8B 5TNCA 4C0JA 1JC2A 5I94A 1SL9A 1YVLA 1QVIZ 4I5JA 3CABA 3NSKA 4PCWA 1S5GZ 1A4PA 1JF0A 4FQOA 4ORBB 3MSEB 4HSZA 1S5GY 1WRKA 2HETA 1NYAA 2EGDA 5HLOA 3TS5C 5D69A 3D0YA 2LANA 4I5KA 1DGVA 1B7TY 4N1FA 1S26D 2AUCA 3EKJA 1FBVA 2LC5A 1XFVO 3BYAA 5J3XA 5PALA 3K21A 1EXRA 1DC1A 1DEKA 1XK4A 3D0YB 1SCMB 2LAPA 4FQTA 3VB1A 5HKZA 1XFUO 1DJGA 4QJ5B 3DYEA 2K7OA 1TN4A 1TWOA 1CMGA 2LCPA 1U5IA 1KSOA 2LMUA 4YRUA 2NXQA 2F2OA 4DCKA 1CTRA 1NX2A 1ORGA 2E30A 1NCYA 2OS8C 4MZLA 2KBMA 4XJKA 1DF0A 3LCPC 5DKNA 3EK8A 2EC6B 4IJ7A 1JWDA 2LHLA 1CFCA 1E8AA 2FCDA 2QEHA 2E6WA 1R6PA 1H8BA 4IL1A 1F4QA 4U8DA 5AEQA 1GJYA 1LA0A 1QX5B 4NDCA 3DY9A 2FJYA 4MRXA 2H61A 1QLKA 4F0ZB 1PVAA 1PULA 1TCOB 1SYMA 3CTNA 3BFAA 3TS5B 4C0LA 1J55A 1SCMC 2F33A 4MLWA 3RLZA 2MA2A 1QLSA 2JPTA 1L2OC 1OZOA 1SL8A 1AVSA 1FPWA 1WLZA 3M0WA 5I8NA 3DZTA 1UHNA 2K7BA 5HLVA 1B7TZ 1J1EA 1J1DA 2FCEA 3BUWB 1KQMB 2LLSA 2I18A 2WORA 4CFQA 1EJ3A 2M1UA 1TUJA 2BL0B 2K61A 2Q91A 3S0BA 1C3YA 1C3ZA 2BKIB 2GGMA 1IQ3A 1MQ1A 3KHEA 2A4JA 1CFFA 3H4SE 1KK8C 1U5IB 3DF0A 4R1EA 5AERA 1OOGA 2F3ZA 1NX1A 1CM1A 1RJVA 2JOJA 2MLFC 2PALA 1QX7A 1YRUB 1S3PA 2F3YA 5BPJA 2OPOA 1Z4HA 1M39A 2IS9A 3EVVA 1A03A 2LP3A 3HX4A 2M49B 1WLMA 4USLA 5FYXA 4N5XA 2JQ6A 2NCPA 1IKUA 4YGBB 5KTYA 2M97A 3PN7C 1B8LA 2PRUA 1NSHA 2WC6A 1AK8A 1RFJA 1F8HA 3I5IB 3PN7B 5I2OA 4I5NB 2KGRA 3BFBA 1OMRA 3SG6A 2L5YA 2EHBA 5EL2A 4UPGA 5HL1A 1SMGA 2P70A 2LVKA 1CDMA 1M46A 1WDCC 3D77A 1PALA 3EK7A 1CDLA 2LP2A 4OZDA 1KQVA 2ZRTA 3WXAA 5AANA 1BF5A 3CYZA 3TDZA 1YUTA 2ZNDA 3DVJA 1NCZA 5IBWA 1UUSA 1JFJA 4GGFC 1YX8A 3E3RA 1WRLA 1YVHA 1QJTA 1IG5A 3SS5A 1TUZA 3AKAA 4HRHA 3WHUB 3VROA 3BUOB 3K1EA 3S0AA 2TN4A 1A29A 1IWQA 1Y1XA 1XFZO 3VRRA 3BQ3A 1BOCA 2KYCA 1W9ZA 4XJKB 1P28A 2KBIA 3WNXB 3DVEA 1FI6A 4PT1A 3B87A 2KFHA 1DGUA 3L4AA 1YR5A 2COLB 3KF9A 1BR4B 1TIZA 2G2BA 1IH0A 5HYDA 2QPTA 1UURA 5K89A 1ODBA 2JULA 4ETOA 1JBAA 1MHOA 2K7CA 2BKHB 4GPLB 1S6IA 3A8RA 3OBVA 1DJHA 3SJSA 1SPYA 2KFGA 2KYFA 3CZ1A 3HCMA 5I2QA 3SS4A 1RWYA 2JXCA 1NUBA 1G4YR 2JWWA 1W7IB 2L4HA 3FS7A 1UHKA 1B9AA 1K93D 2KFFA 1OOFA 2P6BB 3LLEA 1CLBA 2BBMA 2LE9B 1AJ4A 2M8UA 4CPVA 1BLQA 3I5FB 1GGWA 2M0RA 1AHRA 3NSLA 3FWBA 1C7VA 1YURA 4E68A 5F6TA 2H8VA 2I7AA 5FI6A 3UO9A 2H61C 3N7HA 1SL7A 2CBLA 2ZNEA 3O4XA 1KSMA 2NZ0A 4INWA 3BUMB 4MN0A 4MVFA 4PE4A 1KCYA 2KGBC 3EKHA 1D1OA 1SCVA 1Y1UA 3DVMA 1OW4A 3BXKA 2H2KA 3QMEA 4AOMA 5AXIA 1EL4A 1OZSA 1WDCB 4ORAB 2V53A 1UHIA 3NSIA 3PLFB 2LMTA 3NHTA 1BT6A 2F8PA 1GQMA 2KLEA 2LV7A 3BUNB 3DD4A 4NQGA 1XFYO 2MHHA 3SG3A 2NLNA 2F2PA 2ZN9A 1RECA 3AAJA 3BFHA 3D74A 5D7FA 1TCFA 4ORCB 1LKJA 1DJYA 2BNXA 3EG5B 3WHTB 4XYNA 3O2PA 1HT9A 3R1VA 3VRPA 4JWQA 2LVJA 3TUYB 3S0GA 4A4BA 1UHJA 2M3WA 1JUOA 3ICBA 3OX5A 3S0DA 1LA3A 5KSZA 2Y4QA 1F55A 3BJHA 2KI4C 3PM2A 2LMVA 5ER4X 1QV0A 3I5IC 2KSPA 2PSRA 4TNCA 1WRZA 3V2LA 1KQMC 4PALA 3CWGA 1SNLA 1YTZC 2JTZA 2M7LA 4DUQA 3B86A 3IQOA 2CXJA 3TDUA 1SR6B 4ICBA 3BUXB 1B8RA 2LLTA 1DF0B 1Y1AA 2KAYA 1EH2A 4GGFA 2K8MB 4FTGA 3OB2B 1TTXA 1A75B 5JOLA 1T14A 1MF8B 3EVRA 5DICA 2BECA 5JJGA 1BG1A 1LXFC 2AAOA 3R1OA 1V1GA 4YGDB 3CZ0A 2BCAA 2PVBA 2LUXA 4JD9A 3A4UB 3BOWB 1MXEA 2L2CA 4WRIA 2JU0A 1TNXA 1N65A 1YUSA 3I5FC 2YGUA 5FI7A 1CDNA 2M29A 1YX7A 2JZIA 1PVBA 2MAZA 3FE8A 1SRAA 2LVIA 4PE1A 2ZFDA 4OV2A 4BY4A 2WCJA 1MXLC 2K0JA 1MUXA 1DQEA 4P2YB 5FI2A 1BODA 3CR4X 2KDHA 3RZSA 3VRQA 1LINA 1PK0D 2OS8B 3OGNA 2QDIA 3FIAA 1K95A 4MEWA 1KFUL 3CGAA 2LLUA 4GGNA 1JF2A 1KFXL 1F71A 2Q4UA 1GM0A 1MWNA 1NPQA 1DELA 2WCFA 1KFUS 1OOJA 1ZUZA 3CS1A 4GFTA 2LM5A 2PASA 3ZWHA 2GGZA 2PMYA 2KAXA 4MBEA 3PFVA 4JKTA 1OOIX 1C07A 2HQ8A 1M63B 1NCXA 1J7OA 1ZFSA 2WCMA 2JPOA 3FE6A 1UWOA 2Y1NA 2MJWB 3JVTB 3OP0A 4PDZA 1QTXA 4AQJA 3NHIA 1HQVA 1SSEB 1K9KA 2VRGA 3AKBA 4N1GA 1QATA 1L2OB 2L0PA 2KNEA 3EK4A 2WOSA 4ZCUA 1FW4A 1S6JA 1TNQA 3CR2A 4OCIA 3SG4A 4PHMA 2WNDA 1KWOC 5HKYA 1S1EA 3KO0A 1DT7B 1ALWA 1V1FA 1ZMZA 2K60A 2L50A 3B7AA 1UHHA 1S36A 2WCLA 3D76A 3JTDC 5GQQC 4F7FA 3GK4X 3JTDB 1JSAA 4CIDA 2PQLA 2L51A 2OTGB 1GGZA 3PALA 3ZNIA 1VRKA 1CDPA 1IIOA 3I5HC 3SIBA 5KU1A 1OE9B 1CM4A 2RGIA 3L47A 3D78A 2KQYA 1S6CA 1KK7Z 3AAKA 1BMOA 1CKKA 2JC2A 2KQ6A 1G8IA 2JNXA 3UNWA 1F54A 1CFDA 1Y0VH 3PM8A 3I5GC 1CLLA 3TUYC 1OOHA 2LUCA 1XK4C 1XFWO 2WCBA 2NCOA 2P71A 3IQQA 1QIWA 1Z2CB 2HQWA 2K2FA 2KI4B 3BOWA 2I94A 1DJWA 2WC8A 3D75A 3GOFA 1XFXO 4YGEB 4OR9B 2FJUB 2SASA 1CNPA 1AJ5A 4A4CA 2CT9A 2JT0A 1BR1B 1G33A 1Y6WA 2CCMA 2KLDA 2PYQA 3LL8B 2QEVA 1KWOB 4DIRA 2BCBA 2M1KB 2SCPA 1K9PA 1DMOA 4QJ3B 2FOTA 3NGVA 4INXA 1B1GA 5B8IB 2JT8A 4DS7A 3PATA 3VGOA 1DJIA 3O78A 1SR6C 3Q8IA 1SKTA 5CSNA 3GK1A 1QV1A 1EG3A 2WCKA 1IGVA 2L98A 3D73A 3SS3A 3I5GB 1H4BA 1X02A 2CTNA 2OTGC 4JQ0D 2KPHA 2LHIA 2GTEA 1SK6D 2MBXA 