1Y6WA

Trapped intermediate of calmodulin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
145
structure length
145
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGCNPTEAELQDMINEVDADGNGTINFPEFLTMMARCMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structure of a Trapped Intermediate of Calmodulin: Calcium Regulation of EF-hand Proteins from a New Perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 43
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2004-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y6wA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1y6wA02
3VROA 4I5NB 1DJIA 5HLVA 3D10A 4U8DA 1UHNA 1J7QA 3CTNA 1KFXL 2KFHA 3JVTC 1H8BA 4MRYA 1IJ5A 2HETA 1OQPA 2LP3A 3BUOB 3K21A 2LLTA 1EH2A 2BKIB 3KEVA 3CLNA 1NCXA 1SR6C 2KI6D 1W7IB 3SG5A 1CFFA 4E68A 3TUYB 1TNXA 1H4BA 2LE9B 1EG3A 2K7DA 5KU1A 4CPVA 2HPSA 4MN0A 3AKBA 3ZNIA 1Q80A 1NX2A 4USLA 4DS7A 1NX1A 2ZNDA 3HCMA 4JWQA 3OB2B 4OVNF 3E3RA 1MXEA 2MHHA 3LCPC 4N1GA 1B47A 2KI4C 2EC6B 1D1OA 5CSNA 3NXAA 2NCOA 4N1FA 3VRQA 1HT9A 2PRUA 2G9BA 1QATA 4HRGA 4I5LB 1KSOA 2LMTA 1DJHA 1QASA 5K89A 1NX3A 2L0PA 4PE7A 1YUSA 2WORA 1KK8C 3CR5X 3FWBA 3ZWHA 5D69A 1LINA 3VRNA 4BY5A 1ZACA 3NSKA 5ER5A 1DTLA 1S3PA 4AOMA 1SYMA 1B9AA 2F33A 1PSRA 1SL9A 2LVVA 2M8UA 1LXFC 2JXLA 2L2EA 1CLLA 3EKJA 4UPGA 2L50A 2E30A 4M2OA 1TRFA 4XJKB 1XFUO 1SNLA 2KAVA 1TIZA 3GK2A 3PN7C 5HKYA 2NXQA 5I2QA 1QXPA 1XFZO 2WCFA 2ZN8A 3BYAA 3OB1B 4PHJA 1BR4B 1XYDA 1C7WA 2K2AA 1BG1A 1NIWA 1UURA 3OX5A 2KNEA 1K94A 2K2FA 2JZIA 1CDLA 3DF0B 2Q4UA 1XFWO 1QIWA 1S6IA 3KPXA 1J55A 1S26D 1SBJA 2KDHA 2LUCA 2KGBC 3TS5C 4YGAA 1DJGA 1KFXS 3GK1A 4HREE 4MZLA 1LA3A 1B4CA 1K2HA 1M31A 1N2DA 5DKNA 2OTGC 4M2PA 2Y1MA 1FBVA 2MLFC 3CZTX 1R6PA 2JC2A 1CB1A 1DJXA 4CIDA 5JOLA 1DGUA 3SG2A 1FI6A 1CFCA 1N65A 2JQ6A 2KBMA 1ODBA 1WLZA 2BE4A 2ZN9A 2M3WA 1B7TY 3I5HC 5CSJA 3SIAA 1B7TZ 3CWGA 1A2XA 1ZOTB 2CXJA 1RK9A 2LAPA 1OZOA 3PFVA 2KYFA 3A4UB 1JUOA 3WHTB 3C1VA 2LHLA 1DJWA 1Y1XA 1S36A 1ZFSA 2Y4QA 1YX7A 3M0WA 2JNFA 1GGWA 2ZNEA 1WRKA 1R2UA 4ZCVA 3DVKA 1K95A 1F4QA 1K8UA 5AFPA 1N0YA 4P5OE 2TN4A 4QJ5B 1KK7Y 1TNQA 1CDMA 3BUNB 2R2IA 1PRWA 1KK7Z 2NZ0A 3EK8A 1DMOA 1X02A 4L9MA 2SASA 2Y1NA 2P6BB 2BKHB 4C0JA 1CFDA 5IBWA 3QRXA 5FYXA 1YUTA 2KAYA 2QPTA 1KCYA 1NSHA 1KQMC 2PSRA 1F54A 1BT6A 1GJYA 1WRLA 1MXLC 5DKQA 1CM1A 1QIVA 3I5FB 1FI5A 5F6TA 1OMVA 4OR9B 2F8PA 2OS8B 2F3ZA 4PCWA 1IJ6A 4YI8A 2LVKA 1B8CA 2ZRTA 3I5IB 2LVIA 1XFVO 3BXKA 2K7BA 4WRIA 1QVIY 2G2BA 1KWOB 1JBAA 2MLEC 1UHIA 1QVIZ 1BLQA 3FS7A 1NPQA 2BL0C 3BOWB 1AP4A 1J1EA 1JWDA 2JTZA 3DVEA 4MRXA 1OMRA 1J7OA 3PLFB 3VGOA 3O6BA 4NDBA 2I18A 4GBAA 3LL8B 1QJTA 1UHKA 1YRUB 2NLNA 4ORBB 1QV1A 4M2QA 5AXIA 2SCPA 3GK4X 2CCMA 1EJ3A 4NQGA 2CT9A 4PHMA 2ISDA 2KI6C 2PASA 1A03A 2LM5A 4XJKA 1A29A 2JWWA 4JQ0D 1K90D 4PHKA 1BU3A 3LLEA 3WHUB 1DT7B 2KGRA 1YRTB 1XVJA 2M7LA 1MHOA 1IGVA 3LK0A 2PMYA 1A75B 4PALA 4PDZA 1MF8B 1TNPA 3IQQA 1RROA 3F45A 3BUWB 1GQMA 3GOFA 1UHHA 4MZKA 1DJYA 1RTP1 1CNPA 4OKHA 3DF0A 3NSLA 2HQ8A 1BF5A 4OV2A 3SJSA 5AANA 1KQVA 3JVTB 1IH0A 1CKKA 1S1EA 1QV0A 2MA2A 1K9PA 2K7OA 4PHNA 2JNXA 3D0YB 3AAJA 5AERA 5JJGA 3SG4A 3SG7A 1IWQA 1SKTA 2LHIA 1C7VA 4D1EA 1NWDA 4YGEB 1OE9B 2B1UA 4A4CA 1CM4A 2LV7A 3NSOA 2COLB 3NSIA 4QJ3B 5B8IB 4GGFC 2LVJA 1YX8A 2OPOA 3VRRA 2MJWB 2JRFA 4TNCA 4CFRA 1F70A 1WY9A 2KHNA 5BPJA 1QLKA 2M0RA 2LNKA 4ORAB 2RGIA 4GFTA 4GGFA 4GUKA 1SPYA 4GPLB 1NP8A 5I8NA 1DGVA 2O60A 1WDCB 2FOTA 2GGZA 4YGDB 3IF7A 2K61A 4I5JA 1AK8A 1Y6WA 1M46A 2A4JA 1GGZA 1LKJA 1XA5A 1YVHA 4MEWA 1OSAA 2LMUA 1IG5A 4MLWA 1QS7A 2AAOA 2WOSA 5KTYA 1G8IA 3HX4A 5DKRA 1Y1UA 1FF1A 4YGBB 2PVBA 4GNKB 1OZSA 3DVMA 2PALA 3OHMB 1J1DA 1BR1B 1DF0B 2MRDA 3ICBA 1L2OB 1PSBA 2HQWA 5HKWA 4F0ZB 1CFPA 1W7JB 3FWCA 3PALA 3I5FC 1C07A 4CLNA 2KFFA 4YBHB 3FIAA 1M63B 2O5GA 2BE6A 3BUXB 1SRAA 1U5IB 3I5IC 4AQIA 3RM1A 2WC8A 1RWYA 4I5KA 2H2KA 2KQYA 2MAZA 5PALA 1KWOC 3VRPA 1J7PA 2AUCA 4IL1A 3TUYC 1EG4A 1QLSA 2GGMA 3I5GB 1BOCA 4FTGA 5CPVA 1F55A 2K8MB 1RJVA 1UUSA 1OMDA 2KSPA 2L4HA 1F4OA 4MBEA 3KO0A 4MZJA 5TNCA 1G4YR 2KOTA 1LVCD 1PK0D 4MVFA 3BOWA 5I2LA 2EC6C 1HQVA 5GQQC 1V1FA 2L98A 2JTTA 4FQOA 2Q91A 1SL7A 3PATA 1CLBA 1SK6D 2F3YA 2AMIA 1BJFA 1G33A 2M1KB 4DCKA 4WQ2A 2L5XB 1V1GA 3JTDB 5CSIA 4NDDA 1KFUS 1NYAA 5I2OA 3EK4A 3DD4A 2F2OA 3CS1A 3I5HB 2MBXA 2M1UA 3RLZA 1SY9A 1TTXA 1ALWA 1A75A 1AVSA 4YGCB 2LP2A 1XFXO 2Y5IA 1SCMB 1TCFA 1CTRA 1B8LA 2ZFDA 4N5XA 1JFKA 2M49B 1B1GA 1ZUZA 3EK7A 4DIRA 3AAKA 1FW4A 2JT0A 3CR2A 3O78A 3OP0A 1M39A 2I2RE 5HKZA 1NX0A 2CBLA 1SCVA 3IQOA 3SIBA 1CMFA 1UWOA 1JFJA 1JC2A 1XK4C 2JULA 3SG3A 1FPWA 2LLSA 1A4PA 4AQJA 2EGDA 1K9KA 3D0YA 2KYCA 1DVIA 4PE4A 1BODA 1YR5A 1DJZA 3O2PA 1B8RA 4Q04A 4CFQA 1XK4A 1QX7A 1MUXA 2FCEA 2KAXA 4BY4A 1MQ1A 1VRKA 4NDCA 1KQMB 2KBIA 1TNWA 1JSAA 3PSRA 4C0LA 2NCPA 4P2YB 5AEQA 3CR4X 1WDCC 3H4SE 1MWNA 5D7FA 1ALVA 5HLOA 2LANA 1S6JA 1PVAA 1SMGA 1K9UA 4OCIA 2ZRSA 3TZ1A 1SR6B 4DRWA 3WNXB 1YURA 5G08A 3TDUA 1IKUA 1XFYO 1TCOB 2BL0B 1M45A 2JT8A 2LLUA 2QACA 1AJ4A 2H61C 3KF9A 1CMGA 4ORCB 3WXAA 2VRGA 1K93D 1UHJA 1L2OC 1CDNA 1F8HA 1KFUL 2JXCA 1SW8A 4DUQA 1WLMA 1AJ5A 1XO5A 2BECA 2I94A 1WRZA 4HRHA 2D8NA 3O4YA 3SG6A 1SL8A 1MR8A 1YVLA 2H61A 2EHBA 4ZCUA 1K96A 2KI4B 2M9GA 1DF0A 4C0KA 2BCAA 4GAOA 5J3XA 3PM8A 1IQ3A 1YTZC 3EKHA 1Y1AA 2LCPA 2K0JA 2BCXA 2JT3A 5KSZA 3DVJA 3I5GC 4ETOA 1YUUA 2E6WA 1CLMA 2L51A 1U5IA 1RECA 5HYDA 4YRUA 1IRJA 1KK8B 1S5GY 3AKAA 3OX6A 2HF5A 1ZMZA 1L7ZA 1S5GZ 2I7AA 2BBNA 4A4BA 3MSEB 2L4IA 3TDZA 1TOPA 1OOJA 1PVBA 2KQ6A 1PALA 2JOJA 2GV5A 2OS8C 1CDPA 5CSFA 3PN7B 2LUXA 2ZKMX 3BUMB 3LK1A 1TN4A 4R1EA 2K7CA 3A8RA 1JF0A 2BBMA 1IQ5A 1E8AA 2FCDA 3CGAA 3TDIA 3JTDC 2WCEA 4HSZA 4XYNA 1JF2A 1NCZA 2DOQA 2JPTA 2BCBA 4JPZB 2F2PA 4GGNA 1NCYA 1UP5A 2CTNA 1AHRA 1EL4A 1QX2A 2KFGA 4PE1A 1KSMA 1NUBA 1SCMC 2LC5A 3EVVA 3TS5B 5ER4X 4PE0A 1J7RA 1PULA 3EVUA 2OTGB 4MSPA 1BMOA 1QX5B 1EXRA 2FJUB 1LA0A 2IS9A 1AUIB 2V53A 1QTXA 2CNPA 2M7NA 1Y0VH 3BQ3A 3EVRA 2WCBA 4QJ4B 3KHEA 2M97A 2WNDA 4YI9A 2JU0A 1RFJA 4ICBA 1F71A 2LMVA 1S6CA 2M29A 4WQ3A
