5HYDA

Crystal structure of calcium-free human s100z
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
PTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-Z
publication title Solving the crystal structure of human calcium-free S100Z: the siege and conquer of one of the last S100 family strongholds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 37
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5hydA00
2L0PA 2BBMA 1XO5A 1S6JA 3MSEB 3C1VA 1SNLA 4YI9A 1PK0D 4MRYA 2Y1NA 2JNFA 1PSRA 2JU0A 1TNPA 2HF5A 2OS8C 3I5GB 5D7FA 4CFQA 1XFYO 2M49B 3O4YA 3WHTB 4N1GA 2KAYA 1ZFSA 1A75A 2LC5A 2AAOA 2MJWB 4NQGA 1ZUZA 1KK7Z 1M31A 2KOTA 3I5FC 1TRFA 1WDCC 2Y4QA 2WC8A 1IQ3A 1KFXS 1W7JB 1YRTB 1QV0A 2M8UA 3TDUA 4A4CA 1JSAA 2LANA 2F3YA 3D0YA 2KFHA 1L7ZA 2JT3A 2BECA 4R1EA 1K9PA 1XK4C 1G33A 4QJ5B 4MVFA 3EVUA 1KSMA 1IWQA 1OMRA 4MBEA 1M45A 5HLOA 3OP0A 4YGDB 2LMUA 4Q04A 1CM4A 3GK4X 2PMYA 4HSZA 1FPWA 2PALA 1LVCD 2M97A 3JVTC 1K9UA 3K21A 1BJFA 2BL0B 1QVIZ 3TS5C 1Q80A 1IJ6A 1SMGA 2HETA 4YGBB 1OE9B 1TOPA 1U5IA 1SK6D 1DGVA 2JC2A 3F45A 1K93D 1S6CA 1KK8B 2L2EA 5I2LA 3H4SE 3LLEA 5BPJA 1SL7A 1NCYA 4MRXA 1JBAA 1IJ5A 4C0KA 2LLUA 2EC6B 4OKHA 2Y1MA 2G2BA 2HPSA 1SY9A 2JTTA 3DVEA 5I8NA 2I2RE 4L9MA 1RK9A 2CNPA 3VRNA 1L2OB 4CLNA 3O2PA 1SCMC 1BODA 1KQMB 1CDMA 1K8UA 2KI6D 3PATA 1FF1A 1CLBA 2LVVA 2MLFC 3KO0A 2KGBC 1KFXL 1IGVA 1NX1A 3TUYB 1BR1B 2M9GA 2LMVA 1NSHA 2Y5IA 2Q4UA 4PHMA 1AHRA 1Y6WA 2G9BA 1MR8A 4GGNA 2H2KA 1QX5B 2K7CA 4FQOA 1SR6B 1AJ4A 2KHNA 1Y1XA 1G8IA 4MZJA 3I5IC 2PRUA 1DT7B 2JULA 3CS1A 1AJ5A 3CZTX 5DKNA 1J7RA 2MA2A 1LINA 2LUXA 2ZNDA 3CTNA 3GOFA 1DVIA 3KF9A 3BUWB 1UHIA 1IG5A 2E30A 2KFGA 2LHLA 2LM5A 1CDNA 1S5GY 2ZN9A 1FI5A 2M29A 3IQOA 3SG6A 4PALA 1DF0A 2LUCA 1UHNA 2O60A 4DUQA 4ORCB 4MZKA 3BXKA 4PE0A 5JJGA 1IH0A 1HT9A 1TCFA 4M2PA 2M1UA 2H61A 3LCPC 3RM1A 1PSBA 3WNXB 1QX7A 4F0ZB 1JF0A 1DJZA 5I2OA 1K9KA 1M46A 3I5HC 1BOCA 1CDPA 4MSPA 2BKHB 3EK8A 2LCPA 1MQ1A 1PALA 3O6BA 3EVVA 1SBJA 1B47A 1GJYA 1TNXA 2EGDA 3PN7B 5CSNA 2LP3A 4NDCA 2VRGA 3BUXB 4HREE 4CPVA 5KTYA 1DTLA 4CIDA 2NZ0A 1QLKA 1RJVA 2LLTA 1HQVA 1WRZA 4P5OE 3SJSA 3KEVA 2E6WA 1C07A 1CMFA 3OHMB 2GGZA 4HRGA 1BF5A 2K7BA 1EL4A 1FBVA 4AQIA 1CFPA 1NUBA 1UUSA 1EJ3A 2L51A 3EK7A 1CB1A 5CSIA 1SL8A 3GK2A 2OS8B 2LE9B 2JXLA 1Y1AA 3VRPA 4TNCA 2LVJA 2KAXA 3DVMA 1QXPA 3DVKA 3I5FB 4XJKB 4UPGA 1WDCB 1SCVA 1J7QA 1GGWA 2L50A 1CFFA 4A4BA 5HKYA 1B7TZ 3KHEA 1PVAA 2PVBA 1SPYA 3PSRA 1NP8A 1KWOC 2K7OA 3LL8B 2JRFA 3SG4A 1BG1A 2KFFA 3FIAA 3EKJA 1S36A 3AKBA 1QJTA 1J1DA 2L4HA 1A03A 5F6TA 5HLVA 5AANA 1J7OA 4CFRA 2KSPA 3SG3A 2O5GA 2WOSA 1K90D 1DGUA 1QLSA 2L4IA 3JVTB 2LHIA 1YRUB 3TS5B 1F54A 1PULA 2PASA 1Y1UA 3NXAA 3QRXA 1EG3A 3BOWB 1A2XA 1SKTA 2QPTA 1MWNA 1K2HA 2GV5A 4YI8A 4I5KA 3VROA 1F8HA 1PRWA 1OZOA 4U8DA 1JC2A 1DJYA 1UP5A 3BUOB 3DF0B 1BR4B 2JPTA 1F71A 3A4UB 1MXLC 2M0RA 2L5XB 2JZIA 2CT9A 3CGAA 1ZMZA 5HKWA 3D10A 4DCKA 2NXQA 2JT0A 4WQ3A 1X02A 1ZACA 2I94A 3SIBA 2TN4A 1SCMB 1OSAA 1QIWA 4ZCVA 1QTXA 4PHJA 4QJ4B 4GFTA 1YX8A 4BY5A 1S5GZ 4M2OA 1CDLA 1UHKA 1NYAA 2M3WA 3LK1A 1K96A 2KI4C 2M7LA 1JUOA 4JQ0D 3HX4A 1YUUA 1NX3A 1QX2A 3I5IB 1NX0A 4YGAA 1MUXA 1E8AA 2K2AA 1J55A 2AUCA 1YVHA 4OCIA 2WNDA 2P6BB 2ZN8A 2JT8A 2WCBA 1LXFC 2D8NA 2H61C 4ORBB 1XFZO 3VGOA 1CKKA 1JFJA 1SYMA 2IS9A 2LMTA 1ALVA 2DOQA 3JTDC 3SIAA 1N65A 1UHJA 3CR4X 3DD4A 3FWCA 2SASA 4PCWA 4MEWA 5ER4X 3AAJA 1F55A 2LAPA 5CSJA 4PHNA 4YGCB 4DS7A 2K0JA 5PALA 2I7AA 2JNXA 1IRJA 3EKHA 2BCAA 4I5NB 1IKUA 1AP4A 2BE4A 3NSOA 2ZRTA 1N2DA 1TNQA 2KBIA 4HRHA 4IL1A 1R2UA 4NDBA 1J7PA 1ODBA 4D1EA 1QV1A 2CCMA 2CBLA 5CSFA 1CFDA 3I5HB 2MRDA 2SCPA 3OX6A 5KU1A 2M7NA 1F4OA 1NCZA 1XFXO 2FCEA 1B1GA 2HQWA 3LK0A 1JF2A 1FI6A 1S3PA 1YX7A 2MBXA 2KQ6A 4YGEB 4PE1A 1CM1A 5TNCA 2ISDA 1JFKA 2KDHA 1QATA 4JWQA 1M39A 2F3ZA 1F4QA 1NIWA 1DMOA 1BT6A 2RGIA 3CLNA 2HQ8A 1J1EA 3PFVA 1XFWO 5DKRA 4OR9B 3AKAA 1A75B 2KAVA 1CLLA 2OPOA 3VRQA 2V53A 4GGFA 1BMOA 3SG7A 1V1FA 2NLNA 1TCOB 5I2QA 1OMVA 3M0WA 1AUIB 3D0YB 2FJUB 1DJXA 1YUSA 3BUMB 4C0JA 2K61A 4PHKA 1B8CA 1YR5A 2R2IA 1BLQA 1N0YA 4GPLB 2F2PA 1MXEA 2FOTA 1CNPA 1WRKA 3ICBA 3RLZA 2F8PA 4PE7A 5ER5A 1R6PA 4P2YB 4WRIA 3A8RA 3SG5A 2JOJA 5JOLA 1NPQA 1XVJA 2WCFA 1KWOB 4GBAA 3IQQA 2KNEA 1RWYA 3KPXA 2NCPA 1H4BA 2WCEA 2ZRSA 4XYNA 3FWBA 1IQ5A 2BCBA 1ALWA 1SRAA 3HCMA 2OTGC 2I18A 3IF7A 3OX5A 2LV7A 4ICBA 2BCXA 1B8RA 1BU3A 4YRUA 3TDZA 1QASA 3BUNB 2M1KB 3BYAA 1B8LA 4AOMA 2LVKA 1S26D 1CLMA 2KQYA 2LVIA 5J3XA 2FCDA 4BY4A 3GK1A 2ZFDA 2KI6C 1OMDA 3I5GC 1WLZA 2WORA 2A4JA 1RTP1 1S6IA 5AEQA 1A4PA 1TIZA 4MLWA 3BQ3A 2JTZA 2BE6A 1QIVA 1CMGA 4C0LA 1S1EA 2MHHA 4PDZA 4ORAB 1RECA 2F33A 2JWWA 4NDDA 4N5XA 5G08A 1V1GA 1A29A 3AAKA 2QACA 4N1FA 2K7DA 1NX2A 2KYCA 3WXAA 2KGRA 2LLSA 4GNKB 4MZLA 4DRWA 2KI4B 1B7TY 4XJKA 1KSOA 5GQQC 1DF0B 1KK7Y 4PE4A 3TZ1A 4AQJA 4JPZB 1OZSA 3SG2A 5AERA 2BL0C 1WRLA 2CXJA 4I5LB 1ZOTB 1KCYA 1OOJA 5CPVA 1RFJA 1XK4A 2GGMA 3OB2B 1B4CA 3JTDB 1DJGA 4I5JA 2CTNA 2K2FA 1DJHA 1M63B 1K94A 1LA0A 1D1OA 1AK8A 1YTZC 2NCOA 1KK8C 1B9AA 1UWOA 1C7WA 2BKIB 2LP2A 1KFUS 1AVSA 3NSIA 5AXIA 3TDIA 5AFPA 4FTGA 1LA3A 3BOWA 1QVIY 2EC6C 2AMIA 3PLFB 3E3RA 4M2QA 2ZKMX 3OB1B 1WLMA 2COLB 5DKQA 1L2OC 1SL9A 1TN4A 3PALA 1DJIA 1KQMC 3WHUB 5B8IB 2MAZA 1C7VA 4GGFC 3TUYC 3FS7A 2Q91A 3DF0A 4GAOA 4OVNF 1RROA 2KBMA 1WY9A 1SR6C 3ZWHA 4USLA 5FYXA 3NSLA 4MN0A 1LKJA 1UURA 5IBWA 1GQMA 1EH2A 3O78A 2PSRA 2EHBA 2BBNA 1Y0VH 4GUKA 4YBHB 2JXCA 3EVRA 5K89A 1YUTA 3DVJA 3NSKA 1XFUO 4DIRA 3VRRA 4ZCUA 1YURA 1OQPA 3ZNIA 2ZNEA 1JWDA 2KYFA 5HKZA 1DJWA 1TTXA 5HYDA 1F70A 2B1UA 1KQVA 3PM8A 2K8MB 1CFCA 1QS7A 3EK4A 4E68A 1KFUL 1MF8B 1K95A 3CWGA 4WQ2A 1XFVO 1NWDA 1UHHA 3CR5X 1PVBA 4OV2A 2JQ6A 1GGZA 4QJ3B 1CTRA 1TNWA 1H8BA 2MLEC 2OTGB 1G4YR 3PN7C 4ETOA 1MHOA 1YVLA 1EXRA 1VRKA 2F2OA 1SW8A 1XYDA 2LNKA 1U5IB 1XA5A 5KSZA 1FW4A 1EG4A 3CR2A 5D69A 1NCXA 2L98A 1W7IB