2CNPA 1K90D 1UP5A 4PHJA 2BBNA 2L5XB 4GBAA 4GAOA 3TDIA 2L4IA 3S0FA 2JXLA 1MR8A 2O5GA 3SIAA 1CLMA 1IQ5A 3IVTA 3QRXA 2KI6D 3LK1A 1W7JB 2ISDA 2JTTA 4NDDA 4PHKA 2DOQA 1CMFA 2LNKA 2M7NA 3B6XA 5DKRA 3PJIA 4GNKB 3SG7A 1K94A 4M2PA 2G9BA 3O4YA 1A2XA 2K7DA 2QEOA 1QWVA 1PSBA 3CLNA 1J7PA 1QX2A 4YGCB 5CSIA 1N2DA 2JRFA 2K2AA 1SY9A 3SG2A 4BY5A 1A75A 4YGAA 3KPXA 1QS7A 5ER5A 2M9GA 3SG5A 2AMIA 1AUIB 1K9UA 1QASA 2Y1MA 3DVKA 1BJFA 4HREE 4OVNF 1K2HA 1R2UA 2D8NA 5HKWA 1PRWA 2ERBA 4Q04A 1J7QA 1M31A 1NP8A 1IJ6A 1EG4A 1PSRA 1XVJA 1CB1A 2O60A 4M2QA 3TZ1A 4YBHB 1B4CA 1L7ZA 3NXAA 2I2RE 3JVTC 2KI6C 4WQ2A 4CFRA 1B8CA 1YUUA 2JT3A 1XYDA 2QACA 2ZN8A 5CSJA 1RTP1 4I5LB 5DKQA 2EC6C 1F4OA 3L4LA 4DRWA 1K96A 1N0YA 1NIWA 1TOPA 1KK7Y 3FWCA 3KEVA 4ZCVA 1QVIY 3S0EA 1SBJA 1WY9A 4P5OE 4NDBA 5I2LA 1NX0A 2HF5A 2QEBA 1LS8A 3I5HB 2WC5A 1IJ5A 1FI5A 1XO5A 2MLEC 1ALVA 3F45A 1AP4A 2KHNA 2HPSA 3R1PA 3RM1A 3R72A 1XA5A 3DXLA 3LK0A 1NWDA 3OB1B 4QJ4B 1K8UA 1BU3A 1OMVA 3O6BA 1JFKA 1F70A 4JPZB 5G08A 4HRGA 1DJXA 1LVCD 1DVIA 4L9MA 3CDNA 2JNFA 4MZJA 1XFRA 1TNWA 4GUKA 1FF1A 1KFXS 3EVUA 2WCEA 4MSPA 1Q80A 4YI8A 4C0KA 4PHNA 1CFPA 1QIVA 1TNPA 1DTLA 2MRDA 3GK2A 1ZOTB 1B47A 4OKHA 2ZRSA 5CSFA 5AFPA 1OQPA 3CR5X 3FE9A 3OHMB 4MZKA 1OSAA 2BE4A 2ZKMX 3D10A 4AQIA 4PE7A 4PE0A 3B88A 3C1VA 3CZTX 3OX6A 1ZACA 3PSRA 1SW8A 2WCHA 2LVVA 2BCXA 1TRFA 1RROA 1YRTB 4M2OA 2BAPA 5D3OA 1NX3A 1M45A 2GV5A 1J7RA 2L2EA 4MRYA 2B1UA 3CZ2A 4D1EA 1RK9A 1QXPA 4YI9A 3IF7A 2KOTA 1C7WA 4CLNA 1IRJA 2R2IA 2KAVA 5CPVA 3NSOA
chains in the Genus database with same CATH topology
2BL0C 4WQ3A 1OMDA 2Y5IA 2BE6A 3VRNA 3DF0B 1DJZA 1KK8B 5TNCA 4C0JA 1JC2A 1SL9A 1YVLA 1QVIZ 4I5JA 3NSKA 4PCWA 1S5GZ 1A4PA 1JF0A 4FQOA 4ORBB 3MSEB 4HSZA 1S5GY 1WRKA 2HETA 1NYAA 2EGDA 5HLOA 3TS5C 5D69A 3D0YA 2LANA 4I5KA 1DGVA 1B7TY 4N1FA 1S26D 2AUCA 3EKJA 1FBVA 2LC5A 1XFVO 3BYAA 5J3XA 5PALA 3K21A 1EXRA 1XK4A 3D0YB 1SCMB 2LAPA 5HKZA 1XFUO 1DJGA 4QJ5B 2K7OA 1TN4A 1CMGA 2LCPA 1U5IA 1KSOA 2LMUA 4YRUA 2NXQA 2F2OA 4DCKA 1CTRA 1NX2A 2E30A 1NCYA 2OS8C 4MZLA 2KBMA 4XJKA 1DF0A 3LCPC 5DKNA 3EK8A 2EC6B 1JWDA 2LHLA 1CFCA 1E8AA 2FCDA 2E6WA 1R6PA 1H8BA 4IL1A 1F4QA 4U8DA 5AEQA 1GJYA 1LA0A 1QX5B 4NDCA 4MRXA 2H61A 1QLKA 4F0ZB 1PVAA 1PULA 1TCOB 1SYMA 3CTNA 3TS5B 4C0LA 1J55A 1SCMC 2F33A 4MLWA 3RLZA 2MA2A 1QLSA 2JPTA 1L2OC 1OZOA 1SL8A 1AVSA 1FPWA 1WLZA 3M0WA 5I8NA 1UHNA 2K7BA 5HLVA 1B7TZ 1J1EA 1J1DA 2FCEA 3BUWB 1KQMB 2LLSA 2I18A 2WORA 4CFQA 1EJ3A 2M1UA 2BL0B 2Q91A 2K61A 2BKIB 2GGMA 1IQ3A 1MQ1A 3KHEA 2A4JA 1CFFA 3H4SE 1KK8C 1U5IB 3DF0A 4R1EA 5AERA 2F3ZA 1NX1A 1CM1A 1RJVA 2JOJA 2MLFC 2PALA 1QX7A 1YRUB 1S3PA 2F3YA 5BPJA 2OPOA 1M39A 2IS9A 3EVVA 1A03A 2LP3A 3HX4A 2M49B 1WLMA 4USLA 5FYXA 4N5XA 2JQ6A 2NCPA 1IKUA 4YGBB 5KTYA 2M97A 3PN7C 1B8LA 2PRUA 1NSHA 1AK8A 1RFJA 1F8HA 3I5IB 3PN7B 5I2OA 4I5NB 2KGRA 3SG6A 1OMRA 2EHBA 4UPGA 1SMGA 2LVKA 1CDMA 1M46A 1WDCC 1PALA 3EK7A 1CDLA 2LP2A 1KQVA 2ZRTA 3WXAA 5AANA 1BF5A 3TDZA 1YUTA 2ZNDA 3DVJA 1NCZA 5IBWA 1UUSA 1JFJA 4GGFC 1YX8A 3E3RA 1WRLA 1YVHA 1QJTA 1IG5A 3AKAA 4HRHA 3WHUB 3VROA 3BUOB 2TN4A 1A29A 1IWQA 1Y1XA 1XFZO 3VRRA 3BQ3A 1BOCA 2KYCA 4XJKB 2KBIA 3WNXB 3DVEA 1FI6A 2KFHA 1DGUA 1YR5A 2COLB 3KF9A 1BR4B 1TIZA 2G2BA 1IH0A 5HYDA 2QPTA 1UURA 5K89A 1ODBA 2JULA 4ETOA 1JBAA 1MHOA 2K7CA 2BKHB 4GPLB 1S6IA 3A8RA 1DJHA 3SJSA 1SPYA 2KFGA 2KYFA 3HCMA 5I2QA 1RWYA 2JXCA 1NUBA 1G4YR 2JWWA 1W7IB 2L4HA 3FS7A 1UHKA 1B9AA 1K93D 2KFFA 2P6BB 3LLEA 1CLBA 2BBMA 2LE9B 1AJ4A 2M8UA 4CPVA 1BLQA 3I5FB 1GGWA 2M0RA 1AHRA 3NSLA 3FWBA 1C7VA 1YURA 4E68A 5F6TA 2I7AA 2H61C 1SL7A 2CBLA 2ZNEA 4MVFA 1KSMA 2NZ0A 4MN0A 3BUMB 4PE4A 1KCYA 2KGBC 3EKHA 1D1OA 1SCVA 1Y1UA 3DVMA 3BXKA 2H2KA 4AOMA 5AXIA 1EL4A 1OZSA 1WDCB 4ORAB 2V53A 1UHIA 3NSIA 3PLFB 2LMTA 1BT6A 2F8PA 1GQMA 2LV7A 3BUNB 3DD4A 4NQGA 1XFYO 2MHHA 3SG3A 2NLNA 2F2PA 2ZN9A 1RECA 3AAJA 5D7FA 1TCFA 4ORCB 1LKJA 1DJYA 3WHTB 4XYNA 1HT9A 3VRPA 4JWQA 2LVJA 3TUYB 4A4BA 1UHJA 2M3WA 1JUOA 3ICBA 3OX5A 1LA3A 5KSZA 2Y4QA 1F55A 2KI4C 2LMVA 5ER4X 1QV0A 3I5IC 2KSPA 2PSRA 4TNCA 1WRZA 1KQMC 4PALA 3CWGA 1SNLA 1YTZC 2JTZA 4DUQA 3IQOA 3TDUA 2CXJA 1SR6B 4ICBA 3BUXB 1B8RA 2LLTA 1DF0B 1Y1AA 2KAYA 1EH2A 4GGFA 2K8MB 4FTGA 3OB2B 1TTXA 1A75B 5JOLA 1MF8B 3EVRA 2BECA 5JJGA 1BG1A 1LXFC 2AAOA 1V1GA 4YGDB 1CB1A 2BCAA 2PVBA 2LUXA 4WRIA 3A4UB 3BOWB 1MXEA 2JU0A 1TNXA 1N65A 1YUSA 3I5FC 1CDNA 2M29A 1YX7A 2JZIA 1PVBA 2MAZA 4PE1A 1SRAA 2LVIA 2ZFDA 4OV2A 4BY4A 1MXLC 2K0JA 1MUXA 4P2YB 1BODA 3CR4X 2KDHA 3VRQA 1LINA 1PK0D 2OS8B 3FIAA 1K95A 4MEWA 1KFUL 3CGAA 2LLUA 4GGNA 1JF2A 1KFXL 1F71A 2Q4UA 1MWNA 1NPQA 2WCFA 1KFUS 1OOJA 1ZUZA 3CS1A 4GFTA 2LM5A 2PASA 3ZWHA 2GGZA 2PMYA 2KAXA 4MBEA 3PFVA 1C07A 2HQ8A 