5HYDA

Crystal structure of calcium-free human s100z
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
PTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein S100-Z
publication title Solving the crystal structure of human calcium-free S100Z: the siege and conquer of one of the last S100 family strongholds.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5hydA00
1YUTA 3GK1A 4MVFA 1KWOB 4NDCA 1A75A 2PRUA 4ORBB 5D69A 1DF0A 5AEQA 1YUUA 2GGMA 4WRIA 3ZWHA 5AFPA 1S36A 1CDNA 3RM1A 2K2AA 4YGBB 2CXJA 1K96A 2E30A 4YI9A 1KQMB 1YVHA 1B4CA 4N1FA 2Y4QA 1X02A 2MA2A 3A4UB 5BPJA 1DVIA 1FI6A 1NP8A 1QV0A 1C7VA 2NCOA 2AMIA 1SBJA 1A2XA 1WDCB 4MSPA 1LA3A 1XVJA 1OOJA 1EL4A 1B9AA 1CFCA 2O60A 2L5XB 4YGEB 4BY5A 1OMDA 3PATA 1A75B 1BR1B 1DF0B 4NDBA 3BUOB 4MLWA 1CTRA 3WHTB 1S1EA 2MLFC 1F71A 3PN7C 4NQGA 5I2OA 2JRFA 3SG5A 2BBNA 1QV1A 1D1OA 1U5IA 2CTNA 3DF0B 1CMFA 3BUXB 1OE9B 4ZCUA 1H8BA 1LVCD 1TRFA 1SCMC 2BECA 1YR5A 2EHBA 1AHRA 2LVIA 1JF0A 4OV2A 2F2PA 4OVNF 1J55A 3SG4A 1SR6C 2K61A 3CTNA 2JQ6A 1SL9A 2KQYA 2G2BA 1IQ5A 3BXKA 3I5IB 4CLNA 3VRNA 1SW8A 3SG7A 4PDZA 4PCWA 5AANA 1OQPA 2F3YA 4MEWA 1CFPA 4A4CA 3NSOA 2I2RE 2L98A 4I5NB 5K89A 1SMGA 1K9PA 5AXIA 1XFUO 1CB1A 1E8AA 1MR8A 2BBMA 2WORA 4GPLB 1S6JA 1UHNA 2LM5A 1B8CA 4CPVA 4AQJA 1WRKA 3E3RA 3TDZA 2LMVA 4USLA 1TIZA 2EC6B 5KU1A 2JNFA 4HSZA 3LL8B 3RLZA 5ER4X 2I94A 3OX6A 1MXLC 2CT9A 1XFXO 2ISDA 3SG3A 3CZTX 1QIVA 2ZKMX 2JC2A 5I2LA 3GK4X 5B8IB 1DMOA 2BCAA 3I5FC 1JSAA 1IJ6A 5GQQC 4YGCB 1MXEA 1OSAA 5KSZA 2K7OA 1G4YR 2ZRTA 1PRWA 1YX7A 5G08A 2KGRA 5HYDA 1RJVA 1BOCA 4N1GA 3FWCA 1K90D 1OMVA 3KO0A 1EG4A 1NCZA 2L2EA 1F55A 1QIWA 3SG2A 5I2QA 3EK4A 1JC2A 2PMYA 2FCEA 4QJ4B 1CMGA 1R6PA 2LAPA 1LKJA 4YGAA 1YVLA 1DJYA 1A29A 3PN7B 1Y1AA 5DKQA 2NCPA 4PHJA 1NYAA 1IRJA 1B7TZ 1RFJA 4OKHA 2LV7A 1WY9A 2FJUB 1JFKA 1SCMB 1IH0A 