chains in the Genus database with same CATH superfamily
2L0PA 2BBMA 1XO5A 1S6JA 3MSEB 3C1VA 1SNLA 4YI9A 2WCHA 3BFBA 1PK0D 4MRYA 2Y1NA 2JNFA 1PSRA 2JU0A 1TNPA 2HF5A 2OS8C 3I5GB 1Z2CB 5D7FA 1XFYO 2M49B 3S0FA 3O4YA 3WHTB 4N1GA 2KAYA 1ZFSA 3R1OA 1A75A 2LC5A 2AAOA 2MJWB 4NQGA 1ZUZA 1KK7Z 1M31A 2KOTA 3I5FC 1TRFA 1WDCC 4F7FA 2Y4QA 2WC8A 1IQ3A 1KFXS 1W7JB 1YRTB 1QV0A 2M8UA 3TDUA 4A4CA 1JSAA 5D3OA 5EL2A 2LANA 2F3YA 3D0YA 2KFHA 1L7ZA 2JT3A 2BECA 4R1EA 1K9PA 1XK4C 1G33A 4QJ5B 4MVFA 3CZ1A 3EVUA 1KSMA 1IWQA 1OMRA 4MBEA 1M45A 5HLOA 3OP0A 4YGDB 2L5YA 2LMUA 4Q04A 1CM4A 3GK4X 2PMYA 4HSZA 1FPWA 2PALA 1LVCD 2M97A 3JVTC 1K9UA 3K21A 1BJFA 2BL0B 1QVIZ 2ERBA 3D76A 4FQTA 3TS5C 1Q80A 1IJ6A 1SMGA 2HETA 4YGBB 1OE9B 1TOPA 1U5IA 1SK6D 1DGVA 2JC2A 3F45A 1K93D 2YGUA 1S6CA 1KK8B 2L2EA 5I2LA 3S0DA 4INXA 3H4SE 3LLEA 5BPJA 1SL7A 1NCYA 4MRXA 1JBAA 4PT1A 1IJ5A 4C0KA 2JPOA 2LLUA 3BFHA 2GTEA 3DY9A 2EC6B 4OKHA 2Y1MA 2G2BA 2HPSA 1SY9A 2JTTA 3DVEA 5I8NA 2I2RE 4L9MA 1RK9A 2CNPA 3VRNA 1C3ZA 1L2OB 4CLNA 3O2PA 1SCMC 1BODA 1KQMB 1CDMA 1K8UA 2KI6D 3PATA 1FF1A 3D73A 3SS3A 1CLBA 2LVVA 2MLFC 3KO0A 2KGBC 1KFXL 1IGVA 1NX1A 3TUYB 1BR1B 2M9GA 2LMVA 1NSHA 2Y5IA 2Q4UA 4IJ7A 4PHMA 1AHRA 1Y6WA 2G9BA 1MR8A 3CZ2A 2H2KA 1QX5B 2K7CA 4GGNA 4FQOA 1SR6B 1AJ4A 2KHNA 1Y1XA 3FE8A 1G8IA 4MZJA 3I5IC 5HL1A 4OZDA 2PRUA 1DT7B 2JULA 3CS1A 1AJ5A 3CZTX 5DKNA 2FJYA 1J7RA 2MA2A 3DZTA 1LINA 2LUXA 2ZNDA 2KLDA 3CTNA 3GOFA 1DVIA 3KF9A 3BUWB 1UHIA 1IG5A 2E30A 2KFGA 2LHLA 2LM5A 1CDNA 1S5GY 2ZN9A 1FI5A 2M29A 3L4LA 3IQOA 3SG6A 4PALA 1DF0A 2LUCA 1UHNA 2O60A 4DUQA 4ORCB 4MZKA 3BXKA 4PE0A 4JKTA 3DXLA 5JJGA 1HT9A 1TCFA 2K60A 4M2PA 2M1UA 1IH0A 2H61A 3LCPC 3RM1A 1PSBA 3WNXB 1QX7A 4F0ZB 1JF0A 1DJZA 5I2OA 1K9KA 1M46A 3I5HC 1BOCA 1CDPA 4MSPA 2BKHB 3EK8A 2KLEA 2LCPA 1MQ1A 1PALA 3O6BA 3EVVA 1SBJA 1B47A 3PM2A 1GJYA 1TNXA 2EGDA 3FE9A 3PN7B 3S0AA 5CSNA 5I94A 2LP3A 4NDCA 2VRGA 3BUXB 3N7HA 4HREE 4CPVA 2PYQA 5KTYA 1DTLA 4CIDA 2NZ0A 1QLKA 1RJVA 2LLTA 1HQVA 1WRZA 4P5OE 3SJSA 1DEKA 2E6WA 3D75A 3KEVA 1C07A 1CMFA 3OHMB 2GGZA 3V2LA 4HRGA 1BF5A 2K7BA 1EL4A 1FBVA 4AQIA 1CFPA 1NUBA 1UUSA 1EJ3A 1XFRA 2L51A 3EK7A 1CB1A 1OOIX 1QWVA 2WC6A 5CSIA 1SL8A 3GK2A 2OS8B 2LE9B 2JXLA 1Y1AA 3VRPA 4TNCA 2LVJA 2KAXA 3DVMA 1QXPA 3DVKA 3I5FB 4XJKB 4UPGA 1WDCB 1SCVA 2L2CA 1J7QA 1GGWA 2L50A 1CFFA 4A4BA 5HKYA 1B7TZ 3KHEA 1PVAA 2PVBA 1SPYA 3PSRA 3L47A 1NP8A 1KWOC 2K7OA 3LL8B 2JRFA 2KPHA 3SG4A 1BG1A 2KFFA 3FIAA 3EKJA 1S36A 3AKBA 1QJTA 1J1DA 2L4HA 1A03A 5F6TA 5HLVA 5AANA 1J7OA 4CFRA 2KSPA 3SG3A 2O5GA 2P71A 2WOSA 1K90D 1DGUA 1QLSA 1OOFA 2L4IA 3JVTB 2LHIA 1DC1A 1YRUB 3TS5B 1F54A 1PULA 2PASA 1Y1UA 3BJHA 3NXAA 3QRXA 1EG3A 3BOWB 1A2XA 1SKTA 4JD9A 2QPTA 1MWNA 1K2HA 2GV5A 4YI8A 4I5KA 3VROA 1F8HA 2QDIA 1PRWA 2QEVA 3NHTA 1OZOA 4U8DA 1JC2A 1DJYA 1UP5A 3BUOB 3B86A 3DF0B 1BR4B 2JPTA 1F71A 3A4UB 1MXLC 2M0RA 2L5XB 2JZIA 2CT9A 3CGAA 1ZMZA 5HKWA 3D10A 4DCKA 2NXQA 2JT0A 4WQ3A 1X02A 1ZACA 2I94A 3SIBA 2TN4A 1SCMB 1OSAA 1QIWA 3NHIA 4ZCVA 1QTXA 3NGVA 4PHJA 4QJ4B 4GFTA 1YX8A 4BY5A 1S5GZ 4M2OA 1CDLA 1UHKA 1NYAA 2M3WA 3LK1A 1K96A 2PQLA 2KI4C 2M7LA 1JUOA 4JQ0D 3HX4A 2WCKA 3SS5A 1YUUA 1NX3A 1QX2A 3I5IB 1NX0A 1TWOA 3R1PA 1MUXA 4YGAA 1E8AA 2K2AA 1J55A 2AUCA 1YVHA 4OCIA 2WNDA 2P6BB 2ZN8A 2JT8A 2WCBA 1LXFC 2D8NA 2H61C 4ORBB 1XFZO 3VGOA 1CKKA 1JFJA 1SYMA 2IS9A 2LMTA 3UO9A 1ALVA 2DOQA 3JTDC 3SIAA 1N65A 1UHJA 3BFAA 3CR4X 3DD4A 2SASA 3EG5B 3FWCA 4MEWA 4PCWA 5ER4X 3AAJA 1F55A 2LAPA 5CSJA 4PHNA 4YGCB 4DS7A 2K0JA 5PALA 3RZSA 2I7AA 2JNXA 1IRJA 3EKHA 2BCAA 4I5NB 1IKUA 1AP4A 2BE4A 3NSOA 2ZRTA 1N2DA 1TNQA 2KBIA 4HRHA 3DYEA 1R2UA 4IL1A 4NDBA 1J7PA 1ODBA 4D1EA 1QV1A 3OGNA 3B7AA 2CCMA 2CBLA 4INWA 5CSFA 1CFDA 3I5HB 2MRDA 2SCPA 3OX6A 5KU1A 2M7NA 1F4OA 1NCZA 1XFXO 2FCEA 1B1GA 2HQWA 1TUJA 3LK0A 1JF2A 1FI6A 1LS8A 1S3PA 1YX7A 2MBXA 3K1EA 2KQ6A 4YGEB 4PE1A 1CM1A 5TNCA 2WCLA 2ISDA 1DQEA 1JFKA 2KDHA 1OOGA 1QATA 4JWQA 1M39A 2F3ZA 1F4QA 1NIWA 1DMOA 1BT6A 2RGIA 3CLNA 2HQ8A 1J1EA 3PFVA 1XFWO 5DKRA 4OR9B 3AKAA 1A75B 2KAVA 1CLLA 2OPOA 3VRQA 2V53A 4GGFA 1BMOA 3SG7A 1V1FA 2NLNA 1TCOB 5I2QA 1OMVA 3CDNA 3M0WA 1AUIB 1W9ZA 3D0YB 2FJUB 1DJXA 1YUSA 3BUMB 1GM0A 4C0JA 2K61A 3R1VA 4PHKA 1B8CA 1YR5A 2R2IA 1BLQA 1N0YA 2WCJA 2F2PA 1MXEA 2FOTA 4GPLB 1CNPA 1WRKA 3ICBA 3RLZA 2F8PA 4PE7A 3B6XA 1R6PA 4P2YB 5ER5A 4WRIA 3A8RA 3SG5A 2JOJA 5JOLA 1NPQA 1XVJA 2WCFA 1KWOB 4GBAA 3IQQA 2KNEA 1RWYA 3KPXA 2NCPA 1H4BA 2WCEA 2ZRSA 4XYNA 3FWBA 1IQ5A 2BCBA 1ALWA 1SRAA 3HCMA 2OTGC 3PJIA 2I18A 3IF7A 3OX5A 2LV7A 4ICBA 2BCXA 1B8RA 1BU3A 4YRUA 3TDZA 1QASA 3BUNB 3CABA 2M1KB 4KYNA 3BYAA 1B8LA 4AOMA 2LVKA 1S26D 1CLMA 2KQYA 2LVIA 5J3XA 2FCDA 4BY4A 3GK1A 3D78A 2ZFDA 2KI6C 1OMDA 5FI7A 3I5GC 3OBVA 1WLZA 2WORA 1RTP1 2A4JA 1S6IA 3S0GA 5AEQA 1A4PA 1TIZA 4MLWA 3BQ3A 2JTZA 2BE6A 1QIVA 1CMGA 4C0LA 1S1EA 2MHHA 4PDZA 4ORAB 1RECA 2F33A 2JWWA 4NDDA 4N5XA 5G08A 1V1GA 1A29A 3AAKA 2QACA 4N1FA 2K7DA 3UNWA 1NX2A 2KYCA 3WXAA 3R72A 2KGRA 2LLSA 4GNKB 4MZLA 4DRWA 2KI4B 1C3YA 1B7TY 4XJKA 1KSOA 5GQQC 