1Y6WA

Trapped intermediate of calmodulin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
145
structure length
145
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGCNPTEAELQDMINEVDADGNGTINFPEFLTMMARCMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structure of a Trapped Intermediate of Calmodulin: Calcium Regulation of EF-hand Proteins from a New Perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 43
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2004-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y6wA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y6wA02
2ZN8A 2D8NA 1M45A 4HSZA 4GGFC 3NSOA 3VRNA 2OS8B 4GPLB 4D1EA 1C07A 2KBMA 2I7AA 4MSPA 4UPGA 1TIZA 1S6CA 1MHOA 4PE1A 2LVIA 3AKAA 2DOQA 3TDZA 1KSOA 1XFUO 2LE9B 1WY9A 2ZRTA 4YGEB 2LM5A 3LK1A 3SG7A 1CM4A 1QLKA 1ZUZA 1EG4A 1CFCA 2E30A 3OB2B 1K94A 2BCBA 3BXKA 1K93D 2KAVA 1AJ5A 1A4PA 3AAJA 1IQ5A 3DF0A 3O6BA 1BR1B 4XYNA 3OX6A 1KK7Z 2FJUB 1KWOB 1N0YA 2AAOA 3EVVA 2GV5A 4MZLA 1XFZO 1EH2A 3A4UB 1K90D 1NPQA 2MLFC 2M9GA 1NWDA 3CGAA 1V1GA 2CT9A 2L4HA 3HX4A 2I2RE 3O2PA 4F0ZB 3DF0B 1RTP1 3IQOA 1DJHA 3ZNIA 4QJ4B 1CTRA 3KF9A 4AQJA 1ZACA 1DGVA 3JTDB 5HYDA 4HRGA 2VRGA 1C7WA 1EXRA 4FTGA 1DTLA 2I94A 2MHHA 1J7RA 3PN7B 2M97A 1QX2A 1YR5A 5KSZA 1CB1A 1F71A 2I18A 4MN0A 2JQ6A 4A4CA 1B4CA 1M63B 1AJ4A 2NCPA 3CTNA 2EC6C 2LMUA 4FQOA 1DJIA 2P6BB 5I8NA 2M1UA 1JFKA 2M29A 4PHKA 2OS8C 3FWCA 3TZ1A 1ZFSA 1SL9A 1B8RA 1GGZA 2KOTA 3PSRA 5CSNA 4NDCA 1CMFA 1SCMB 1BR4B 1GQMA 1IRJA 5AFPA 2CBLA 1H4BA 1UHIA 1B9AA 1AUIB 3EKJA 5AANA 1WDCC 2FCEA 1SCVA 1LXFC 4AOMA 2ZFDA 4JQ0D 4ETOA 4I5KA 2MJWB 2Y4QA 2ZRSA 3D0YA 5HLOA 2AMIA 4P2YB 2LV7A 3I5HC 1FPWA 1CLMA 4M2QA 3VROA 1IQ3A 4ORAB 1OSAA 2G9BA 1IWQA 2AUCA 1ZOTB 5I2LA 1BU3A 1G33A 3AKBA 2OTGC 1KWOC 3DVEA 1KSMA 1NSHA 2JU0A 1A29A 2GGZA 2LUXA 3EKHA 1E8AA 1JFJA 4NQGA 3TS5B 3VRRA 1PULA 1YUSA 5CSJA 2CNPA 2WCFA 4WQ2A 2E6WA 1PSBA 3D0YB 3RLZA 1J7QA 5PALA 1OQPA 2BE6A 2BBNA 2NXQA 4ZCVA 1LINA 4OR9B 2PVBA 1L7ZA 2JNXA 1BMOA 3SG4A 1YRTB 1WLMA 3DVJA 3PN7C 1KK8C 3DVKA 3LLEA 2ISDA 2IS9A 1F4OA 1TN4A 1ZMZA 2LMTA 1MXEA 1LA3A 5HKZA 4JPZB 1YVLA 5G08A 3AAKA 2FOTA 2F3ZA 2LLTA 1DF0A 4PALA 1SY9A 1UURA 2PMYA 2MA2A 1SYMA 2BKHB 1S5GZ 4YGCB 2KI4C 2KAXA 2WOSA 2LP3A 3GK4X 1S5GY 4OKHA 3SG5A 2WORA 1MF8B 2L5XB 3TDIA 1J1EA 2KNEA 4PCWA 1J55A 4OV2A 1EG3A 1WRZA 1Y1XA 3DVMA 1TCFA 2JT8A 3GOFA 2K7OA 3FIAA 2BL0C 4YRUA 4MZKA 4OVNF 4C0JA 1DF0B 4N1GA 1QV1A 2QPTA 1G4YR 2LCPA 2LUCA 1MUXA 2FCDA 1J1DA 3SG3A 2SASA 1MWNA 2L50A 4MZJA 2BCAA 5B8IB 1OZSA 4QJ5B 1K9KA 1SBJA 1RK9A 3A8RA 2JT3A 1KFUL 3CLNA 3I5IB 5DKRA 2MAZA 2LC5A 1KK7Y 3I5FB 4MRYA 1NYAA 2WCBA 1NCXA 1TNPA 2JRFA 1F8HA 4CFQA 2B1UA 5AXIA 5CPVA 2JZIA 5HKWA 2ZN9A 3PFVA 1SW8A 2EHBA 5KU1A 1IJ5A 5I2OA 2CTNA 4C0LA 2M49B 4MBEA 1SR6B 2O60A 2ZKMX 2F8PA 2H61C 2K8MB 1RROA 2L98A 3OHMB 4WQ3A 4A4BA 4GGNA 1CFPA 2LLUA 3CZTX 5DKNA 1QS7A 4DCKA 1K95A 3CR5X 1NX0A 1SL7A 2PASA 1CNPA 1NCYA 2NLNA 3GK1A 2NZ0A 4PHNA 3SG6A 1W7JB 3GK2A 4ORCB 1NX2A 1FI5A 2K7CA 1F55A 1RJVA 2KGBC 2ZNDA 1NX1A 1XK4A 3FS7A 1L2OB 4CPVA 2BE4A 3SIBA 1FBVA 1YUUA 5GQQC 1M39A 1JSAA 1ODBA 4YGDB 1YX7A 1Y1UA 2K2FA 5ER4X 4CLNA 1DJXA 2KQYA 2Y1NA 2KBIA 3OB1B 3JVTB 3BUMB 1SKTA 4XJKA 3BOWA 1WRLA 2KDHA 1SK6D 1V1FA 4PDZA 3I5GB 1LVCD 1WRKA 1GGWA 1Q80A 2LVJA 1PSRA 3BUOB 2M1KB 4IL1A 4PE0A 2K7BA 4I5JA 5I2QA 4JWQA 3LCPC 1XVJA 2K61A 1IH0A 4DIRA 4M2PA 1K96A 1R2UA 3CR2A 2KYFA 1X02A 1TNWA 1B8LA 1FW4A 3BQ3A 5CSIA 1RWYA 2KI6C 2MRDA 1F4QA 3BOWB 3OX5A 3CWGA 4XJKB 4BY5A 2HF5A 3TUYB 3EK4A 1QIWA 3D10A 3MSEB 1KQMB 3VGOA 2F3YA 1EL4A 5CSFA 1CKKA 2KGRA 1B8CA 4GAOA 4GNKB 1ALVA 4ZCUA 2M8UA 1N65A 5AERA 2KFGA 1PVAA 1IG5A 3FWBA 5HLVA 4GUKA 1JC2A 2CXJA 4BY4A 1BF5A 2Y1MA 4PHJA 1J7OA 1J7PA 3NSLA 2F33A 1CDPA 1S26D 2WC8A 3JTDC 1VRKA 1XFXO 4PE4A 1G8IA 3M0WA 3NSIA 2BECA 3BUNB 2JULA 3WNXB 2A4JA 2KFHA 1JBAA 2JT0A 1RFJA 2QACA 2KI6D 3C1VA 1R6PA 2KQ6A 1RECA 1KFUS 1M46A 4E68A 1XFWO 1FF1A 1B47A 3EVRA 2JOJA 1QTXA 4YI9A 2HETA 2WNDA 5D7FA 3PALA 3KHEA 1UUSA 1OOJA 4WRIA 1XA5A 5FYXA 4GBAA 1XO5A 4CFRA 1KFXS 1AHRA 2M7NA 3JVTC 4ICBA 1AVSA 1SCMC 3TDUA 1BG1A 3SIAA 2NCOA 3SJSA 1YVHA 3KO0A 1PRWA 1MR8A 1YX8A 1MQ1A 2L51A 4HRHA 4U8DA 1IKUA 4MRXA 2GGMA 3EVUA 5J3XA 1QX5B 2V53A 1SNLA 2K7DA 2K2AA 2O5GA 1QLSA 5D69A 1UHHA 4DRWA 1LA0A 1DJWA 3F45A 3WHUB 2KYCA 2RGIA 1JUOA 5IBWA 5TNCA 3VRQA 1A03A 4TNCA 3SG2A 1OMVA 2JPTA 2Q4UA 2JXLA 3TUYC 1KQMC 1TNXA 2JXCA 1CM1A 2M7LA 1QASA 2ZNEA 4MLWA 3IF7A 3TS5C 1DGUA 2BKIB 3WHTB 1UHJA 1CDNA 5JJGA 1NX3A 1BT6A 2LHIA 1AK8A 1WDCB 1HT9A 4HREE 4M2OA 1IGVA 1BJFA 1KFXL 1MXLC 1XYDA 2KAYA 2Y5IA 3I5HB 1S6IA 1B7TZ 3H4SE 1C7VA 2LLSA 2BCXA 2MBXA 2BBMA 1B7TY 4GFTA 4CIDA 2KFFA 2R2IA 2OTGB 3ICBA 1KCYA 1DJZA 1TOPA 1JWDA 1U5IA 2Q91A 1BOCA 1CLBA 1CLLA 1NCZA 1K2HA 1JF2A 3IQQA 4YGBB 3LL8B 1UP5A 4AQIA 1QVIZ 1PVBA 2CCMA 4C0KA 3EK8A 5ER5A 4P5OE 2LANA 1QVIY 2LMVA 2H2KA 1YTZC 5BPJA 1SPYA 1B1GA 1UHNA 2COLB 4GGFA 3E3RA 1D1OA 5KTYA 1DJGA 3O4YA 4YBHB 2F2OA 4I5LB 2JTTA 2LAPA 4QJ3B 1KK8B 1A75A 1EJ3A 1U5IB 4MEWA 1JF0A 1QJTA 1WLZA 1NIWA 1HQVA 2WCEA 1KQVA 2JTZA 1PALA 3HCMA 2MLEC 1QV0A 1DMOA 1FI6A 3BUWB 3VRPA 1ALWA 1CFFA 2LHLA 1S1EA 3LK0A 4R1EA 1CDMA 4PHMA 3CR4X 1YRUB 3O78A 1CMGA 1OZOA 2KI4B 1S3PA 1SMGA 1XFVO 3I5IC 1M31A 4N5XA 3BUXB 3K21A 3KEVA 3I5FC 3PLFB 1A75B 1LKJA 2M3WA 4YI8A 2JNFA 1QIVA 2PSRA 1F70A 1DJYA 4I5NB 1H8BA 1TTXA 4ORBB 4NDDA 4DS7A 2BL0B 1PK0D 2L2EA 4MVFA 3PATA 1GJYA 1Y6WA 5JOLA 3DD4A 1AP4A 1YURA 1K9PA 2K0JA 1IJ6A 1SR6C 1QXPA 1YUTA 1NUBA 5HKYA 1K8UA 2M0RA 3OP0A 1OMRA 2H61A 1QX7A 3KPXA 1N2DA 4USLA 2HQWA 2HQ8A 5F6TA 2JWWA 2LVKA 2HPSA 1DT7B 4DUQA 2LP2A 5DKQA 3WXAA 1DVIA 1NP8A 1W7IB 5AEQA 1TRFA 1A2XA 2G2BA 1CFDA 2F2PA 2PRUA 1BLQA 2TN4A 1L2OC 1UHKA 2PALA 4Q04A 4NDBA 2L4IA 2JC2A 1TCOB 3PM8A 1K9UA 1CDLA 3RM1A 1SRAA 4OCIA 3NXAA 3ZWHA 3QRXA 1OMDA 2OPOA 1XFYO 2EGDA 1S36A 1UWOA 2LVVA 3EK7A 3I5GC 1Y0VH 1S6JA 1OE9B 1BODA 5K89A 3CS1A 4N1FA 4YGAA 1TNQA 4PE7A 1XK4C 1SL8A 1F54A 2KSPA 1QATA 1Y1AA 3NSKA 2LNKA 2EC6B 3BYAA 4L9MA 2KHNA 2L0PA 2SCPA