chains in the Genus database with same CATH superfamily
3VROA 4I5NB 1DJIA 5HLVA 3D10A 4U8DA 3S0BA 1UHNA 1J7QA 3CTNA 3S0FA 1KFXL 2KFHA 3JVTC 3R1VA 5I94A 1H8BA 4MRYA 1IJ5A 2HETA 1OQPA 2LP3A 3BUOB 3K21A 2LLTA 1EH2A 2BKIB 3KEVA 3CLNA 1NCXA 1SR6C 2KI6D 1W7IB 2KLEA 3SG5A 1CFFA 4E68A 3TUYB 1TNXA 1H4BA 2LE9B 1EG3A 2K7DA 5KU1A 4CPVA 2HPSA 4MN0A 3R1PA 3AKBA 3ZNIA 1Q80A 3B87A 1NX2A 4USLA 3UO9A 4DS7A 1NX1A 2ZNDA 3HCMA 4JWQA 3VB1A 3OB2B 4OVNF 3BFHA 1MXEA 2MHHA 3D74A 3E3RA 3LCPC 1B47A 2KI4C 2EC6B 4N1GA 4OZDA 1D1OA 5CSNA 3NXAA 2NCOA 4N1FA 3VRQA 3BJHA 1HT9A 2PRUA 2G9BA 3SS3A 1QATA 2PQLA 4HRGA 3O4XA 4I5LB 1KSOA 2LMTA 1DJHA 1QASA 5K89A 3D78A 1NX3A 2L0PA 4PE7A 1YUSA 3CYZA 3DY9A 2WORA 1KK8C 3CR5X 3FWBA 3ZWHA 5D69A 1LINA 3VRNA 3L4LA 4BY5A 5DICA 1ZACA 3NSKA 5ER5A 3RZSA 1DTLA 1S3PA 4AOMA 1SYMA 1B9AA 2F33A 1OW4A 1PSRA 5FI7A 1SL9A 2LVVA 2M8UA 1LXFC 2JXLA 2L2EA 1CLLA 3EKJA 4PT1A 4UPGA 2L50A 2E30A 4M2OA 1TRFA 4XJKB 1XFUO 1SNLA 2KAVA 1TIZA 3GK2A 3PN7C 5HKYA 2NXQA 5I2QA 1QXPA 1XFZO 2WCFA 2ZN8A 3BYAA 3OB1B 4PHJA 1C3YA 1TUJA 1BR4B 1OOHA 4INWA 1XYDA 1C7WA 2K2AA 1BG1A 1NIWA 1UURA 3OX5A 2KNEA 1Z2CB 1K94A 2K2FA 1XFRA 2JZIA 1CDLA 3DF0B 2Q4UA 1XFWO 1QIWA 1S6IA 3KPXA 1J55A 1S26D 1SBJA 2KDHA 2LUCA 2KGBC 1Z4HA 3TS5C 4YGAA 1DJGA 1KFXS 3GK1A 4HREE 4MZLA 1LA3A 1B4CA 1K2HA 1M31A 1N2DA 5DKNA 2OTGC 2WCJA 4M2PA 2Y1MA 1FBVA 2MLFC 3CZTX 1R6PA 2JC2A 3BFAA 1CB1A 1LS8A 1DJXA 4CIDA 5JOLA 1DGUA 3SG2A 2K60A 1FI6A 1CFCA 1N65A 2JQ6A 2KBMA 1ODBA 1WLZA 2BE4A 2ZN9A 2PYQA 3R72A 3D76A 2M3WA 2WCMA 5FI6A 1B7TY 3I5HC 5CSJA 3SIAA 1B7TZ 3CWGA 1A2XA 1ZOTB 2CXJA 1RK9A 2FJYA 1GM0A 2LAPA 1OZOA 3PFVA 2KYFA 3A4UB 3B6XA 1JUOA 3WHTB 3C1VA 2LHLA 1DJWA 1Y1XA 1S36A 1ZFSA 2Y4QA 1YX7A 3M0WA 2JNFA 1GGWA 2ZNEA 1WRKA 1R2UA 4ZCVA 3DVKA 1K95A 1IIOA 1F4QA 1K8UA 5AFPA 1N0YA 4P5OE 3L4AA 2TN4A 4QJ5B 3D75A 1KK7Y 1TNQA 1CDMA 3BUNB 2R2IA 1PRWA 1KK7Z 2NZ0A 3EK8A 3FE8A 1DMOA 1X02A 4L9MA 3CZ2A 3UNWA 2SASA 2Y1NA 2P6BB 2BKHB 4C0JA 1CFDA 5IBWA 3QRXA 5FYXA 1YUTA 2KAYA 2QPTA 1KCYA 1NSHA 1KQMC 2PSRA 2QEVA 1F54A 4F7FA 1BT6A 1GJYA 1WRLA 1MXLC 5DKQA 1CM1A 1QIVA 3I5FB 1FI5A 5F6TA 1OMVA 4OR9B 2F8PA 2OS8B 2F3ZA 4PCWA 1IJ6A 4YI8A 2LVKA 1B8CA 2ZRTA 3I5IB 2LVIA 1XFVO 3BXKA 2K7BA 4WRIA 1QVIY 2G2BA 3R1OA 1KWOB 1JBAA 2MLEC 3Q8IA 1UHIA 1QVIZ 1BLQA 5FI2A 3FS7A 1NPQA 2BL0C 3BOWB 1AP4A 1J1EA 1JWDA 2JTZA 3DVEA 4MRXA 1OMRA 1J7OA 3PLFB 3VGOA 3L47A 3O6BA 4NDBA 2I18A 4GBAA 3OGNA 3LL8B 1QJTA 1UHKA 1YRUB 2NLNA 4ORBB 1QV1A 4M2QA 5AXIA 2SCPA 3GK4X 2CCMA 1EJ3A 4NQGA 2CT9A 4PHMA 2ISDA 1TUZA 2KI6C 2PASA 1A03A 2LM5A 3DZTA 4XJKA 1A29A 1C3ZA 2JWWA 4JQ0D 1K90D 3D77A 1BU3A 3LLEA 4PHKA 3WHUB 2KGRA 1DT7B 1YRTB 1XVJA 2M7LA 1MHOA 1IGVA 3LK0A 2PMYA 1A75B 4PALA 4PDZA 1MF8B 1TNPA 3IQQA 1RROA 3F45A 3BUWB 1GQMA 3GOFA 1UHHA 4MZKA 1DJYA 1RTP1 1CNPA 4OKHA 3DF0A 3NSLA 2HQ8A 1BF5A 4OV2A 3SJSA 2H8VA 5AANA 1W9ZA 1KQVA 3JVTB 1IH0A 1CKKA 1S1EA 1QV0A 2MA2A 1K9PA 2K7OA 4PHNA 2JNXA 3D0YB 3AAJA 5AERA 5JJGA 3SG4A 3SG7A 1IWQA 1SKTA 2LHIA 1C7VA 4D1EA 1NWDA 3D73A 1OE9B 2B1UA 1QWVA 4YGEB 3SS4A 4A4CA 1T14A 1CM4A 2LV7A 2QEHA 3NSOA 2COLB 3DXLA 3NSIA 4QJ3B 4GGFC 5B8IB 1OOIX 3FE9A 2LVJA 1YX8A 2OPOA 3VRRA 2MJWB 2JRFA 4TNCA 4CFRA 1F70A 1WY9A 2KHNA 3OBVA 1QLKA 2M0RA 4FQTA 1DELA 2LNKA 4ORAB 5BPJA 3CZ1A 2P70A 2RGIA 4GFTA 4GGFA 4GUKA 1SPYA 3N7HA 4GPLB 1NP8A 5I8NA 1DGVA 2O60A 1WDCB 2FOTA 2GGZA 4YGDB 3IF7A 2K61A 4I5JA 1AK8A 1Y6WA 1M46A 2A4JA 1GGZA 1LKJA 1XA5A 1YVHA 4MEWA 1OSAA 2LMUA 1IG5A 4MLWA 1QS7A 2AAOA 2WOSA 5KTYA 1G8IA 3HX4A 5DKRA 1Y1UA 3CABA 1FF1A 4YGBB 2PVBA 4GNKB 1OZSA 3DVMA 2PALA 3SS5A 3OHMB 1J1DA 1BR1B 1DF0B 2MRDA 2P71A 1L2OB 1PSBA 2HQWA 3ICBA 5HKWA 4F0ZB 1CFPA 1W7JB 3FWCA 3PALA 3I5FC 1C07A 4CLNA 2KFFA 4YBHB 3FIAA 1M63B 3B86A 1DC1A 2O5GA 2QEBA 2BE6A 2KLDA 3BUXB 1SRAA 1U5IB 3I5IC 4AQIA 3RM1A 2WC8A 1RWYA 1OOGA 2H2KA 2KQYA 1TWOA 2MAZA 4I5KA 3IVTA 4IJ7A 5PALA 2L5YA 1KWOC 3VRPA 1J7PA 2AUCA 4IL1A 3TUYC 1EG4A 1QLSA 2GGMA 3I5GB 3NHIA 1BOCA 4FTGA 5CPVA 5D3OA 1F55A 2K8MB 3DYEA 1RJVA 1UUSA 1OMDA 2KSPA 2L4HA 1F4OA 4MBEA 3KO0A 4MZJA 5TNCA 1G4YR 2KOTA 1LVCD 1PK0D 4MVFA 3BOWA 5I2LA 5HL1A 2EC6C 1HQVA 5GQQC 3K1EA 1V1FA 2L98A 2JTTA 4FQOA 2Q91A 1SL7A 3PATA 1CLBA 1SK6D 2F3YA 2AMIA 1BJFA 1G33A 2M1KB 3B88A 3NHTA 4DCKA 4WQ2A 2L5XB 1V1GA 3JTDB 5CSIA 4NDDA 1KFUS 1NYAA 2BAPA 3EK4A 5I2OA 3DD4A 2F2OA 3CS1A 3I5HB 3NGVA 2MBXA 3QMEA 3V2LA 3PM2A 2M1UA 3RLZA 3CZ0A 1SY9A 1TTXA 1ALWA 1A75A 1AVSA 4YGCB 2LP2A 1XFXO 2Y5IA 1SCMB 1TCFA 1CTRA 3S0DA 1B8LA 2QEOA 2ZFDA 3S0GA 4N5XA 1JFKA 3CDNA 2M49B 1B1GA 1ZUZA 3EK7A 4DIRA 3AAKA 1FW4A 2JT0A 3CR2A 3O78A 3OP0A 1M39A 2I2RE 5HKZA 1NX0A 2CBLA 1SCVA 3IQOA 3SIBA 1CMFA 1UWOA 2QDIA 1JFJA 1JC2A 2GTEA 1XK4C 2JULA 3SG3A 1FPWA 2LLSA 1A4PA 4AQJA 2EGDA 1K9KA 3D0YA 2KYCA 1DVIA 4PE4A 1BODA 1YR5A 1DJZA 4JKTA 3O2PA 1B8RA 4Q04A 4CFQA 1XK4A 1QX7A 2WCLA 3PJIA 1MUXA 2FCEA 2KAXA 4BY4A 1MQ1A 