3S0EA 1DF0B 1KK7Y 4PE4A 3D74A 3O4XA 3TZ1A 4AQJA 4JPZB 1OZSA 3SG2A 5AERA 2BL0C 2QEHA 1WRLA 2CXJA 4I5LB 1TUZA 1ZOTB 1OOJA 5CPVA 1RFJA 1XK4A 2GGMA 3OB2B 1B4CA 1KCYA 3JTDB 1DJGA 4I5JA 2CTNA 3SS4A 2K2FA 1DJHA 1SSEB 1M63B 1K94A 1LA0A 3QMEA 1D1OA 1IIOA 1AK8A 1YTZC 2QEOA 2NCOA 1KK8C 1B9AA 1UWOA 1C7WA 2BKIB 2LP2A 1KFUS 1AVSA 3NSIA 5AXIA 3TDIA 5AFPA 4FTGA 1LA3A 1OW4A 1QVIY 2EC6C 2WCMA 3BOWA 3VB1A 3CYZA 1DELA 2AMIA 3E3RA 3PLFB 4M2QA 2ZKMX 3OB1B 1WLMA 2BAPA 1T14A 2COLB 5DKQA 5FI2A 5DICA 1L2OC 3B88A 1SL9A 1TN4A 3PALA 1DJIA 1KQMC 3WHUB 5B8IB 2MAZA 1C7VA 4GGFC 3TUYC 3FS7A 2Q91A 3DF0A 4GAOA 4OVNF 5FI6A 1RROA 2KBMA 1WY9A 1SR6C 2P70A 3ZWHA 4USLA 5FYXA 3NSLA 4MN0A 1LKJA 1UURA 2BNXA 1GQMA 5IBWA 3O78A 2PSRA 2EHBA 1EH2A 2BBNA 1Y0VH 4GUKA 4YBHB 2JXCA 3EVRA 5K89A 1YUTA 3DVJA 3NSKA 1XFUO 1P28A 4DIRA 3VRRA 4ZCUA 1YURA 1OQPA 3ZNIA 2ZNEA 1JWDA 2WC5A 2KYFA 5HKZA 1DJWA 1TTXA 3D77A 5HYDA 1F70A 2B1UA 3IVTA 1KQVA 1Z4HA 3PM8A 2K8MB 1CFCA 1QS7A 3EK4A 4E68A 1KFUL 1MF8B 1K95A 3CWGA 4WQ2A 1XFVO 3FE6A 1NWDA 1UHHA 3L4AA 3CR5X 1PVBA 4OV2A 1ORGA 2JQ6A 1GGZA 4CFQA 4QJ3B 1CTRA 2H8VA 1TNWA 1H8BA 2MLEC 2OTGB 1G4YR 3PN7C 3Q8IA 3S0BA 4ETOA 1YVLA 1MHOA 3CZ0A 1EXRA 1OOHA 1VRKA 2F2OA 1SW8A 1XYDA 3B87A 2LNKA 1U5IB 1XA5A 5KSZA 1FW4A 1EG4A 3CR2A 5D69A 1NCXA 2QEBA 2L98A 1W7IB
chains in the Genus database with same CATH topology
2L0PA 2BBMA 1XO5A 1S6JA 3MSEB 3C1VA 1SNLA 4YI9A 1PK0D 4MRYA 2Y1NA 2JNFA 1PSRA 2JU0A 1TNPA 2HF5A 2OS8C 3I5GB 5D7FA 4CFQA 1XFYO 2M49B 3O4YA 3WHTB 4N1GA 2KAYA 1ZFSA 1A75A 2LC5A 2AAOA 2MJWB 4NQGA 1ZUZA 1KK7Z 1M31A 2KOTA 3I5FC 1TRFA 1WDCC 2Y4QA 2WC8A 1IQ3A 1KFXS 1W7JB 1YRTB 1QV0A 2M8UA 3TDUA 4A4CA 1JSAA 2LANA 2F3YA 3D0YA 2KFHA 1L7ZA 2JT3A 2BECA 4R1EA 1K9PA 1XK4C 1G33A 4QJ5B 4MVFA 3EVUA 1KSMA 1IWQA 1OMRA 4MBEA 1M45A 5HLOA 3OP0A 4YGDB 2LMUA 4Q04A 1CM4A 3GK4X 2PMYA 4HSZA 1FPWA 2PALA 1LVCD 2M97A 3JVTC 1K9UA 3K21A 1BJFA 2BL0B 1QVIZ 3TS5C 1Q80A 1IJ6A 1SMGA 2HETA 4YGBB 1OE9B 1TOPA 1U5IA 1SK6D 1DGVA 2JC2A 3F45A 1K93D 1S6CA 1KK8B 2L2EA 5I2LA 3H4SE 3LLEA 5BPJA 1SL7A 1NCYA 4MRXA 1JBAA 1IJ5A 4C0KA 2LLUA 2EC6B 4OKHA 2Y1MA 2G2BA 2HPSA 1SY9A 2JTTA 3DVEA 5I8NA 2I2RE 4L9MA 1RK9A 2CNPA 3VRNA 1L2OB 4CLNA 3O2PA 1SCMC 1BODA 1KQMB 1CDMA 1K8UA 2KI6D 3PATA 1FF1A 1CLBA 2LVVA 2MLFC 3KO0A 2KGBC 1KFXL 1IGVA 1NX1A 3TUYB 1BR1B 2M9GA 2LMVA 1NSHA 2Y5IA 2Q4UA 4PHMA 1AHRA 1Y6WA 2G9BA 1MR8A 4GGNA 2H2KA 1QX5B 2K7CA 4FQOA 1SR6B 1AJ4A 2KHNA 1Y1XA 1G8IA 4MZJA 3I5IC 2PRUA 1DT7B 2JULA 3CS1A 1AJ5A 3CZTX 5DKNA 1J7RA 2MA2A 1LINA 2LUXA 2ZNDA 3CTNA 3GOFA 1DVIA 3KF9A 3BUWB 1UHIA 1IG5A 2E30A 2KFGA 2LHLA 2LM5A 1CDNA 1S5GY 2ZN9A 1FI5A 2M29A 3IQOA 3SG6A 4PALA 1DF0A 2LUCA 1UHNA 2O60A 4DUQA 4ORCB 4MZKA 3BXKA 4PE0A 5JJGA 1IH0A 1HT9A 1TCFA 4M2PA 2M1UA 2H61A 3LCPC 3RM1A 1PSBA 3WNXB 1QX7A 4F0ZB 1JF0A 1DJZA 5I2OA 1K9KA 1M46A 3I5HC 1BOCA 1CDPA 4MSPA 2BKHB 3EK8A 2LCPA 1MQ1A 1PALA 3O6BA 3EVVA 1SBJA 1B47A 1GJYA 1TNXA 2EGDA 3PN7B 5CSNA 2LP3A 4NDCA 2VRGA 3BUXB 4HREE 4CPVA 5KTYA 1DTLA 4CIDA 2NZ0A 1QLKA 1RJVA 2LLTA 1HQVA 1WRZA 4P5OE 3SJSA 3KEVA 2E6WA 1C07A 1CMFA 3OHMB 2GGZA 4HRGA 1BF5A 2K7BA 1EL4A 1FBVA 4AQIA 1CFPA 1NUBA 1UUSA 1EJ3A 2L51A 3EK7A 1CB1A 5CSIA 1SL8A 3GK2A 2OS8B 2LE9B 2JXLA 1Y1AA 3VRPA 4TNCA 2LVJA 2KAXA 3DVMA 1QXPA 3DVKA 3I5FB 4XJKB 4UPGA 1WDCB 1SCVA 1J7QA 1GGWA 2L50A 1CFFA 4A4BA 5HKYA 1B7TZ 3KHEA 1PVAA 2PVBA 1SPYA 3PSRA 1NP8A 1KWOC 2K7OA 3LL8B 2JRFA 3SG4A 1BG1A 2KFFA 3FIAA 3EKJA 1S36A 3AKBA 1QJTA 1J1DA 2L4HA 1A03A 5F6TA 5HLVA 5AANA 1J7OA 4CFRA 2KSPA 3SG3A 2O5GA 2WOSA 1K90D 1DGUA 1QLSA 2L4IA 3JVTB 2LHIA 1YRUB 3TS5B 1F54A 1PULA 2PASA 1Y1UA 3NXAA 3QRXA 1EG3A 3BOWB 1A2XA 1SKTA 2QPTA 1MWNA 1K2HA 2GV5A 4YI8A 4I5KA 3VROA 1F8HA 1PRWA 1OZOA 4U8DA 1JC2A 1DJYA 1UP5A 3BUOB 3DF0B 1BR4B 2JPTA 1F71A 3A4UB 1MXLC 2M0RA 2L5XB 2JZIA 2CT9A 3CGAA 1ZMZA 5HKWA 3D10A 4DCKA 2NXQA 2JT0A 4WQ3A 1X02A 1ZACA 2I94A 3SIBA 2TN4A 1SCMB 1OSAA 1QIWA 4ZCVA 1QTXA 4PHJA 4QJ4B 4GFTA 1YX8A 4BY5A 1S5GZ 4M2OA 1CDLA 1UHKA 1NYAA 2M3WA 3LK1A 1K96A 2KI4C 2M7LA 1JUOA 4JQ0D 3HX4A 1YUUA 1NX3A 1QX2A 3I5IB 1NX0A 4YGAA 1MUXA 1E8AA 2K2AA 1J55A 2AUCA 1YVHA 4OCIA 2WNDA 2P6BB 2ZN8A 2JT8A 2WCBA 1LXFC 2D8NA 2H61C 4ORBB 1XFZO 3VGOA 1CKKA 1JFJA 1SYMA 2IS9A 2LMTA 1ALVA 2DOQA 3JTDC 3SIAA 1N65A 1UHJA 3CR4X 3DD4A 3FWCA 2SASA 4PCWA 4MEWA 5ER4X 3AAJA 1F55A 2LAPA 5CSJA 4PHNA 4YGCB 4DS7A 2K0JA 5PALA 2I7AA 2JNXA 1IRJA 3EKHA 2BCAA 4I5NB 1IKUA 1AP4A 2BE4A 3NSOA 2ZRTA 1N2DA 1TNQA 2KBIA 4HRHA 4IL1A 1R2UA 4NDBA 1J7PA 1ODBA 4D1EA 1QV1A 2CCMA 2CBLA 5CSFA 1CFDA 3I5HB 2MRDA 2SCPA 3OX6A 5KU1A 2M7NA 1F4OA 1NCZA 1XFXO 2FCEA 1B1GA 2HQWA 3LK0A 1JF2A 1FI6A 1S3PA 1YX7A 2MBXA 2KQ6A 4YGEB 4PE1A 1CM1A 5TNCA 2ISDA 1JFKA 2KDHA 1QATA 4JWQA 1M39A 2F3ZA 1F4QA 1NIWA 1DMOA 1BT6A 2RGIA 3CLNA 2HQ8A 1J1EA 3PFVA 1XFWO 5DKRA 4OR9B 3AKAA 1A75B 2KAVA 1CLLA 2OPOA 3VRQA 2V53A 4GGFA 1BMOA 3SG7A 1V1FA 2NLNA 1TCOB 5I2QA 1OMVA 3M0WA 1AUIB 3D0YB 2FJUB 1DJXA 1YUSA 3BUMB 4C0JA 2K61A 4PHKA 1B8CA 1YR5A 2R2IA 1BLQA 1N0YA 4GPLB 2F2PA 1MXEA 2FOTA 1CNPA 1WRKA 3ICBA 3RLZA 2F8PA 4PE7A 5ER5A 1R6PA 4P2YB 4WRIA 3A8RA 3SG5A 2JOJA 5JOLA 1NPQA 1XVJA 2WCFA 1KWOB 4GBAA 3IQQA 2KNEA 1RWYA 3KPXA 2NCPA 1H4BA 2WCEA 2ZRSA 4XYNA 3FWBA 1IQ5A 2BCBA 1ALWA 1SRAA 3HCMA 2OTGC 2I18A 3IF7A 3OX5A 2LV7A 4ICBA 2BCXA 1B8RA 1BU3A 4YRUA 3TDZA 1QASA 3BUNB 2M1KB 3BYAA 1B8LA 4AOMA 2LVKA 1S26D 1CLMA 2KQYA 2LVIA 5J3XA 2FCDA 4BY4A 3GK1A 2ZFDA 2KI6C 1OMDA 3I5GC 1WLZA 2WORA 