chains in the Genus database with same CATH superfamily
2ZN8A 2D8NA 2KPHA 3IVTA 1M45A 4HSZA 4GGFC 3NSOA 3VRNA 2OS8B 4GPLB 3S0DA 3BFHA 4D1EA 1C07A 2KBMA 2I7AA 3B6XA 4MSPA 4UPGA 3S0FA 1TIZA 1S6CA 3D76A 1MHOA 3D77A 4PE1A 5HL1A 2LVIA 3AKAA 2DOQA 3TDZA 1KSOA 1XFUO 2LE9B 1WY9A 2ZRTA 4YGEB 2LM5A 3LK1A 3SG7A 1CM4A 1QLKA 1ZUZA 1EG4A 1CFCA 2E30A 3OB2B 1K94A 2BCBA 3BXKA 1K93D 2KAVA 1AJ5A 1A4PA 3AAJA 1IQ5A 2GTEA 3DF0A 3O6BA 1BR1B 4XYNA 3FE8A 3OX6A 1KK7Z 2FJUB 1KWOB 1N0YA 2WCMA 2AAOA 3EVVA 2GV5A 4MZLA 1XFZO 1EH2A 3A4UB 1K90D 2QEHA 1NPQA 2MLFC 2M9GA 1NWDA 3CGAA 1V1GA 2CT9A 2L4HA 3HX4A 2I2RE 3O2PA 4F0ZB 3DF0B 1RTP1 3IQOA 1DJHA 3ZNIA 4QJ4B 1CTRA 3KF9A 4AQJA 1ZACA 1DGVA 3JTDB 5HYDA 4HRGA 2VRGA 1C7WA 1EXRA 4FTGA 1DTLA 2I94A 2MHHA 1J7RA 3PN7B 2M97A 1QX2A 1YR5A 5KSZA 3DZTA 1CB1A 3CZ1A 1F71A 2I18A 4MN0A 2JQ6A 4A4CA 1B4CA 1M63B 1AJ4A 2NCPA 3CTNA 2EC6C 2LMUA 4FQOA 1DJIA 5EL2A 3EG5B 2P6BB 5I8NA 2M1UA 1JFKA 2M29A 1OOFA 4PHKA 2OS8C 3FWCA 3TZ1A 1ZFSA 1SL9A 1B8RA 1GGZA 2KOTA 3PSRA 5CSNA 4NDCA 1CMFA 2WCJA 1SCMB 1BR4B 1GQMA 1IRJA 3CDNA 5AFPA 2P71A 2CBLA 1H4BA 1UHIA 1B9AA 1AUIB 3EKJA 5AANA 1WDCC 2FCEA 1SCVA 1LXFC 4AOMA 2ZFDA 4JQ0D 4ETOA 4I5KA 2MJWB 2Y4QA 3OGNA 2ZRSA 3D0YA 5HLOA 3S0EA 2AMIA 4P2YB 2LV7A 3I5HC 1FPWA 1CLMA 4M2QA 3VROA 1IQ3A 4ORAB 1OSAA 2G9BA 1IWQA 2AUCA 1ZOTB 5I2LA 1BU3A 1G33A 3N7HA 2WCKA 3AKBA 1TWOA 3NHTA 2OTGC 1KWOC 3DVEA 1KSMA 1NSHA 2JU0A 1A29A 2GGZA 2LUXA 3EKHA 1E8AA 3V2LA 1JFJA 4NQGA 3S0AA 3TS5B 3VRRA 1PULA 1YUSA 5CSJA 2CNPA 2WCFA 1Z4HA 4WQ2A 2E6WA 1PSBA 3D0YB 3RLZA 1J7QA 3NGVA 5PALA 1OQPA 2BE6A 2BBNA 2NXQA 4KYNA 4ZCVA 1LINA 4OR9B 2PVBA 1L7ZA 3B87A 2JNXA 1BMOA 2QEBA 3SG4A 3VB1A 1YRTB 2WC5A 1WLMA 3DVJA 3PN7C 1KK8C 3DVKA 3LLEA 2ISDA 2IS9A 1F4OA 1TN4A 2KLEA 1ZMZA 1TUJA 1C3YA 2LMTA 1MXEA 1LA3A 5HKZA 4JPZB 1YVLA 5G08A 3AAKA 2FOTA 2F3ZA 2LLTA 1DF0A 4PALA 1SY9A 1UURA 1TUZA 1Z2CB 2PMYA 2QDIA 2MA2A 1SYMA 2BKHB 1S5GZ 3BFBA 4YGCB 2KI4C 3B88A 2KAXA 2WOSA 2LP3A 3GK4X 1S5GY 4OKHA 3SG5A 2WORA 1MF8B 2L5XB 3TDIA 1J1EA 2KNEA 4PCWA 1J55A 4OV2A 1EG3A 1WRZA 1Y1XA 3DVMA 3R1VA 1TCFA 2JT8A 3GOFA 2K7OA 3FIAA 2BL0C 4YRUA 4MZKA 4OVNF 4C0JA 1DF0B 4N1GA 1QV1A 3B7AA 2QPTA 1G4YR 2LCPA 2LUCA 1MUXA 2FCDA 1J1DA 3SG3A 2SASA 3Q8IA 1MWNA 2L50A 1SSEB 2BCAA 4MZJA 1OZSA 5B8IB 4QJ5B 1K9KA 1SBJA 1RK9A 3A8RA 2JT3A 1KFUL 3CLNA 3I5IB 5DKRA 1OOHA 1OW4A 2MAZA 2LC5A 1KK7Y 3I5FB 4MRYA 1NYAA 2WCBA 1NCXA 1TNPA 2JRFA 1F8HA 4CFQA 2B1UA 5AXIA 5CPVA 2JZIA 5HKWA 2ZN9A 3PFVA 1SW8A 2EHBA 5KU1A 3QMEA 1IJ5A 3S0BA 5I2OA 2CTNA 3SS3A 4C0LA 3DY9A 2M49B 4MBEA 1SR6B 2O60A 2ZKMX 3FE6A 2F8PA 2H61C 2K8MB 1RROA 2L98A 3OHMB 4WQ3A 4A4BA 3B86A 4GGNA 1CFPA 2LLUA 3CZTX 1C3ZA 5DKNA 1QS7A 4DCKA 1K95A 3CR5X 1NX0A 1SL7A 2PASA 1CNPA 1NCYA 2YGUA 2NLNA 3GK1A 4OZDA 2NZ0A 4PHNA 3SG6A 1W7JB 3GK2A 3R72A 1NX2A 4ORCB 1FI5A 2K7CA 2WCLA 1RJVA 1F55A 2KGBC 2ZNDA 2PQLA 1NX1A 1XK4A 3FS7A 2BAPA 1L2OB 4CPVA 2BE4A 3SIBA 1FBVA 1YUUA 5GQQC 1M39A 1JSAA 1ODBA 4YGDB 1YX7A 1Y1UA 2K2FA 5ER4X 4CLNA 1DJXA 2KQYA 2L2CA 2Y1NA 2KBIA 3OB1B 3JVTB 3BUMB 1SKTA 4XJKA 3BOWA 1WRLA 4JKTA 2KDHA 3R1OA 1SK6D 1V1FA 4PDZA 3I5GB 1LVCD 1WRKA 1GGWA 1Q80A 2LVJA 1PSRA 3BUOB 2M1KB 4IL1A 4PE0A 2K7BA 4I5JA 5I2QA 3DYEA 4JWQA 1LS8A 5FI6A 3LCPC 1XVJA 3FE9A 2K61A 1IH0A 4DIRA 4M2PA 1K96A 1R2UA 3CR2A 2KYFA 1X02A 1TNWA 1B8LA 1FW4A 3BQ3A 5CSIA 1RWYA 2KI6C 2MRDA 1F4QA 3BOWB 3OX5A 3CWGA 1ORGA 4XJKB 2HF5A 3TUYB 3EK4A 1QIWA 3D10A 3MSEB 1KQMB 4BY5A 3BFAA 3VGOA 2F3YA 1EL4A 3O4XA 5CSFA 1CKKA 2JPOA 2KGRA 1B8CA 4GAOA 2WCHA 4GNKB 1ALVA 4ZCUA 1DEKA 2M8UA 1N65A 5AERA 2KFGA 1PVAA 1IG5A 3FWBA 5HLVA 4GUKA 1JC2A 2CXJA 4BY4A 1BF5A 2Y1MA 3PJIA 4PHJA 1J7OA 1XFRA 3OBVA 3NSLA 1J7PA 2F33A 1CDPA 3RZSA 1S26D 2WC8A 3JTDC 1VRKA 1XFXO 4PE4A 2BNXA 1G8IA 3M0WA 3NSIA 2BECA 3BUNB 2JULA 3WNXB 2A4JA 2KFHA 1JBAA 2JT0A 1RFJA 2QACA 2KI6D 1DQEA 3C1VA 1R6PA 2KQ6A 1RECA 1KFUS 1M46A 3CABA 4E68A 1XFWO 1FF1A 1B47A 3EVRA 2JOJA 1QTXA 4YI9A 2ERBA 2HETA 2WNDA 5D7FA 1DC1A 3PALA 3KHEA 1UUSA 1OOJA 4WRIA 1XA5A 5FYXA 4GBAA 1XO5A 4CFRA 1KFXS 1AHRA 2M7NA 3JVTC 4ICBA 1T14A 1AVSA 1SCMC 3TDUA 1BG1A 2FJYA 3CZ0A 4INXA 3SIAA 2NCOA 3SJSA 1YVHA 3KO0A 1PRWA 1MR8A 1YX8A 1MQ1A 2L51A 4HRHA 4U8DA 1IKUA 4MRXA 2GGMA 3EVUA 5J3XA 1QX5B 2V53A 1SNLA 2K7DA 2K2AA 2O5GA 1QLSA 5D69A 1UHHA 2K60A 4DRWA 3D75A 1LA0A 1DJWA 3F45A 3WHUB 2KYCA 2RGIA 5FI7A 1JUOA 5IBWA 5TNCA 3VRQA 1A03A 4F7FA 3L4AA 4TNCA 3SG2A 3D78A 1OMVA 2JPTA 2Q4UA 2JXLA 3TUYC 1KQMC 1TNXA 2JXCA 1CM1A 2M7LA 1QASA 2ZNEA 4MLWA 3IF7A 3DXLA 3R1PA 1DGUA 2BKIB 3TS5C 1UHJA 3WHTB 5JJGA 1NX3A 1CDNA 1BT6A 2LHIA 3L4LA 1AK8A 1WDCB 1HT9A 4HREE 4M2OA 1IGVA 1BJFA 1KFXL 1MXLC 2PYQA 1XYDA 2KAYA 2Y5IA 3I5HB 1S6IA 1B7TZ 3H4SE 1C7VA 2LLSA 3D73A 2BCXA 2MBXA 2BBMA 1B7TY 4GFTA 4CIDA 2KFFA 5DICA 2R2IA 2OTGB 3ICBA 1KCYA 3D74A 1DJZA 1TOPA 2L5YA 1IIOA 2QEOA 1U5IA 1JWDA 2Q91A 1BOCA 1CLBA 1OOGA 1CLLA 1NCZA 1K2HA 