1VRKA 4NDCA 1KQMB 3S0EA 2KBIA 1TNWA 1JSAA 2L2CA 3PSRA 4C0LA 2NCPA 4P2YB 5AEQA 3CR4X 1WDCC 3H4SE 1MWNA 5D7FA 1SSEB 1ALVA 5HLOA 2LANA 3FE6A 1S6JA 2WC5A 1PVAA 1ORGA 1SMGA 1K9UA 4OCIA 2ZRSA 3TZ1A 1SR6B 3S0AA 4DRWA 3WNXB 1YURA 5G08A 3TDUA 1IKUA 1XFYO 1TCOB 2BL0B 1M45A 2JT8A 2LLUA 2QACA 1AJ4A 2H61C 3KF9A 1CMGA 4ORCB 3WXAA 2VRGA 1K93D 1UHJA 1L2OC 1CDNA 1F8HA 1KFUL 2JXCA 1SW8A 4DUQA 1WLMA 1AJ5A 1XO5A 2BECA 2I94A 1WRZA 4HRHA 2D8NA 3O4YA 3SG6A 1SL8A 1MR8A 1YVLA 2H61A 2EHBA 4ZCUA 1K96A 2KI4B 2M9GA 1DF0A 4C0KA 2BCAA 4GAOA 5J3XA 3PM8A 1IQ3A 1YTZC 3EKHA 1Y1AA 2LCPA 2K0JA 2BCXA 2KPHA 2JT3A 5KSZA 3DVJA 3I5GC 4ETOA 1YUUA 2BNXA 2E6WA 1CLMA 2L51A 1U5IA 1RECA 5HYDA 1P28A 4YRUA 1IRJA 1KK8B 1S5GY 3AKAA 3OX6A 2JPOA 2HF5A 1ZMZA 1L7ZA 1S5GZ 2I7AA 2YGUA 2BBNA 4A4BA 3MSEB 2L4IA 3TDZA 1TOPA 1OOJA 4INXA 2ERBA 1PVBA 3EG5B 2KQ6A 1PALA 2JOJA 2GV5A 2OS8C 1CDPA 4JD9A 5CSFA 3PN7B 2LUXA 2ZKMX 3BUMB 3LK1A 1TN4A 4R1EA 2K7CA 3A8RA 1JF0A 2BBMA 1IQ5A 1E8AA 2FCDA 3CGAA 3TDIA 3JTDC 2WCHA 2WCEA 3BFBA 4HSZA 4XYNA 1JF2A 1NCZA 2DOQA 2JPTA 2BCBA 4JPZB 2F2PA 4GGNA 1DQEA 1NCYA 1UP5A 2CTNA 1AHRA 1EL4A 1OOFA 1QX2A 2WCKA 2KFGA 4PE1A 1KSMA 1NUBA 1SCMC 2LC5A 3B7AA 3EVVA 5ER4X 4PE0A 3TS5B 1J7RA 1PULA 2WC6A 1DEKA 3EVUA 2OTGB 4MSPA 1BMOA 1QX5B 1EXRA 2FJUB 1LA0A 2IS9A 1AUIB 2V53A 1QTXA 4KYNA 2CNPA 2M7NA 1Y0VH 3BQ3A 3EVRA 2WCBA 4QJ4B 3KHEA 2M97A 2WNDA 4YI9A 2JU0A 1RFJA 4ICBA 1F71A 5EL2A 2LMVA 1S6CA 2M29A 4WQ3A
chains in the Genus database with same CATH topology
3VROA 4I5NB 1DJIA 5HLVA 3D10A 4U8DA 1UHNA 1J7QA 3CTNA 1KFXL 2KFHA 3JVTC 1H8BA 4MRYA 1IJ5A 2HETA 1OQPA 2LP3A 3BUOB 3K21A 2LLTA 1EH2A 2BKIB 3KEVA 3CLNA 1NCXA 1SR6C 2KI6D 1W7IB 3SG5A 1CFFA 4E68A 3TUYB 1TNXA 1H4BA 2LE9B 1EG3A 2K7DA 5KU1A 4CPVA 2HPSA 4MN0A 3AKBA 3ZNIA 1Q80A 1NX2A 4USLA 4DS7A 1NX1A 2ZNDA 3HCMA 4JWQA 3OB2B 4OVNF 3E3RA 1MXEA 2MHHA 3LCPC 4N1GA 1B47A 2KI4C 2EC6B 1D1OA 5CSNA 3NXAA 2NCOA 4N1FA 3VRQA 1HT9A 2PRUA 2G9BA 1QATA 4HRGA 4I5LB 1KSOA 2LMTA 1DJHA 1QASA 5K89A 1NX3A 2L0PA 4PE7A 1YUSA 2WORA 1KK8C 3CR5X 3FWBA 3ZWHA 5D69A 1LINA 3VRNA 4BY5A 1ZACA 3NSKA 5ER5A 1DTLA 1S3PA 4AOMA 1SYMA 1B9AA 2F33A 1PSRA 1SL9A 2LVVA 2M8UA 1LXFC 2JXLA 2L2EA 1CLLA 3EKJA 4UPGA 2L50A 2E30A 4M2OA 1TRFA 4XJKB 1XFUO 1SNLA 2KAVA 1TIZA 3GK2A 3PN7C 5HKYA 2NXQA 5I2QA 1QXPA 1XFZO 2WCFA 2ZN8A 3BYAA 3OB1B 4PHJA 1BR4B 1XYDA 1C7WA 2K2AA 1BG1A 1NIWA 1UURA 3OX5A 2KNEA 1K94A 2K2FA 2JZIA 1CDLA 3DF0B 2Q4UA 1XFWO 1QIWA 1S6IA 3KPXA 1J55A 1S26D 1SBJA 2KDHA 2LUCA 2KGBC 3TS5C 4YGAA 1DJGA 1KFXS 3GK1A 4HREE 4MZLA 1LA3A 1B4CA 1K2HA 1M31A 1N2DA 5DKNA 2OTGC 4M2PA 2Y1MA 1FBVA 2MLFC 3CZTX 1R6PA 2JC2A 1CB1A 1DJXA 4CIDA 5JOLA 1DGUA 3SG2A 1FI6A 1CFCA 1N65A 2JQ6A 2KBMA 1ODBA 1WLZA 2BE4A 2ZN9A 2M3WA 1B7TY 3I5HC 5CSJA 3SIAA 1B7TZ 3CWGA 1A2XA 1ZOTB 2CXJA 1RK9A 2LAPA 1OZOA 3PFVA 2KYFA 3A4UB 1JUOA 3WHTB 3C1VA 2LHLA 1DJWA 1Y1XA 1S36A 1ZFSA 2Y4QA 1YX7A 3M0WA 2JNFA 1GGWA 2ZNEA 1WRKA 1R2UA 4ZCVA 3DVKA 1K95A 1F4QA 1K8UA 5AFPA 1N0YA 4P5OE 2TN4A 4QJ5B 1KK7Y 1TNQA 1CDMA 3BUNB 2R2IA 1PRWA 1KK7Z 2NZ0A 3EK8A 1DMOA 1X02A 4L9MA 2SASA 2Y1NA 2P6BB 2BKHB 4C0JA 1CFDA 5IBWA 3QRXA 5FYXA 1YUTA 2KAYA 2QPTA 1KCYA 1NSHA 1KQMC 2PSRA 1F54A 1BT6A 1GJYA 1WRLA 1MXLC 5DKQA 1CM1A 1QIVA 3I5FB 1FI5A 5F6TA 1OMVA 4OR9B 2F8PA 2OS8B 2F3ZA 4PCWA 1IJ6A 4YI8A 2LVKA 1B8CA 2ZRTA 3I5IB 2LVIA 1XFVO 3BXKA 2K7BA 4WRIA 1QVIY 2G2BA 1KWOB 1JBAA 2MLEC 1UHIA 1QVIZ 1BLQA 3FS7A 1NPQA 2BL0C 3BOWB 1AP4A 1J1EA 1JWDA 2JTZA 3DVEA 4MRXA 1OMRA 1J7OA 3PLFB 3VGOA 3O6BA 4NDBA 2I18A 4GBAA 3LL8B 1QJTA 1UHKA 1YRUB 2NLNA 4ORBB 1QV1A 4M2QA 5AXIA 2SCPA 3GK4X 2CCMA 1EJ3A 4NQGA 2CT9A 4PHMA 2ISDA 2KI6C 2PASA 1A03A 2LM5A 4XJKA 1A29A 2JWWA 4JQ0D 1K90D 4PHKA 1BU3A 3LLEA 3WHUB 1DT7B 2KGRA 1YRTB 1XVJA 2M7LA 1MHOA 1IGVA 3LK0A 2PMYA 1A75B 4PALA 4PDZA 1MF8B 1TNPA 3IQQA 1RROA 3F45A 3BUWB 1GQMA 3GOFA 1UHHA 4MZKA 1DJYA 1RTP1 1CNPA 4OKHA 3DF0A 3NSLA 2HQ8A 1BF5A 4OV2A 3SJSA 5AANA 1KQVA 3JVTB 1IH0A 1CKKA 1S1EA 1QV0A 2MA2A 1K9PA 2K7OA 4PHNA 2JNXA 3D0YB 3AAJA 5AERA 5JJGA 3SG4A 3SG7A 1IWQA 1SKTA 2LHIA 1C7VA 4D1EA 1NWDA 4YGEB 1OE9B 2B1UA 4A4CA 1CM4A 2LV7A 3NSOA 2COLB 3NSIA 4QJ3B 5B8IB 4GGFC 2LVJA 1YX8A 2OPOA 3VRRA 2MJWB 2JRFA 4TNCA 4CFRA 1F70A 1WY9A 2KHNA 5BPJA 1QLKA 2M0RA 2LNKA 4ORAB 2RGIA 4GFTA 4GGFA 4GUKA 1SPYA 4GPLB 1NP8A 5I8NA 1DGVA 2O60A 1WDCB 2FOTA 2GGZA 4YGDB 3IF7A 2K61A 4I5JA 1AK8A 1Y6WA 1M46A 2A4JA 1GGZA 1LKJA 1XA5A 1YVHA 4MEWA 1OSAA 2LMUA 1IG5A 4MLWA 1QS7A 2AAOA 2WOSA 5KTYA 1G8IA 3HX4A 5DKRA 1Y1UA 1FF1A 4YGBB 2PVBA 4GNKB 1OZSA 3DVMA 2PALA 3OHMB 1J1DA 1BR1B 1DF0B 2MRDA 3ICBA 1L2OB 1PSBA 2HQWA 5HKWA 4F0ZB 1CFPA 1W7JB 3FWCA 3PALA 3I5FC 1C07A 4CLNA 2KFFA 4YBHB 3FIAA 1M63B 2O5GA 2BE6A 3BUXB 1SRAA 1U5IB 3I5IC 4AQIA 3RM1A 2WC8A 1RWYA 4I5KA 2H2KA 2KQYA 2MAZA 5PALA 1KWOC 3VRPA 1J7PA 2AUCA 4IL1A 3TUYC 1EG4A 1QLSA 2GGMA 3I5GB 1BOCA 4FTGA 5CPVA 1F55A 2K8MB 1RJVA 1UUSA 1OMDA 2KSPA 2L4HA 1F4OA 4MBEA 3KO0A 4MZJA 5TNCA 1G4YR 2KOTA 1LVCD 1PK0D 4MVFA 3BOWA 5I2LA 2EC6C 1HQVA 5GQQC 1V1FA 2L98A 2JTTA 4FQOA 2Q91A 1SL7A 3PATA 1CLBA 1SK6D 2F3YA 2AMIA 1BJFA 1G33A 2M1KB 4DCKA 4WQ2A 2L5XB 1V1GA 3JTDB 5CSIA 4NDDA 1KFUS 1NYAA 5I2OA 3EK4A 3DD4A 2F2OA 3CS1A 3I5HB 2MBXA 2M1UA 3RLZA 1SY9A 1TTXA 1ALWA 1A75A 1AVSA 4YGCB 2LP2A 1XFXO 2Y5IA 1SCMB 1TCFA 1CTRA 1B8LA 2ZFDA 4N5XA 1JFKA 2M49B 1B1GA 1ZUZA 3EK7A 4DIRA 3AAKA 1FW4A 2JT0A 3CR2A 3O78A 3OP0A 1M39A 2I2RE 5HKZA 1NX0A 2CBLA 1SCVA 3IQOA 3SIBA 1CMFA 1UWOA 1JFJA 1JC2A 1XK4C 