1M63B 1NCXA 1J7OA 1ZFSA 3JVTB 3OP0A 1UWOA 2Y1NA 2MJWB 4PDZA 1QTXA 4AQJA 1HQVA 1K9KA 2VRGA 3AKBA 4N1GA 1QATA 1L2OB 2L0PA 2KNEA 3EK4A 2WOSA 4ZCUA 1FW4A 1S6JA 1TNQA 3CR2A 4OCIA 3SG4A 4PHMA 2WNDA 1KWOC 5HKYA 1S1EA 3KO0A 1DT7B 1ALWA 1V1FA 1ZMZA 2L50A 5GQQC 3JTDC 1UHHA 1S36A 4QJ4B 3GK4X 3JTDB 1JSAA 4CIDA 2L51A 2OTGB 1GGZA 3PALA 3ZNIA 1VRKA 1CDPA 3I5HC 3SIBA 5KU1A 1OE9B 1CM4A 2RGIA 2KQYA 1S6CA 1KK7Z 3AAKA 1BMOA 1CKKA 2JC2A 2KQ6A 1G8IA 2JNXA 1F54A 1CFDA 1Y0VH 3PM8A 3I5GC 1CLLA 3TUYC 2LUCA 1XK4C 1XFWO 2WCBA 2NCOA 3IQQA 3O2PA 1QIWA 2HQWA 2K2FA 2KI4B 3BOWA 2M7LA 2I94A 1DJWA 2WC8A 3GOFA 4YGEB 1XFXO 4OR9B 2FJUB 2SASA 1CNPA 1AJ5A 4A4CA 2CT9A 2JT0A 1BR1B 1G33A 1Y6WA 2CCMA 3LL8B 4DIRA 1KWOB 1DMOA 2BCBA 2M1KB 2SCPA 1K9PA 4QJ3B 2FOTA 1B1GA 5B8IB 2JT8A 4DS7A 3PATA 3VGOA 1DJIA 3O78A 1SR6C 5CSNA 1SKTA 3GK1A 1QV1A 1EG3A 1H4BA 1IGVA 2L98A 3I5GB 1X02A 2CTNA 2OTGC 4JQ0D 2LHIA 1SK6D 2MBXA 2CNPA 1K90D 1UP5A 4PHJA 2BBNA 2L5XB 4GBAA 4GAOA 3TDIA 2L4IA 2JXLA 1MR8A 2O5GA 3SIAA 1CLMA 1IQ5A 3QRXA 2ISDA 2KI6D 3LK1A 1W7JB 2JTTA 4NDDA 4PHKA 2DOQA 1CMFA 2LNKA 2M7NA 5DKRA 4GNKB 3SG7A 1K94A 4M2PA 2G9BA 3O4YA 1A2XA 2K7DA 1J7PA 1PSBA 3CLNA 1QX2A 4YGCB 5CSIA 1N2DA 2JRFA 2K2AA 1SY9A 3SG2A 4BY5A 1A75A 4YGAA 3KPXA 1QS7A 5ER5A 2M9GA 3SG5A 2AMIA 1AUIB 1K9UA 1QASA 2Y1MA 3DVKA 1BJFA 4HREE 4OVNF 1K2HA 1R2UA 2D8NA 5HKWA 1PRWA 4Q04A 1J7QA 1M31A 1NP8A 1IJ6A 1EG4A 1PSRA 1XVJA 2O60A 4M2QA 3TZ1A 4YBHB 1B4CA 1L7ZA 3NXAA 2I2RE 3JVTC 2KI6C 4WQ2A 4CFRA 1B8CA 1YUUA 2JT3A 1XYDA 2QACA 2ZN8A 5CSJA 1RTP1 4I5LB 5DKQA 2EC6C 1F4OA 4DRWA 1K96A 1N0YA 1NIWA 1TOPA 1KK7Y 3FWCA 3KEVA 4ZCVA 1QVIY 1SBJA 1WY9A 4P5OE 4NDBA 5I2LA 1NX0A 2HF5A 3I5HB 1IJ5A 1FI5A 1XO5A 2MLEC 1ALVA 3F45A 1AP4A 2KHNA 2HPSA 3RM1A 1XA5A 3LK0A 1NWDA 3OB1B 1K8UA 1BU3A 1OMVA 3O6BA 1JFKA 1F70A 4JPZB 5G08A 4HRGA 1DJXA 1LVCD 1DVIA 4L9MA 2JNFA 4MZJA 1TNWA 4GUKA 1FF1A 1KFXS 3EVUA 2WCEA 4MSPA 1Q80A 4YI8A 4C0KA 4PHNA 1CFPA 1QIVA 1TNPA 1DTLA 2MRDA 3GK2A 1ZOTB 1B47A 4OKHA 2ZRSA 5CSFA 5AFPA 1OQPA 3CR5X 3OHMB 4MZKA 1OSAA 2BE4A 2ZKMX 3D10A 4AQIA 4PE7A 4PE0A 3C1VA 3CZTX 3OX6A 1ZACA 3PSRA 1SW8A 2LVVA 2BCXA 1TRFA 1RROA 1YRTB 4M2OA 1NX3A 1M45A 2GV5A 1J7RA 2L2EA 4MRYA 2B1UA 4D1EA 1RK9A 1QXPA 4YI9A 3IF7A 2KOTA 1C7WA 4CLNA 1IRJA 2R2IA 2KAVA 5CPVA 3NSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL0 C;  4WQ3 A;  1OMD A;  2Y5I A;  2BE6 A;  3VRN A;  3DF0 B;  1DJZ A;  1KK8 B;  5TNC A;  4C0J A;  1JC2 A;  1SL9 A;  1YVL A;  1QVI Z;  4I5J A;  3NSK A;  4PCW A;  1S5G Z;  1A4P A;  1JF0 A;  4FQO A;  4ORB B;  3MSE B;  4HSZ A;  1S5G Y;  1WRK A;  2HET A;  1NYA A;  2EGD A;  5HLO A;  3TS5 C;  5D69 A;  3D0Y A;  2LAN A;  4I5K A;  1DGV A;  1B7T Y;  4N1F A;  1S26 D;  2AUC A;  3EKJ A;  1FBV A;  2LC5 A;  1XFV O;  3BYA A;  5J3X A;  5PAL A;  3K21 A;  1EXR A;  1XK4 A;  3D0Y B;  1SCM B;  2LAP A;  5HKZ A;  1XFU O;  1DJG A;  4QJ5 B;  2K7O A;  1TN4 A;  1CMG A;  2LCP A;  1U5I A;  1KSO A;  2LMU A;  4YRU A;  2NXQ A;  2F2O A;  4DCK A;  1CTR A;  1NX2 A;  2E30 A;  1NCY A;  2OS8 C;  4MZL A;  2KBM A;  4XJK A;  1DF0 A;  3LCP C;  5DKN A;  3EK8 A;  2EC6 B;  1JWD A;  2LHL A;  1CFC A;  1E8A A;  2FCD A;  2E6W A;  1R6P A;  1H8B A;  4IL1 A;  1F4Q A;  4U8D A;  5AEQ A;  1GJY A;  1LA0 A;  1QX5 B;  4NDC A;  4MRX A;  2H61 A;  1QLK A;  4F0Z B;  1PVA A;  1PUL A;  1TCO B;  1SYM A;  3CTN A;  3TS5 B;  4C0L A;  1J55 A;  1SCM C;  2F33 A;  4MLW A;  3RLZ A;  2MA2 A;  1QLS A;  2JPT A;  1L2O C;  1OZO A;  1SL8 A;  1AVS A;  1FPW A;  1WLZ A;  3M0W A;  5I8N A;  1UHN A;  2K7B A;  5HLV A;  1B7T Z;  1J1E A;  1J1D A;  2FCE A;  3BUW B;  1KQM B;  2LLS A;  2I18 A;  2WOR A;  4CFQ A;  1EJ3 A;  2M1U A;  2BL0 B;  2Q91 A;  2K61 A;  2BKI B;  2GGM A;  1IQ3 A;  1MQ1 A;  3KHE A;  2A4J A;  1CFF A;  3H4S E;  1KK8 C;  1U5I B;  3DF0 A;  4R1E A;  5AER A;  2F3Z A;  1NX1 A;  1CM1 A;  1RJV A;  2JOJ A;  2MLF C;  2PAL A;  1QX7 A;  1YRU B;  1S3P A;  2F3Y A;  5BPJ A;  2OPO A;  1M39 A;  2IS9 A;  3EVV A;  1A03 A;  2LP3 A;  3HX4 A;  2M49 B;  1WLM A;  4USL A;  5FYX A;  4N5X A;  2JQ6 A;  2NCP A;  1IKU A;  4YGB B;  5KTY A;  2M97 A;  3PN7 C;  1B8L A;  2PRU A;  1NSH A;  1AK8 A;  1RFJ A;  1F8H A;  3I5I B;  3PN7 B;  5I2O A;  4I5N B;  2KGR A;  3SG6 A;  1OMR A;  2EHB A;  4UPG A;  1SMG A;  2LVK A;  1CDM A;  1M46 A;  1WDC C;  1PAL A;  3EK7 A;  1CDL A;  2LP2 A;  1KQV A;  2ZRT A;  3WXA A;  5AAN A;  1BF5 A;  3TDZ A;  1YUT A;  2ZND A;  3DVJ A;  1NCZ A;  5IBW A;  1UUS A;  1JFJ A;  4GGF C;  1YX8 A;  3E3R A;  1WRL A;  1YVH A;  1QJT A;  1IG5 A;  3AKA A;  4HRH A;  3WHU B;  3VRO A;  3BUO B;  2TN4 A;  1A29 A;  1IWQ A;  1Y1X A;  1XFZ O;  3VRR A;  3BQ3 A;  1BOC A;  2KYC A;  4XJK