1P28A 1JF2A 4INWA 3IQQA 4YGBB 3LL8B 1UP5A 4AQIA 1QVIZ 1PVBA 2CCMA 4C0KA 3EK8A 5ER5A 4P5OE 2LANA 1QVIY 2LMVA 5FI2A 5I94A 2H2KA 1YTZC 3CZ2A 5BPJA 1SPYA 1B1GA 1UHNA 2COLB 4GGFA 3BJHA 3E3RA 1D1OA 5KTYA 1DJGA 3O4YA 4YBHB 2F2OA 2KLDA 4I5LB 2JTTA 3UNWA 2LAPA 4QJ3B 1KK8B 2P70A 1A75A 1EJ3A 1U5IB 4MEWA 1JF0A 1QJTA 1WLZA 1NIWA 1HQVA 2WCEA 1KQVA 2JTZA 1PALA 3HCMA 2MLEC 1QV0A 1DMOA 1FI6A 3BUWB 3VRPA 1ALWA 1CFFA 2LHLA 1S1EA 3LK0A 4R1EA 1CDMA 4PHMA 3CR4X 1YRUB 3O78A 1CMGA 1OZOA 2KI4B 1S3PA 1SMGA 1XFVO 3I5IC 1M31A 4JD9A 3L47A 4N5XA 3BUXB 3K21A 3KEVA 3I5FC 3PLFB 1A75B 1LKJA 2M3WA 4YI8A 2JNFA 1QIVA 2PSRA 1F70A 1DJYA 4I5NB 1H8BA 1TTXA 4ORBB 4NDDA 4DS7A 2BL0B 1PK0D 2L2EA 3PM2A 4MVFA 3PATA 1GJYA 1Y6WA 5JOLA 3DD4A 3UO9A 1AP4A 1YURA 1K9PA 2K0JA 1IJ6A 1SR6C 1QXPA 1YUTA 3K1EA 1NUBA 5HKYA 1K8UA 2M0RA 1OOIX 2H8VA 1OMRA 3OP0A 4PT1A 1GM0A 2QEVA 2H61A 1QX7A 3KPXA 1N2DA 4USLA 2HQWA 2HQ8A 5F6TA 2JWWA 2LVKA 2HPSA 1DELA 3S0GA 3SS5A 4DUQA 1DT7B 2LP2A 5DKQA 3WXAA 1DVIA 1NP8A 1W7IB 5AEQA 1TRFA 1A2XA 2G2BA 1CFDA 1QWVA 2F2PA 2PRUA 2WC6A 1BLQA 2TN4A 1L2OC 1UHKA 2PALA 4Q04A 4NDBA 2L4IA 2JC2A 1TCOB 3PM8A 1K9UA 1CDLA 3RM1A 3SS4A 1SRAA 4OCIA 3NXAA 3ZWHA 3QRXA 1OMDA 2OPOA 1XFYO 2EGDA 1S36A 3NHIA 4IJ7A 1UWOA 2LVVA 3EK7A 3I5GC 1Y0VH 5D3OA 1S6JA 1OE9B 1BODA 3CYZA 4FQTA 5K89A 3CS1A 4N1FA 4YGAA 1TNQA 4PE7A 1XK4C 1SL8A 1F54A 2KSPA 1QATA 1Y1AA 3NSKA 2LNKA 2EC6B 3BYAA 4L9MA 2KHNA 2L0PA 1W9ZA 2SCPA
chains in the Genus database with same CATH topology
2ZN8A 2D8NA 1M45A 4HSZA 4GGFC 3NSOA 3VRNA 2OS8B 4GPLB 4D1EA 1C07A 2KBMA 2I7AA 4MSPA 4UPGA 1TIZA 1S6CA 1MHOA 4PE1A 2LVIA 3AKAA 2DOQA 3TDZA 1KSOA 1XFUO 2LE9B 1WY9A 2ZRTA 4YGEB 2LM5A 3LK1A 3SG7A 1CM4A 1QLKA 1ZUZA 1EG4A 1CFCA 2E30A 3OB2B 1K94A 2BCBA 3BXKA 1K93D 2KAVA 1AJ5A 1A4PA 3AAJA 1IQ5A 3DF0A 3O6BA 1BR1B 4XYNA 3OX6A 1KK7Z 2FJUB 1KWOB 1N0YA 2AAOA 3EVVA 2GV5A 4MZLA 1XFZO 1EH2A 3A4UB 1K90D 1NPQA 2MLFC 2M9GA 1NWDA 3CGAA 1V1GA 2CT9A 2L4HA 3HX4A 2I2RE 3O2PA 4F0ZB 3DF0B 1RTP1 3IQOA 1DJHA 3ZNIA 4QJ4B 1CTRA 3KF9A 4AQJA 1ZACA 1DGVA 3JTDB 5HYDA 4HRGA 2VRGA 1C7WA 1EXRA 4FTGA 1DTLA 2I94A 2MHHA 1J7RA 3PN7B 2M97A 1QX2A 1YR5A 5KSZA 1CB1A 1F71A 2I18A 4MN0A 2JQ6A 4A4CA 1B4CA 1M63B 1AJ4A 2NCPA 3CTNA 2EC6C 2LMUA 4FQOA 1DJIA 2P6BB 5I8NA 2M1UA 1JFKA 2M29A 4PHKA 2OS8C 3FWCA 3TZ1A 1ZFSA 1SL9A 1B8RA 1GGZA 2KOTA 3PSRA 5CSNA 4NDCA 1CMFA 1SCMB 1BR4B 1GQMA 1IRJA 5AFPA 2CBLA 1H4BA 1UHIA 1B9AA 1AUIB 3EKJA 5AANA 1WDCC 2FCEA 1SCVA 1LXFC 4AOMA 2ZFDA 4JQ0D 4ETOA 4I5KA 2MJWB 2Y4QA 2ZRSA 3D0YA 5HLOA 2AMIA 4P2YB 2LV7A 3I5HC 1FPWA 1CLMA 4M2QA 3VROA 1IQ3A 4ORAB 1OSAA 2G9BA 1IWQA 2AUCA 1ZOTB 5I2LA 1BU3A 1G33A 3AKBA 2OTGC 1KWOC 3DVEA 1KSMA 1NSHA 2JU0A 1A29A 2GGZA 2LUXA 3EKHA 1E8AA 1JFJA 4NQGA 3TS5B 3VRRA 1PULA 1YUSA 5CSJA 2CNPA 2WCFA 4WQ2A 2E6WA 1PSBA 3D0YB 3RLZA 1J7QA 5PALA 1OQPA 2BE6A 2BBNA 2NXQA 4ZCVA 1LINA 4OR9B 2PVBA 1L7ZA 2JNXA 1BMOA 3SG4A 1YRTB 1WLMA 3DVJA 3PN7C 1KK8C 3DVKA 3LLEA 2ISDA 2IS9A 1F4OA 1TN4A 1ZMZA 2LMTA 1MXEA 1LA3A 5HKZA 4JPZB 1YVLA 5G08A 3AAKA 2FOTA 2F3ZA 2LLTA 1DF0A 4PALA 1SY9A 1UURA 2PMYA 2MA2A 1SYMA 2BKHB 1S5GZ 4YGCB 2KI4C 2KAXA 2WOSA 2LP3A 3GK4X 1S5GY 4OKHA 3SG5A 2WORA 1MF8B 2L5XB 3TDIA 1J1EA 2KNEA 4PCWA 1J55A 4OV2A 1EG3A 1WRZA 1Y1XA 3DVMA 1TCFA 2JT8A 3GOFA 2K7OA 3FIAA 2BL0C 4YRUA 4MZKA 4OVNF 4C0JA 1DF0B 4N1GA 1QV1A 2QPTA 1G4YR 2LCPA 2LUCA 1MUXA 2FCDA 1J1DA 3SG3A 2SASA 1MWNA 2L50A 4MZJA 2BCAA 5B8IB 1OZSA 4QJ5B 1K9KA 1SBJA 1RK9A 3A8RA 2JT3A 1KFUL 3CLNA 3I5IB 5DKRA 2MAZA 2LC5A 1KK7Y 3I5FB 4MRYA 1NYAA 2WCBA 1NCXA 1TNPA 2JRFA 1F8HA 4CFQA 2B1UA 5AXIA 5CPVA 2JZIA 5HKWA 2ZN9A 3PFVA 1SW8A 2EHBA 5KU1A 1IJ5A 5I2OA 2CTNA 4C0LA 2M49B 4MBEA 1SR6B 2O60A 2ZKMX 2F8PA 2H61C 2K8MB 1RROA 2L98A 3OHMB 4WQ3A 4A4BA 4GGNA 1CFPA 2LLUA 3CZTX 5DKNA 1QS7A 4DCKA 1K95A 3CR5X 1NX0A 1SL7A 2PASA 1CNPA 1NCYA 2NLNA 3GK1A 2NZ0A 4PHNA 3SG6A 1W7JB 3GK2A 4ORCB 1NX2A 1FI5A 2K7CA 1F55A 1RJVA 2KGBC 2ZNDA 1NX1A 1XK4A 3FS7A 1L2OB 4CPVA 2BE4A 3SIBA 1FBVA 1YUUA 5GQQC 1M39A 1JSAA 1ODBA 4YGDB 1YX7A 1Y1UA 2K2FA 5ER4X 4CLNA 1DJXA 2KQYA 2Y1NA 2KBIA 3OB1B 3JVTB 3BUMB 1SKTA 4XJKA 3BOWA 1WRLA 2KDHA 1SK6D 1V1FA 4PDZA 3I5GB 1LVCD 1WRKA 1GGWA 1Q80A 2LVJA 1PSRA 3BUOB 2M1KB 4IL1A 4PE0A 2K7BA 4I5JA 5I2QA 4JWQA 3LCPC 1XVJA 2K61A 1IH0A 4DIRA 4M2PA 1K96A 1R2UA 3CR2A 2KYFA 1X02A 1TNWA 1B8LA 1FW4A 3BQ3A 5CSIA 1RWYA 2KI6C 2MRDA 1F4QA 3BOWB 3OX5A 3CWGA 4XJKB 4BY5A 2HF5A 3TUYB 3EK4A 1QIWA 3D10A 3MSEB 1KQMB 3VGOA 2F3YA 1EL4A 5CSFA 1CKKA 2KGRA 1B8CA 4GAOA 4GNKB 1ALVA 4ZCUA 2M8UA 1N65A 5AERA 2KFGA 1PVAA 1IG5A 3FWBA 5HLVA 4GUKA 1JC2A 2CXJA 4BY4A 1BF5A 2Y1MA 4PHJA 1J7OA 1J7PA 3NSLA 2F33A 1CDPA 1S26D 2WC8A 3JTDC 1VRKA 1XFXO 4PE4A 1G8IA 3M0WA 3NSIA 2BECA 3BUNB 2JULA 3WNXB 2A4JA 2KFHA 1JBAA 2JT0A 1RFJA 2QACA 2KI6D 3C1VA 1R6PA 2KQ6A 1RECA 1KFUS 1M46A 4E68A 1XFWO 1FF1A 1B47A 3EVRA 2JOJA 1QTXA 4YI9A 2HETA 2WNDA 5D7FA 3PALA 3KHEA 1UUSA 1OOJA 4WRIA 1XA5A 5FYXA 4GBAA 1XO5A 4CFRA 1KFXS 1AHRA 2M7NA 3JVTC 4ICBA 1AVSA 1SCMC 3TDUA 1BG1A 3SIAA 2NCOA 3SJSA 1YVHA 3KO0A 1PRWA 1MR8A 1YX8A 1MQ1A 2L51A 4HRHA 4U8DA 1IKUA 4MRXA 2GGMA 3EVUA 5J3XA 1QX5B 2V53A 1SNLA 2K7DA 2K2AA 2O5GA 1QLSA 5D69A 1UHHA 4DRWA 1LA0A 1DJWA 3F45A 3WHUB 2KYCA 2RGIA 1JUOA 5IBWA 5TNCA 3VRQA 1A03A 4TNCA 3SG2A 1OMVA 2JPTA 2Q4UA 2JXLA 3TUYC 1KQMC 1TNXA 2JXCA 1CM1A 2M7LA 1QASA 2ZNEA 4MLWA 3IF7A 3TS5C 1DGUA 2BKIB 3WHTB 1UHJA 1CDNA 5JJGA 1NX3A 1BT6A 2LHIA 1AK8A 1WDCB 1HT9A 4HREE 4M2OA 1IGVA 1BJFA 1KFXL 