2LUCA 4ORAB 1J7RA 1RK9A 2O5GA 4I5LB 1KSOA 1BMOA 5CPVA 3OB1B 1AK8A 1LA0A 1A4PA 1NIWA 2MAZA 1L2OB 1YX8A 3IQQA 3OP0A 2HQWA 2JT8A 1XFVO 1CDLA 1XYDA 2BKIB 5J3XA 1DGUA 2LVJA 3I5HC 4I5JA 1S26D 1WLZA 3H4SE 2LC5A 2MRDA 4GUKA 3EKJA 2EGDA 3CR5X 4P5OE 5TNCA 2WOSA 4P2YB 2JU0A 4BY4A 1NX0A 1WLMA 4MZLA 1AJ4A 2DOQA 3NSKA 2Q4UA 3AKBA 5DKNA 2LLSA 3EVRA 3I5FB 2L4IA 2JTTA 2ZFDA 4WQ3A 2LE9B 1BR4B 1FI5A 2IS9A 1IJ5A 2GGZA 1CM4A 3TS5C 1TCOB 1S3PA 1MWNA 1NCXA 2KYFA 2M49B 1F54A 1ALWA 1TNWA 2HF5A 1XK4C 4PE1A 1SRAA 1TOPA 1UP5A 2LUXA 3PFVA 4DS7A 4JQ0D 1TTXA 2WNDA 4GNKB 4DUQA 4GAOA 3CS1A 5HLOA 1V1FA 1H4BA 3AAKA 3AAJA 1ZUZA 2JT3A 3CWGA 1WRLA 4YGDB 1ALVA 4M2PA 1PSRA 1XFZO 1YURA 5FYXA 1M45A 2OPOA 1G33A 2H2KA 2JOJA 2KNEA 1UURA 1W7JB 2M29A 2M7NA 3VRPA 5F6TA 1ZACA 3WHUB 4JPZB 5CSJA 1C07A 2MLEC 1PSBA 2F33A 1XO5A 1G8IA 2LVKA 1M46A 4IL1A 3NXAA 4A4BA 1NSHA 3I5GB 3LCPC 2M0RA 3I5HB 2AAOA 4CFRA 4OR9B 3C1VA 5HKZA 1XFWO 3JTDC 1AJ5A 1U5IB 1FPWA 1XK4A 1QJTA 4GFTA 2K7DA 2NLNA 1DJIA 2BE4A 2JZIA 3AKAA 1K8UA 3CR2A 4PE0A 2F3ZA 1QX7A 2HQ8A 3FS7A 2KQ6A 2KYCA 4U8DA 1QATA 1L7ZA 3DVKA 1F8HA 4YI8A 1BU3A 1YRUB 4XJKA 1QLKA 3CGAA 2G9BA 2KI6C 2L51A 2SCPA 1SCVA 3TS5B 2ZNEA 2H61C 4UPGA 1Y1UA 2K8MB 1UHJA 2KFGA 1CDPA 2A4JA 3TUYC 1CLMA 1UHIA 2WCBA 5CSFA 1EH2A 3PALA 3A8RA 2HETA 4N5XA 2M3WA 5AERA 4DIRA 1JWDA 1Y1XA 2KI4C 2WCFA 3BQ3A 3D0YA 4HRGA 1CLBA 1V1GA 2M7LA 1OZSA 2KDHA 2PALA 2LP2A 3QRXA 1DJXA 1PALA 1CFDA 4C0JA 1QS7A 1AP4A 4QJ3B 3BOWA 3O78A 1RECA 2LHIA 2LLUA 1YUSA 2L50A 2BL0C 4E68A 1SPYA 2LP3A 1KQMC 2P6BB 5JOLA 5IBWA 2NZ0A 1J1DA 1HQVA 1FF1A 2M8UA 2LCPA 3PM8A 4ZCVA 1OMRA 2QPTA 2R2IA 1SR6B 4GGFC 3D0YB 3IF7A 1SYMA 2JT0A 1MUXA 1QXPA 4AQIA 2B1UA 1K2HA 2KAXA 2F2OA 2RGIA 1HT9A 4DCKA 4F0ZB 2L4HA 2JXCA 1CDMA 1QTXA 3O2PA 4ORCB 2H61A 2BE6A 2LMTA 3KHEA 4TNCA 2Q91A 3WNXB 3JTDB 2KAYA 2I18A 4MZKA 