B;  2KBI A;  3WNX B;  3DVE A;  1FI6 A;  2KFH A;  1DGU A;  1YR5 A;  2COL B;  3KF9 A;  1BR4 B;  1TIZ A;  2G2B A;  1IH0 A;  5HYD A;  2QPT A;  1UUR A;  5K89 A;  1ODB A;  2JUL A;  4ETO A;  1JBA A;  1MHO A;  2K7C A;  2BKH B;  4GPL B;  1S6I A;  3A8R A;  1DJH A;  3SJS A;  1SPY A;  2KFG A;  2KYF A;  3HCM A;  5I2Q A;  1RWY A;  2JXC A;  1NUB A;  1G4Y R;  2JWW A;  1W7I B;  2L4H A;  3FS7 A;  1UHK A;  1B9A A;  1K93 D;  2KFF A;  2P6B B;  3LLE A;  1CLB A;  2BBM A;  2LE9 B;  1AJ4 A;  2M8U A;  4CPV A;  1BLQ A;  3I5F B;  1GGW A;  2M0R A;  1AHR A;  3NSL A;  3FWB A;  1C7V A;  1YUR A;  4E68 A;  5F6T A;  2I7A A;  2H61 C;  1SL7 A;  2CBL A;  2ZNE A;  4MVF A;  1KSM A;  2NZ0 A;  4MN0 A;  3BUM B;  4PE4 A;  1KCY A;  2KGB C;  3EKH A;  1D1O A;  1SCV A;  1Y1U A;  3DVM A;  3BXK A;  2H2K A;  4AOM A;  5AXI A;  1EL4 A;  1OZS A;  1WDC B;  4ORA B;  2V53 A;  1UHI A;  3NSI A;  3PLF B;  2LMT A;  1BT6 A;  2F8P A;  1GQM A;  2LV7 A;  3BUN B;  3DD4 A;  4NQG A;  1XFY O;  2MHH A;  3SG3 A;  2NLN A;  2F2P A;  2ZN9 A;  1REC A;  3AAJ A;  5D7F A;  1TCF A;  4ORC B;  1LKJ A;  1DJY A;  3WHT B;  4XYN A;  1HT9 A;  3VRP A;  4JWQ A;  2LVJ A;  3TUY B;  4A4B A;  1UHJ A;  2M3W A;  1JUO A;  3ICB A;  3OX5 A;  1LA3 A;  5KSZ A;  2Y4Q A;  1F55 A;  2KI4 C;  2LMV A;  5ER4 X;  1QV0 A;  3I5I C;  2KSP A;  2PSR A;  4TNC A;  1WRZ A;  1KQM C;  4PAL A;  3CWG A;  1SNL A;  1YTZ C;  2JTZ A;  4DUQ A;  3IQO A;  3TDU A;  2CXJ A;  1SR6 B;  4ICB A;  3BUX B;  1B8R A;  2LLT A;  1DF0 B;  1Y1A A;  2KAY A;  1EH2 A;  4GGF A;  2K8M B;  4FTG A;  3OB2 B;  1TTX A;  1A75 B;  5JOL A;  1MF8 B;  3EVR A;  2BEC A;  5JJG A;  1BG1 A;  1LXF C;  2AAO A;  1V1G A;  4YGD B;  1CB1 A;  2BCA A;  2PVB A;  2LUX A;  4WRI A;  3A4U B;  3BOW B;  1MXE A;  2JU0 A;  1TNX A;  1N65 A;  1YUS A;  3I5F C;  1CDN A;  2M29 A;  1YX7 A;  2JZI A;  1PVB A;  2MAZ A;  4PE1 A;  1SRA A;  2LVI A;  2ZFD A;  4OV2 A;  4BY4 A;  1MXL C;  2K0J A;  1MUX A;  4P2Y B;  1BOD A;  3CR4 X;  2KDH A;  3VRQ A;  1LIN A;  1PK0 D;  2OS8 B;  3FIA A;  1K95 A;  4MEW A;  1KFU L;  3CGA A;  2LLU A;  4GGN A;  1JF2 A;  1KFX L;  1F71 A;  2Q4U A;  1MWN A;  1NPQ A;  2WCF A;  1KFU S;  1OOJ A;  1ZUZ A;  3CS1 A;  4GFT A;  2LM5 A;  2PAS A;  3ZWH A;  2GGZ A;  2PMY A;  2KAX A;  4MBE A;  3PFV A;  1C07 A;  2HQ8 A;  1M63 B;  1NCX A;  1J7O A;  1ZFS A;  3JVT B;  3OP0 A;  1UWO A;  2Y1N A;  2MJW B;  4PDZ A;  1QTX A;  4AQJ A;  1HQV A;  1K9K A;  2VRG A;  3AKB A;  4N1G A;  1QAT A;  1L2O B;  2L0P A;  2KNE A;  3EK4 A;  2WOS A;  4ZCU A;  1FW4 A;  1S6J A;  1TNQ A;  3CR2 A;  4OCI A;  3SG4 A;  4PHM A;  2WND A;  1KWO C;  5HKY A;  1S1E A;  3KO0 A;  1DT7 B;  1ALW A;  1V1F A;  1ZMZ A;  2L50 A;  5GQQ C;  3JTD C;  1UHH A;  1S36 A;  4QJ4 B;  3GK4 X;  3JTD B;  1JSA A;  4CID A;  2L51 A;  2OTG B;  1GGZ A;  3PAL A;  3ZNI A;  1VRK A;  1CDP A;  3I5H C;  3SIB A;  5KU1 A;  1OE9 B;  1CM4 A;  2RGI A;  2KQY A;  1S6C A;  1KK7 Z;  3AAK A;  1BMO A;  1CKK A;  2JC2 A;  2KQ6 A;  1G8I A;  2JNX A;  1F54 A;  1CFD A;  1Y0V H;  3PM8 A;  3I5G C;  1CLL A;  3TUY C;  2LUC A;  1XK4 C;  1XFW O;  2WCB A;  2NCO A;  3IQQ A;  3O2P A;  1QIW A;  2HQW A;  2K2F A;  2KI4 B;  3BOW A;  2M7L A;  2I94 A;  1DJW A;  2WC8 A;  3GOF A;  4YGE B;  1XFX O;  4OR9 B;  2FJU B;  2SAS A;  1CNP A;  1AJ5 A;  4A4C A;  2CT9 A;  2JT0 A;  1BR1 B;  1G33 A;  1Y6W A;  2CCM A;  3LL8 B;  4DIR A;  1KWO B;  1DMO A;  2BCB A;  2M1K B;  2SCP A;  1K9P A;  4QJ3 B;  2FOT A;  1B1G A;  5B8I B;  2JT8 A;  4DS7 A;  3PAT A;  3VGO A;  1DJI A;  3O78 A;  1SR6 C;  5CSN A;  1SKT A;  3GK1 A;  1QV1 A;  1EG3 A;  1H4B A;  1IGV A;  2L98 A;  3I5G B;  1X02 A;  2CTN A;  2OTG C;  4JQ0 D;  2LHI A;  1SK6 D;  2MBX A;  2CNP A;  1K90 D;  1UP5 A;  4PHJ A;  2BBN A;  2L5X B;  4GBA A;  4GAO A;  3TDI A;  2L4I A;  2JXL A;  1MR8 A;  2O5G A;  3SIA A;  1CLM A;  1IQ5 A;  3QRX A;  2ISD A;  2KI6 D;  3LK1 A;  1W7J B;  2JTT A;  4NDD A;  4PHK A;  2DOQ A;  1CMF A;  2LNK A;  2M7N A;  5DKR A;  4GNK B;  3SG7 A;  1K94 A;  4M2P A;  2G9B A;  3O4Y A;  1A2X A;  2K7D A;  1J7P A;  1PSB A;  3CLN A;  1QX2 A;  4YGC B;  5CSI A;  1N2D A;  2JRF A;  2K2A A;  1SY9 A;  3SG2 A;  4BY5 A;  1A75 A;  4YGA A;  3KPX A;  1QS7 A;  5ER5 A;  2M9G A;  3SG5 A;  2AMI A;  1AUI B;  1K9U A;  1QAS A;  2Y1M A;  3DVK A;  1BJF A;  4HRE E;  4OVN F;  1K2H A;  1R2U A;  2D8N A;  5HKW A;  1PRW A;  4Q04 A;  1J7Q A;  1M31 A;  1NP8 A;  1IJ6 A;  1EG4 A;  1PSR A;  1XVJ A;  2O60 A;  4M2Q A;  3TZ1 A;  4YBH B;  1B4C A;  1L7Z A;  3NXA A;  2I2R E;  3JVT C;  2KI6 C;  4WQ2 A;  4CFR A;  1B8C A;  1YUU A;  2JT3 A;  1XYD A;  2QAC A;  2ZN8 A;  5CSJ A;  1RTP 1;  4I5L B;  5DKQ A;  2EC6 C;  1F4O A;  4DRW