1MXLC 1XYDA 2KAYA 2Y5IA 3I5HB 1S6IA 1B7TZ 3H4SE 1C7VA 2LLSA 2BCXA 2MBXA 2BBMA 1B7TY 4GFTA 4CIDA 2KFFA 2R2IA 2OTGB 3ICBA 1KCYA 1DJZA 1TOPA 1JWDA 1U5IA 2Q91A 1BOCA 1CLBA 1CLLA 1NCZA 1K2HA 1JF2A 3IQQA 4YGBB 3LL8B 1UP5A 4AQIA 1QVIZ 1PVBA 2CCMA 4C0KA 3EK8A 5ER5A 4P5OE 2LANA 1QVIY 2LMVA 2H2KA 1YTZC 5BPJA 1SPYA 1B1GA 1UHNA 2COLB 4GGFA 3E3RA 1D1OA 5KTYA 1DJGA 3O4YA 4YBHB 2F2OA 4I5LB 2JTTA 2LAPA 4QJ3B 1KK8B 1A75A 1EJ3A 1U5IB 4MEWA 1JF0A 1QJTA 1WLZA 1NIWA 1HQVA 2WCEA 1KQVA 2JTZA 1PALA 3HCMA 2MLEC 1QV0A 1DMOA 1FI6A 3BUWB 3VRPA 1ALWA 1CFFA 2LHLA 1S1EA 3LK0A 4R1EA 1CDMA 4PHMA 3CR4X 1YRUB 3O78A 1CMGA 1OZOA 2KI4B 1S3PA 1SMGA 1XFVO 3I5IC 1M31A 4N5XA 3BUXB 3K21A 3KEVA 3I5FC 3PLFB 1A75B 1LKJA 2M3WA 4YI8A 2JNFA 1QIVA 2PSRA 1F70A 1DJYA 4I5NB 1H8BA 1TTXA 4ORBB 4NDDA 4DS7A 2BL0B 1PK0D 2L2EA 4MVFA 3PATA 1GJYA 1Y6WA 5JOLA 3DD4A 1AP4A 1YURA 1K9PA 2K0JA 1IJ6A 1SR6C 1QXPA 1YUTA 1NUBA 5HKYA 1K8UA 2M0RA 3OP0A 1OMRA 2H61A 1QX7A 3KPXA 1N2DA 4USLA 2HQWA 2HQ8A 5F6TA 2JWWA 2LVKA 2HPSA 1DT7B 4DUQA 2LP2A 5DKQA 3WXAA 1DVIA 1NP8A 1W7IB 5AEQA 1TRFA 1A2XA 2G2BA 1CFDA 2F2PA 2PRUA 1BLQA 2TN4A 1L2OC 1UHKA 2PALA 4Q04A 4NDBA 2L4IA 2JC2A 1TCOB 3PM8A 1K9UA 1CDLA 3RM1A 1SRAA 4OCIA 3NXAA 3ZWHA 3QRXA 1OMDA 2OPOA 1XFYO 2EGDA 1S36A 1UWOA 2LVVA 3EK7A 3I5GC 1Y0VH 1S6JA 1OE9B 1BODA 5K89A 3CS1A 4N1FA 4YGAA 1TNQA 4PE7A 1XK4C 1SL8A 1F54A 2KSPA 1QATA 1Y1AA 3NSKA 2LNKA 2EC6B 3BYAA 4L9MA 2KHNA 2L0PA 2SCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZN8 A;  2D8N A;  1M45 A;  4HSZ A;  4GGF C;  3NSO A;  3VRN A;  2OS8 B;  4GPL B;  4D1E A;  1C07 A;  2KBM A;  2I7A A;  4MSP A;  4UPG A;  1TIZ A;  1S6C A;  1MHO A;  4PE1 A;  2LVI A;  3AKA A;  2DOQ A;  3TDZ A;  1KSO A;  1XFU O;  2LE9 B;  1WY9 A;  2ZRT A;  4YGE B;  2LM5 A;  3LK1 A;  3SG7 A;  1CM4 A;  1QLK A;  1ZUZ A;  1EG4 A;  1CFC A;  2E30 A;  3OB2 B;  1K94 A;  2BCB A;  3BXK A;  1K93 D;  2KAV A;  1AJ5 A;  1A4P A;  3AAJ A;  1IQ5 A;  3DF0 A;  3O6B A;  1BR1 B;  4XYN A;  3OX6 A;  1KK7 Z;  2FJU B;  1KWO B;  1N0Y A;  2AAO A;  3EVV A;  2GV5 A;  4MZL A;  1XFZ O;  1EH2 A;  3A4U B;  1K90 D;  1NPQ A;  2MLF C;  2M9G A;  1NWD A;  3CGA A;  1V1G A;  2CT9 A;  2L4H A;  3HX4 A;  2I2R E;  3O2P A;  4F0Z B;  3DF0 B;  1RTP 1;  3IQO A;  1DJH A;  3ZNI A;  4QJ4 B;  1CTR A;  3KF9 A;  4AQJ A;  1ZAC A;  1DGV A;  3JTD B;  5HYD A;  4HRG A;  2VRG A;  1C7W A;  1EXR A;  4FTG A;  1DTL A;  2I94 A;  2MHH A;  1J7R A;  3PN7 B;  2M97 A;  1QX2 A;  1YR5 A;  5KSZ A;  1CB1 A;  1F71 A;  2I18 A;  4MN0 A;  2JQ6 A;  4A4C A;  1B4C A;  1M63 B;  1AJ4 A;  2NCP A;  3CTN A;  2EC6 C;  2LMU A;  4FQO A;  1DJI A;  2P6B B;  5I8N A;  2M1U A;  1JFK A;  2M29 A;  4PHK A;  2OS8 C;  3FWC A;  3TZ1 A;  1ZFS A;  1SL9 A;  1B8R A;  1GGZ A;  2KOT A;  3PSR A;  5CSN A;  4NDC A;  1CMF A;  1SCM B;  1BR4 B;  1GQM A;  1IRJ A;  5AFP A;  2CBL A;  1H4B A;  1UHI A;  1B9A A;  1AUI B;  3EKJ A;  5AAN A;  1WDC C;  2FCE A;  1SCV A;  1LXF C;  4AOM A;  2ZFD A;  4JQ0 D;  4ETO A;  4I5K A;  2MJW B;  2Y4Q A;  2ZRS A;  3D0Y A;  5HLO A;  2AMI A;  4P2Y B;  2LV7 A;  3I5H C;  1FPW A;  1CLM A;  4M2Q A;  3VRO A;  1IQ3 A;  4ORA B;  1OSA A;  2G9B A;  1IWQ A;  2AUC A;  1ZOT B;  5I2L A;  1BU3 A;  1G33 A;  3AKB A;  2OTG C;  1KWO C;  3DVE A;  1KSM A;  1NSH A;  2JU0 A;  1A29 A;  2GGZ A;  2LUX A;  3EKH A;  1E8A A;  1JFJ A;  4NQG A;  3TS5 B;  3VRR A;  1PUL A;  1YUS A;  5CSJ A;  2CNP A;  2WCF A;  4WQ2 A;  2E6W A;  1PSB A;  3D0Y B;  3RLZ A;  1J7Q A;  5PAL A;  1OQP A;  2BE6 A;  2BBN A;  2NXQ A;  4ZCV A;  1LIN A;  4OR9 B;  2PVB A;  1L7Z A;  2JNX A;  1BMO A;  3SG4 A;  1YRT B;  1WLM A;  3DVJ A;  3PN7 C;  1KK8 C;  3DVK A;  3LLE A;  2ISD A;  2IS9 A;  1F4O A;  1TN4 A;  1ZMZ A;  2LMT A;  1MXE A;  1LA3 A;  5HKZ A;  4JPZ B;  1YVL A;  5G08 A;  3AAK A;  2FOT A;  2F3Z A;  2LLT A;  1DF0 A;  4PAL A;  1SY9 A;  1UUR A;  2PMY A;  2MA2 A;  1SYM A;  2BKH B;  1S5G Z;  4YGC B;  2KI4 C;  2KAX A;  2WOS A;  2LP3 A;  3GK4 X;  1S5G Y;  4OKH A;  3SG5 A;  2WOR A;  1MF8 B;  2L5X B;  3TDI A;  1J1E A;  2KNE A;  4PCW A;  1J55 A;  4OV2 A;  1EG3 A;  1WRZ A;  1Y1X A;  3DVM A;  1TCF A;  2JT8 A;  3GOF A;  2K7O A;  3FIA A;  2BL0 C;  4YRU A;  4MZK A;  4OVN F;  4C0J A;  1DF0 B;  4N1G A;  1QV1 A;  2QPT A;  1G4Y R;  2LCP A;  2LUC A;  1MUX A;  2FCD A;  1J1D A;  3SG3 A;  2SAS A;  1MWN A;  2L50 A;  4MZJ A;  2BCA A;  5B8I B;  1OZS A;  4QJ5 B;  1K9K A;  1SBJ A;  1RK9 A;  3A8R A;  2JT3 A;  1KFU L;  3CLN A;  3I5I B;  5DKR A;  2MAZ A;  2LC5 A;  1KK7 Y;  3I5F B;  4MRY A;  1NYA A;  2WCB A;  1NCX A;  1TNP A;  2JRF A;  1F8H A;  4CFQ A;  2B1U A;  5AXI A;  5CPV A;  2JZI A;  5HKW A;  2ZN9 A;  3PFV A;  1SW8 A;  2EHB A;  5KU1 A;  1IJ5 A;  5I2O A;  2CTN A;  4C0L A;  2M49 B;  4MBE A;  1SR6 B;  2O60 A;  2ZKM X;  2F8P A;  2H61 C;  2K8M B;  1RRO A;  2L98 A;  3OHM B;  4WQ3 A;  4A4B A;  4GGN A;  1CFP A;  2LLU A;  3CZT X;  5DKN A;  1QS7 A;  4DCK A;  1K95 A;  3CR5 X;  1NX0 A;  1SL7 A;  2PAS A;  1CNP A;  1NCY A;  2NLN A;  3GK1 A;  2NZ0 A;  4PHN A;  3SG6 A;  1W7J B;  3GK2 A;  4ORC B;  1NX2 A;  1FI5 A;  2K7C A;  1F55 A;  1RJV A;  2KGB C;  2ZND A;  1NX1 A;  1XK4 A;  3FS7 A;  1L2O B;  4CPV A;  2BE4 A;  3SIB A;  1FBV A;  1YUU A;  5GQQ C;  1M39 A;  1JSA A;  1ODB A;  4YGD B;  1YX7 A;  1Y1U A;  2K2F A;  5ER4 X;  4CLN A;  1DJX A;  2KQY A;  2Y1N A;  2KBI A;  3OB1 B;  3JVT B;  3BUM B;  1SKT A;  4XJK A;  3BOW A;  1WRL A;  2KDH A;  1SK6 D;  1V1F A;  