2A4JA 1RTP1 1S6IA 5AEQA 1A4PA 1TIZA 4MLWA 3BQ3A 2JTZA 2BE6A 1QIVA 1CMGA 4C0LA 1S1EA 2MHHA 4PDZA 4ORAB 1RECA 2F33A 2JWWA 4NDDA 4N5XA 5G08A 1V1GA 1A29A 3AAKA 2QACA 4N1FA 2K7DA 1NX2A 2KYCA 3WXAA 2KGRA 2LLSA 4GNKB 4MZLA 4DRWA 2KI4B 1B7TY 4XJKA 1KSOA 5GQQC 1DF0B 1KK7Y 4PE4A 3TZ1A 4AQJA 4JPZB 1OZSA 3SG2A 5AERA 2BL0C 1WRLA 2CXJA 4I5LB 1ZOTB 1KCYA 1OOJA 5CPVA 1RFJA 1XK4A 2GGMA 3OB2B 1B4CA 3JTDB 1DJGA 4I5JA 2CTNA 2K2FA 1DJHA 1M63B 1K94A 1LA0A 1D1OA 1AK8A 1YTZC 2NCOA 1KK8C 1B9AA 1UWOA 1C7WA 2BKIB 2LP2A 1KFUS 1AVSA 3NSIA 5AXIA 3TDIA 5AFPA 4FTGA 1LA3A 3BOWA 1QVIY 2EC6C 2AMIA 3PLFB 3E3RA 4M2QA 2ZKMX 3OB1B 1WLMA 2COLB 5DKQA 1L2OC 1SL9A 1TN4A 3PALA 1DJIA 1KQMC 3WHUB 5B8IB 2MAZA 1C7VA 4GGFC 3TUYC 3FS7A 2Q91A 3DF0A 4GAOA 4OVNF 1RROA 2KBMA 1WY9A 1SR6C 3ZWHA 4USLA 5FYXA 3NSLA 4MN0A 1LKJA 1UURA 5IBWA 1GQMA 1EH2A 3O78A 2PSRA 2EHBA 2BBNA 1Y0VH 4GUKA 4YBHB 2JXCA 3EVRA 5K89A 1YUTA 3DVJA 3NSKA 1XFUO 4DIRA 3VRRA 4ZCUA 1YURA 1OQPA 3ZNIA 2ZNEA 1JWDA 2KYFA 5HKZA 1DJWA 1TTXA 5HYDA 1F70A 2B1UA 1KQVA 3PM8A 2K8MB 1CFCA 1QS7A 3EK4A 4E68A 1KFUL 1MF8B 1K95A 3CWGA 4WQ2A 1XFVO 1NWDA 1UHHA 3CR5X 1PVBA 4OV2A 2JQ6A 1GGZA 4QJ3B 1CTRA 1TNWA 1H8BA 2MLEC 2OTGB 1G4YR 3PN7C 4ETOA 1MHOA 1YVLA 1EXRA 1VRKA 2F2OA 1SW8A 1XYDA 2LNKA 1U5IB 1XA5A 5KSZA 1FW4A 1EG4A 3CR2A 5D69A 1NCXA 2L98A 1W7IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0P A;  2BBM A;  1XO5 A;  1S6J A;  3MSE B;  3C1V A;  1SNL A;  4YI9 A;  1PK0 D;  4MRY A;  2Y1N A;  2JNF A;  1PSR A;  2JU0 A;  1TNP A;  2HF5 A;  2OS8 C;  3I5G B;  5D7F A;  4CFQ A;  1XFY O;  2M49 B;  3O4Y A;  3WHT B;  4N1G A;  2KAY A;  1ZFS A;  1A75 A;  2LC5 A;  2AAO A;  2MJW B;  4NQG A;  1ZUZ A;  1KK7 Z;  1M31 A;  2KOT A;  3I5F C;  1TRF A;  1WDC C;  2Y4Q A;  2WC8 A;  1IQ3 A;  1KFX S;  1W7J B;  1YRT B;  1QV0 A;  2M8U A;  3TDU A;  4A4C A;  1JSA A;  2LAN A;  2F3Y A;  3D0Y A;  2KFH A;  1L7Z A;  2JT3 A;  2BEC A;  4R1E A;  1K9P A;  1XK4 C;  1G33 A;  4QJ5 B;  4MVF A;  3EVU A;  1KSM A;  1IWQ A;  1OMR A;  4MBE A;  1M45 A;  5HLO A;  3OP0 A;  4YGD B;  2LMU A;  4Q04 A;  1CM4 A;  3GK4 X;  2PMY A;  4HSZ A;  1FPW A;  2PAL A;  1LVC D;  2M97 A;  3JVT C;  1K9U A;  3K21 A;  1BJF A;  2BL0 B;  1QVI Z;  3TS5 C;  1Q80 A;  1IJ6 A;  1SMG A;  2HET A;  4YGB B;  1OE9 B;  1TOP A;  1U5I A;  1SK6 D;  1DGV A;  2JC2 A;  3F45 A;  1K93 D;  1S6C A;  1KK8 B;  2L2E A;  5I2L A;  3H4S E;  3LLE A;  5BPJ A;  1SL7 A;  1NCY A;  4MRX A;  1JBA A;  1IJ5 A;  4C0K A;  2LLU A;  2EC6 B;  4OKH A;  2Y1M A;  2G2B A;  2HPS A;  1SY9 A;  2JTT A;  3DVE A;  5I8N A;  2I2R E;  4L9M A;  1RK9 A;  2CNP A;  3VRN A;  1L2O B;  4CLN A;  3O2P A;  1SCM C;  1BOD A;  1KQM B;  1CDM A;  1K8U A;  2KI6 D;  3PAT A;  1FF1 A;  1CLB A;  2LVV A;  2MLF C;  3KO0 A;  2KGB C;  1KFX L;  1IGV A;  1NX1 A;  3TUY B;  1BR1 B;  2M9G A;  2LMV A;  1NSH A;  2Y5I A;  2Q4U A;  4PHM A;  1AHR A;  1Y6W A;  2G9B A;  1MR8 A;  4GGN A;  2H2K A;  1QX5 B;  2K7C A;  4FQO A;  1SR6 B;  1AJ4 A;  2KHN A;  1Y1X A;  1G8I A;  4MZJ A;  3I5I C;  2PRU A;  1DT7 B;  2JUL A;  3CS1 A;  1AJ5 A;  3CZT X;  5DKN A;  1J7R A;  2MA2 A;  1LIN A;  2LUX A;  2ZND A;  3CTN A;  3GOF A;  1DVI A;  3KF9 A;  3BUW B;  1UHI A;  1IG5 A;  2E30 A;  2KFG A;  2LHL A;  2LM5 A;  1CDN A;  1S5G Y;  2ZN9 A;  1FI5 A;  2M29 A;  3IQO A;  3SG6 A;  4PAL A;  1DF0 A;  2LUC A;  1UHN A;  2O60 A;  4DUQ A;  4ORC B;  4MZK A;  3BXK A;  4PE0 A;  5JJG A;  1IH0 A;  1HT9 A;  1TCF A;  4M2P A;  2M1U A;  2H61 A;  3LCP C;  3RM1 A;  1PSB A;  3WNX B;  1QX7 A;  4F0Z B;  1JF0 A;  1DJZ A;  5I2O A;  1K9K A;  1M46 A;  3I5H C;  1BOC A;  1CDP A;  4MSP A;  2BKH B;  3EK8 A;  2LCP A;  1MQ1 A;  1PAL A;  3O6B A;  3EVV A;  1SBJ A;  1B47 A;  1GJY A;  1TNX A;  2EGD A;  3PN7 B;  5CSN A;  2LP3 A;  4NDC A;  2VRG A;  3BUX B;  4HRE E;  4CPV A;  5KTY A;  1DTL A;  4CID A;  2NZ0 A;  1QLK A;  1RJV A;  2LLT A;  1HQV A;  1WRZ A;  4P5O E;  3SJS A;  3KEV A;  2E6W A;  1C07 A;  1CMF A;  3OHM B;  2GGZ A;  4HRG A;  1BF5 A;  2K7B A;  1EL4 A;  1FBV A;  4AQI A;  1CFP A;  1NUB A;  1UUS A;  1EJ3 A;  2L51 A;  3EK7 A;  1CB1 A;  5CSI A;  1SL8 A;  3GK2 A;  2OS8 B;  2LE9 B;  2JXL A;  1Y1A A;  3VRP A;  4TNC A;  2LVJ A;  2KAX A;  3DVM A;  1QXP A;  3DVK A;  3I5F B;  4XJK B;  4UPG A;  1WDC B;  1SCV A;  1J7Q A;  1GGW A;  2L50 A;  1CFF A;  4A4B A;  5HKY A;  1B7T Z;  3KHE A;  1PVA A;  2PVB A;  1SPY A;  3PSR A;  1NP8 A;  1KWO C;  2K7O A;  3LL8 B;  2JRF A;  3SG4 A;  1BG1 A;  2KFF A;  3FIA A;  3EKJ A;  1S36 A;  3AKB A;  1QJT A;  1J1D A;  2L4H A;  1A03 A;  5F6T A;  5HLV A;  5AAN A;  1J7O A;  4CFR A;  2KSP A;  3SG3 A;  2O5G A;  2WOS A;  1K90 D;  1DGU A;  1QLS A;  2L4I A;  3JVT B;  2LHI A;  1YRU B;  3TS5 B;  1F54 A;  1PUL A;  2PAS A;  1Y1U A;  3NXA A;  3QRX A;  1EG3 A;  3BOW B;  1A2X A;  1SKT A;  2QPT A;  1MWN A;  1K2H A;  2GV5 A;  4YI8 A;  4I5K A;  3VRO A;  1F8H A;  1PRW A;  1OZO A;  4U8D A;  1JC2 A;  1DJY A;  1UP5 A;  3BUO B;  3DF0 B;  1BR4 B;  2JPT A;  1F71 A;  3A4U B;  1MXL C;  2M0R A;  2L5X B;  2JZI A;  2CT9 A;  3CGA A;  1ZMZ A;  5HKW A;  3D10 A;  4DCK A;  2NXQ A;  2JT0 A;  4WQ3 A;  1X02 A;  1ZAC A;  2I94 A;  3SIB A;  2TN4 A;  1SCM B;  1OSA A;  1QIW A;  4ZCV A;  1QTX A;  4PHJ A;  4QJ4 B;  4GFT A;  1YX8 A;  4BY5 A;  1S5G Z;  4M2O A;  1CDL A;  1UHK A;  1NYA A;  2M3W A;  3LK1 A;  1K96 A;  2KI4 C;  2M7L A;  1JUO A;  4JQ0 D;  3HX4 A;  1YUU A;  1NX3 A;  1QX2 A;  3I5I B;  