1DJGA 5I8NA 4FTGA 4GGNA 2QACA 1TNQA 2TN4A 1ODBA 4MZJA 1SL7A 1M31A 1PVBA 1RROA 2WCEA 4NDDA 4PHMA 1NUBA 1DTLA 1C7WA 1JBAA 1F4QA 2K2FA 2V53A 2KGBC 1SY9A 1KFUS 1DJWA 1CM1A 1EG3A 1UHHA 3CR4X 3I5IC 3NSLA 4PHKA 1S6CA 3EKHA 5D7FA 1B8LA 2ZRSA 3TUYB 1JF2A 3VRQA 1SL8A 1AUIB 1NX2A 3VRRA 2JWWA 1LINA 4GGFA 4CFQA 2KI4B 3WXAA 2LNKA 1M39A 3PSRA 5HKWA 1NWDA 3VGOA 2ZN8A 1ZFSA 2LANA 1B8RA 1UUSA 2E6WA 2OS8C 1S6IA 3LLEA 4PALA 2MBXA 1CFFA 3O6BA 2CCMA 1JUOA 1PVAA 1KFUL 3LK0A 1BG1A 1YTZC 1DJZA 1K9KA 1TNPA 2JPTA 3BUMB 4D1EA 2ZN9A 2KSPA 2BL0B 3OB2B 3GK2A 3DF0A 2KOTA 2VRGA 1QLSA 2JTZA 3IQOA 2KBIA 2PASA 1QVIY 3PLFB 4ETOA 3TDUA 1N0YA 3JVTC 2I7AA 2JNXA 5HKYA 2D8NA 3HCMA 1J1EA 2CNPA 2SASA 1MF8B 1IQ3A 1BF5A 4M2QA 1KFXS 2F8PA 1CKKA 4QJ5B 2KI6D 4M2OA 1BLQA 1J7QA 1W7IB 1WRZA 5HLVA 5CSIA 2OTGC 3NSIA 1B1GA 1QASA 4C0LA 3BYAA 2MJWB 1K9UA 3TDIA 2KFFA 3CLNA 3OX5A 1PULA 1KK7Z 4JWQA 4YRUA 1ZOTB 5ER5A 2M97A 3BUWB 1DJHA 1QX5B 3KEVA 1F4OA 1LXFC 1MHOA 3OHMB 4MN0A 1A03A 1JFJA 1OZOA 2NXQA 1SNLA 1DT7B 1EJ3A 1UWOA 2LMUA 1BODA 1B47A 4AOMA 2M1UA 4L9MA 2K7CA 4WQ2A 3LK1A 2KHNA 5JJGA 4PE7A 1KFXL 1KK8C 1L2OC 3ICBA 3K21A 1BT6A 1N2DA 3TZ1A 4PE4A 1K95A 4PHNA 1EXRA 3EVUA 1IG5A 1ZMZA 1GJYA 1XA5A 1NCYA 3HX4A 4C0KA 4DRWA 3DVJA 1SKTA 2BKHB 5KTYA 1K93D 4HRHA 1KK7Y 3DVEA 2OS8B 1IKUA 1NX1A 4MRXA 1IGVA 4XJKB 3KF9A 4XYNA 3SIAA 1CNPA 1FW4A 1KWOC 4I5KA 1R2UA 2M9GA 1RTP1 4FQOA 2LLTA 2Y1MA 2HPSA 1NPQA 1QX2A 1SK6D 4HREE 3EK7A 3EK8A 1M63B 1YRTB 3MSEB 1TCFA 1NX3A 1Y0VH 1Y6WA 4MRYA 4OCIA 5CSNA 1IWQA 2L0PA 3JVTB 2M1KB 4CIDA 1S5GZ 1WDCC 1F70A 3FIAA 4Q04A 2Y1NA 2LHLA 2FOTA 3DD4A 1PK0D 2OTGB 1AVSA 2KAVA 3SG6A 2KFHA 1J7OA 3BOWB 2K0JA 3EVVA 3SIBA 1Q80A 1CLLA 2PVBA 1XFYO 2FCDA 1GGWA 3D10A 2MHHA 3BUNB 3KPXA 4ICBA 1TN4A 1FBVA 1N65A 4GBAA 2Y5IA 1DGVA 2CBLA 2ZNDA 1GQMA 3DVMA 2K7BA 2KBMA 2COLB 2AUCA 1TNXA 1S5GY 1KK8B 3M0WA 2BCXA 2GV5A 1MQ1A 2JXLA 1BJFA 1J7PA 3I5GC 1UHKA 3ZNIA 3O4YA 4MBEA 1KCYA 1QVIZ 2LVVA 1RWYA 1KQVA 2BCBA 1K94A 3GOFA 1GGZA 3F45A 1VRKA 2WC8A 2PSRA 1B7TY 3FWBA 1KSMA 5DKRA 3VROA 5PALA 2JULA 4R1EA 4YBHB 2EC6C 3SJSA