A;  1K96 A;  1N0Y A;  1NIW A;  1TOP A;  1KK7 Y;  3FWC A;  3KEV A;  4ZCV A;  1QVI Y;  1SBJ A;  1WY9 A;  4P5O E;  4NDB A;  5I2L A;  1NX0 A;  2HF5 A;  3I5H B;  1IJ5 A;  1FI5 A;  1XO5 A;  2MLE C;  1ALV A;  3F45 A;  1AP4 A;  2KHN A;  2HPS A;  3RM1 A;  1XA5 A;  3LK0 A;  1NWD A;  3OB1 B;  1K8U A;  1BU3 A;  1OMV A;  3O6B A;  1JFK A;  1F70 A;  4JPZ B;  5G08 A;  4HRG A;  1DJX A;  1LVC D;  1DVI A;  4L9M A;  2JNF A;  4MZJ A;  1TNW A;  4GUK A;  1FF1 A;  1KFX S;  3EVU A;  2WCE A;  4MSP A;  1Q80 A;  4YI8 A;  4C0K A;  4PHN A;  1CFP A;  1QIV A;  1TNP A;  1DTL A;  2MRD A;  3GK2 A;  1ZOT B;  1B47 A;  4OKH A;  2ZRS A;  5CSF A;  5AFP A;  1OQP A;  3CR5 X;  3OHM B;  4MZK A;  1OSA A;  2BE4 A;  2ZKM X;  3D10 A;  4AQI A;  4PE7 A;  4PE0 A;  3C1V A;  3CZT X;  3OX6 A;  1ZAC A;  3PSR A;  1SW8 A;  2LVV A;  2BCX A;  1TRF A;  1RRO A;  1YRT B;  4M2O A;  1NX3 A;  1M45 A;  2GV5 A;  1J7R A;  2L2E A;  4MRY A;  2B1U A;  4D1E A;  1RK9 A;  1QXP A;  4YI9 A;  3IF7 A;  2KOT A;  1C7W A;  4CLN A;  1IRJ A;  2R2I A;  2KAV A;  5CPV A;  3NSO A; 
#chains in the Genus database with same CATH topology
 2BL0 C;  4WQ3 A;  1OMD A;  2Y5I A;  2BE6 A;  3VRN A;  3DF0 B;  1DJZ A;  4KYN A;  1KK8 B;  5TNC A;  4C0J A;  1JC2 A;  5I94 A;  1SL9 A;  1YVL A;  1QVI Z;  4I5J A;  3CAB A;  3NSK A;  4PCW A;  1S5G Z;  1A4P A;  1JF0 A;  4FQO A;  4ORB B;  3MSE B;  4HSZ A;  1S5G Y;  1WRK A;  2HET A;  1NYA A;  2EGD A;  5HLO A;  3TS5 C;  5D69 A;  3D0Y A;  2LAN A;  4I5K A;  1DGV A;  1B7T Y;  4N1F A;  1S26 D;  2AUC A;  3EKJ A;  1FBV A;  2LC5 A;  1XFV O;  3BYA A;  5J3X A;  5PAL A;  3K21 A;  1EXR A;  1DC1 A;  1DEK A;  1XK4 A;  3D0Y B;  1SCM B;  2LAP A;  4FQT A;  3VB1 A;  5HKZ A;  1XFU O;  1DJG A;  4QJ5 B;  3DYE A;  2K7O A;  1TN4 A;  1TWO A;  1CMG A;  2LCP A;  1U5I A;  1KSO A;  2LMU A;  4YRU A;  2NXQ A;  2F2O A;  4DCK A;  1CTR A;  1NX2 A;  1ORG A;  2E30 A;  1NCY A;  2OS8 C;  4MZL A;  2KBM A;  4XJK A;  1DF0 A;  3LCP C;  5DKN A;  3EK8 A;  2EC6 B;  4IJ7 A;  1JWD A;  2LHL A;  1CFC A;  1E8A A;  2FCD A;  2QEH A;  2E6W A;  1R6P A;  1H8B A;  4IL1 A;  1F4Q A;  4U8D A;  5AEQ A;  1GJY A;  1LA0 A;  1QX5 B;  4NDC A;  3DY9 A;  2FJY A;  4MRX A;  2H61 A;  1QLK A;  4F0Z B;  1PVA A;  1PUL A;  1TCO B;  1SYM A;  3CTN A;  3BFA A;  3TS5 B;  4C0L A;  1J55 A;  1SCM C;  2F33 A;  4MLW A;  3RLZ A;  2MA2 A;  1QLS A;  2JPT A;  1L2O C;  1OZO A;  1SL8 A;  1AVS A;  1FPW A;  1WLZ A;  3M0W A;  5I8N A;  3DZT A;  1UHN A;  2K7B A;  5HLV A;  1B7T Z;  1J1E A;  1J1D A;  2FCE A;  3BUW B;  1KQM B;  2LLS A;  2I18 A;  2WOR A;  4CFQ A;  1EJ3 A;  2M1U A;  1TUJ A;  2BL0 B;  2K61 A;  2Q91 A;  3S0B A;  1C3Y A;  1C3Z A;  2BKI B;  2GGM A;  1IQ3 A;  1MQ1 A;  3KHE A;  2A4J A;  1CFF A;  3H4S E;  1KK8 C;  1U5I B;  3DF0 A;  4R1E A;  5AER A;  1OOG A;  2F3Z A;  1NX1 A;  1CM1 A;  1RJV A;  2JOJ A;  2MLF C;  2PAL A;  1QX7 A;  1YRU B;  1S3P A;  2F3Y A;  5BPJ A;  2OPO A;  1Z4H A;  1M39 A;  2IS9 A;  3EVV A;  1A03 A;  2LP3 A;  3HX4 A;  2M49 B;  1WLM A;  4USL A;  5FYX A;  4N5X A;  2JQ6 A;  2NCP A;  1IKU A;  4YGB B;  5KTY A;  2M97 A;  3PN7 C;  1B8L A;  2PRU A;  1NSH A;  2WC6 A;  1AK8 A;  1RFJ A;  1F8H A;  3I5I B;  3PN7 B;  5I2O A;  4I5N B;  2KGR A;  3BFB A;  1OMR A;  3SG6 A;  2L5Y A;  2EHB A;  5EL2 A;  4UPG A;  5HL1 A;  1SMG A;  2P70 A;  2LVK A;  1CDM A;  1M46 A;  1WDC C;  3D77 A;  1PAL A;  3EK7 A;  1CDL A;  2LP2 A;  4OZD A;  1KQV A;  2ZRT A;  3WXA A;  5AAN A;  1BF5 A;  3CYZ A;  3TDZ A;  1YUT A;  2ZND A;  3DVJ A;  1NCZ A;  5IBW A;  1UUS A;  1JFJ A;  4GGF C;  1YX8 A;  3E3R A;  1WRL A;  1YVH A;  1QJT A;  1IG5 A;  3SS5 A;  1TUZ A;  3AKA A;  4HRH A;  3WHU B;  3VRO A;  3BUO B;  3K1E A;  3S0A A;  2TN4 A;  1A29 A;  1IWQ A;  1Y1X A;  1XFZ O;  3VRR A;  3BQ3 A;  1BOC A;  2KYC A;  1W9Z A;  4XJK B;  1P28 A;  2KBI A;  3WNX B;  3DVE A;  1FI6 A;  4PT1 A;  3B87 A;  2KFH A;  1DGU A;  3L4A A;  1YR5 A;  2COL B;  3KF9 A;  1BR4 B;  1TIZ A;  2G2B A;  1IH0 A;  5HYD A;  2QPT A;  1UUR A;  5K89 A;  1ODB A;  2JUL A;  4ETO A;  1JBA A;  1MHO A;  2K7C A;  2BKH B;  4GPL B;  1S6I A;  3A8R A;  3OBV A;  1DJH A;  3SJS A;  1SPY A;  2KFG A;  2KYF A;  3CZ1 A;  3HCM A;  5I2Q A;  3SS4 A;  1RWY A;  2JXC A;  1NUB A;  1G4Y R;  2JWW A;  1W7I B;  2L4H A;  3FS7 A;  1UHK A;  1B9A A;  1K93 D;  2KFF A;  1OOF A;  2P6B B;  3LLE A;  1CLB A;  2BBM A;  2LE9 B;  1AJ4 A;  2M8U A;  4CPV A;  1BLQ A;  3I5F B;  1GGW A;  2M0R A;  1AHR A;  3NSL A;  3FWB A;  1C7V A;  1YUR A;  4E68 A;  5F6T A;  2H8V A;  2I7A A;  5FI6 A;  3UO9 A;  2H61 C;  3N7H A;  1SL7 A;  2CBL A;  2ZNE A;  3O4X A;  1KSM A;  2NZ0 A;  4INW A;  3BUM B;  4MN0 A;  4MVF A;  4PE4 A;  1KCY A;  