1NX0 A;  4YGA A;  1MUX A;  1E8A A;  2K2A A;  1J55 A;  2AUC A;  1YVH A;  4OCI A;  2WND A;  2P6B B;  2ZN8 A;  2JT8 A;  2WCB A;  1LXF C;  2D8N A;  2H61 C;  4ORB B;  1XFZ O;  3VGO A;  1CKK A;  1JFJ A;  1SYM A;  2IS9 A;  2LMT A;  1ALV A;  2DOQ A;  3JTD C;  3SIA A;  1N65 A;  1UHJ A;  3CR4 X;  3DD4 A;  3FWC A;  2SAS A;  4PCW A;  4MEW A;  5ER4 X;  3AAJ A;  1F55 A;  2LAP A;  5CSJ A;  4PHN A;  4YGC B;  4DS7 A;  2K0J A;  5PAL A;  2I7A A;  2JNX A;  1IRJ A;  3EKH A;  2BCA A;  4I5N B;  1IKU A;  1AP4 A;  2BE4 A;  3NSO A;  2ZRT A;  1N2D A;  1TNQ A;  2KBI A;  4HRH A;  4IL1 A;  1R2U A;  4NDB A;  1J7P A;  1ODB A;  4D1E A;  1QV1 A;  2CCM A;  2CBL A;  5CSF A;  1CFD A;  3I5H B;  2MRD A;  2SCP A;  3OX6 A;  5KU1 A;  2M7N A;  1F4O A;  1NCZ A;  1XFX O;  2FCE A;  1B1G A;  2HQW A;  3LK0 A;  1JF2 A;  1FI6 A;  1S3P A;  1YX7 A;  2MBX A;  2KQ6 A;  4YGE B;  4PE1 A;  1CM1 A;  5TNC A;  2ISD A;  1JFK A;  2KDH A;  1QAT A;  4JWQ A;  1M39 A;  2F3Z A;  1F4Q A;  1NIW A;  1DMO A;  1BT6 A;  2RGI A;  3CLN A;  2HQ8 A;  1J1E A;  3PFV A;  1XFW O;  5DKR A;  4OR9 B;  3AKA A;  1A75 B;  2KAV A;  1CLL A;  2OPO A;  3VRQ A;  2V53 A;  4GGF A;  1BMO A;  3SG7 A;  1V1F A;  2NLN A;  1TCO B;  5I2Q A;  1OMV A;  3M0W A;  1AUI B;  3D0Y B;  2FJU B;  1DJX A;  1YUS A;  3BUM B;  4C0J A;  2K61 A;  4PHK A;  1B8C A;  1YR5 A;  2R2I A;  1BLQ A;  1N0Y A;  4GPL B;  2F2P A;  1MXE A;  2FOT A;  1CNP A;  1WRK A;  3ICB A;  3RLZ A;  2F8P A;  4PE7 A;  5ER5 A;  1R6P A;  4P2Y B;  4WRI A;  3A8R A;  3SG5 A;  2JOJ A;  5JOL A;  1NPQ A;  1XVJ A;  2WCF A;  1KWO B;  4GBA A;  3IQQ A;  2KNE A;  1RWY A;  3KPX A;  2NCP A;  1H4B A;  2WCE A;  2ZRS A;  4XYN A;  3FWB A;  1IQ5 A;  2BCB A;  1ALW A;  1SRA A;  3HCM A;  2OTG C;  2I18 A;  3IF7 A;  3OX5 A;  2LV7 A;  4ICB A;  2BCX A;  1B8R A;  1BU3 A;  4YRU A;  3TDZ A;  1QAS A;  3BUN B;  2M1K B;  3BYA A;  1B8L A;  4AOM A;  2LVK A;  1S26 D;  1CLM A;  2KQY A;  2LVI A;  5J3X A;  2FCD A;  4BY4 A;  3GK1 A;  2ZFD A;  2KI6 C;  1OMD A;  3I5G C;  1WLZ A;  2WOR A;  2A4J A;  1RTP 1;  1S6I A;  5AEQ A;  1A4P A;  1TIZ A;  4MLW A;  3BQ3 A;  2JTZ A;  2BE6 A;  1QIV A;  1CMG A;  4C0L A;  1S1E A;  2MHH A;  4PDZ A;  4ORA B;  1REC A;  2F33 A;  2JWW A;  4NDD A;  4N5X A;  5G08 A;  1V1G A;  1A29 A;  3AAK A;  2QAC A;  4N1F A;  2K7D A;  1NX2 A;  2KYC A;  3WXA A;  2KGR A;  2LLS A;  4GNK B;  4MZL A;  4DRW A;  2KI4 B;  1B7T Y;  4XJK A;  1KSO A;  5GQQ C;  1DF0 B;  1KK7 Y;  4PE4 A;  3TZ1 A;  4AQJ A;  4JPZ B;  1OZS A;  3SG2 A;  5AER A;  2BL0 C;  1WRL A;  2CXJ A;  4I5L B;  1ZOT B;  1KCY A;  1OOJ A;  5CPV A;  1RFJ A;  1XK4 A;  2GGM A;  3OB2 B;  1B4C A;  3JTD B;  1DJG A;  4I5J A;  2CTN A;  2K2F A;  1DJH A;  1M63 B;  1K94 A;  1LA0 A;  1D1O A;  1AK8 A;  1YTZ C;  2NCO A;  1KK8 C;  1B9A A;  1UWO A;  1C7W A;  2BKI B;  2LP2 A;  1KFU S;  1AVS A;  3NSI A;  5AXI A;  3TDI A;  5AFP A;  4FTG A;  1LA3 A;  3BOW A;  1QVI Y;  2EC6 C;  2AMI A;  3PLF B;  3E3R A;  4M2Q A;  2ZKM X;  3OB1 B;  1WLM A;  2COL B;  5DKQ A;  1L2O C;  1SL9 A;  1TN4 A;  3PAL A;  1DJI A;  1KQM C;  3WHU B;  5B8I B;  2MAZ A;  1C7V A;  4GGF C;  3TUY C;  3FS7 A;  2Q91 A;  3DF0 A;  4GAO A;  4OVN F;  1RRO A;  2KBM A;  1WY9 A;  1SR6 C;  3ZWH A;  4USL A;  5FYX A;  3NSL A;  4MN0 A;  1LKJ A;  1UUR A;  5IBW A;  1GQM A;  1EH2 A;  3O78 A;  2PSR A;  2EHB A;  2BBN A;  1Y0V H;  4GUK A;  4YBH B;  2JXC A;  3EVR A;  5K89 A;  1YUT A;  3DVJ A;  3NSK A;  1XFU O;  4DIR A;  3VRR A;  4ZCU A;  1YUR A;  1OQP A;  3ZNI A;  2ZNE A;  1JWD A;  2KYF A;  5HKZ A;  1DJW A;  1TTX A;  5HYD A;  1F70 A;  2B1U A;  1KQV A;  3PM8 A;  2K8M B;  1CFC A;  1QS7 A;  3EK4 A;  4E68 A;  1KFU L;  1MF8 B;  1K95 A;  3CWG A;  4WQ2 A;  1XFV O;  1NWD A;  1UHH A;  3CR5 X;  1PVB A;  4OV2 A;  2JQ6 A;  1GGZ A;  4QJ3 B;  1CTR A;  1TNW A;  1H8B A;  2MLE C;  2OTG B;  1G4Y R;  3PN7 C;  4ETO A;  1MHO A;  1YVL A;  1EXR A;  1VRK A;  2F2O A;  1SW8 A;  1XYD A;  2LNK A;  1U5I B;  1XA5 A;  5KSZ A;  1FW4 A;  1EG4 A;  3CR2 A;  5D69 A;  1NCX A;  2L98 A;  1W7I B; 
#chains in the Genus database with same CATH topology
 2L0P A;  2BBM A;  1XO5 A;  1S6J A;  3MSE B;  3C1V A;  1SNL A;  4YI9 A;  2WCH A;  3BFB A;  1PK0 D;  4MRY A;  2Y1N A;  2JNF A;  1PSR A;  2JU0 A;  1TNP A;  2HF5 A;  2OS8 C;  3I5G B;  1Z2C B;  5D7F A;  1XFY O;  2M49 B;  3S0F A;  3O4Y A;  3WHT B;  4N1G A;  2KAY A;  1ZFS A;  3R1O A;  1A75 A;  2LC5 A;  2AAO A;  2MJW B;  4NQG A;  1ZUZ A;  1KK7 Z;  1M31 A;  2KOT A;  3I5F C;  1TRF A;  1WDC C;  4F7F A;  2Y4Q A;  2WC8 A;  1IQ3 A;  1KFX S;  1W7J B;  1YRT B;  1QV0 A;  2M8U A;  3TDU A;  4A4C A;  1JSA A;  5D3O A;  5EL2 A;  2LAN A;  2F3Y A;  3D0Y A;  2KFH A;  1L7Z A;  2JT3 A;  2BEC A;  4R1E A;  1K9P A;  1XK4 C;  1G33 A;  4QJ5 B;  4MVF A;  3CZ1 A;  3EVU A;  1KSM A;  1IWQ A;  1OMR A;  4MBE A;  1M45 A;  5HLO A;  3OP0 A;  4YGD B;  2L5Y A;  2LMU A;  4Q04 A;  1CM4 A;  3GK4 X;  2PMY A;  4HSZ A;  1FPW A;  2PAL A;  1LVC D;  2M97 A;  3JVT C;  1K9U A;  3K21 A;  1BJF A;  2BL0 B;  1QVI Z;  2ERB A;  3D76 A;  4FQT A;  3TS5 C;  1Q80 A;  1IJ6 A;  1SMG A;  2HET A;  4YGB B;  1OE9 B;  1TOP A;  1U5I A;  1SK6 D;  1DGV A;  2JC2 A;  3F45 A;  1K93 D;  2YGU A;  1S6C A;  1KK8 B;  2L2E A;  5I2L A;  3S0D A;  4INX A;  3H4S E;  3LLE A;  5BPJ A;  1SL7 A;  1NCY A;  4MRX A;  1JBA A;  4PT1 A;  1IJ5 A;  4C0K A;  2JPO A;  2LLU A;  3BFH A;  2GTE A;  3DY9 A;  2EC6 B;  4OKH A;  2Y1M