4PDZ A;  3I5G B;  1LVC D;  1WRK A;  1GGW A;  1Q80 A;  2LVJ A;  1PSR A;  3BUO B;  2M1K B;  4IL1 A;  4PE0 A;  2K7B A;  4I5J A;  5I2Q A;  4JWQ A;  3LCP C;  1XVJ A;  2K61 A;  1IH0 A;  4DIR A;  4M2P A;  1K96 A;  1R2U A;  3CR2 A;  2KYF A;  1X02 A;  1TNW A;  1B8L A;  1FW4 A;  3BQ3 A;  5CSI A;  1RWY A;  2KI6 C;  2MRD A;  1F4Q A;  3BOW B;  3OX5 A;  3CWG A;  4XJK B;  4BY5 A;  2HF5 A;  3TUY B;  3EK4 A;  1QIW A;  3D10 A;  3MSE B;  1KQM B;  3VGO A;  2F3Y A;  1EL4 A;  5CSF A;  1CKK A;  2KGR A;  1B8C A;  4GAO A;  4GNK B;  1ALV A;  4ZCU A;  2M8U A;  1N65 A;  5AER A;  2KFG A;  1PVA A;  1IG5 A;  3FWB A;  5HLV A;  4GUK A;  1JC2 A;  2CXJ A;  4BY4 A;  1BF5 A;  2Y1M A;  4PHJ A;  1J7O A;  1J7P A;  3NSL A;  2F33 A;  1CDP A;  1S26 D;  2WC8 A;  3JTD C;  1VRK A;  1XFX O;  4PE4 A;  1G8I A;  3M0W A;  3NSI A;  2BEC A;  3BUN B;  2JUL A;  3WNX B;  2A4J A;  2KFH A;  1JBA A;  2JT0 A;  1RFJ A;  2QAC A;  2KI6 D;  3C1V A;  1R6P A;  2KQ6 A;  1REC A;  1KFU S;  1M46 A;  4E68 A;  1XFW O;  1FF1 A;  1B47 A;  3EVR A;  2JOJ A;  1QTX A;  4YI9 A;  2HET A;  2WND A;  5D7F A;  3PAL A;  3KHE A;  1UUS A;  1OOJ A;  4WRI A;  1XA5 A;  5FYX A;  4GBA A;  1XO5 A;  4CFR A;  1KFX S;  1AHR A;  2M7N A;  3JVT C;  4ICB A;  1AVS A;  1SCM C;  3TDU A;  1BG1 A;  3SIA A;  2NCO A;  3SJS A;  1YVH A;  3KO0 A;  1PRW A;  1MR8 A;  1YX8 A;  1MQ1 A;  2L51 A;  4HRH A;  4U8D A;  1IKU A;  4MRX A;  2GGM A;  3EVU A;  5J3X A;  1QX5 B;  2V53 A;  1SNL A;  2K7D A;  2K2A A;  2O5G A;  1QLS A;  5D69 A;  1UHH A;  4DRW A;  1LA0 A;  1DJW A;  3F45 A;  3WHU B;  2KYC A;  2RGI A;  1JUO A;  5IBW A;  5TNC A;  3VRQ A;  1A03 A;  4TNC A;  3SG2 A;  1OMV A;  2JPT A;  2Q4U A;  2JXL A;  3TUY C;  1KQM C;  1TNX A;  2JXC A;  1CM1 A;  2M7L A;  1QAS A;  2ZNE A;  4MLW A;  3IF7 A;  3TS5 C;  1DGU A;  2BKI B;  3WHT B;  1UHJ A;  1CDN A;  5JJG A;  1NX3 A;  1BT6 A;  2LHI A;  1AK8 A;  1WDC B;  1HT9 A;  4HRE E;  4M2O A;  1IGV A;  1BJF A;  1KFX L;  1MXL C;  1XYD A;  2KAY A;  2Y5I A;  3I5H B;  1S6I A;  1B7T Z;  3H4S E;  1C7V A;  2LLS A;  2BCX A;  2MBX A;  2BBM A;  1B7T Y;  4GFT A;  4CID A;  2KFF A;  2R2I A;  2OTG B;  3ICB A;  1KCY A;  1DJZ A;  1TOP A;  1JWD A;  1U5I A;  2Q91 A;  1BOC A;  1CLB A;  1CLL A;  1NCZ A;  1K2H A;  1JF2 A;  3IQQ A;  4YGB B;  3LL8 B;  1UP5 A;  4AQI A;  1QVI Z;  1PVB A;  2CCM A;  4C0K A;  3EK8 A;  5ER5 A;  4P5O E;  2LAN A;  1QVI Y;  2LMV A;  2H2K A;  1YTZ C;  5BPJ A;  1SPY A;  1B1G A;  1UHN A;  2COL B;  4GGF A;  3E3R A;  1D1O A;  5KTY A;  1DJG A;  3O4Y A;  4YBH B;  2F2O A;  4I5L B;  2JTT A;  2LAP A;  4QJ3 B;  1KK8 B;  1A75 A;  1EJ3 A;  1U5I B;  4MEW A;  1JF0 A;  1QJT A;  1WLZ A;  1NIW A;  1HQV A;  2WCE A;  1KQV A;  2JTZ A;  1PAL A;  3HCM A;  2MLE C;  1QV0 A;  1DMO A;  1FI6 A;  3BUW B;  3VRP A;  1ALW A;  1CFF A;  2LHL A;  1S1E A;  3LK0 A;  4R1E A;  1CDM A;  4PHM A;  3CR4 X;  1YRU B;  3O78 A;  1CMG A;  1OZO A;  2KI4 B;  1S3P A;  1SMG A;  1XFV O;  3I5I C;  1M31 A;  4N5X A;  3BUX B;  3K21 A;  3KEV A;  3I5F C;  3PLF B;  1A75 B;  1LKJ A;  2M3W A;  4YI8 A;  2JNF A;  1QIV A;  2PSR A;  1F70 A;  1DJY A;  4I5N B;  1H8B A;  1TTX A;  4ORB B;  4NDD A;  4DS7 A;  2BL0 B;  1PK0 D;  2L2E A;  4MVF A;  3PAT A;  1GJY A;  1Y6W A;  5JOL A;  3DD4 A;  1AP4 A;  1YUR A;  1K9P A;  2K0J A;  1IJ6 A;  1SR6 C;  1QXP A;  1YUT A;  1NUB A;  5HKY A;  1K8U A;  2M0R A;  3OP0 A;  1OMR A;  2H61 A;  1QX7 A;  3KPX A;  1N2D A;  4USL A;  2HQW A;  2HQ8 A;  5F6T A;  2JWW A;  2LVK A;  2HPS A;  1DT7 B;  4DUQ A;  2LP2 A;  5DKQ A;  3WXA A;  1DVI A;  1NP8 A;  1W7I B;  5AEQ A;  1TRF A;  1A2X A;  2G2B A;  1CFD A;  2F2P A;  2PRU A;  1BLQ A;  2TN4 A;  1L2O C;  1UHK A;  2PAL A;  4Q04 A;  4NDB A;  2L4I A;  2JC2 A;  1TCO B;  3PM8 A;  1K9U A;  1CDL A;  3RM1 A;  1SRA A;  4OCI A;  3NXA A;  3ZWH A;  3QRX A;  1OMD A;  2OPO A;  1XFY O;  2EGD A;  1S36 A;  1UWO A;  2LVV A;  3EK7 A;  3I5G C;  1Y0V H;  1S6J A;  1OE9 B;  1BOD A;  5K89 A;  3CS1 A;  4N1F A;  4YGA A;  1TNQ A;  4PE7 A;  1XK4 C;  1SL8 A;  1F54 A;  2KSP A;  1QAT A;  1Y1A A;  3NSK A;  2LNK A;  2EC6 B;  3BYA A;  4L9M A;  2KHN A;  2L0P A;  2SCP A; 
#chains in the Genus database with same CATH topology
 2ZN8 A;  2D8N A;  2KPH A;  3IVT A;  1M45 A;  4HSZ A;  4GGF C;  3NSO A;  3VRN A;  2OS8 B;  4GPL B;  3S0D A;  3BFH A;  4D1E A;  1C07 A;  2KBM A;  2I7A A;  3B6X A;  4MSP A;  4UPG A;  3S0F A;  1TIZ A;  1S6C A;  3D76 A;  1MHO A;  3D77 A;  4PE1 A;  5HL1 A;  2LVI A;  3AKA A;  2DOQ A;  3TDZ A;  1KSO A;  1XFU O;  2LE9 B;  1WY9 A;  2ZRT A;  4YGE B;  2LM5 A;  3LK1 A;  3SG7 A;  1CM4 A;  1QLK A;  1ZUZ A;  1EG4 A;  1CFC A;  2E30 A;  3OB2 B;  1K94 A;  2BCB A;  3BXK A;  1K93 D;  2KAV A;  1AJ5 A;  1A4P A;  3AAJ A;  1IQ5 A;  2GTE A;  3DF0 A;  3O6B A;  1BR1 B;  4XYN A;  3FE8 A;  3OX6 A;  1KK7 Z;  2FJU B;  1KWO B;  1N0Y A;  2WCM A;  2AAO A;  3EVV A;  2GV5 A;  4MZL A;  1XFZ O;  1EH2 A;  3A4U B;  1K90 D;  2QEH A;  1NPQ A;  2MLF C;  2M9G A;  1NWD A;  3CGA A;  1V1G A;  2CT9 A;  2L4H A;  3HX4 A;  2I2R E;  3O2P A;  4F0Z B;  3DF0 B;  1RTP 1;  3IQO A;  1DJH A;  3ZNI A;  4QJ4 B;  1CTR A;  3KF9 A;  4AQJ A;  1ZAC A;  1DGV A;  3JTD B;  5HYD A;  4HRG A;  2VRG A;  1C7W A;  1EXR A;  4FTG A;  1DTL A;  2I94 A;  2MHH A;  1J7R A;  3PN7 B;  2M97 A;  1QX2 A;  1YR5 A;  5KSZ A;  3DZT A;  1CB1 A;  3CZ1 A;  1F71 A;  2I18 A;  4MN0 A;  2JQ6 A;  4A4C A;  1B4C A;  1M63 B;  1AJ4 A;  2NCP A;  3CTN A;  2EC6 C;  