2KGB C;  3EKH A;  1D1O A;  1SCV A;  1Y1U A;  3DVM A;  1OW4 A;  3BXK A;  2H2K A;  3QME A;  4AOM A;  5AXI A;  1EL4 A;  1OZS A;  1WDC B;  4ORA B;  2V53 A;  1UHI A;  3NSI A;  3PLF B;  2LMT A;  3NHT A;  1BT6 A;  2F8P A;  1GQM A;  2KLE A;  2LV7 A;  3BUN B;  3DD4 A;  4NQG A;  1XFY O;  2MHH A;  3SG3 A;  2NLN A;  2F2P A;  2ZN9 A;  1REC A;  3AAJ A;  3BFH A;  3D74 A;  5D7F A;  1TCF A;  4ORC B;  1LKJ A;  1DJY A;  2BNX A;  3EG5 B;  3WHT B;  4XYN A;  3O2P A;  1HT9 A;  3R1V A;  3VRP A;  4JWQ A;  2LVJ A;  3TUY B;  3S0G A;  4A4B A;  1UHJ A;  2M3W A;  1JUO A;  3ICB A;  3OX5 A;  3S0D A;  1LA3 A;  5KSZ A;  2Y4Q A;  1F55 A;  3BJH A;  2KI4 C;  3PM2 A;  2LMV A;  5ER4 X;  1QV0 A;  3I5I C;  2KSP A;  2PSR A;  4TNC A;  1WRZ A;  3V2L A;  1KQM C;  4PAL A;  3CWG A;  1SNL A;  1YTZ C;  2JTZ A;  2M7L A;  4DUQ A;  3B86 A;  3IQO A;  2CXJ A;  3TDU A;  1SR6 B;  4ICB A;  3BUX B;  1B8R A;  2LLT A;  1DF0 B;  1Y1A A;  2KAY A;  1EH2 A;  4GGF A;  2K8M B;  4FTG A;  3OB2 B;  1TTX A;  1A75 B;  5JOL A;  1T14 A;  1MF8 B;  3EVR A;  5DIC A;  2BEC A;  5JJG A;  1BG1 A;  1LXF C;  2AAO A;  3R1O A;  1V1G A;  4YGD B;  3CZ0 A;  2BCA A;  2PVB A;  2LUX A;  4JD9 A;  3A4U B;  3BOW B;  1MXE A;  2L2C A;  4WRI A;  2JU0 A;  1TNX A;  1N65 A;  1YUS A;  3I5F C;  2YGU A;  5FI7 A;  1CDN A;  2M29 A;  1YX7 A;  2JZI A;  1PVB A;  2MAZ A;  3FE8 A;  1SRA A;  2LVI A;  4PE1 A;  2ZFD A;  4OV2 A;  4BY4 A;  2WCJ A;  1MXL C;  2K0J A;  1MUX A;  1DQE A;  4P2Y B;  5FI2 A;  1BOD A;  3CR4 X;  2KDH A;  3RZS A;  3VRQ A;  1LIN A;  1PK0 D;  2OS8 B;  3OGN A;  2QDI A;  3FIA A;  1K95 A;  4MEW A;  1KFU L;  3CGA A;  2LLU A;  4GGN A;  1JF2 A;  1KFX L;  1F71 A;  2Q4U A;  1GM0 A;  1MWN A;  1NPQ A;  1DEL A;  2WCF A;  1KFU S;  1OOJ A;  1ZUZ A;  3CS1 A;  4GFT A;  2LM5 A;  2PAS A;  3ZWH A;  2GGZ A;  2PMY A;  2KAX A;  4MBE A;  3PFV A;  4JKT A;  1OOI X;  1C07 A;  2HQ8 A;  1M63 B;  1NCX A;  1J7O A;  1ZFS A;  2WCM A;  2JPO A;  3FE6 A;  1UWO A;  2Y1N A;  2MJW B;  3JVT B;  3OP0 A;  4PDZ A;  1QTX A;  4AQJ A;  3NHI A;  1HQV A;  1SSE B;  1K9K A;  2VRG A;  3AKB A;  4N1G A;  1QAT A;  1L2O B;  2L0P A;  2KNE A;  3EK4 A;  2WOS A;  4ZCU A;  1FW4 A;  1S6J A;  1TNQ A;  3CR2 A;  4OCI A;  3SG4 A;  4PHM A;  2WND A;  1KWO C;  5HKY A;  1S1E A;  3KO0 A;  1DT7 B;  1ALW A;  1V1F A;  1ZMZ A;  2K60 A;  2L50 A;  3B7A A;  1UHH A;  1S36 A;  2WCL A;  3D76 A;  3JTD C;  5GQQ C;  4F7F A;  3GK4 X;  3JTD B;  1JSA A;  4CID A;  2PQL A;  2L51 A;  2OTG B;  1GGZ A;  3PAL A;  3ZNI A;  1VRK A;  1CDP A;  1IIO A;  3I5H C;  3SIB A;  5KU1 A;  1OE9 B;  1CM4 A;  2RGI A;  3L47 A;  3D78 A;  2KQY A;  1S6C A;  1KK7 Z;  3AAK A;  1BMO A;  1CKK A;  2JC2 A;  2KQ6 A;  1G8I A;  2JNX A;  3UNW A;  1F54 A;  1CFD A;  1Y0V H;  3PM8 A;  3I5G C;  1CLL A;  3TUY C;  1OOH A;  2LUC A;  1XK4 C;  1XFW O;  2WCB A;  2NCO A;  2P71 A;  3IQQ A;  1QIW A;  1Z2C B;  2HQW A;  2K2F A;  2KI4 B;  3BOW A;  2I94 A;  1DJW A;  2WC8 A;  3D75 A;  3GOF A;  1XFX O;  4YGE B;  4OR9 B;  2FJU B;  2SAS A;  1CNP A;  1AJ5 A;  4A4C A;  2CT9 A;  2JT0 A;  1BR1 B;  1G33 A;  1Y6W A;  2CCM A;  2KLD A;  2PYQ A;  3LL8 B;  2QEV A;  1KWO B;  4DIR A;  2BCB A;  2M1K B;  2SCP A;  1K9P A;  1DMO A;  4QJ3 B;  2FOT A;  3NGV A;  4INX A;  1B1G A;  5B8I B;  2JT8 A;  4DS7 A;  3PAT A;  3VGO A;  1DJI A;  3O78 A;  1SR6 C;  3Q8I A;  1SKT A;  5CSN A;  3GK1 A;  1QV1 A;  1EG3 A;  2WCK A;  1IGV A;  2L98 A;  3D73 A;  3SS3 A;  3I5G B;  1H4B A;  1X02 A;  2CTN A;  2OTG C;  4JQ0 D;  2KPH A;  2LHI A;  2GTE A;  1SK6 D;  2MBX A;  2CNP A;  1K90 D;  1UP5 A;  4PHJ A;  2BBN A;  2L5X B;  4GBA A;  4GAO A;  3TDI A;  2L4I A;  3S0F A;  2JXL A;  1MR8 A;  2O5G A;  3SIA A;  1CLM A;  1IQ5 A;  3IVT A;  3QRX A;  2KI6 D;  3LK1 A;  1W7J B;  2ISD A;  2JTT A;  4NDD A;  4PHK A;  2DOQ A;  1CMF A;  2LNK A;  2M7N A;  3B6X A;  5DKR A;  3PJI A;  4GNK B;  3SG7 A;  1K94 A;  4M2P A;  2G9B A;  3O4Y A;  1A2X A;  2K7D A;  2QEO A;  1QWV A;  1PSB A;  3CLN A;  1J7P A;  1QX2 A;  4YGC B;  5CSI A;  1N2D A;  2JRF A;  2K2A A;  1SY9 A;  3SG2 A;  4BY5 A;  1A75 A;  4YGA A;  3KPX A;  1QS7 A;  5ER5 A;  2M9G A;  3SG5 A;  2AMI A;  1AUI B;  1K9U A;  1QAS A;  2Y1M A;  3DVK A;  1BJF A;  4HRE E;  4OVN F;  1K2H A;  1R2U A;  2D8N A;  5HKW A;  1PRW A;  2ERB A;  4Q04 A;  1J7Q A;  1M31 A;  1NP8 A;  1IJ6 A;  1EG4 A;  1PSR A;  1XVJ A;  1CB1 A;  2O60 A;  4M2Q A;  3TZ1 A;  4YBH B;  1B4C A;  1L7Z A;  3NXA A;  2I2R E;  3JVT C;  2KI6 C;  4WQ2 A;  4CFR A;  1B8C A;  1YUU A;  2JT3 A;  1XYD A;  2QAC A;  2ZN8 A;  5CSJ A;  1RTP 1;  4I5L B;  5DKQ A;  2EC6 C;  1F4O A;  3L4L A;  4DRW A;  1K96 A;  1N0Y A;  1NIW A;  1TOP A;  1KK7 Y;  3FWC A;  