2JULA 3SG3A 1FPWA 2LLSA 1A4PA 4AQJA 2EGDA 1K9KA 3D0YA 2KYCA 1DVIA 4PE4A 1BODA 1YR5A 1DJZA 3O2PA 1B8RA 4Q04A 4CFQA 1XK4A 1QX7A 1MUXA 2FCEA 2KAXA 4BY4A 1MQ1A 1VRKA 4NDCA 1KQMB 2KBIA 1TNWA 1JSAA 3PSRA 4C0LA 2NCPA 4P2YB 5AEQA 3CR4X 1WDCC 3H4SE 1MWNA 5D7FA 1ALVA 5HLOA 2LANA 1S6JA 1PVAA 1SMGA 1K9UA 4OCIA 2ZRSA 3TZ1A 1SR6B 4DRWA 3WNXB 1YURA 5G08A 3TDUA 1IKUA 1XFYO 1TCOB 2BL0B 1M45A 2JT8A 2LLUA 2QACA 1AJ4A 2H61C 3KF9A 1CMGA 4ORCB 3WXAA 2VRGA 1K93D 1UHJA 1L2OC 1CDNA 1F8HA 1KFUL 2JXCA 1SW8A 4DUQA 1WLMA 1AJ5A 1XO5A 2BECA 2I94A 1WRZA 4HRHA 2D8NA 3O4YA 3SG6A 1SL8A 1MR8A 1YVLA 2H61A 2EHBA 4ZCUA 1K96A 2KI4B 2M9GA 1DF0A 4C0KA 2BCAA 4GAOA 5J3XA 3PM8A 1IQ3A 1YTZC 3EKHA 1Y1AA 2LCPA 2K0JA 2BCXA 2JT3A 5KSZA 3DVJA 3I5GC 4ETOA 1YUUA 2E6WA 1CLMA 2L51A 1U5IA 1RECA 5HYDA 4YRUA 1IRJA 1KK8B 1S5GY 3AKAA 3OX6A 2HF5A 1ZMZA 1L7ZA 1S5GZ 2I7AA 2BBNA 4A4BA 3MSEB 2L4IA 3TDZA 1TOPA 1OOJA 1PVBA 2KQ6A 1PALA 2JOJA 2GV5A 2OS8C 1CDPA 5CSFA 3PN7B 2LUXA 2ZKMX 3BUMB 3LK1A 1TN4A 4R1EA 2K7CA 3A8RA 1JF0A 2BBMA 1IQ5A 1E8AA 2FCDA 3CGAA 3TDIA 3JTDC 2WCEA 4HSZA 4XYNA 1JF2A 1NCZA 2DOQA 2JPTA 2BCBA 4JPZB 2F2PA 4GGNA 1NCYA 1UP5A 2CTNA 1AHRA 1EL4A 1QX2A 2KFGA 4PE1A 1KSMA 1NUBA 1SCMC 2LC5A 3EVVA 3TS5B 5ER4X 4PE0A 1J7RA 1PULA 3EVUA 2OTGB 4MSPA 1BMOA 1QX5B 1EXRA 2FJUB 1LA0A 2IS9A 1AUIB 2V53A 1QTXA 2CNPA 2M7NA 1Y0VH 3BQ3A 3EVRA 2WCBA 4QJ4B 3KHEA 2M97A 2WNDA 4YI9A 2JU0A 1RFJA 4ICBA 1F71A 2LMVA 1S6CA 2M29A 4WQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRO A;  4I5N B;  1DJI A;  5HLV A;  3D10 A;  4U8D A;  1UHN A;  1J7Q A;  3CTN A;  1KFX L;  2KFH A;  3JVT C;  1H8B A;  4MRY A;  1IJ5 A;  2HET A;  1OQP A;  2LP3 A;  3BUO B;  3K21 A;  2LLT A;  1EH2 A;  2BKI B;  3KEV A;  3CLN A;  1NCX A;  1SR6 C;  2KI6 D;  1W7I B;  3SG5 A;  1CFF A;  4E68 A;  3TUY B;  1TNX A;  1H4B A;  2LE9 B;  1EG3 A;  2K7D A;  5KU1 A;  4CPV A;  2HPS A;  4MN0 A;  3AKB A;  3ZNI A;  1Q80 A;  1NX2 A;  4USL A;  4DS7 A;  1NX1 A;  2ZND A;  3HCM A;  4JWQ A;  3OB2 B;  4OVN F;  3E3R A;  1MXE A;  2MHH A;  3LCP C;  4N1G A;  1B47 A;  2KI4 C;  2EC6 B;  1D1O A;  5CSN A;  3NXA A;  2NCO A;  4N1F A;  3VRQ A;  1HT9 A;  2PRU A;  2G9B A;  1QAT A;  4HRG A;  4I5L B;  1KSO A;  2LMT A;  1DJH A;  1QAS A;  5K89 A;  1NX3 A;  2L0P A;  4PE7 A;  1YUS A;  2WOR A;  1KK8 C;  3CR5 X;  3FWB A;  3ZWH A;  5D69 A;  1LIN A;  3VRN A;  4BY5 A;  1ZAC A;  3NSK A;  5ER5 A;  1DTL A;  1S3P A;  4AOM A;  1SYM A;  1B9A A;  2F33 A;  1PSR A;  1SL9 A;  2LVV A;  2M8U A;  1LXF C;  2JXL A;  2L2E A;  1CLL A;  3EKJ A;  4UPG A;  2L50 A;  2E30 A;  4M2O A;  1TRF A;  4XJK B;  1XFU O;  1SNL A;  2KAV A;  1TIZ A;  3GK2 A;  3PN7 C;  5HKY A;  2NXQ A;  5I2Q A;  1QXP A;  1XFZ O;  2WCF A;  2ZN8 A;  3BYA A;  3OB1 B;  4PHJ A;  1BR4 B;  1XYD A;  1C7W A;  2K2A A;  1BG1 A;  1NIW A;  1UUR A;  3OX5 A;  2KNE A;  1K94 A;  2K2F A;  2JZI A;  1CDL A;  3DF0 B;  2Q4U A;  1XFW O;  1QIW A;  1S6I A;  3KPX A;  1J55 A;  1S26 D;  1SBJ A;  2KDH A;  2LUC A;  2KGB C;  3TS5 C;  4YGA A;  1DJG A;  1KFX S;  3GK1 A;  4HRE E;  4MZL A;  1LA3 A;  1B4C A;  1K2H A;  1M31 A;  1N2D A;  5DKN A;  2OTG C;  4M2P A;  2Y1M A;  1FBV A;  2MLF C;  3CZT X;  1R6P A;  2JC2 A;  1CB1 A;  1DJX A;  4CID A;  5JOL A;  1DGU A;  3SG2 A;  1FI6 A;  1CFC A;  1N65 A;  2JQ6 A;  2KBM A;  1ODB A;  1WLZ A;  2BE4 A;  2ZN9 A;  2M3W A;  1B7T Y;  3I5H C;  5CSJ A;  3SIA A;  1B7T Z;  3CWG A;  1A2X A;  1ZOT B;  2CXJ A;  1RK9 A;  2LAP A;  1OZO A;  3PFV A;  2KYF A;  3A4U B;  1JUO A;  3WHT B;  3C1V A;  2LHL A;  1DJW A;  1Y1X A;  1S36 A;  1ZFS A;  2Y4Q A;  1YX7 A;  3M0W A;  2JNF A;  1GGW A;  2ZNE A;  1WRK A;  1R2U A;  4ZCV A;  3DVK A;  1K95 A;  1F4Q A;  1K8U A;  5AFP A;  1N0Y A;  4P5O E;  2TN4 A;  4QJ5 B;  1KK7 Y;  1TNQ A;  1CDM A;  3BUN B;  2R2I A;  1PRW A;  1KK7 Z;  2NZ0 A;  3EK8 A;  1DMO A;  1X02 A;  4L9M A;  2SAS A;  2Y1N A;  2P6B B;  2BKH B;  4C0J A;  1CFD A;  5IBW A;  3QRX A;  5FYX A;  1YUT A;  2KAY A;  2QPT A;  1KCY A;  1NSH A;  1KQM C;  2PSR A;  1F54 A;  1BT6 A;  1GJY A;  1WRL A;  1MXL C;  5DKQ A;  1CM1 A;  1QIV A;  3I5F B;  1FI5 A;  5F6T A;  1OMV A;  4OR9 B;  2F8P A;  2OS8 B;  2F3Z A;  4PCW A;  1IJ6 A;  4YI8 A;  2LVK A;  1B8C A;  2ZRT A;  3I5I B;  2LVI A;  1XFV O;  3BXK A;  2K7B A;  4WRI A;  1QVI Y;  2G2B A;  1KWO B;  1JBA A;  2MLE C;  1UHI A;  1QVI Z;  1BLQ A;  3FS7 A;  1NPQ A;  2BL0 C;  3BOW B;  1AP4 A;  1J1E A;  1JWD A;  2JTZ A;  3DVE A;  4MRX A;  1OMR A;  1J7O A;  3PLF B;  3VGO A;  3O6B A;  4NDB A;  2I18 A;  4GBA A;  3LL8 B;  1QJT A;  1UHK A;  1YRU B;  2NLN A;  4ORB B;  1QV1 A;  4M2Q A;  5AXI A;  2SCP A;  3GK4 X;  2CCM A;  1EJ3 A;  4NQG A;  2CT9 A;  4PHM A;  2ISD A;  2KI6 C;  2PAS A;  1A03 A;  2LM5 A;  4XJK A;  1A29 A;  2JWW A;  4JQ0 D;  1K90 D;  4PHK A;  1BU3 A;  3LLE A;  3WHU B;  1DT7 B;  2KGR A;  1YRT B;  1XVJ A;  2M7L A;  1MHO A;  1IGV A;  3LK0 A;  2PMY A;  1A75 B;  4PAL A;  4PDZ A;  1MF8 B;  1TNP A;  3IQQ A;  1RRO A;  3F45 A;  3BUW B;  1GQM A;  3GOF A;  1UHH A;  4MZK A;  1DJY A;  1RTP 1;  1CNP A;  4OKH A;  3DF0 A;  3NSL A;  2HQ8 A;  1BF5 A;  4OV2 A;  3SJS A;  5AAN A;  1KQV A;  3JVT B;  1IH0 A;  1CKK A;  1S1E A;  1QV0 A;  2MA2 A;  1K9P A;  2K7O A;  4PHN A;  2JNX A;  3D0Y B;  3AAJ A;  5AER A;  5JJG A;  3SG4 A;  3SG7 A;  1IWQ A;  1SKT A;  2LHI A;  1C7V A;  4D1E A;  1NWD A;  4YGE B;  1OE9 B;  2B1U A;  4A4C A;  1CM4 A;  2LV7 A;  3NSO A;  2COL B;  3NSI A;  4QJ3 B;  5B8I B;  