2LMU A;  4FQO A;  1DJI A;  5EL2 A;  3EG5 B;  2P6B B;  5I8N A;  2M1U A;  1JFK A;  2M29 A;  1OOF A;  4PHK A;  2OS8 C;  3FWC A;  3TZ1 A;  1ZFS A;  1SL9 A;  1B8R A;  1GGZ A;  2KOT A;  3PSR A;  5CSN A;  4NDC A;  1CMF A;  2WCJ A;  1SCM B;  1BR4 B;  1GQM A;  1IRJ A;  3CDN A;  5AFP A;  2P71 A;  2CBL A;  1H4B A;  1UHI A;  1B9A A;  1AUI B;  3EKJ A;  5AAN A;  1WDC C;  2FCE A;  1SCV A;  1LXF C;  4AOM A;  2ZFD A;  4JQ0 D;  4ETO A;  4I5K A;  2MJW B;  2Y4Q A;  3OGN A;  2ZRS A;  3D0Y A;  5HLO A;  3S0E A;  2AMI A;  4P2Y B;  2LV7 A;  3I5H C;  1FPW A;  1CLM A;  4M2Q A;  3VRO A;  1IQ3 A;  4ORA B;  1OSA A;  2G9B A;  1IWQ A;  2AUC A;  1ZOT B;  5I2L A;  1BU3 A;  1G33 A;  3N7H A;  2WCK A;  3AKB A;  1TWO A;  3NHT A;  2OTG C;  1KWO C;  3DVE A;  1KSM A;  1NSH A;  2JU0 A;  1A29 A;  2GGZ A;  2LUX A;  3EKH A;  1E8A A;  3V2L A;  1JFJ A;  4NQG A;  3S0A A;  3TS5 B;  3VRR A;  1PUL A;  1YUS A;  5CSJ A;  2CNP A;  2WCF A;  1Z4H A;  4WQ2 A;  2E6W A;  1PSB A;  3D0Y B;  3RLZ A;  1J7Q A;  3NGV A;  5PAL A;  1OQP A;  2BE6 A;  2BBN A;  2NXQ A;  4KYN A;  4ZCV A;  1LIN A;  4OR9 B;  2PVB A;  1L7Z A;  3B87 A;  2JNX A;  1BMO A;  2QEB A;  3SG4 A;  3VB1 A;  1YRT B;  2WC5 A;  1WLM A;  3DVJ A;  3PN7 C;  1KK8 C;  3DVK A;  3LLE A;  2ISD A;  2IS9 A;  1F4O A;  1TN4 A;  2KLE A;  1ZMZ A;  1TUJ A;  1C3Y A;  2LMT A;  1MXE A;  1LA3 A;  5HKZ A;  4JPZ B;  1YVL A;  5G08 A;  3AAK A;  2FOT A;  2F3Z A;  2LLT A;  1DF0 A;  4PAL A;  1SY9 A;  1UUR A;  1TUZ A;  1Z2C B;  2PMY A;  2QDI A;  2MA2 A;  1SYM A;  2BKH B;  1S5G Z;  3BFB A;  4YGC B;  2KI4 C;  3B88 A;  2KAX A;  2WOS A;  2LP3 A;  3GK4 X;  1S5G Y;  4OKH A;  3SG5 A;  2WOR A;  1MF8 B;  2L5X B;  3TDI A;  1J1E A;  2KNE A;  4PCW A;  1J55 A;  4OV2 A;  1EG3 A;  1WRZ A;  1Y1X A;  3DVM A;  3R1V A;  1TCF A;  2JT8 A;  3GOF A;  2K7O A;  3FIA A;  2BL0 C;  4YRU A;  4MZK A;  4OVN F;  4C0J A;  1DF0 B;  4N1G A;  1QV1 A;  3B7A A;  2QPT A;  1G4Y R;  2LCP A;  2LUC A;  1MUX A;  2FCD A;  1J1D A;  3SG3 A;  2SAS A;  3Q8I A;  1MWN A;  2L50 A;  1SSE B;  2BCA A;  4MZJ A;  1OZS A;  5B8I B;  4QJ5 B;  1K9K A;  1SBJ A;  1RK9 A;  3A8R A;  2JT3 A;  1KFU L;  3CLN A;  3I5I B;  5DKR A;  1OOH A;  1OW4 A;  2MAZ A;  2LC5 A;  1KK7 Y;  3I5F B;  4MRY A;  1NYA A;  2WCB A;  1NCX A;  1TNP A;  2JRF A;  1F8H A;  4CFQ A;  2B1U A;  5AXI A;  5CPV A;  2JZI A;  5HKW A;  2ZN9 A;  3PFV A;  1SW8 A;  2EHB A;  5KU1 A;  3QME A;  1IJ5 A;  3S0B A;  5I2O A;  2CTN A;  3SS3 A;  4C0L A;  3DY9 A;  2M49 B;  4MBE A;  1SR6 B;  2O60 A;  2ZKM X;  3FE6 A;  2F8P A;  2H61 C;  2K8M B;  1RRO A;  2L98 A;  3OHM B;  4WQ3 A;  4A4B A;  3B86 A;  4GGN A;  1CFP A;  2LLU A;  3CZT X;  1C3Z A;  5DKN A;  1QS7 A;  4DCK A;  1K95 A;  3CR5 X;  1NX0 A;  1SL7 A;  2PAS A;  1CNP A;  1NCY A;  2YGU A;  2NLN A;  3GK1 A;  4OZD A;  2NZ0 A;  4PHN A;  3SG6 A;  1W7J B;  3GK2 A;  3R72 A;  1NX2 A;  4ORC B;  1FI5 A;  2K7C A;  2WCL A;  1RJV A;  1F55 A;  2KGB C;  2ZND A;  2PQL A;  1NX1 A;  1XK4 A;  3FS7 A;  2BAP A;  1L2O B;  4CPV A;  2BE4 A;  3SIB A;  1FBV A;  1YUU A;  5GQQ C;  1M39 A;  1JSA A;  1ODB A;  4YGD B;  1YX7 A;  1Y1U A;  2K2F A;  5ER4 X;  4CLN A;  1DJX A;  2KQY A;  2L2C A;  2Y1N A;  2KBI A;  3OB1 B;  3JVT B;  3BUM B;  1SKT A;  4XJK A;  3BOW A;  1WRL A;  4JKT A;  2KDH A;  3R1O A;  1SK6 D;  1V1F A;  4PDZ A;  3I5G B;  1LVC D;  1WRK A;  1GGW A;  1Q80 A;  2LVJ A;  1PSR A;  3BUO B;  2M1K B;  4IL1 A;  4PE0 A;  2K7B A;  4I5J A;  5I2Q A;  3DYE A;  4JWQ A;  1LS8 A;  5FI6 A;  3LCP C;  1XVJ A;  3FE9 A;  2K61 A;  1IH0 A;  4DIR A;  4M2P A;  1K96 A;  1R2U A;  3CR2 A;  2KYF A;  1X02 A;  1TNW A;  1B8L A;  1FW4 A;  3BQ3 A;  5CSI A;  1RWY A;  2KI6 C;  2MRD A;  1F4Q A;  3BOW B;  3OX5 A;  3CWG A;  1ORG A;  4XJK B;  2HF5 A;  3TUY B;  3EK4 A;  1QIW A;  3D10 A;  3MSE B;  1KQM B;  4BY5 A;  3BFA A;  3VGO A;  2F3Y A;  1EL4 A;  3O4X A;  5CSF A;  1CKK A;  2JPO A;  2KGR A;  1B8C A;  4GAO A;  2WCH A;  4GNK B;  1ALV A;  4ZCU A;  1DEK A;  2M8U A;  1N65 A;  5AER A;  2KFG A;  1PVA A;  1IG5 A;  3FWB A;  5HLV A;  4GUK A;  1JC2 A;  2CXJ A;  4BY4 A;  1BF5 A;  2Y1M A;  3PJI A;  4PHJ A;  1J7O A;  1XFR A;  3OBV A;  3NSL A;  1J7P A;  2F33 A;  1CDP A;  3RZS A;  1S26 D;  2WC8 A;  3JTD C;  1VRK A;  1XFX O;  4PE4 A;  2BNX A;  1G8I A;  3M0W A;  3NSI A;  2BEC A;  3BUN B;  2JUL A;  3WNX B;  2A4J A;  2KFH A;  1JBA A;  2JT0 A;  1RFJ A;  2QAC A;  2KI6 D;  1DQE A;  3C1V A;  1R6P A;  2KQ6 A;  1REC A;  1KFU S;  1M46 A;  3CAB A;  4E68 A;  1XFW O;  1FF1 A;  1B47 A;  3EVR A;  2JOJ A;  1QTX A;  4YI9 A;  2ERB A;  2HET A;  2WND A;  5D7F A;  1DC1 A;  3PAL A;  3KHE A;  1UUS A;  1OOJ A;  4WRI A;  1XA5 A;  5FYX A;  4GBA A;  1XO5 A;  4CFR A;  1KFX S;  1AHR A;  2M7N A;  3JVT C;  4ICB A;  1T14 A;  1AVS A;  1SCM C;  3TDU A;  1BG1 A;  2FJY A;  3CZ0 A;  4INX A;  3SIA A;  2NCO A;  3SJS A;  1YVH A;  3KO0 A;  1PRW A;  1MR8 A;  1YX8 A;  1MQ1 A;  2L51 A;  4HRH A;  4U8D A;  1IKU A;  4MRX A;  2GGM A;  3EVU A;  5J3X A;  1QX5 B;  2V53 A;  1SNL A;  2K7D A;  2K2A A;  2O5G A;  1QLS A;  5D69 A;  1UHH A;  2K60 A;  4DRW A;  3D75 A;  1LA0 A;  1DJW A;  3F45 A;  3WHU B;  2KYC A;  2RGI A;  5FI7 A;  1JUO A;  5IBW A;  5TNC A;  3VRQ A;  1A03 A;  4F7F A;  3L4A A;  4TNC A;  3SG2 A;  3D78 A;  1OMV A;  2JPT A;  2Q4U A;  2JXL A;  3TUY C;  1KQM C;  1TNX A;  2JXC A;  1CM1 A;  2M7L A;  1QAS A;  2ZNE A;  4MLW A;  3IF7 A;  3DXL A;  3R1P A;  1DGU A;  2BKI B;  3TS5 C;  