3KEV A;  4ZCV A;  1QVI Y;  3S0E A;  1SBJ A;  1WY9 A;  4P5O E;  4NDB A;  5I2L A;  1NX0 A;  2HF5 A;  2QEB A;  1LS8 A;  3I5H B;  2WC5 A;  1IJ5 A;  1FI5 A;  1XO5 A;  2MLE C;  1ALV A;  3F45 A;  1AP4 A;  2KHN A;  2HPS A;  3R1P A;  3RM1 A;  3R72 A;  1XA5 A;  3DXL A;  3LK0 A;  1NWD A;  3OB1 B;  4QJ4 B;  1K8U A;  1BU3 A;  1OMV A;  3O6B A;  1JFK A;  1F70 A;  4JPZ B;  5G08 A;  4HRG A;  1DJX A;  1LVC D;  1DVI A;  4L9M A;  3CDN A;  2JNF A;  4MZJ A;  1XFR A;  1TNW A;  4GUK A;  1FF1 A;  1KFX S;  3EVU A;  2WCE A;  4MSP A;  1Q80 A;  4YI8 A;  4C0K A;  4PHN A;  1CFP A;  1QIV A;  1TNP A;  1DTL A;  2MRD A;  3GK2 A;  1ZOT B;  1B47 A;  4OKH A;  2ZRS A;  5CSF A;  5AFP A;  1OQP A;  3CR5 X;  3FE9 A;  3OHM B;  4MZK A;  1OSA A;  2BE4 A;  2ZKM X;  3D10 A;  4AQI A;  4PE7 A;  4PE0 A;  3B88 A;  3C1V A;  3CZT X;  3OX6 A;  1ZAC A;  3PSR A;  1SW8 A;  2WCH A;  2LVV A;  2BCX A;  1TRF A;  1RRO A;  1YRT B;  4M2O A;  2BAP A;  5D3O A;  1NX3 A;  1M45 A;  2GV5 A;  1J7R A;  2L2E A;  4MRY A;  2B1U A;  3CZ2 A;  4D1E A;  1RK9 A;  1QXP A;  4YI9 A;  3IF7 A;  2KOT A;  1C7W A;  4CLN A;  1IRJ A;  2R2I A;  2KAV A;  5CPV A;  3NSO A; 
#chains in the Genus database with same CATH homology
 2BL0 C;  4WQ3 A;  1OMD A;  2Y5I A;  2BE6 A;  3VRN A;  3DF0 B;  1DJZ A;  1KK8 B;  5TNC A;  4C0J A;  1JC2 A;  1SL9 A;  1YVL A;  1QVI Z;  4I5J A;  3NSK A;  4PCW A;  1S5G Z;  1A4P A;  1JF0 A;  4FQO A;  4ORB B;  3MSE B;  4HSZ A;  1S5G Y;  1WRK A;  2HET A;  1NYA A;  2EGD A;  5HLO A;  3TS5 C;  5D69 A;  3D0Y A;  2LAN A;  4I5K A;  1DGV A;  1B7T Y;  4N1F A;  1S26 D;  2AUC A;  3EKJ A;  1FBV A;  2LC5 A;  1XFV O;  3BYA A;  5J3X A;  5PAL A;  3K21 A;  1EXR A;  1XK4 A;  3D0Y B;  1SCM B;  2LAP A;  5HKZ A;  1XFU O;  1DJG A;  4QJ5 B;  2K7O A;  1TN4 A;  1CMG A;  2LCP A;  1U5I A;  1KSO A;  2LMU A;  4YRU A;  2NXQ A;  2F2O A;  4DCK A;  1CTR A;  1NX2 A;  2E30 A;  1NCY A;  2OS8 C;  4MZL A;  2KBM A;  4XJK A;  1DF0 A;  3LCP C;  5DKN A;  3EK8 A;  2EC6 B;  1JWD A;  2LHL A;  1CFC A;  1E8A A;  2FCD A;  2E6W A;  1R6P A;  1H8B A;  4IL1 A;  1F4Q A;  4U8D A;  5AEQ A;  1GJY A;  1LA0 A;  1QX5 B;  4NDC A;  4MRX A;  2H61 A;  1QLK A;  4F0Z B;  1PVA A;  1PUL A;  1TCO B;  1SYM A;  3CTN A;  3TS5 B;  4C0L A;  1J55 A;  1SCM C;  2F33 A;  4MLW A;  3RLZ A;  2MA2 A;  1QLS A;  2JPT A;  1L2O C;  1OZO A;  1SL8 A;  1AVS A;  1FPW A;  1WLZ A;  3M0W A;  5I8N A;  1UHN A;  2K7B A;  5HLV A;  1B7T Z;  1J1E A;  1J1D A;  2FCE A;  3BUW B;  1KQM B;  2LLS A;  2I18 A;  2WOR A;  4CFQ A;  1EJ3 A;  2M1U A;  2BL0 B;  2Q91 A;  2K61 A;  2BKI B;  2GGM A;  1IQ3 A;  1MQ1 A;  3KHE A;  2A4J A;  1CFF A;  3H4S E;  1KK8 C;  1U5I B;  3DF0 A;  4R1E A;  5AER A;  2F3Z A;  1NX1 A;  1CM1 A;  1RJV A;  2JOJ A;  2MLF C;  2PAL A;  1QX7 A;  1YRU B;  1S3P A;  2F3Y A;  5BPJ A;  2OPO A;  1M39 A;  2IS9 A;  3EVV A;  1A03 A;  2LP3 A;  3HX4 A;  2M49 B;  1WLM A;  4USL A;  5FYX A;  4N5X A;  2JQ6 A;  2NCP A;  1IKU A;  4YGB B;  5KTY A;  2M97 A;  3PN7 C;  1B8L A;  2PRU A;  1NSH A;  1AK8 A;  1RFJ A;  1F8H A;  3I5I B;  3PN7 B;  5I2O A;  4I5N B;  2KGR A;  3SG6 A;  1OMR A;  2EHB A;  4UPG A;  1SMG A;  2LVK A;  1CDM A;  1M46 A;  1WDC C;  1PAL A;  3EK7 A;  1CDL A;  2LP2 A;  1KQV A;  2ZRT A;  3WXA A;  5AAN A;  1BF5 A;  3TDZ A;  1YUT A;  2ZND A;  3DVJ A;  1NCZ A;  5IBW A;  1UUS A;  1JFJ A;  4GGF C;  1YX8 A;  3E3R A;  1WRL A;  1YVH A;  1QJT A;  1IG5 A;  3AKA A;  4HRH A;  3WHU B;  3VRO A;  3BUO B;  2TN4 A;  1A29 A;  1IWQ A;  1Y1X A;  1XFZ O;  3VRR A;  3BQ3 A;  1BOC A;  2KYC A;  4XJK B;  2KBI A;  3WNX B;  3DVE A;  1FI6 A;  2KFH A;  1DGU A;  1YR5 A;  2COL B;  3KF9 A;  1BR4 B;  1TIZ A;  2G2B A;  1IH0 A;  5HYD A;  2QPT A;  1UUR A;  5K89 A;  1ODB A;  2JUL A;  4ETO A;  1JBA A;  1MHO A;  2K7C A;  2BKH B;  4GPL B;  1S6I A;  3A8R A;  1DJH A;  3SJS A;  1SPY A;  2KFG A;  2KYF A;  3HCM A;  5I2Q A;  1RWY A;  2JXC A;  1NUB A;  1G4Y R;  2JWW A;  1W7I B;  2L4H A;  3FS7 A;  1UHK A;  1B9A A;  1K93 D;  2KFF A;  2P6B B;  3LLE A;  1CLB A;  2BBM A;  2LE9 B;  1AJ4 A;  2M8U A;  4CPV A;  1BLQ A;  3I5F B;  1GGW A;  2M0R A;  1AHR A;  3NSL A;  3FWB A;  1C7V A;  1YUR A;  4E68 A;  5F6T A;  2I7A A;  2H61 C;  1SL7 A;  2CBL A;  2ZNE A;  4MVF A;  1KSM A;  2NZ0 A;  4MN0 A;  3BUM B;  4PE4 A;  1KCY A;  2KGB C;  3EKH A;  1D1O A;  1SCV A;  1Y1U A;  3DVM A;  3BXK A;  2H2K A;  4AOM A;  5AXI A;  1EL4 A;  1OZS A;  1WDC B;  4ORA B;  2V53 A;  1UHI A;  3NSI A;  3PLF B;  2LMT A;  1BT6 A;  2F8P A;  1GQM A;  2LV7 A;  3BUN B;  3DD4 A;  4NQG A;  1XFY O;  2MHH A;  3SG3 A;  2NLN A;  2F2P A;  2ZN9 A;  1REC A;  3AAJ A;  5D7F A;  1TCF A;  4ORC B;  1LKJ A;  1DJY A;  3WHT B;  4XYN