chains in the Genus database with same CATH superfamily
1YUTA 3GK1A 4MVFA 3D76A 1KWOB 4NDCA 1A75A 2PRUA 4ORBB 5D69A 1DF0A 5AEQA 1YUUA 2GGMA 4WRIA 3ZWHA 5AFPA 1S36A 1CDNA 3RM1A 2K2AA 4YGBB 2CXJA 1K96A 2E30A 4YI9A 1KQMB 1YVHA 1B4CA 4N1FA 2Y4QA 1X02A 2MA2A 3A4UB 5BPJA 1DVIA 1FI6A 1NP8A 1QV0A 1C7VA 1T14A 2NCOA 2AMIA 1SBJA 1A2XA 1WDCB 4MSPA 1LA3A 1XVJA 3SS4A 1OOJA 2GTEA 1EL4A 1B9AA 1CFCA 2O60A 2L5XB 4YGEB 4BY5A 1OMDA 3CDNA 3PATA 1A75B 1BR1B 1DF0B 3CABA 4NDBA 3BUOB 4MLWA 1CTRA 3WHTB 1S1EA 2MLFC 1F71A 3PN7C 4NQGA 5I2OA 2JRFA 3SS3A 2BBNA 3SG5A 1QV1A 1D1OA 1U5IA 2CTNA 3DF0B 1CMFA 3BUXB 3D77A 4F7FA 1OE9B 4ZCUA 1H8BA 1LVCD 1TRFA 1SCMC 2BECA 1OOHA 1YR5A 2EHBA 1AHRA 1XFRA 1JF0A 2LVIA 4OV2A 2QEVA 2F2PA 4OVNF 1J55A 3SG4A 1SR6C 2K61A 3CTNA 2JQ6A 1SL9A 2KQYA 2G2BA 1IQ5A 3BXKA 3I5IB 4CLNA 3VRNA 1SW8A 3SG7A 4JD9A 4PDZA 4PCWA 5AANA 1OQPA 2F3YA 4MEWA 1CFPA 4A4CA 2PYQA 3NSOA 2I2RE 2L98A 2BNXA 4I5NB 5K89A 1SMGA 1K9PA 5AXIA 1XFUO 1CB1A 1E8AA 1MR8A 2BBMA 2WORA 4GPLB 1S6JA 1UHNA 2LM5A 1B8CA 3UO9A 4PT1A 4AQJA 4CPVA 1WRKA 3E3RA 3TDZA 2LMVA 4USLA 1W9ZA 1TIZA 2EC6B 5KU1A 2JNFA 4HSZA 3LL8B 3RLZA 5ER4X 4INXA 2I94A 3OX6A 1MXLC 2CT9A 1XFXO 2ISDA 3RZSA 3SG3A 3CZTX 1QIVA 2ZKMX 2JC2A 5DICA 3GK4X 5I2LA 5B8IB 1DMOA 2QEBA 1QWVA 2BCAA 3I5FC 1JSAA 1IJ6A 5GQQC 4YGCB 1MXEA 3D74A 1OSAA 5KSZA 2K7OA 1G4YR 2ZRTA 1PRWA 1YX7A 5G08A 2KGRA 5HYDA 1RJVA 2QDIA 1BOCA 3NGVA 4N1GA 3FWCA 1K90D 1OMVA 3KO0A 1EG4A 1NCZA 2L2EA 1F55A 1QIWA 3SG2A 5I2QA 3EK4A 1JC2A 2PMYA 2FCEA 4QJ4B 1CMGA 1R6PA 2LAPA 1LKJA 4YGAA 1YVLA 3NHIA 1DJYA 1A29A 3PN7B 1Y1AA 5DKQA 2NCPA 4PHJA 