4GGF C;  2LVJ A;  1YX8 A;  2OPO A;  3VRR A;  2MJW B;  2JRF A;  4TNC A;  4CFR A;  1F70 A;  1WY9 A;  2KHN A;  5BPJ A;  1QLK A;  2M0R A;  2LNK A;  4ORA B;  2RGI A;  4GFT A;  4GGF A;  4GUK A;  1SPY A;  4GPL B;  1NP8 A;  5I8N A;  1DGV A;  2O60 A;  1WDC B;  2FOT A;  2GGZ A;  4YGD B;  3IF7 A;  2K61 A;  4I5J A;  1AK8 A;  1Y6W A;  1M46 A;  2A4J A;  1GGZ A;  1LKJ A;  1XA5 A;  1YVH A;  4MEW A;  1OSA A;  2LMU A;  1IG5 A;  4MLW A;  1QS7 A;  2AAO A;  2WOS A;  5KTY A;  1G8I A;  3HX4 A;  5DKR A;  1Y1U A;  1FF1 A;  4YGB B;  2PVB A;  4GNK B;  1OZS A;  3DVM A;  2PAL A;  3OHM B;  1J1D A;  1BR1 B;  1DF0 B;  2MRD A;  3ICB A;  1L2O B;  1PSB A;  2HQW A;  5HKW A;  4F0Z B;  1CFP A;  1W7J B;  3FWC A;  3PAL A;  3I5F C;  1C07 A;  4CLN A;  2KFF A;  4YBH B;  3FIA A;  1M63 B;  2O5G A;  2BE6 A;  3BUX B;  1SRA A;  1U5I B;  3I5I C;  4AQI A;  3RM1 A;  2WC8 A;  1RWY A;  4I5K A;  2H2K A;  2KQY A;  2MAZ A;  5PAL A;  1KWO C;  3VRP A;  1J7P A;  2AUC A;  4IL1 A;  3TUY C;  1EG4 A;  1QLS A;  2GGM A;  3I5G B;  1BOC A;  4FTG A;  5CPV A;  1F55 A;  2K8M B;  1RJV A;  1UUS A;  1OMD A;  2KSP A;  2L4H A;  1F4O A;  4MBE A;  3KO0 A;  4MZJ A;  5TNC A;  1G4Y R;  2KOT A;  1LVC D;  1PK0 D;  4MVF A;  3BOW A;  5I2L A;  2EC6 C;  1HQV A;  5GQQ C;  1V1F A;  2L98 A;  2JTT A;  4FQO A;  2Q91 A;  1SL7 A;  3PAT A;  1CLB A;  1SK6 D;  2F3Y A;  2AMI A;  1BJF A;  1G33 A;  2M1K B;  4DCK A;  4WQ2 A;  2L5X B;  1V1G A;  3JTD B;  5CSI A;  4NDD A;  1KFU S;  1NYA A;  5I2O A;  3EK4 A;  3DD4 A;  2F2O A;  3CS1 A;  3I5H B;  2MBX A;  2M1U A;  3RLZ A;  1SY9 A;  1TTX A;  1ALW A;  1A75 A;  1AVS A;  4YGC B;  2LP2 A;  1XFX O;  2Y5I A;  1SCM B;  1TCF A;  1CTR A;  1B8L A;  2ZFD A;  4N5X A;  1JFK A;  2M49 B;  1B1G A;  1ZUZ A;  3EK7 A;  4DIR A;  3AAK A;  1FW4 A;  2JT0 A;  3CR2 A;  3O78 A;  3OP0 A;  1M39 A;  2I2R E;  5HKZ A;  1NX0 A;  2CBL A;  1SCV A;  3IQO A;  3SIB A;  1CMF A;  1UWO A;  1JFJ A;  1JC2 A;  1XK4 C;  2JUL A;  3SG3 A;  1FPW A;  2LLS A;  1A4P A;  4AQJ A;  2EGD A;  1K9K A;  3D0Y A;  2KYC A;  1DVI A;  4PE4 A;  1BOD A;  1YR5 A;  1DJZ A;  3O2P A;  1B8R A;  4Q04 A;  4CFQ A;  1XK4 A;  1QX7 A;  1MUX A;  2FCE A;  2KAX A;  4BY4 A;  1MQ1 A;  1VRK A;  4NDC A;  1KQM B;  2KBI A;  1TNW A;  1JSA A;  3PSR A;  4C0L A;  2NCP A;  4P2Y B;  5AEQ A;  3CR4 X;  1WDC C;  3H4S E;  1MWN A;  5D7F A;  1ALV A;  5HLO A;  2LAN A;  1S6J A;  1PVA A;  1SMG A;  1K9U A;  4OCI A;  2ZRS A;  3TZ1 A;  1SR6 B;  4DRW A;  3WNX B;  1YUR A;  5G08 A;  3TDU A;  1IKU A;  1XFY O;  1TCO B;  2BL0 B;  1M45 A;  2JT8 A;  2LLU A;  2QAC A;  1AJ4 A;  2H61 C;  3KF9 A;  1CMG A;  4ORC B;  3WXA A;  2VRG A;  1K93 D;  1UHJ A;  1L2O C;  1CDN A;  1F8H A;  1KFU L;  2JXC A;  1SW8 A;  4DUQ A;  1WLM A;  1AJ5 A;  1XO5 A;  2BEC A;  2I94 A;  1WRZ A;  4HRH A;  2D8N A;  3O4Y A;  3SG6 A;  1SL8 A;  1MR8 A;  1YVL A;  2H61 A;  2EHB A;  4ZCU A;  1K96 A;  2KI4 B;  2M9G A;  1DF0 A;  4C0K A;  2BCA A;  4GAO A;  5J3X A;  3PM8 A;  1IQ3 A;  1YTZ C;  3EKH A;  1Y1A A;  2LCP A;  2K0J A;  2BCX A;  2JT3 A;  5KSZ A;  3DVJ A;  3I5G C;  4ETO A;  1YUU A;  2E6W A;  1CLM A;  2L51 A;  1U5I A;  1REC A;  5HYD A;  4YRU A;  1IRJ A;  1KK8 B;  1S5G Y;  3AKA A;  3OX6 A;  2HF5 A;  1ZMZ A;  1L7Z A;  1S5G Z;  2I7A A;  2BBN A;  4A4B A;  3MSE B;  2L4I A;  3TDZ A;  1TOP A;  1OOJ A;  1PVB A;  2KQ6 A;  1PAL A;  2JOJ A;  2GV5 A;  2OS8 C;  1CDP A;  5CSF A;  3PN7 B;  2LUX A;  2ZKM X;  3BUM B;  3LK1 A;  1TN4 A;  4R1E A;  2K7C A;  3A8R A;  1JF0 A;  2BBM A;  1IQ5 A;  1E8A A;  2FCD A;  3CGA A;  3TDI A;  3JTD C;  2WCE A;  4HSZ A;  4XYN A;  1JF2 A;  1NCZ A;  2DOQ A;  2JPT A;  2BCB A;  4JPZ B;  2F2P A;  4GGN A;  1NCY A;  1UP5 A;  2CTN A;  1AHR A;  1EL4 A;  1QX2 A;  2KFG A;  4PE1 A;  1KSM A;  1NUB A;  1SCM C;  2LC5 A;  3EVV A;  3TS5 B;  5ER4 X;  4PE0 A;  1J7R A;  1PUL A;  3EVU A;  2OTG B;  4MSP A;  1BMO A;  1QX5 B;  1EXR A;  2FJU B;  1LA0 A;  2IS9 A;  1AUI B;  2V53 A;  1QTX A;  2CNP A;  2M7N A;  1Y0V H;  3BQ3 A;  3EVR A;  2WCB A;  4QJ4 B;  3KHE A;  2M97 A;  2WND A;  4YI9 A;  2JU0 A;  1RFJ A;  4ICB A;  1F71 A;  2LMV A;  1S6C A;  2M29 A;  4WQ3 A; 
#chains in the Genus database with same CATH topology
 3VRO A;  4I5N B;  1DJI A;  5HLV A;  3D10 A;  4U8D A;  3S0B A;  1UHN A;  1J7Q A;  3CTN A;  3S0F A;  1KFX L;  2KFH A;  3JVT C;  3R1V A;  5I94 A;  1H8B A;  4MRY A;  1IJ5 A;  2HET A;  1OQP A;  2LP3 A;  3BUO B;  3K21 A;  2LLT A;  1EH2 A;  2BKI B;  3KEV A;  3CLN A;  1NCX A;  1SR6 C;  2KI6 D;  1W7I B;  2KLE A;  3SG5 A;  1CFF A;  4E68 A;  3TUY B;  1TNX A;  1H4B A;  2LE9 B;  1EG3 A;  2K7D A;  5KU1 A;  4CPV A;  2HPS A;  4MN0 A;  3R1P A;  3AKB A;  3ZNI A;  1Q80 A;  3B87 A;  1NX2 A;  4USL A;  3UO9 A;  4DS7 A;  1NX1 A;  2ZND A;  3HCM A;  4JWQ A;  3VB1 A;  3OB2 B;  4OVN F;  3BFH A;  1MXE A;  2MHH A;  3D74 A;  3E3R A;  3LCP C;  1B47 A;  2KI4 C;  2EC6 B;  4N1G A;  4OZD A;  1D1O A;  5CSN A;  3NXA A;  2NCO A;  4N1F A;  3VRQ A;  3BJH A;  1HT9 A;  2PRU A;  2G9B A;  3SS3 A;  1QAT A;  2PQL A;  4HRG A;  3O4X A;  4I5L B;  1KSO A;  2LMT A;  1DJH A;  1QAS A;  5K89 A;  3D78 A;  1NX3 A;  2L0P A;  4PE7 A;  1YUS A;  3CYZ A;  3DY9 A;  2WOR A;  1KK8 C;  3CR5 X;  3FWB A;  3ZWH A;  5D69 A;  1LIN A;  3VRN A;  3L4L A;  4BY5 A;  5DIC A;  1ZAC A;  3NSK A;  5ER5 A;  3RZS A;  1DTL A;  1S3P A;  4AOM A;  1SYM A;  1B9A A;  2F33 A;  1OW4 A;  1PSR A;  5FI7 A;  1SL9 A;  2LVV A;  2M8U A;  1LXF C;  2JXL A;  