1UHJ A;  3WHT B;  5JJG A;  1NX3 A;  1CDN A;  1BT6 A;  2LHI A;  3L4L A;  1AK8 A;  1WDC B;  1HT9 A;  4HRE E;  4M2O A;  1IGV A;  1BJF A;  1KFX L;  1MXL C;  2PYQ A;  1XYD A;  2KAY A;  2Y5I A;  3I5H B;  1S6I A;  1B7T Z;  3H4S E;  1C7V A;  2LLS A;  3D73 A;  2BCX A;  2MBX A;  2BBM A;  1B7T Y;  4GFT A;  4CID A;  2KFF A;  5DIC A;  2R2I A;  2OTG B;  3ICB A;  1KCY A;  3D74 A;  1DJZ A;  1TOP A;  2L5Y A;  1IIO A;  2QEO A;  1U5I A;  1JWD A;  2Q91 A;  1BOC A;  1CLB A;  1OOG A;  1CLL A;  1NCZ A;  1K2H A;  1P28 A;  1JF2 A;  4INW A;  3IQQ A;  4YGB B;  3LL8 B;  1UP5 A;  4AQI A;  1QVI Z;  1PVB A;  2CCM A;  4C0K A;  3EK8 A;  5ER5 A;  4P5O E;  2LAN A;  1QVI Y;  2LMV A;  5FI2 A;  5I94 A;  2H2K A;  1YTZ C;  3CZ2 A;  5BPJ A;  1SPY A;  1B1G A;  1UHN A;  2COL B;  4GGF A;  3BJH A;  3E3R A;  1D1O A;  5KTY A;  1DJG A;  3O4Y A;  4YBH B;  2F2O A;  2KLD A;  4I5L B;  2JTT A;  3UNW A;  2LAP A;  4QJ3 B;  1KK8 B;  2P70 A;  1A75 A;  1EJ3 A;  1U5I B;  4MEW A;  1JF0 A;  1QJT A;  1WLZ A;  1NIW A;  1HQV A;  2WCE A;  1KQV A;  2JTZ A;  1PAL A;  3HCM A;  2MLE C;  1QV0 A;  1DMO A;  1FI6 A;  3BUW B;  3VRP A;  1ALW A;  1CFF A;  2LHL A;  1S1E A;  3LK0 A;  4R1E A;  1CDM A;  4PHM A;  3CR4 X;  1YRU B;  3O78 A;  1CMG A;  1OZO A;  2KI4 B;  1S3P A;  1SMG A;  1XFV O;  3I5I C;  1M31 A;  4JD9 A;  3L47 A;  4N5X A;  3BUX B;  3K21 A;  3KEV A;  3I5F C;  3PLF B;  1A75 B;  1LKJ A;  2M3W A;  4YI8 A;  2JNF A;  1QIV A;  2PSR A;  1F70 A;  1DJY A;  4I5N B;  1H8B A;  1TTX A;  4ORB B;  4NDD A;  4DS7 A;  2BL0 B;  1PK0 D;  2L2E A;  3PM2 A;  4MVF A;  3PAT A;  1GJY A;  1Y6W A;  5JOL A;  3DD4 A;  3UO9 A;  1AP4 A;  1YUR A;  1K9P A;  2K0J A;  1IJ6 A;  1SR6 C;  1QXP A;  1YUT A;  3K1E A;  1NUB A;  5HKY A;  1K8U A;  2M0R A;  1OOI X;  2H8V A;  1OMR A;  3OP0 A;  4PT1 A;  1GM0 A;  2QEV A;  2H61 A;  1QX7 A;  3KPX A;  1N2D A;  4USL A;  2HQW A;  2HQ8 A;  5F6T A;  2JWW A;  2LVK A;  2HPS A;  1DEL A;  3S0G A;  3SS5 A;  4DUQ A;  1DT7 B;  2LP2 A;  5DKQ A;  3WXA A;  1DVI A;  1NP8 A;  1W7I B;  5AEQ A;  1TRF A;  1A2X A;  2G2B A;  1CFD A;  1QWV A;  2F2P A;  2PRU A;  2WC6 A;  1BLQ A;  2TN4 A;  1L2O C;  1UHK A;  2PAL A;  4Q04 A;  4NDB A;  2L4I A;  2JC2 A;  1TCO B;  3PM8 A;  1K9U A;  1CDL A;  3RM1 A;  3SS4 A;  1SRA A;  4OCI A;  3NXA A;  3ZWH A;  3QRX A;  1OMD A;  2OPO A;  1XFY O;  2EGD A;  1S36 A;  3NHI A;  4IJ7 A;  1UWO A;  2LVV A;  3EK7 A;  3I5G C;  1Y0V H;  5D3O A;  1S6J A;  1OE9 B;  1BOD A;  3CYZ A;  4FQT A;  5K89 A;  3CS1 A;  4N1F A;  4YGA A;  1TNQ A;  4PE7 A;  1XK4 C;  1SL8 A;  1F54 A;  2KSP A;  1QAT A;  1Y1A A;  3NSK A;  2LNK A;  2EC6 B;  3BYA A;  4L9M A;  2KHN A;  2L0P A;  1W9Z A;  2SCP A; 
#chains in the Genus database with same CATH homology
 2ZN8 A;  2D8N A;  1M45 A;  4HSZ A;  4GGF C;  3NSO A;  3VRN A;  2OS8 B;  4GPL B;  4D1E A;  1C07 A;  2KBM A;  2I7A A;  4MSP A;  4UPG A;  1TIZ A;  1S6C A;  1MHO A;  4PE1 A;  2LVI A;  3AKA A;  2DOQ A;  3TDZ A;  1KSO A;  1XFU O;  2LE9 B;  1WY9 A;  2ZRT A;  4YGE B;  2LM5 A;  3LK1 A;  3SG7 A;  1CM4 A;  1QLK A;  1ZUZ A;  1EG4 A;  1CFC A;  2E30 A;  3OB2 B;  1K94 A;  2BCB A;  3BXK A;  1K93 D;  2KAV A;  1AJ5 A;  1A4P A;  3AAJ A;  1IQ5 A;  3DF0 A;  3O6B A;  1BR1 B;  4XYN A;  3OX6 A;  1KK7 Z;  2FJU B;  1KWO B;  1N0Y A;  2AAO A;  3EVV A;  2GV5 A;  4MZL A;  1XFZ O;  1EH2 A;  3A4U B;  1K90 D;  1NPQ A;  2MLF C;  2M9G A;  1NWD A;  3CGA A;  1V1G A;  2CT9 A;  2L4H A;  3HX4 A;  2I2R E;  3O2P A;  4F0Z B;  3DF0 B;  1RTP 1;  3IQO A;  1DJH A;  3ZNI A;  4QJ4 B;  1CTR A;  3KF9 A;  4AQJ A;  1ZAC A;  1DGV A;  3JTD B;  5HYD A;  4HRG A;  2VRG A;  1C7W A;  1EXR A;  4FTG A;  1DTL A;  2I94 A;  2MHH A;  1J7R A;  3PN7 B;  2M97 A;  1QX2 A;  1YR5 A;  5KSZ A;  1CB1 A;  1F71 A;  2I18 A;  4MN0 A;  2JQ6 A;  4A4C A;  1B4C A;  1M63 B;  1AJ4 A;  2NCP A;  3CTN A;  2EC6 C;  2LMU A;  4FQO A;  1DJI A;  2P6B B;  5I8N A;  2M1U A;  1JFK A;  2M29 A;  4PHK A;  2OS8 C;  3FWC A;  3TZ1 A;  1ZFS A;  1SL9 A;  1B8R A;  1GGZ A;  2KOT A;  3PSR A;  5CSN A;  4NDC A;  1CMF A;  1SCM B;  1BR4 B;  1GQM A;  1IRJ A;  5AFP A;  2CBL A;  1H4B A;  1UHI A;  1B9A A;  1AUI B;  3EKJ A;  5AAN A;  1WDC C;  2FCE A;  1SCV A;  1LXF C;  4AOM A;  2ZFD A;  4JQ0 D;  4ETO A;  4I5K A;  2MJW B;  2Y4Q A;  2ZRS A;  3D0Y A;  5HLO A;  2AMI A;  4P2Y B;  2LV7 A;  3I5H C;  1FPW A;  1CLM A;  4M2Q A;  3VRO A;  1IQ3 A;  4ORA B;  1OSA A;  2G9B A;  1IWQ A;  2AUC A;  1ZOT B;  5I2L A;  1BU3 A;  1G33 A;  3AKB A;  2OTG C;  1KWO C;  3DVE A;  1KSM A;  1NSH A;  2JU0 A;  1A29 A;  2GGZ A;  2LUX A;  3EKH A;  1E8A A;  1JFJ A;  4NQG A;  3TS5 B;  3VRR A;  1PUL A;  1YUS A;  5CSJ A;  2CNP A;  2WCF A;  4WQ2 A;  2E6W A;  1PSB A;  3D0Y B;  3RLZ A;  1J7Q A;  5PAL A;  1OQP A;  2BE6 A;  2BBN A;  2NXQ A;  4ZCV A;  1LIN A;  4OR9 B;  2PVB A;  1L7Z A;  2JNX A;  1BMO A;  3SG4 A;  1YRT B;  1WLM A;  3DVJ A;  3PN7 C;  1KK8 C;  3DVK A;  3LLE A;  2ISD A;  2IS9 A;  1F4O A;  1TN4 A;  1ZMZ A;  2LMT A;  1MXE A;  1LA3 A;  5HKZ A;  4JPZ B;  1YVL A;  5G08 A;  3AAK A;  2FOT A;  2F3Z A;  2LLT A;  1DF0 A;  4PAL A;  1SY9 A;  1UUR A;  2PMY A;  2MA2 A;  1SYM A;  2BKH B;  1S5G Z;  4YGC B;  2KI4 C;  2KAX A;  2WOS A;  2LP3 A;  3GK4 X;  1S5G Y;  4OKH A;  3SG5 A;  2WOR A;  1MF8 B;  2L5X B;  3TDI A;  1J1E A;  2KNE A;  4PCW A;  1J55 A;  4OV2 A;  1EG3 A;  1WRZ A;  1Y1X A;  3DVM A;  1TCF A;  2JT8 A;  3GOF A;  2K7O A;  3FIA A;  2BL0 C;  4YRU A;  4MZK