A;  2G2B A;  2HPS A;  1SY9 A;  2JTT A;  3DVE A;  5I8N A;  2I2R E;  4L9M A;  1RK9 A;  2CNP A;  3VRN A;  1C3Z A;  1L2O B;  4CLN A;  3O2P A;  1SCM C;  1BOD A;  1KQM B;  1CDM A;  1K8U A;  2KI6 D;  3PAT A;  1FF1 A;  3D73 A;  3SS3 A;  1CLB A;  2LVV A;  2MLF C;  3KO0 A;  2KGB C;  1KFX L;  1IGV A;  1NX1 A;  3TUY B;  1BR1 B;  2M9G A;  2LMV A;  1NSH A;  2Y5I A;  2Q4U A;  4IJ7 A;  4PHM A;  1AHR A;  1Y6W A;  2G9B A;  1MR8 A;  3CZ2 A;  2H2K A;  1QX5 B;  2K7C A;  4GGN A;  4FQO A;  1SR6 B;  1AJ4 A;  2KHN A;  1Y1X A;  3FE8 A;  1G8I A;  4MZJ A;  3I5I C;  5HL1 A;  4OZD A;  2PRU A;  1DT7 B;  2JUL A;  3CS1 A;  1AJ5 A;  3CZT X;  5DKN A;  2FJY A;  1J7R A;  2MA2 A;  3DZT A;  1LIN A;  2LUX A;  2ZND A;  2KLD A;  3CTN A;  3GOF A;  1DVI A;  3KF9 A;  3BUW B;  1UHI A;  1IG5 A;  2E30 A;  2KFG A;  2LHL A;  2LM5 A;  1CDN A;  1S5G Y;  2ZN9 A;  1FI5 A;  2M29 A;  3L4L A;  3IQO A;  3SG6 A;  4PAL A;  1DF0 A;  2LUC A;  1UHN A;  2O60 A;  4DUQ A;  4ORC B;  4MZK A;  3BXK A;  4PE0 A;  4JKT A;  3DXL A;  5JJG A;  1HT9 A;  1TCF A;  2K60 A;  4M2P A;  2M1U A;  1IH0 A;  2H61 A;  3LCP C;  3RM1 A;  1PSB A;  3WNX B;  1QX7 A;  4F0Z B;  1JF0 A;  1DJZ A;  5I2O A;  1K9K A;  1M46 A;  3I5H C;  1BOC A;  1CDP A;  4MSP A;  2BKH B;  3EK8 A;  2KLE A;  2LCP A;  1MQ1 A;  1PAL A;  3O6B A;  3EVV A;  1SBJ A;  1B47 A;  3PM2 A;  1GJY A;  1TNX A;  2EGD A;  3FE9 A;  3PN7 B;  3S0A A;  5CSN A;  5I94 A;  2LP3 A;  4NDC A;  2VRG A;  3BUX B;  3N7H A;  4HRE E;  4CPV A;  2PYQ A;  5KTY A;  1DTL A;  4CID A;  2NZ0 A;  1QLK A;  1RJV A;  2LLT A;  1HQV A;  1WRZ A;  4P5O E;  3SJS A;  1DEK A;  2E6W A;  3D75 A;  3KEV A;  1C07 A;  1CMF A;  3OHM B;  2GGZ A;  3V2L A;  4HRG A;  1BF5 A;  2K7B A;  1EL4 A;  1FBV A;  4AQI A;  1CFP A;  1NUB A;  1UUS A;  1EJ3 A;  1XFR A;  2L51 A;  3EK7 A;  1CB1 A;  1OOI X;  1QWV A;  2WC6 A;  5CSI A;  1SL8 A;  3GK2 A;  2OS8 B;  2LE9 B;  2JXL A;  1Y1A A;  3VRP A;  4TNC A;  2LVJ A;  2KAX A;  3DVM A;  1QXP A;  3DVK A;  3I5F B;  4XJK B;  4UPG A;  1WDC B;  1SCV A;  2L2C A;  1J7Q A;  1GGW A;  2L50 A;  1CFF A;  4A4B A;  5HKY A;  1B7T Z;  3KHE A;  1PVA A;  2PVB A;  1SPY A;  3PSR A;  3L47 A;  1NP8 A;  1KWO C;  2K7O A;  3LL8 B;  2JRF A;  2KPH A;  3SG4 A;  1BG1 A;  2KFF A;  3FIA A;  3EKJ A;  1S36 A;  3AKB A;  1QJT A;  1J1D A;  2L4H A;  1A03 A;  5F6T A;  5HLV A;  5AAN A;  1J7O A;  4CFR A;  2KSP A;  3SG3 A;  2O5G A;  2P71 A;  2WOS A;  1K90 D;  1DGU A;  1QLS A;  1OOF A;  2L4I A;  3JVT B;  2LHI A;  1DC1 A;  1YRU B;  3TS5 B;  1F54 A;  1PUL A;  2PAS A;  1Y1U A;  3BJH A;  3NXA A;  3QRX A;  1EG3 A;  3BOW B;  1A2X A;  1SKT A;  4JD9 A;  2QPT A;  1MWN A;  1K2H A;  2GV5 A;  4YI8 A;  4I5K A;  3VRO A;  1F8H A;  2QDI A;  1PRW A;  2QEV A;  3NHT A;  1OZO A;  4U8D A;  1JC2 A;  1DJY A;  1UP5 A;  3BUO B;  3B86 A;  3DF0 B;  1BR4 B;  2JPT A;  1F71 A;  3A4U B;  1MXL C;  2M0R A;  2L5X B;  2JZI A;  2CT9 A;  3CGA A;  1ZMZ A;  5HKW A;  3D10 A;  4DCK A;  2NXQ A;  2JT0 A;  4WQ3 A;  1X02 A;  1ZAC A;  2I94 A;  3SIB A;  2TN4 A;  1SCM B;  1OSA A;  1QIW A;  3NHI A;  4ZCV A;  1QTX A;  3NGV A;  4PHJ A;  4QJ4 B;  4GFT A;  1YX8 A;  4BY5 A;  1S5G Z;  4M2O A;  1CDL A;  1UHK A;  1NYA A;  2M3W A;  3LK1 A;  1K96 A;  2PQL A;  2KI4 C;  2M7L A;  1JUO A;  4JQ0 D;  3HX4 A;  2WCK A;  3SS5 A;  1YUU A;  1NX3 A;  1QX2 A;  3I5I B;  1NX0 A;  1TWO A;  3R1P A;  1MUX A;  4YGA A;  1E8A A;  2K2A A;  1J55 A;  2AUC A;  1YVH A;  4OCI A;  2WND A;  2P6B B;  2ZN8 A;  2JT8 A;  2WCB A;  1LXF C;  2D8N A;  2H61 C;  4ORB B;  1XFZ O;  3VGO A;  1CKK A;  1JFJ A;  1SYM A;  2IS9 A;  2LMT A;  3UO9 A;  1ALV A;  2DOQ A;  3JTD C;  3SIA A;  1N65 A;  1UHJ A;  3BFA A;  3CR4 X;  3DD4 A;  2SAS A;  3EG5 B;  3FWC A;  4MEW A;  4PCW A;  5ER4 X;  3AAJ A;  1F55 A;  2LAP A;  5CSJ A;  4PHN A;  4YGC B;  4DS7 A;  2K0J A;  5PAL A;  3RZS A;  2I7A A;  2JNX A;  1IRJ A;  3EKH A;  2BCA A;  4I5N B;  1IKU A;  1AP4 A;  2BE4 A;  3NSO A;  2ZRT A;  1N2D A;  1TNQ A;  2KBI A;  4HRH A;  3DYE A;  1R2U A;  4IL1 A;  4NDB A;  1J7P A;  1ODB A;  4D1E A;  1QV1 A;  3OGN A;  3B7A A;  2CCM A;  2CBL A;  4INW A;  5CSF A;  1CFD A;  3I5H B;  2MRD A;  2SCP A;  3OX6 A;  5KU1 A;  2M7N A;  1F4O A;  1NCZ A;  1XFX O;  2FCE A;  1B1G A;  2HQW A;  1TUJ A;  3LK0 A;  1JF2 A;  1FI6 A;  1LS8 A;  1S3P A;  1YX7 A;  2MBX A;  3K1E A;  2KQ6 A;  4YGE B;  4PE1 A;  1CM1 A;  5TNC A;  2WCL A;  2ISD A;  1DQE A;  1JFK A;  2KDH A;  1OOG A;  1QAT A;  4JWQ A;  1M39 A;  2F3Z A;  1F4Q A;  1NIW A;  1DMO A;  1BT6 A;  2RGI A;  3CLN A;  2HQ8 A;  1J1E A;  3PFV A;  1XFW O;  5DKR A;  4OR9 B;  3AKA A;  1A75 B;  2KAV A;  1CLL A;  2OPO A;  3VRQ A;  2V53 A;  4GGF A;  1BMO A;  3SG7 A;  1V1F A;  2NLN A;  1TCO B;  5I2Q A;  1OMV A;  3CDN A;  3M0W A;  1AUI B;  1W9Z A;  3D0Y B;  2FJU B;  1DJX A;  1YUS A;  3BUM B;  1GM0 A;  4C0J A;  2K61 A;  3R1V A;  4PHK A;  1B8C A;  1YR5 A;  2R2I A;  1BLQ A;  1N0Y A;  2WCJ A;  2F2P A;  1MXE A;  2FOT A;  4GPL B;  1CNP A;  1WRK A;  3ICB A;  3RLZ A;  2F8P A;  4PE7 A;  3B6X A;  1R6P A;  4P2Y B;  5ER5 A;  4WRI A;  3A8R A;  3SG5 A;  2JOJ A;  5JOL A;  1NPQ A;  1XVJ A;  2WCF A;  1KWO B;  4GBA A;  3IQQ A;  2KNE A;  1RWY A;  3KPX A;  2NCP A;  1H4B A;  2WCE A;  2ZRS A;  4XYN A;  3FWB A;  1IQ5 A;  2BCB A;  1ALW A;  1SRA A;  3HCM A;  2OTG C;  3PJI A;  2I18 A;  3IF7 A;  3OX5 A;  2LV7 A;  4ICB A;  2BCX A;  1B8R A;  1BU3 A;  4YRU A;  3TDZ A;  1QAS A;  