1NYAA 3S0DA 1IRJA 1B7TZ 1RFJA 4OKHA 3B88A 2LV7A 1WY9A 2FJUB 1JFKA 1SCMB 1IH0A 2LUCA 3QMEA 4ORAB 2L5YA 3S0EA 1J7RA 1RK9A 2O5GA 4I5LB 1KSOA 1BMOA 5CPVA 3OB1B 1AK8A 1LA0A 1A4PA 1NIWA 2MAZA 1L2OB 1YX8A 2WCLA 3IQQA 3OP0A 2HQWA 2JT8A 1XFVO 3B87A 1CDLA 4IJ7A 1ORGA 1XYDA 2BKIB 5J3XA 1DGUA 3FE8A 5D3OA 2LVJA 3I5HC 4I5JA 2WCMA 1S26D 1WLZA 3DZTA 2LC5A 2MRDA 3H4SE 4GUKA 3EKJA 2EGDA 3CR5X 1Z4HA 4P5OE 5TNCA 2WOSA 4P2YB 2BAPA 2JU0A 4BY4A 1NX0A 1WLMA 2QEHA 4MZLA 1AJ4A 2DOQA 3NSKA 2Q4UA 4JKTA 3AKBA 5DKNA 2LLSA 3EVRA 3FE9A 3I5FB 2L4IA 2JTTA 2ZFDA 4WQ3A 1GM0A 2LE9B 1BR4B 1FI5A 2IS9A 1IJ5A 2GGZA 3V2LA 1CM4A 3TS5C 1TCOB 1S3PA 1MWNA 1NCXA 2KYFA 2M49B 1F54A 1ALWA 1TNWA 2HF5A 1XK4C 4PE1A 1SRAA 1TOPA 1UP5A 2LUXA 3PFVA 4DS7A 4JQ0D 1TTXA 2WNDA 4GNKB 3S0BA 4DUQA 4GAOA 3CS1A 5HLOA 1V1FA 1H4BA 3AAKA 3AAJA 1ZUZA 2JT3A 3CWGA 1C3YA 2P71A 3CZ2A 1WRLA 4YGDB 1ALVA 4M2PA 1DQEA 1PSRA 1XFZO 1YURA 5FYXA 1M45A 2OPOA 1G33A 2H2KA 2JOJA 2KNEA 1UURA 1W7JB 2M29A 2M7NA 3VRPA 3D78A 5F6TA 1ZACA 3WHUB 4JPZB 5CSJA 1C07A 2MLEC 1PSBA 2F33A 2KPHA 2KLDA 1XO5A 1G8IA 2LVKA 1M46A 4IL1A 3DYEA 3NXAA 3L4LA 4A4BA 1NSHA 3I5GB 3LCPC 3OBVA 2M0RA 3IVTA 3I5HB 2AAOA 5EL2A 4OR9B 4CFRA 3EG5B 3C1VA 5HKZA 1XFWO 3JTDC 1AJ5A 1U5IB 3O4XA 1XK4A 1QJTA 1FPWA 4GFTA 2K7DA 2NLNA 1DJIA 2BE4A 3K1EA 2JZIA 3AKAA 1K8UA 3CR2A 4PE0A 2F3ZA 1QX7A 2HQ8A 3FS7A 2JPOA 2FJYA 2KQ6A 2KYCA 4U8DA 1QATA 1L7ZA 3DVKA 1F8HA 4YI8A 1BU3A 1YRUB 4XJKA 1QLKA 3CGAA 2G9BA 2WCJA 2KI6C 2L51A 2SCPA 3R1PA 1P28A 1SCVA 3TS5B 2ZNEA 2H61C 4UPGA 1Y1UA 2K8MB 1UHJA 2KFGA 1CDPA 2A4JA 3TUYC 1CLMA 1SSEB 1UHIA 2WCBA 5CSFA 1EH2A 3PALA 3A8RA 2HETA 4N5XA 2M3WA 5AERA 4DIRA 1JWDA 1Y1XA 2KI4C 2WCFA 3BQ3A 3D0YA 4HRGA 1CLBA 1V1GA 3CZ0A 2M7LA 3BFHA 1OZSA 3BJHA 2KDHA 2PALA 2LP2A 3S0AA 3QRXA 1DJXA 1PALA 1CFDA 4C0JA 1QS7A 2KLEA 1AP4A 4QJ3B 3VB1A 3BOWA 3O78A 