A;  4OVN F;  4C0J A;  1DF0 B;  4N1G A;  1QV1 A;  2QPT A;  1G4Y R;  2LCP A;  2LUC A;  1MUX A;  2FCD A;  1J1D A;  3SG3 A;  2SAS A;  1MWN A;  2L50 A;  4MZJ A;  2BCA A;  5B8I B;  1OZS A;  4QJ5 B;  1K9K A;  1SBJ A;  1RK9 A;  3A8R A;  2JT3 A;  1KFU L;  3CLN A;  3I5I B;  5DKR A;  2MAZ A;  2LC5 A;  1KK7 Y;  3I5F B;  4MRY A;  1NYA A;  2WCB A;  1NCX A;  1TNP A;  2JRF A;  1F8H A;  4CFQ A;  2B1U A;  5AXI A;  5CPV A;  2JZI A;  5HKW A;  2ZN9 A;  3PFV A;  1SW8 A;  2EHB A;  5KU1 A;  1IJ5 A;  5I2O A;  2CTN A;  4C0L A;  2M49 B;  4MBE A;  1SR6 B;  2O60 A;  2ZKM X;  2F8P A;  2H61 C;  2K8M B;  1RRO A;  2L98 A;  3OHM B;  4WQ3 A;  4A4B A;  4GGN A;  1CFP A;  2LLU A;  3CZT X;  5DKN A;  1QS7 A;  4DCK A;  1K95 A;  3CR5 X;  1NX0 A;  1SL7 A;  2PAS A;  1CNP A;  1NCY A;  2NLN A;  3GK1 A;  2NZ0 A;  4PHN A;  3SG6 A;  1W7J B;  3GK2 A;  4ORC B;  1NX2 A;  1FI5 A;  2K7C A;  1F55 A;  1RJV A;  2KGB C;  2ZND A;  1NX1 A;  1XK4 A;  3FS7 A;  1L2O B;  4CPV A;  2BE4 A;  3SIB A;  1FBV A;  1YUU A;  5GQQ C;  1M39 A;  1JSA A;  1ODB A;  4YGD B;  1YX7 A;  1Y1U A;  2K2F A;  5ER4 X;  4CLN A;  1DJX A;  2KQY A;  2Y1N A;  2KBI A;  3OB1 B;  3JVT B;  3BUM B;  1SKT A;  4XJK A;  3BOW A;  1WRL A;  2KDH A;  1SK6 D;  1V1F A;  4PDZ A;  3I5G B;  1LVC D;  1WRK A;  1GGW A;  1Q80 A;  2LVJ A;  1PSR A;  3BUO B;  2M1K B;  4IL1 A;  4PE0 A;  2K7B A;  4I5J A;  5I2Q A;  4JWQ A;  3LCP C;  1XVJ A;  2K61 A;  1IH0 A;  4DIR A;  4M2P A;  1K96 A;  1R2U A;  3CR2 A;  2KYF A;  1X02 A;  1TNW A;  1B8L A;  1FW4 A;  3BQ3 A;  5CSI A;  1RWY A;  2KI6 C;  2MRD A;  1F4Q A;  3BOW B;  3OX5 A;  3CWG A;  4XJK B;  4BY5 A;  2HF5 A;  3TUY B;  3EK4 A;  1QIW A;  3D10 A;  3MSE B;  1KQM B;  3VGO A;  2F3Y A;  1EL4 A;  5CSF A;  1CKK A;  2KGR A;  1B8C A;  4GAO A;  4GNK B;  1ALV A;  4ZCU A;  2M8U A;  1N65 A;  5AER A;  2KFG A;  1PVA A;  1IG5 A;  3FWB A;  5HLV A;  4GUK A;  1JC2 A;  2CXJ A;  4BY4 A;  1BF5 A;  2Y1M A;  4PHJ A;  1J7O A;  1J7P A;  3NSL A;  2F33 A;  1CDP A;  1S26 D;  2WC8 A;  3JTD C;  1VRK A;  1XFX O;  4PE4 A;  1G8I A;  3M0W A;  3NSI A;  2BEC A;  3BUN B;  2JUL A;  3WNX B;  2A4J A;  2KFH A;  1JBA A;  2JT0 A;  1RFJ A;  2QAC A;  2KI6 D;  3C1V A;  1R6P A;  2KQ6 A;  1REC A;  1KFU S;  1M46 A;  4E68 A;  1XFW O;  1FF1 A;  1B47 A;  3EVR A;  2JOJ A;  1QTX A;  4YI9 A;  2HET A;  2WND A;  5D7F A;  3PAL A;  3KHE A;  1UUS A;  1OOJ A;  4WRI A;  1XA5 A;  5FYX A;  4GBA A;  1XO5 A;  4CFR A;  1KFX S;  1AHR A;  2M7N A;  3JVT C;  4ICB A;  1AVS A;  1SCM C;  3TDU A;  1BG1 A;  3SIA A;  2NCO A;  3SJS A;  1YVH A;  3KO0 A;  1PRW A;  1MR8 A;  1YX8 A;  1MQ1 A;  2L51 A;  4HRH A;  4U8D A;  1IKU A;  4MRX A;  2GGM A;  3EVU A;  5J3X A;  1QX5 B;  2V53 A;  1SNL A;  2K7D A;  2K2A A;  2O5G A;  1QLS A;  5D69 A;  1UHH A;  4DRW A;  1LA0 A;  1DJW A;  3F45 A;  3WHU B;  2KYC A;  2RGI A;  1JUO A;  5IBW A;  5TNC A;  3VRQ A;  1A03 A;  4TNC A;  3SG2 A;  1OMV A;  2JPT A;  2Q4U A;  2JXL A;  3TUY C;  1KQM C;  1TNX A;  2JXC A;  1CM1 A;  2M7L A;  1QAS A;  2ZNE A;  4MLW A;  3IF7 A;  3TS5 C;  1DGU A;  2BKI B;  3WHT B;  1UHJ A;  1CDN A;  5JJG A;  1NX3 A;  1BT6 A;  2LHI A;  1AK8 A;  1WDC B;  1HT9 A;  4HRE E;  4M2O A;  1IGV A;  1BJF A;  1KFX L;  1MXL C;  1XYD A;  2KAY A;  2Y5I A;  3I5H B;  1S6I A;  1B7T Z;  3H4S E;  1C7V A;  2LLS A;  2BCX A;  2MBX A;  2BBM A;  1B7T Y;  4GFT A;  4CID A;  2KFF A;  2R2I A;  2OTG B;  3ICB A;  1KCY A;  1DJZ A;  1TOP A;  1JWD A;  1U5I A;  2Q91 A;  1BOC A;  1CLB A;  1CLL A;  1NCZ A;  1K2H A;  1JF2 A;  3IQQ A;  4YGB B;  3LL8 B;  1UP5 A;  4AQI A;  1QVI Z;  1PVB A;  2CCM A;  4C0K A;  3EK8 A;  5ER5 A;  4P5O E;  2LAN A;  1QVI Y;  2LMV A;  2H2K A;  1YTZ C;  5BPJ A;  1SPY A;  1B1G A;  1UHN A;  2COL B;  4GGF A;  3E3R A;  1D1O A;  5KTY A;  1DJG A;  3O4Y A;  4YBH B;  2F2O A;  4I5L B;  2JTT A;  2LAP A;  4QJ3 B;  1KK8 B;  1A75 A;  1EJ3 A;  1U5I B;  4MEW A;  1JF0 A;  1QJT A;  1WLZ A;  1NIW A;  1HQV A;  2WCE A;  1KQV A;  2JTZ A;  1PAL A;  3HCM A;  2MLE C;  1QV0 A;  1DMO A;  1FI6 A;  3BUW B;  3VRP A;  1ALW A;  1CFF A;  2LHL A;  1S1E A;  3LK0 A;  4R1E A;  1CDM A;  4PHM A;  3CR4 X;  1YRU B;  3O78 A;  1CMG A;  1OZO A;  2KI4 B;  1S3P A;  1SMG A;  1XFV O;  3I5I C;  1M31 A;  4N5X A;  3BUX B;  3K21 A;  3KEV A;  3I5F C;  3PLF B;  1A75 B;  1LKJ A;  2M3W A;  4YI8 A;  2JNF A;  1QIV A;  2PSR A;  1F70 A;  1DJY A;  4I5N B;  1H8B A;  1TTX A;  4ORB B;  4NDD A;  4DS7 A;  2BL0 B;  1PK0 D;  2L2E A;  4MVF A;  3PAT A;  1GJY A;  1Y6W A;  5JOL A;  3DD4 A;  1AP4 A;  1YUR A;  1K9P A;  2K0J A;  1IJ6 A;  1SR6 C;  1QXP A;  1YUT A;  1NUB A;  5HKY A;  1K8U A;  2M0R A;  3OP0 A;  1OMR A;  2H61 A;  1QX7 A;  3KPX A;  1N2D A;  4USL A;  2HQW A;  2HQ8 A;  5F6T A;  2JWW A;  2LVK A;  2HPS A;  1DT7 B;  4DUQ A;  2LP2 A;  5DKQ A;  3WXA A;  1DVI A;  1NP8 A;  1W7I B;  5AEQ A;  1TRF A;  1A2X A;  2G2B A;  1CFD A;  2F2P A;  2PRU A;  1BLQ A;  2TN4 A;  1L2O C;  1UHK A;  2PAL A;  4Q04 A;  4NDB A;  2L4I A;  2JC2 A;  1TCO B;  3PM8 A;  1K9U A;  1CDL A;  3RM1 A;  1SRA A;  4OCI A;  3NXA A;  3ZWH A;  3QRX A;  1OMD A;  2OPO A;  1XFY O;  2EGD A;  1S36 A;  1UWO A;  2LVV A;  3EK7 A;  3I5G C;  1Y0V H;  1S6J A;  1OE9 B;  1BOD A;  5K89 A;  3CS1 A;  4N1F A;  4YGA A;  1TNQ A;  4PE7 A;  1XK4 C;  1SL8 A;  1F54 A;  2KSP A;  1QAT A;  1Y1A A;  3NSK A;  2LNK A;  2EC6 B;  3BYA A;  4L9M A;  2KHN A;  2L0P A;  2SCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...