3BUN B;  3CAB A;  2M1K B;  4KYN A;  3BYA A;  1B8L A;  4AOM A;  2LVK A;  1S26 D;  1CLM A;  2KQY A;  2LVI A;  5J3X A;  2FCD A;  4BY4 A;  3GK1 A;  3D78 A;  2ZFD A;  2KI6 C;  1OMD A;  5FI7 A;  3I5G C;  3OBV A;  1WLZ A;  2WOR A;  1RTP 1;  2A4J A;  1S6I A;  3S0G A;  5AEQ A;  1A4P A;  1TIZ A;  4MLW A;  3BQ3 A;  2JTZ A;  2BE6 A;  1QIV A;  1CMG A;  4C0L A;  1S1E A;  2MHH A;  4PDZ A;  4ORA B;  1REC A;  2F33 A;  2JWW A;  4NDD A;  4N5X A;  5G08 A;  1V1G A;  1A29 A;  3AAK A;  2QAC A;  4N1F A;  2K7D A;  3UNW A;  1NX2 A;  2KYC A;  3WXA A;  3R72 A;  2KGR A;  2LLS A;  4GNK B;  4MZL A;  4DRW A;  2KI4 B;  1C3Y A;  1B7T Y;  4XJK A;  1KSO A;  5GQQ C;  3S0E A;  1DF0 B;  1KK7 Y;  4PE4 A;  3D74 A;  3O4X A;  3TZ1 A;  4AQJ A;  4JPZ B;  1OZS A;  3SG2 A;  5AER A;  2BL0 C;  2QEH A;  1WRL A;  2CXJ A;  4I5L B;  1TUZ A;  1ZOT B;  1OOJ A;  5CPV A;  1RFJ A;  1XK4 A;  2GGM A;  3OB2 B;  1B4C A;  1KCY A;  3JTD B;  1DJG A;  4I5J A;  2CTN A;  3SS4 A;  2K2F A;  1DJH A;  1SSE B;  1M63 B;  1K94 A;  1LA0 A;  3QME A;  1D1O A;  1IIO A;  1AK8 A;  1YTZ C;  2QEO A;  2NCO A;  1KK8 C;  1B9A A;  1UWO A;  1C7W A;  2BKI B;  2LP2 A;  1KFU S;  1AVS A;  3NSI A;  5AXI A;  3TDI A;  5AFP A;  4FTG A;  1LA3 A;  1OW4 A;  1QVI Y;  2EC6 C;  2WCM A;  3BOW A;  3VB1 A;  3CYZ A;  1DEL A;  2AMI A;  3E3R A;  3PLF B;  4M2Q A;  2ZKM X;  3OB1 B;  1WLM A;  2BAP A;  1T14 A;  2COL B;  5DKQ A;  5FI2 A;  5DIC A;  1L2O C;  3B88 A;  1SL9 A;  1TN4 A;  3PAL A;  1DJI A;  1KQM C;  3WHU B;  5B8I B;  2MAZ A;  1C7V A;  4GGF C;  3TUY C;  3FS7 A;  2Q91 A;  3DF0 A;  4GAO A;  4OVN F;  5FI6 A;  1RRO A;  2KBM A;  1WY9 A;  1SR6 C;  2P70 A;  3ZWH A;  4USL A;  5FYX A;  3NSL A;  4MN0 A;  1LKJ A;  1UUR A;  2BNX A;  1GQM A;  5IBW A;  3O78 A;  2PSR A;  2EHB A;  1EH2 A;  2BBN A;  1Y0V H;  4GUK A;  4YBH B;  2JXC A;  3EVR A;  5K89 A;  1YUT A;  3DVJ A;  3NSK A;  1XFU O;  1P28 A;  4DIR A;  3VRR A;  4ZCU A;  1YUR A;  1OQP A;  3ZNI A;  2ZNE A;  1JWD A;  2WC5 A;  2KYF A;  5HKZ A;  1DJW A;  1TTX A;  3D77 A;  5HYD A;  1F70 A;  2B1U A;  3IVT A;  1KQV A;  1Z4H A;  3PM8 A;  2K8M B;  1CFC A;  1QS7 A;  3EK4 A;  4E68 A;  1KFU L;  1MF8 B;  1K95 A;  3CWG A;  4WQ2 A;  1XFV O;  3FE6 A;  1NWD A;  1UHH A;  3L4A A;  3CR5 X;  1PVB A;  4OV2 A;  1ORG A;  2JQ6 A;  1GGZ A;  4CFQ A;  4QJ3 B;  1CTR A;  2H8V A;  1TNW A;  1H8B A;  2MLE C;  2OTG B;  1G4Y R;  3PN7 C;  3Q8I A;  3S0B A;  4ETO A;  1YVL A;  1MHO A;  3CZ0 A;  1EXR A;  1OOH A;  1VRK A;  2F2O A;  1SW8 A;  1XYD A;  3B87 A;  2LNK A;  1U5I B;  1XA5 A;  5KSZ A;  1FW4 A;  1EG4 A;  3CR2 A;  5D69 A;  1NCX A;  2QEB A;  2L98 A;  1W7I B; 
#chains in the Genus database with same CATH homology
 2L0P A;  2BBM A;  1XO5 A;  1S6J A;  3MSE B;  3C1V A;  1SNL A;  4YI9 A;  1PK0 D;  4MRY A;  2Y1N A;  2JNF A;  1PSR A;  2JU0 A;  1TNP A;  2HF5 A;  2OS8 C;  3I5G B;  5D7F A;  4CFQ A;  1XFY O;  2M49 B;  3O4Y A;  3WHT B;  4N1G A;  2KAY A;  1ZFS A;  1A75 A;  2LC5 A;  2AAO A;  2MJW B;  4NQG A;  1ZUZ A;  1KK7 Z;  1M31 A;  2KOT A;  3I5F C;  1TRF A;  1WDC C;  2Y4Q A;  2WC8 A;  1IQ3 A;  1KFX S;  1W7J B;  1YRT B;  1QV0 A;  2M8U A;  3TDU A;  4A4C A;  1JSA A;  2LAN A;  2F3Y A;  3D0Y A;  2KFH A;  1L7Z A;  2JT3 A;  2BEC A;  4R1E A;  1K9P A;  1XK4 C;  1G33 A;  4QJ5 B;  4MVF A;  3EVU A;  1KSM A;  1IWQ A;  1OMR A;  4MBE A;  1M45 A;  5HLO A;  3OP0 A;  4YGD B;  2LMU A;  4Q04 A;  1CM4 A;  3GK4 X;  2PMY A;  4HSZ A;  1FPW A;  2PAL A;  1LVC D;  2M97 A;  3JVT C;  1K9U A;  3K21 A;  1BJF A;  2BL0 B;  1QVI Z;  3TS5 C;  1Q80 A;  1IJ6 A;  1SMG A;  2HET A;  4YGB B;  1OE9 B;  1TOP A;  1U5I A;  1SK6 D;  1DGV A;  2JC2 A;  3F45 A;  1K93 D;  1S6C A;  1KK8 B;  2L2E A;  5I2L A;  3H4S E;  3LLE A;  5BPJ A;  1SL7 A;  1NCY A;  4MRX A;  1JBA A;  1IJ5 A;  4C0K A;  2LLU A;  2EC6 B;  4OKH A;  2Y1M A;  2G2B A;  2HPS A;  1SY9 A;  2JTT A;  3DVE A;  5I8N A;  2I2R E;  4L9M A;  1RK9 A;  2CNP A;  3VRN A;  1L2O B;  4CLN A;  3O2P A;  1SCM C;  1BOD A;  1KQM B;  1CDM A;  1K8U A;  2KI6 D;  3PAT A;  1FF1 A;  1CLB A;  2LVV A;  2MLF C;  3KO0 A;  2KGB C;  1KFX L;  1IGV A;  1NX1 A;  3TUY B;  1BR1 B;  2M9G A;  2LMV A;  1NSH A;  2Y5I A;  2Q4U A;  4PHM A;  1AHR A;  1Y6W A;  2G9B A;  1MR8 A;  4GGN A;  2H2K A;  1QX5 B;  2K7C A;  4FQO A;  1SR6 B;  1AJ4 A;  2KHN A;  1Y1X A;  1G8I A;  4MZJ A;  3I5I C;  2PRU A;  1DT7 B;  2JUL A;  3CS1 A;  1AJ5 A;  3CZT X;  5DKN A;  1J7R A;  2MA2 A;  1LIN A;  2LUX A;  2ZND A;  3CTN A;  3GOF A;  1DVI A;  3KF9 A;  3BUW B;  1UHI A;  1IG5 A;  2E30 A;  2KFG A;  2LHL A;  2LM5 A;  1CDN A;  1S5G Y;  2ZN9 A;  1FI5 A;  2M29 A;  3IQO A;  3SG6 A;  4PAL A;  1DF0 A;  2LUC A;  1UHN A;  2O60 A;  4DUQ A;  4ORC B;  4MZK A;  3BXK A;  4PE0 A;  5JJG A;  1IH0 A;  1HT9 A;  1TCF A;  4M2P A;  2M1U A;  2H61 A;  3LCP C;  3RM1 A;  1PSB A;  3WNX B;  1QX7 A;  4F0Z B;  1JF0 A;  1DJZ A;  5I2O A;  1K9K A;  1M46 A;  3I5H C;  1BOC A;  1CDP A;  4MSP A;  2BKH B;  3EK8 A;  2LCP A;  1MQ1 A;  1PAL A;  3O6B A;  3EVV A;  1SBJ A;  1B47 A;  1GJY A;  1TNX A;  2EGD A;  3PN7 B;  5CSN A;  2LP3 A;  4NDC A;  2VRG A;  3BUX B;  4HRE E;  4CPV A;  5KTY A;  1DTL A;  4CID A;  2NZ0 A;  1QLK A;  1RJV A;  2LLT A;  1HQV A;  1WRZ A;  4P5O E;  3SJS A;  3KEV A;  2E6W A;  1C07 A;  1CMF A;  3OHM B;  2GGZ A;  4HRG A;  1BF5 A;  2K7B A;  1EL4 A;  1FBV A;  4AQI A;  1CFP A;  1NUB A;  1UUS A;  1EJ3 A;  2L51 A;  3EK7 A;  1CB1 A;  