2L2E A;  1CLL A;  3EKJ A;  4PT1 A;  4UPG A;  2L50 A;  2E30 A;  4M2O A;  1TRF A;  4XJK B;  1XFU O;  1SNL A;  2KAV A;  1TIZ A;  3GK2 A;  3PN7 C;  5HKY A;  2NXQ A;  5I2Q A;  1QXP A;  1XFZ O;  2WCF A;  2ZN8 A;  3BYA A;  3OB1 B;  4PHJ A;  1C3Y A;  1TUJ A;  1BR4 B;  1OOH A;  4INW A;  1XYD A;  1C7W A;  2K2A A;  1BG1 A;  1NIW A;  1UUR A;  3OX5 A;  2KNE A;  1Z2C B;  1K94 A;  2K2F A;  1XFR A;  2JZI A;  1CDL A;  3DF0 B;  2Q4U A;  1XFW O;  1QIW A;  1S6I A;  3KPX A;  1J55 A;  1S26 D;  1SBJ A;  2KDH A;  2LUC A;  2KGB C;  1Z4H A;  3TS5 C;  4YGA A;  1DJG A;  1KFX S;  3GK1 A;  4HRE E;  4MZL A;  1LA3 A;  1B4C A;  1K2H A;  1M31 A;  1N2D A;  5DKN A;  2OTG C;  2WCJ A;  4M2P A;  2Y1M A;  1FBV A;  2MLF C;  3CZT X;  1R6P A;  2JC2 A;  3BFA A;  1CB1 A;  1LS8 A;  1DJX A;  4CID A;  5JOL A;  1DGU A;  3SG2 A;  2K60 A;  1FI6 A;  1CFC A;  1N65 A;  2JQ6 A;  2KBM A;  1ODB A;  1WLZ A;  2BE4 A;  2ZN9 A;  2PYQ A;  3R72 A;  3D76 A;  2M3W A;  2WCM A;  5FI6 A;  1B7T Y;  3I5H C;  5CSJ A;  3SIA A;  1B7T Z;  3CWG A;  1A2X A;  1ZOT B;  2CXJ A;  1RK9 A;  2FJY A;  1GM0 A;  2LAP A;  1OZO A;  3PFV A;  2KYF A;  3A4U B;  3B6X A;  1JUO A;  3WHT B;  3C1V A;  2LHL A;  1DJW A;  1Y1X A;  1S36 A;  1ZFS A;  2Y4Q A;  1YX7 A;  3M0W A;  2JNF A;  1GGW A;  2ZNE A;  1WRK A;  1R2U A;  4ZCV A;  3DVK A;  1K95 A;  1IIO A;  1F4Q A;  1K8U A;  5AFP A;  1N0Y A;  4P5O E;  3L4A A;  2TN4 A;  4QJ5 B;  3D75 A;  1KK7 Y;  1TNQ A;  1CDM A;  3BUN B;  2R2I A;  1PRW A;  1KK7 Z;  2NZ0 A;  3EK8 A;  3FE8 A;  1DMO A;  1X02 A;  4L9M A;  3CZ2 A;  3UNW A;  2SAS A;  2Y1N A;  2P6B B;  2BKH B;  4C0J A;  1CFD A;  5IBW A;  3QRX A;  5FYX A;  1YUT A;  2KAY A;  2QPT A;  1KCY A;  1NSH A;  1KQM C;  2PSR A;  2QEV A;  1F54 A;  4F7F A;  1BT6 A;  1GJY A;  1WRL A;  1MXL C;  5DKQ A;  1CM1 A;  1QIV A;  3I5F B;  1FI5 A;  5F6T A;  1OMV A;  4OR9 B;  2F8P A;  2OS8 B;  2F3Z A;  4PCW A;  1IJ6 A;  4YI8 A;  2LVK A;  1B8C A;  2ZRT A;  3I5I B;  2LVI A;  1XFV O;  3BXK A;  2K7B A;  4WRI A;  1QVI Y;  2G2B A;  3R1O A;  1KWO B;  1JBA A;  2MLE C;  3Q8I A;  1UHI A;  1QVI Z;  1BLQ A;  5FI2 A;  3FS7 A;  1NPQ A;  2BL0 C;  3BOW B;  1AP4 A;  1J1E A;  1JWD A;  2JTZ A;  3DVE A;  4MRX A;  1OMR A;  1J7O A;  3PLF B;  3VGO A;  3L47 A;  3O6B A;  4NDB A;  2I18 A;  4GBA A;  3OGN A;  3LL8 B;  1QJT A;  1UHK A;  1YRU B;  2NLN A;  4ORB B;  1QV1 A;  4M2Q A;  5AXI A;  2SCP A;  3GK4 X;  2CCM A;  1EJ3 A;  4NQG A;  2CT9 A;  4PHM A;  2ISD A;  1TUZ A;  2KI6 C;  2PAS A;  1A03 A;  2LM5 A;  3DZT A;  4XJK A;  1A29 A;  1C3Z A;  2JWW A;  4JQ0 D;  1K90 D;  3D77 A;  1BU3 A;  3LLE A;  4PHK A;  3WHU B;  2KGR A;  1DT7 B;  1YRT B;  1XVJ A;  2M7L A;  1MHO A;  1IGV A;  3LK0 A;  2PMY A;  1A75 B;  4PAL A;  4PDZ A;  1MF8 B;  1TNP A;  3IQQ A;  1RRO A;  3F45 A;  3BUW B;  1GQM A;  3GOF A;  1UHH A;  4MZK A;  1DJY A;  1RTP 1;  1CNP A;  4OKH A;  3DF0 A;  3NSL A;  2HQ8 A;  1BF5 A;  4OV2 A;  3SJS A;  2H8V A;  5AAN A;  1W9Z A;  1KQV A;  3JVT B;  1IH0 A;  1CKK A;  1S1E A;  1QV0 A;  2MA2 A;  1K9P A;  2K7O A;  4PHN A;  2JNX A;  3D0Y B;  3AAJ A;  5AER A;  5JJG A;  3SG4 A;  3SG7 A;  1IWQ A;  1SKT A;  2LHI A;  1C7V A;  4D1E A;  1NWD A;  3D73 A;  1OE9 B;  2B1U A;  1QWV A;  4YGE B;  3SS4 A;  4A4C A;  1T14 A;  1CM4 A;  2LV7 A;  2QEH A;  3NSO A;  2COL B;  3DXL A;  3NSI A;  4QJ3 B;  4GGF C;  5B8I B;  1OOI X;  3FE9 A;  2LVJ A;  1YX8 A;  2OPO A;  3VRR A;  2MJW B;  2JRF A;  4TNC A;  4CFR A;  1F70 A;  1WY9 A;  2KHN A;  3OBV A;  1QLK A;  2M0R A;  4FQT A;  1DEL A;  2LNK A;  4ORA B;  5BPJ A;  3CZ1 A;  2P70 A;  2RGI A;  4GFT A;  4GGF A;  4GUK A;  1SPY A;  3N7H A;  4GPL B;  1NP8 A;  5I8N A;  1DGV A;  2O60 A;  1WDC B;  2FOT A;  2GGZ A;  4YGD B;  3IF7 A;  2K61 A;  4I5J A;  1AK8 A;  1Y6W A;  1M46 A;  2A4J A;  1GGZ A;  1LKJ A;  1XA5 A;  1YVH A;  4MEW A;  1OSA A;  2LMU A;  1IG5 A;  4MLW A;  1QS7 A;  2AAO A;  2WOS A;  5KTY A;  1G8I A;  3HX4 A;  5DKR A;  1Y1U A;  3CAB A;  1FF1 A;  4YGB B;  2PVB A;  4GNK B;  1OZS A;  3DVM A;  2PAL A;  3SS5 A;  3OHM B;  1J1D A;  1BR1 B;  1DF0 B;  2MRD A;  2P71 A;  1L2O B;  1PSB A;  2HQW A;  3ICB A;  5HKW A;  4F0Z B;  1CFP A;  1W7J B;  3FWC A;  3PAL A;  3I5F C;  1C07 A;  4CLN A;  2KFF A;  4YBH B;  3FIA A;  1M63 B;  3B86 A;  1DC1 A;  2O5G A;  2QEB A;  2BE6 A;  2KLD A;  3BUX B;  1SRA A;  1U5I B;  3I5I C;  4AQI A;  3RM1 A;  2WC8 A;  1RWY A;  1OOG A;  2H2K A;  2KQY A;  1TWO A;  2MAZ A;  4I5K A;  3IVT A;  4IJ7 A;  5PAL A;  2L5Y A;  1KWO C;  3VRP A;  1J7P A;  2AUC A;  4IL1 A;  3TUY C;  1EG4 A;  1QLS A;  2GGM A;  3I5G B;  3NHI A;  1BOC A;  4FTG A;  5CPV A;  5D3O A;  1F55 A;  2K8M B;  3DYE A;  1RJV A;  1UUS A;  1OMD A;  2KSP A;  2L4H A;  1F4O A;  4MBE A;  3KO0 A;  4MZJ A;  5TNC A;  1G4Y R;  2KOT A;  1LVC D;  1PK0 D;  4MVF A;  3BOW A;  5I2L A;  5HL1 A;  2EC6 C;  1HQV A;  5GQQ C;  3K1E A;  1V1F A;  2L98 A;  2JTT A;  4FQO A;  2Q91 A;  1SL7 A;  3PAT A;  1CLB A;  1SK6 D;  2F3Y A;  2AMI A;  1BJF A;  1G33 A;  2M1K B;  3B88 A;  3NHT A;  4DCK A;  4WQ2 A;  2L5X B;  1V1G A;  3JTD B;  5CSI A;  4NDD A;  1KFU S;  1NYA A;  2BAP A;  3EK4 A;  5I2O A;  3DD4 A;  2F2O A;  3CS1 A;  3I5H B;  3NGV A;  2MBX A;  3QME A;  3V2L A;  3PM2 A;  2M1U A;  3RLZ A;  3CZ0 A;  1SY9 A;  1TTX A;  1ALW A;  1A75 A;  1AVS A;  4YGC B;  2LP2 A;  1XFX O;  2Y5I A;  1SCM B;  1TCF A;  1CTR A;  3S0D A;  1B8L A;  2QEO A;  2ZFD A;  3S0G A;  4N5X A;  1JFK A;  3CDN A;  2M49 B;  