A;  1HT9 A;  3VRP A;  4JWQ A;  2LVJ A;  3TUY B;  4A4B A;  1UHJ A;  2M3W A;  1JUO A;  3ICB A;  3OX5 A;  1LA3 A;  5KSZ A;  2Y4Q A;  1F55 A;  2KI4 C;  2LMV A;  5ER4 X;  1QV0 A;  3I5I C;  2KSP A;  2PSR A;  4TNC A;  1WRZ A;  1KQM C;  4PAL A;  3CWG A;  1SNL A;  1YTZ C;  2JTZ A;  4DUQ A;  3IQO A;  3TDU A;  2CXJ A;  1SR6 B;  4ICB A;  3BUX B;  1B8R A;  2LLT A;  1DF0 B;  1Y1A A;  2KAY A;  1EH2 A;  4GGF A;  2K8M B;  4FTG A;  3OB2 B;  1TTX A;  1A75 B;  5JOL A;  1MF8 B;  3EVR A;  2BEC A;  5JJG A;  1BG1 A;  1LXF C;  2AAO A;  1V1G A;  4YGD B;  1CB1 A;  2BCA A;  2PVB A;  2LUX A;  4WRI A;  3A4U B;  3BOW B;  1MXE A;  2JU0 A;  1TNX A;  1N65 A;  1YUS A;  3I5F C;  1CDN A;  2M29 A;  1YX7 A;  2JZI A;  1PVB A;  2MAZ A;  4PE1 A;  1SRA A;  2LVI A;  2ZFD A;  4OV2 A;  4BY4 A;  1MXL C;  2K0J A;  1MUX A;  4P2Y B;  1BOD A;  3CR4 X;  2KDH A;  3VRQ A;  1LIN A;  1PK0 D;  2OS8 B;  3FIA A;  1K95 A;  4MEW A;  1KFU L;  3CGA A;  2LLU A;  4GGN A;  1JF2 A;  1KFX L;  1F71 A;  2Q4U A;  1MWN A;  1NPQ A;  2WCF A;  1KFU S;  1OOJ A;  1ZUZ A;  3CS1 A;  4GFT A;  2LM5 A;  2PAS A;  3ZWH A;  2GGZ A;  2PMY A;  2KAX A;  4MBE A;  3PFV A;  1C07 A;  2HQ8 A;  1M63 B;  1NCX A;  1J7O A;  1ZFS A;  3JVT B;  3OP0 A;  1UWO A;  2Y1N A;  2MJW B;  4PDZ A;  1QTX A;  4AQJ A;  1HQV A;  1K9K A;  2VRG A;  3AKB A;  4N1G A;  1QAT A;  1L2O B;  2L0P A;  2KNE A;  3EK4 A;  2WOS A;  4ZCU A;  1FW4 A;  1S6J A;  1TNQ A;  3CR2 A;  4OCI A;  3SG4 A;  4PHM A;  2WND A;  1KWO C;  5HKY A;  1S1E A;  3KO0 A;  1DT7 B;  1ALW A;  1V1F A;  1ZMZ A;  2L50 A;  5GQQ C;  3JTD C;  1UHH A;  1S36 A;  4QJ4 B;  3GK4 X;  3JTD B;  1JSA A;  4CID A;  2L51 A;  2OTG B;  1GGZ A;  3PAL A;  3ZNI A;  1VRK A;  1CDP A;  3I5H C;  3SIB A;  5KU1 A;  1OE9 B;  1CM4 A;  2RGI A;  2KQY A;  1S6C A;  1KK7 Z;  3AAK A;  1BMO A;  1CKK A;  2JC2 A;  2KQ6 A;  1G8I A;  2JNX A;  1F54 A;  1CFD A;  1Y0V H;  3PM8 A;  3I5G C;  1CLL A;  3TUY C;  2LUC A;  1XK4 C;  1XFW O;  2WCB A;  2NCO A;  3IQQ A;  3O2P A;  1QIW A;  2HQW A;  2K2F A;  2KI4 B;  3BOW A;  2M7L A;  2I94 A;  1DJW A;  2WC8 A;  3GOF A;  4YGE B;  1XFX O;  4OR9 B;  2FJU B;  2SAS A;  1CNP A;  1AJ5 A;  4A4C A;  2CT9 A;  2JT0 A;  1BR1 B;  1G33 A;  1Y6W A;  2CCM A;  3LL8 B;  4DIR A;  1KWO B;  1DMO A;  2BCB A;  2M1K B;  2SCP A;  1K9P A;  4QJ3 B;  2FOT A;  1B1G A;  5B8I B;  2JT8 A;  4DS7 A;  3PAT A;  3VGO A;  1DJI A;  3O78 A;  1SR6 C;  5CSN A;  1SKT A;  3GK1 A;  1QV1 A;  1EG3 A;  1H4B A;  1IGV A;  2L98 A;  3I5G B;  1X02 A;  2CTN A;  2OTG C;  4JQ0 D;  2LHI A;  1SK6 D;  2MBX A;  2CNP A;  1K90 D;  1UP5 A;  4PHJ A;  2BBN A;  2L5X B;  4GBA A;  4GAO A;  3TDI A;  2L4I A;  2JXL A;  1MR8 A;  2O5G A;  3SIA A;  1CLM A;  1IQ5 A;  3QRX A;  2ISD A;  2KI6 D;  3LK1 A;  1W7J B;  2JTT A;  4NDD A;  4PHK A;  2DOQ A;  1CMF A;  2LNK A;  2M7N A;  5DKR A;  4GNK B;  3SG7 A;  1K94 A;  4M2P A;  2G9B A;  3O4Y A;  1A2X A;  2K7D A;  1J7P A;  1PSB A;  3CLN A;  1QX2 A;  4YGC B;  5CSI A;  1N2D A;  2JRF A;  2K2A A;  1SY9 A;  3SG2 A;  4BY5 A;  1A75 A;  4YGA A;  3KPX A;  1QS7 A;  5ER5 A;  2M9G A;  3SG5 A;  2AMI A;  1AUI B;  1K9U A;  1QAS A;  2Y1M A;  3DVK A;  1BJF A;  4HRE E;  4OVN F;  1K2H A;  1R2U A;  2D8N A;  5HKW A;  1PRW A;  4Q04 A;  1J7Q A;  1M31 A;  1NP8 A;  1IJ6 A;  1EG4 A;  1PSR A;  1XVJ A;  2O60 A;  4M2Q A;  3TZ1 A;  4YBH B;  1B4C A;  1L7Z A;  3NXA A;  2I2R E;  3JVT C;  2KI6 C;  4WQ2 A;  4CFR A;  1B8C A;  1YUU A;  2JT3 A;  1XYD A;  2QAC A;  2ZN8 A;  5CSJ A;  1RTP 1;  4I5L B;  5DKQ A;  2EC6 C;  1F4O A;  4DRW A;  1K96 A;  1N0Y A;  1NIW A;  1TOP A;  1KK7 Y;  3FWC A;  3KEV A;  4ZCV A;  1QVI Y;  1SBJ A;  1WY9 A;  4P5O E;  4NDB A;  5I2L A;  1NX0 A;  2HF5 A;  3I5H B;  1IJ5 A;  1FI5 A;  1XO5 A;  2MLE C;  1ALV A;  3F45 A;  1AP4 A;  2KHN A;  2HPS A;  3RM1 A;  1XA5 A;  3LK0 A;  1NWD A;  3OB1 B;  1K8U A;  1BU3 A;  1OMV A;  3O6B A;  1JFK A;  1F70 A;  4JPZ B;  5G08 A;  4HRG A;  1DJX A;  1LVC D;  1DVI A;  4L9M A;  2JNF A;  4MZJ A;  1TNW A;  4GUK A;  1FF1 A;  1KFX S;  3EVU A;  2WCE A;  4MSP A;  1Q80 A;  4YI8 A;  4C0K A;  4PHN A;  1CFP A;  1QIV A;  1TNP A;  1DTL A;  2MRD A;  3GK2 A;  1ZOT B;  1B47 A;  4OKH A;  2ZRS A;  5CSF A;  5AFP A;  1OQP A;  3CR5 X;  3OHM B;  4MZK A;  1OSA A;  2BE4 A;  2ZKM X;  3D10 A;  4AQI A;  4PE7 A;  4PE0 A;  3C1V A;  3CZT X;  3OX6 A;  1ZAC A;  3PSR A;  1SW8 A;  2LVV A;  2BCX A;  1TRF A;  1RRO A;  1YRT B;  4M2O A;  1NX3 A;  1M45 A;  2GV5 A;  1J7R A;  2L2E A;  4MRY A;  2B1U A;  4D1E A;  1RK9 A;  1QXP A;  4YI9 A;  3IF7 A;  2KOT A;  1C7W A;  4CLN A;  1IRJ A;  2R2I A;  2KAV A;  5CPV A;  3NSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...