5CSI A;  1SL8 A;  3GK2 A;  2OS8 B;  2LE9 B;  2JXL A;  1Y1A A;  3VRP A;  4TNC A;  2LVJ A;  2KAX A;  3DVM A;  1QXP A;  3DVK A;  3I5F B;  4XJK B;  4UPG A;  1WDC B;  1SCV A;  1J7Q A;  1GGW A;  2L50 A;  1CFF A;  4A4B A;  5HKY A;  1B7T Z;  3KHE A;  1PVA A;  2PVB A;  1SPY A;  3PSR A;  1NP8 A;  1KWO C;  2K7O A;  3LL8 B;  2JRF A;  3SG4 A;  1BG1 A;  2KFF A;  3FIA A;  3EKJ A;  1S36 A;  3AKB A;  1QJT A;  1J1D A;  2L4H A;  1A03 A;  5F6T A;  5HLV A;  5AAN A;  1J7O A;  4CFR A;  2KSP A;  3SG3 A;  2O5G A;  2WOS A;  1K90 D;  1DGU A;  1QLS A;  2L4I A;  3JVT B;  2LHI A;  1YRU B;  3TS5 B;  1F54 A;  1PUL A;  2PAS A;  1Y1U A;  3NXA A;  3QRX A;  1EG3 A;  3BOW B;  1A2X A;  1SKT A;  2QPT A;  1MWN A;  1K2H A;  2GV5 A;  4YI8 A;  4I5K A;  3VRO A;  1F8H A;  1PRW A;  1OZO A;  4U8D A;  1JC2 A;  1DJY A;  1UP5 A;  3BUO B;  3DF0 B;  1BR4 B;  2JPT A;  1F71 A;  3A4U B;  1MXL C;  2M0R A;  2L5X B;  2JZI A;  2CT9 A;  3CGA A;  1ZMZ A;  5HKW A;  3D10 A;  4DCK A;  2NXQ A;  2JT0 A;  4WQ3 A;  1X02 A;  1ZAC A;  2I94 A;  3SIB A;  2TN4 A;  1SCM B;  1OSA A;  1QIW A;  4ZCV A;  1QTX A;  4PHJ A;  4QJ4 B;  4GFT A;  1YX8 A;  4BY5 A;  1S5G Z;  4M2O A;  1CDL A;  1UHK A;  1NYA A;  2M3W A;  3LK1 A;  1K96 A;  2KI4 C;  2M7L A;  1JUO A;  4JQ0 D;  3HX4 A;  1YUU A;  1NX3 A;  1QX2 A;  3I5I B;  1NX0 A;  4YGA A;  1MUX A;  1E8A A;  2K2A A;  1J55 A;  2AUC A;  1YVH A;  4OCI A;  2WND A;  2P6B B;  2ZN8 A;  2JT8 A;  2WCB A;  1LXF C;  2D8N A;  2H61 C;  4ORB B;  1XFZ O;  3VGO A;  1CKK A;  1JFJ A;  1SYM A;  2IS9 A;  2LMT A;  1ALV A;  2DOQ A;  3JTD C;  3SIA A;  1N65 A;  1UHJ A;  3CR4 X;  3DD4 A;  3FWC A;  2SAS A;  4PCW A;  4MEW A;  5ER4 X;  3AAJ A;  1F55 A;  2LAP A;  5CSJ A;  4PHN A;  4YGC B;  4DS7 A;  2K0J A;  5PAL A;  2I7A A;  2JNX A;  1IRJ A;  3EKH A;  2BCA A;  4I5N B;  1IKU A;  1AP4 A;  2BE4 A;  3NSO A;  2ZRT A;  1N2D A;  1TNQ A;  2KBI A;  4HRH A;  4IL1 A;  1R2U A;  4NDB A;  1J7P A;  1ODB A;  4D1E A;  1QV1 A;  2CCM A;  2CBL A;  5CSF A;  1CFD A;  3I5H B;  2MRD A;  2SCP A;  3OX6 A;  5KU1 A;  2M7N A;  1F4O A;  1NCZ A;  1XFX O;  2FCE A;  1B1G A;  2HQW A;  3LK0 A;  1JF2 A;  1FI6 A;  1S3P A;  1YX7 A;  2MBX A;  2KQ6 A;  4YGE B;  4PE1 A;  1CM1 A;  5TNC A;  2ISD A;  1JFK A;  2KDH A;  1QAT A;  4JWQ A;  1M39 A;  2F3Z A;  1F4Q A;  1NIW A;  1DMO A;  1BT6 A;  2RGI A;  3CLN A;  2HQ8 A;  1J1E A;  3PFV A;  1XFW O;  5DKR A;  4OR9 B;  3AKA A;  1A75 B;  2KAV A;  1CLL A;  2OPO A;  3VRQ A;  2V53 A;  4GGF A;  1BMO A;  3SG7 A;  1V1F A;  2NLN A;  1TCO B;  5I2Q A;  1OMV A;  3M0W A;  1AUI B;  3D0Y B;  2FJU B;  1DJX A;  1YUS A;  3BUM B;  4C0J A;  2K61 A;  4PHK A;  1B8C A;  1YR5 A;  2R2I A;  1BLQ A;  1N0Y A;  4GPL B;  2F2P A;  1MXE A;  2FOT A;  1CNP A;  1WRK A;  3ICB A;  3RLZ A;  2F8P A;  4PE7 A;  5ER5 A;  1R6P A;  4P2Y B;  4WRI A;  3A8R A;  3SG5 A;  2JOJ A;  5JOL A;  1NPQ A;  1XVJ A;  2WCF A;  1KWO B;  4GBA A;  3IQQ A;  2KNE A;  1RWY A;  3KPX A;  2NCP A;  1H4B A;  2WCE A;  2ZRS A;  4XYN A;  3FWB A;  1IQ5 A;  2BCB A;  1ALW A;  1SRA A;  3HCM A;  2OTG C;  2I18 A;  3IF7 A;  3OX5 A;  2LV7 A;  4ICB A;  2BCX A;  1B8R A;  1BU3 A;  4YRU A;  3TDZ A;  1QAS A;  3BUN B;  2M1K B;  3BYA A;  1B8L A;  4AOM A;  2LVK A;  1S26 D;  1CLM A;  2KQY A;  2LVI A;  5J3X A;  2FCD A;  4BY4 A;  3GK1 A;  2ZFD A;  2KI6 C;  1OMD A;  3I5G C;  1WLZ A;  2WOR A;  2A4J A;  1RTP 1;  1S6I A;  5AEQ A;  1A4P A;  1TIZ A;  4MLW A;  3BQ3 A;  2JTZ A;  2BE6 A;  1QIV A;  1CMG A;  4C0L A;  1S1E A;  2MHH A;  4PDZ A;  4ORA B;  1REC A;  2F33 A;  2JWW A;  4NDD A;  4N5X A;  5G08 A;  1V1G A;  1A29 A;  3AAK A;  2QAC A;  4N1F A;  2K7D A;  1NX2 A;  2KYC A;  3WXA A;  2KGR A;  2LLS A;  4GNK B;  4MZL A;  4DRW A;  2KI4 B;  1B7T Y;  4XJK A;  1KSO A;  5GQQ C;  1DF0 B;  1KK7 Y;  4PE4 A;  3TZ1 A;  4AQJ A;  4JPZ B;  1OZS A;  3SG2 A;  5AER A;  2BL0 C;  1WRL A;  2CXJ A;  4I5L B;  1ZOT B;  1KCY A;  1OOJ A;  5CPV A;  1RFJ A;  1XK4 A;  2GGM A;  3OB2 B;  1B4C A;  3JTD B;  1DJG A;  4I5J A;  2CTN A;  2K2F A;  1DJH A;  1M63 B;  1K94 A;  1LA0 A;  1D1O A;  1AK8 A;  1YTZ C;  2NCO A;  1KK8 C;  1B9A A;  1UWO A;  1C7W A;  2BKI B;  2LP2 A;  1KFU S;  1AVS A;  3NSI A;  5AXI A;  3TDI A;  5AFP A;  4FTG A;  1LA3 A;  3BOW A;  1QVI Y;  2EC6 C;  2AMI A;  3PLF B;  3E3R A;  4M2Q A;  2ZKM X;  3OB1 B;  1WLM A;  2COL B;  5DKQ A;  1L2O C;  1SL9 A;  1TN4 A;  3PAL A;  1DJI A;  1KQM C;  3WHU B;  5B8I B;  2MAZ A;  1C7V A;  4GGF C;  3TUY C;  3FS7 A;  2Q91 A;  3DF0 A;  4GAO A;  4OVN F;  1RRO A;  2KBM A;  1WY9 A;  1SR6 C;  3ZWH A;  4USL A;  5FYX A;  3NSL A;  4MN0 A;  1LKJ A;  1UUR A;  5IBW A;  1GQM A;  1EH2 A;  3O78 A;  2PSR A;  2EHB A;  2BBN A;  1Y0V H;  4GUK A;  4YBH B;  2JXC A;  3EVR A;  5K89 A;  1YUT A;  3DVJ A;  3NSK A;  1XFU O;  4DIR A;  3VRR A;  4ZCU A;  1YUR A;  1OQP A;  3ZNI A;  2ZNE A;  1JWD A;  2KYF A;  5HKZ A;  1DJW A;  1TTX A;  5HYD A;  1F70 A;  2B1U A;  1KQV A;  3PM8 A;  2K8M B;  1CFC A;  1QS7 A;  3EK4 A;  4E68 A;  1KFU L;  1MF8 B;  1K95 A;  3CWG A;  4WQ2 A;  1XFV O;  1NWD A;  1UHH A;  3CR5 X;  1PVB A;  4OV2 A;  2JQ6 A;  1GGZ A;  4QJ3 B;  1CTR A;  1TNW A;  1H8B A;  2MLE C;  2OTG B;  1G4Y R;  3PN7 C;  4ETO A;  1MHO A;  1YVL A;  1EXR A;  1VRK A;  2F2O A;  1SW8 A;  1XYD A;  2LNK A;  1U5I B;  1XA5 A;  5KSZ A;  1FW4 A;  1EG4 A;  3CR2 A;  5D69 A;  1NCX A;  2L98 A;  1W7I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...