1B1G A;  1ZUZ A;  3EK7 A;  4DIR A;  3AAK A;  1FW4 A;  2JT0 A;  3CR2 A;  3O78 A;  3OP0 A;  1M39 A;  2I2R E;  5HKZ A;  1NX0 A;  2CBL A;  1SCV A;  3IQO A;  3SIB A;  1CMF A;  1UWO A;  2QDI A;  1JFJ A;  1JC2 A;  2GTE A;  1XK4 C;  2JUL A;  3SG3 A;  1FPW A;  2LLS A;  1A4P A;  4AQJ A;  2EGD A;  1K9K A;  3D0Y A;  2KYC A;  1DVI A;  4PE4 A;  1BOD A;  1YR5 A;  1DJZ A;  4JKT A;  3O2P A;  1B8R A;  4Q04 A;  4CFQ A;  1XK4 A;  1QX7 A;  2WCL A;  3PJI A;  1MUX A;  2FCE A;  2KAX A;  4BY4 A;  1MQ1 A;  1VRK A;  4NDC A;  1KQM B;  3S0E A;  2KBI A;  1TNW A;  1JSA A;  2L2C A;  3PSR A;  4C0L A;  2NCP A;  4P2Y B;  5AEQ A;  3CR4 X;  1WDC C;  3H4S E;  1MWN A;  5D7F A;  1SSE B;  1ALV A;  5HLO A;  2LAN A;  3FE6 A;  1S6J A;  2WC5 A;  1PVA A;  1ORG A;  1SMG A;  1K9U A;  4OCI A;  2ZRS A;  3TZ1 A;  1SR6 B;  3S0A A;  4DRW A;  3WNX B;  1YUR A;  5G08 A;  3TDU A;  1IKU A;  1XFY O;  1TCO B;  2BL0 B;  1M45 A;  2JT8 A;  2LLU A;  2QAC A;  1AJ4 A;  2H61 C;  3KF9 A;  1CMG A;  4ORC B;  3WXA A;  2VRG A;  1K93 D;  1UHJ A;  1L2O C;  1CDN A;  1F8H A;  1KFU L;  2JXC A;  1SW8 A;  4DUQ A;  1WLM A;  1AJ5 A;  1XO5 A;  2BEC A;  2I94 A;  1WRZ A;  4HRH A;  2D8N A;  3O4Y A;  3SG6 A;  1SL8 A;  1MR8 A;  1YVL A;  2H61 A;  2EHB A;  4ZCU A;  1K96 A;  2KI4 B;  2M9G A;  1DF0 A;  4C0K A;  2BCA A;  4GAO A;  5J3X A;  3PM8 A;  1IQ3 A;  1YTZ C;  3EKH A;  1Y1A A;  2LCP A;  2K0J A;  2BCX A;  2KPH A;  2JT3 A;  5KSZ A;  3DVJ A;  3I5G C;  4ETO A;  1YUU A;  2BNX A;  2E6W A;  1CLM A;  2L51 A;  1U5I A;  1REC A;  5HYD A;  1P28 A;  4YRU A;  1IRJ A;  1KK8 B;  1S5G Y;  3AKA A;  3OX6 A;  2JPO A;  2HF5 A;  1ZMZ A;  1L7Z A;  1S5G Z;  2I7A A;  2YGU A;  2BBN A;  4A4B A;  3MSE B;  2L4I A;  3TDZ A;  1TOP A;  1OOJ A;  4INX A;  2ERB A;  1PVB A;  3EG5 B;  2KQ6 A;  1PAL A;  2JOJ A;  2GV5 A;  2OS8 C;  1CDP A;  4JD9 A;  5CSF A;  3PN7 B;  2LUX A;  2ZKM X;  3BUM B;  3LK1 A;  1TN4 A;  4R1E A;  2K7C A;  3A8R A;  1JF0 A;  2BBM A;  1IQ5 A;  1E8A A;  2FCD A;  3CGA A;  3TDI A;  3JTD C;  2WCH A;  2WCE A;  3BFB A;  4HSZ A;  4XYN A;  1JF2 A;  1NCZ A;  2DOQ A;  2JPT A;  2BCB A;  4JPZ B;  2F2P A;  4GGN A;  1DQE A;  1NCY A;  1UP5 A;  2CTN A;  1AHR A;  1EL4 A;  1OOF A;  1QX2 A;  2WCK A;  2KFG A;  4PE1 A;  1KSM A;  1NUB A;  1SCM C;  2LC5 A;  3B7A A;  3EVV A;  5ER4 X;  4PE0 A;  3TS5 B;  1J7R A;  1PUL A;  2WC6 A;  1DEK A;  3EVU A;  2OTG B;  4MSP A;  1BMO A;  1QX5 B;  1EXR A;  2FJU B;  1LA0 A;  2IS9 A;  1AUI B;  2V53 A;  1QTX A;  4KYN A;  2CNP A;  2M7N A;  1Y0V H;  3BQ3 A;  3EVR A;  2WCB A;  4QJ4 B;  3KHE A;  2M97 A;  2WND A;  4YI9 A;  2JU0 A;  1RFJ A;  4ICB A;  1F71 A;  5EL2 A;  2LMV A;  1S6C A;  2M29 A;  4WQ3 A; 
#chains in the Genus database with same CATH homology
 3VRO A;  4I5N B;  1DJI A;  5HLV A;  3D10 A;  4U8D A;  1UHN A;  1J7Q A;  3CTN A;  1KFX L;  2KFH A;  3JVT C;  1H8B A;  4MRY A;  1IJ5 A;  2HET A;  1OQP A;  2LP3 A;  3BUO B;  3K21 A;  2LLT A;  1EH2 A;  2BKI B;  3KEV A;  3CLN A;  1NCX A;  1SR6 C;  2KI6 D;  1W7I B;  3SG5 A;  1CFF A;  4E68 A;  3TUY B;  1TNX A;  1H4B A;  2LE9 B;  1EG3 A;  2K7D A;  5KU1 A;  4CPV A;  2HPS A;  4MN0 A;  3AKB A;  3ZNI A;  1Q80 A;  1NX2 A;  4USL A;  4DS7 A;  1NX1 A;  2ZND A;  3HCM A;  4JWQ A;  3OB2 B;  4OVN F;  3E3R A;  1MXE A;  2MHH A;  3LCP C;  4N1G A;  1B47 A;  2KI4 C;  2EC6 B;  1D1O A;  5CSN A;  3NXA A;  2NCO A;  4N1F A;  3VRQ A;  1HT9 A;  2PRU A;  2G9B A;  1QAT A;  4HRG A;  4I5L B;  1KSO A;  2LMT A;  1DJH A;  1QAS A;  5K89 A;  1NX3 A;  2L0P A;  4PE7 A;  1YUS A;  2WOR A;  1KK8 C;  3CR5 X;  3FWB A;  3ZWH A;  5D69 A;  1LIN A;  3VRN A;  4BY5 A;  1ZAC A;  3NSK A;  5ER5 A;  1DTL A;  1S3P A;  4AOM A;  1SYM A;  1B9A A;  2F33 A;  1PSR A;  1SL9 A;  2LVV A;  2M8U A;  1LXF C;  2JXL A;  2L2E A;  1CLL A;  3EKJ A;  4UPG A;  2L50 A;  2E30 A;  4M2O A;  1TRF A;  4XJK B;  1XFU O;  1SNL A;  2KAV A;  1TIZ A;  3GK2 A;  3PN7 C;  5HKY A;  2NXQ A;  5I2Q A;  1QXP A;  1XFZ O;  2WCF A;  2ZN8 A;  3BYA A;  3OB1 B;  4PHJ A;  1BR4 B;  1XYD A;  1C7W A;  2K2A A;  1BG1 A;  1NIW A;  1UUR A;  3OX5 A;  2KNE A;  1K94 A;  2K2F A;  2JZI A;  1CDL A;  3DF0 B;  2Q4U A;  1XFW O;  1QIW A;  1S6I A;  3KPX A;  1J55 A;  1S26 D;  1SBJ A;  2KDH A;  2LUC A;  2KGB C;  3TS5 C;  4YGA A;  1DJG A;  1KFX S;  3GK1 A;  4HRE E;  4MZL A;  1LA3 A;  1B4C A;  1K2H A;  1M31 A;  1N2D A;  5DKN A;  2OTG C;  4M2P A;  2Y1M A;  1FBV A;  2MLF C;  3CZT X;  1R6P A;  2JC2 A;  1CB1 A;  1DJX A;  4CID A;  5JOL A;  1DGU A;  3SG2 A;  1FI6 A;  1CFC A;  1N65 A;  2JQ6 A;  2KBM A;  1ODB A;  1WLZ A;  2BE4 A;  2ZN9 A;  2M3W A;  1B7T Y;  3I5H C;  5CSJ A;  3SIA A;  1B7T Z;  3CWG A;  1A2X A;  1ZOT B;  2CXJ A;  1RK9 A;  2LAP A;  1OZO A;  3PFV A;  2KYF A;  3A4U B;  1JUO A;  3WHT B;  3C1V A;  2LHL A;  1DJW A;  1Y1X A;  1S36 A;  1ZFS A;  2Y4Q A;  1YX7 A;  3M0W A;  2JNF A;  1GGW A;  2ZNE A;  1WRK A;  1R2U A;  4ZCV A;  3DVK A;  1K95 A;  1F4Q A;  1K8U A;  5AFP A;  1N0Y A;  4P5O E;  2TN4 A;  4QJ5 B;  1KK7 Y;  1TNQ A;  1CDM A;  3BUN B;  2R2I A;  1PRW A;  1KK7 Z;  2NZ0 A;  3EK8 A;  1DMO A;  1X02 A;  4L9M A;  2SAS A;  2Y1N A;  2P6B B;  2BKH B;  4C0J A;  1CFD A;  5IBW A;  3QRX A;  5FYX A;  1YUT A;  2KAY A;  2QPT A;  1KCY A;  1NSH A;  1KQM C;  2PSR A;  1F54 A;  1BT6 A;  1GJY A;  1WRL A;  1MXL C;  5DKQ A;  1CM1 A;  1QIV A;  3I5F B;  1FI5 A;  5F6T A;  1OMV A;  4OR9 B;  2F8P A;  2OS8 B;  2F3Z A;  4PCW A;  1IJ6 A;  4YI8 A;  2LVK A;  1B8C A;  2ZRT A;  3I5I B;  2LVI A;  1XFV O;  3BXK A;  2K7B A;  4WRI A;  1QVI Y;  2G2B A;  1KWO B;  1JBA A;  2MLE C;  1UHI A;  1QVI Z;  1BLQ A;  3FS7 A;  1NPQ A;  2BL0 C;  3BOW B;  1AP4 A;  1J1E A;  1JWD A;  2JTZ A;  3DVE A;  4MRX A;  1OMR A;  1J7O A;  3PLF B;  3VGO A;  3O6B A;  4NDB A;  2I18 A;  4GBA A;  3LL8 B;  1QJT A;  1UHK A;  1YRU B;  2NLN A;  4ORB B;  1QV1 A;  4M2Q A;  5AXI A;  2SCP A;  3GK4 X;  2CCM A;  1EJ3 A;  4NQG A;  2CT9 A;  4PHM A;  2ISD A;  2KI6 C;  2PAS A;  1A03 A;  2LM5 A;  4XJK A;  1A29 A;  2JWW A;  4JQ0 D;  1K90 D;  4PHK A;  1BU3 A;  3LLE A;  3WHU B;  1DT7 B;  2KGR A;  1YRT B;  1XVJ A;  2M7L A;  1MHO A;  1IGV A;  3LK0 A;  2PMY A;  1A75 B;  4PAL A;  4PDZ A;  1MF8 B;  1TNP A;  3IQQ A;  1RRO A;  3F45 A;  3BUW B;  1GQM A;  3GOF A;  1UHH A;  4MZK A;  1DJY A;  1RTP 1;  1CNP A;  4OKH A;  3DF0 A;  3NSL A;  2HQ8 A;  1BF5 A;  4OV2 A;  3SJS A;  5AAN A;  1KQV A;  3JVT B;  1IH0 A;  1CKK A;  1S1E A;  1QV0 A;  2MA2 A;  1K9P A;  2K7O A;  4PHN A;  2JNX A;  3D0Y B;  3AAJ A;  5AER A;  5JJG A;  3SG4 A;  3SG7 A;  1IWQ A;  1SKT A;  2LHI A;  1C7V A;  4D1E A;  1NWD A;  4YGE B;  1OE9 B;  2B1U A;  4A4C A;  1CM4 A;  2LV7 A;  3NSO A;  2COL B;  3NSI A;  4QJ3 B;  5B8I B;  4GGF C;  2LVJ A;  1YX8 A;  2OPO A;  3VRR A;  2MJW B;  2JRF A;  4TNC A;  4CFR A;  1F70 A;  1WY9 A;  2KHN A;  5BPJ A;  1QLK A;  2M0R A;  2LNK A;  4ORA B;  2RGI A;  4GFT A;  4GGF A;  4GUK A;  1SPY A;  4GPL B;  1NP8 A;  5I8N A;  1DGV A;  2O60 A;  1WDC B;  2FOT A;  2GGZ A;  4YGD B;  3IF7 A;  2K61 A;  4I5J A;  1AK8 A;  1Y6W A;  1M46 A;  2A4J A;  1GGZ A;  1LKJ A;  1XA5 A;  1YVH A;  4MEW A;  1OSA A;  2LMU A;  1IG5 A;  4MLW A;  1QS7 A;  2AAO A;  2WOS A;  5KTY A;  1G8I A;  3HX4 A;  5DKR A;  1Y1U A;  1FF1 A;  4YGB B;  2PVB A;  4GNK B;  1OZS A;  3DVM A;  2PAL A;  3OHM B;  1J1D A;  1BR1 B;  1DF0 B;  2MRD A;  3ICB A;  1L2O B;  1PSB A;  2HQW A;  5HKW A;  4F0Z B;  1CFP A;  1W7J B;  3FWC A;  3PAL A;  3I5F C;  1C07 A;  4CLN A;  2KFF A;  4YBH B;  3FIA A;  1M63 B;  2O5G A;  2BE6 A;  3BUX B;  1SRA A;  1U5I B;  3I5I C;  4AQI A;  3RM1 A;  2WC8 A;  1RWY A;  4I5K A;  2H2K A;  2KQY A;  2MAZ A;  5PAL A;  1KWO C;  3VRP A;  1J7P A;  2AUC A;  4IL1 A;  3TUY C;  1EG4 A;  1QLS A;  2GGM A;  3I5G B;  1BOC A;  4FTG A;  5CPV A;  1F55 A;  2K8M B;  1RJV A;  1UUS A;  1OMD A;  2KSP A;  2L4H A;  1F4O A;  4MBE A;  3KO0 A;  4MZJ A;  5TNC A;  1G4Y R;  2KOT A;  1LVC D;  1PK0 D;  4MVF A;  3BOW A;  5I2L A;  2EC6 C;  1HQV A;  5GQQ C;  1V1F A;  2L98 A;  2JTT A;  4FQO A;  2Q91 A;  1SL7 A;  3PAT A;  1CLB A;  1SK6 D;  2F3Y A;  2AMI A;  1BJF A;  1G33 A;  2M1K B;  4DCK A;  4WQ2 A;  2L5X B;  1V1G A;  3JTD B;  5CSI A;  4NDD A;  1KFU S;  1NYA A;  5I2O A;  3EK4 A;  3DD4 A;  2F2O A;  3CS1 A;  3I5H B;  2MBX A;  2M1U A;  3RLZ A;  1SY9 A;  1TTX A;  1ALW A;  1A75 A;  1AVS A;  4YGC B;  2LP2 A;  1XFX O;  2Y5I A;  1SCM B;  1TCF A;  1CTR A;  1B8L A;  2ZFD A;  4N5X A;  1JFK A;  2M49 B;  1B1G A;  1ZUZ A;  3EK7 A;  4DIR A;  3AAK A;  1FW4 A;  2JT0 A;  3CR2 A;  3O78 A;  3OP0 A;  1M39 A;  2I2R E;  5HKZ A;  1NX0 A;  2CBL A;  1SCV A;  3IQO A;  3SIB A;  1CMF A;  1UWO A;  1JFJ A;  1JC2 A;  1XK4 C;  2JUL A;  3SG3 A;  1FPW A;  2LLS A;  1A4P A;  4AQJ A;  2EGD A;  1K9K A;  3D0Y A;  2KYC A;  1DVI A;  4PE4 A;  1BOD A;  1YR5 A;  1DJZ A;  3O2P A;  1B8R A;  4Q04 A;  4CFQ A;  1XK4 A;  1QX7 A;  1MUX A;  2FCE A;  2KAX A;  4BY4 A;  1MQ1 A;  1VRK A;  4NDC A;  1KQM B;  2KBI A;  1TNW A;  1JSA A;  3PSR A;  4C0L A;  2NCP A;  4P2Y B;  5AEQ A;  3CR4 X;  1WDC C;  3H4S E;  1MWN A;  5D7F A;  1ALV A;  5HLO A;  2LAN A;  1S6J A;  1PVA A;  1SMG A;  1K9U A;  4OCI A;  2ZRS A;  3TZ1 A;  1SR6 B;  4DRW A;  3WNX B;  1YUR A;  5G08 A;  3TDU A;  1IKU A;  1XFY O;  1TCO B;  2BL0 B;  1M45 A;  2JT8 A;  2LLU A;  2QAC A;  1AJ4 A;  2H61 C;  3KF9 A;  1CMG A;  4ORC B;  3WXA A;  2VRG A;  1K93 D;  1UHJ A;  1L2O C;  1CDN A;  1F8H A;  1KFU L;  2JXC A;  1SW8 A;  4DUQ A;  1WLM A;  1AJ5 A;  1XO5 A;  2BEC A;  2I94 A;  1WRZ A;  4HRH A;  2D8N A;  3O4Y A;  3SG6 A;  1SL8 A;  1MR8 A;  1YVL A;  2H61 A;  2EHB A;  4ZCU A;  1K96 A;  2KI4 B;  2M9G A;  1DF0 A;  4C0K A;  2BCA A;  4GAO A;  5J3X A;  3PM8 A;  1IQ3 A;  1YTZ C;  3EKH A;  1Y1A A;  2LCP A;  2K0J A;  2BCX A;  2JT3 A;  5KSZ A;  3DVJ A;  3I5G C;  4ETO A;  1YUU A;  2E6W A;  1CLM A;  2L51 A;  1U5I A;  1REC A;  5HYD A;  4YRU A;  1IRJ A;  1KK8 B;  1S5G Y;  3AKA A;  3OX6 A;  2HF5 A;  1ZMZ A;  1L7Z A;  1S5G Z;  2I7A A;  2BBN A;  4A4B A;  3MSE B;  2L4I A;  3TDZ A;  1TOP A;  1OOJ A;  1PVB A;  2KQ6 A;  1PAL A;  2JOJ A;  2GV5 A;  2OS8 C;  1CDP A;  5CSF A;  3PN7 B;  2LUX A;  2ZKM X;  3BUM B;  3LK1 A;  1TN4 A;  4R1E A;  2K7C A;  3A8R A;  1JF0 A;  2BBM A;  1IQ5 A;  1E8A A;  2FCD A;  3CGA A;  3TDI A;  3JTD C;  2WCE A;  4HSZ A;  4XYN A;  1JF2 A;  1NCZ A;  2DOQ A;  2JPT A;  2BCB A;  4JPZ B;  2F2P A;  4GGN A;  1NCY A;  1UP5 A;  2CTN A;  1AHR A;  1EL4 A;  1QX2 A;  2KFG A;  4PE1 A;  1KSM A;  1NUB A;  1SCM C;  2LC5 A;  3EVV A;  3TS5 B;  5ER4 X;  4PE0 A;  1J7R A;  1PUL A;  3EVU A;  2OTG B;  4MSP A;  1BMO A;  1QX5 B;  1EXR A;  2FJU B;  1LA0 A;  2IS9 A;  1AUI B;  2V53 A;  1QTX A;  2CNP A;  2M7N A;  1Y0V H;  3BQ3 A;  3EVR A;  2WCB A;  4QJ4 B;  3KHE A;  2M97 A;  2WND A;  4YI9 A;  2JU0 A;  1RFJ A;  4ICB A;  1F71 A;  2LMV A;  1S6C A;  2M29 A;  4WQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...