1RECA 2LHIA 3L47A 2LLUA 1YUSA 2L50A 2BL0C 4E68A 1SPYA 2LP3A 1KQMC 2P6BB 5JOLA 5IBWA 1LS8A 2NZ0A 1J1DA 1HQVA 1FF1A 2M8UA 2LCPA 3PM8A 4ZCVA 1OMRA 2QPTA 2R2IA 1SR6B 4GGFC 3D0YB 3IF7A 1SYMA 2JT0A 1MUXA 1QXPA 4AQIA 2B1UA 1K2HA 2KAXA 2F2OA 2RGIA 1HT9A 4DCKA 4F0ZB 2K60A 2JXCA 2L4HA 1CDMA 1QTXA 3O2PA 4ORCB 2H61A 2BE6A 2LMTA 3KHEA 4TNCA 2Q91A 4OZDA 3WNXB 3JTDB 2KAYA 2I18A 4FQTA 4MZKA 1DJGA 5I8NA 4FTGA 4GGNA 2QACA 1TNQA 2TN4A 1ODBA 4MZJA 1SL7A 1M31A 1PVBA 1RROA 2WCEA 4NDDA 4PHMA 5FI7A 1NUBA 1DTLA 3D73A 1C7WA 1JBAA 1F4QA 2K2FA 2V53A 2KGBC 1SY9A 1KFUS 3DY9A 1Z2CB 1DJWA 1CM1A 1EG3A 1UHHA 3CR4X 3I5IC 3NSLA 4PHKA 1S6CA 3OGNA 3D75A 3Q8IA 2QEOA 3EKHA 2ERBA 5D7FA 1B8LA 2ZRSA 3TUYB 1JF2A 3VRQA 3L4AA 1SL8A 1AUIB 1NX2A 3VRRA 2JWWA 1LINA 4GGFA 4CFQA 2KI4B 3WXAA 2LNKA 1M39A 3PSRA 5HKWA 1NWDA 3VGOA 2ZN8A 1ZFSA 2LANA 1B8RA 1UUSA 2E6WA 1OW4A 5I94A 2OS8C 1S6IA 3LLEA 4PALA 2MBXA 1CFFA 3R72A 3O6BA 2CCMA 1JUOA 1PVAA 1KFUL 3LK0A 1BG1A 1YTZC 1DJZA 1K9KA 3BFBA 1TNPA 2JPTA 3BUMB 1DC1A 4D1EA 2ZN9A 2KSPA 2BL0B 3OB2B 3GK2A 3DF0A 2KOTA 2VRGA 1QLSA 2JTZA 3IQOA 2KBIA 2PASA 1QVIY 3PLFB 3R1VA 1C3ZA 4ETOA 3TDUA 1N0YA 3JVTC 2I7AA 2JNXA 5HKYA 2D8NA 3HCMA 1J1EA 3N7HA 2CNPA 2SASA 1MF8B 1IQ3A 1BF5A 4M2QA 1KFXS 2F8PA 3S0FA 3DXLA 4QJ5B 1CKKA 2KI6D 4M2OA 3S0GA 1BLQA 1W7IB 3R1OA 1J7QA 1WRZA 5HLVA 5CSIA 2OTGC 3NSIA 1B1GA 1QASA 4C0LA 3BYAA 1OOFA 2MJWB 1K9UA 2H8VA 2KFFA 3CLNA 3OX5A 1PULA 1KK7Z 4JWQA 4KYNA 3TDIA 1ZOTB 4YRUA 5ER5A 2L2CA 2M97A 3BUWB 1DJHA 1QX5B 3KEVA 1DELA 1F4OA 1LXFC 1MHOA 3OHMB 4MN0A 1A03A 1IIOA 1JFJA 1OZOA 2NXQA 2WC5A 1SNLA 1DT7B 1EJ3A 1UWOA 2LMUA 1BODA 1B47A 4AOMA 3PM2A 2M1UA 2WC6A 2K7CA 3B6XA 2YGUA 2KHNA 3FE6A 3LK1A 4L9MA 4WQ2A 4PE7A 5JJGA 1KFXL 1KK8C 1L2OC 3ICBA 3K21A 1BT6A 1N2DA 1OOIX 3TZ1A 4PE4A 1K95A 4PHNA 1EXRA 3EVUA 1IG5A 1ZMZA 1GJYA 1XA5A 5FI6A 1NCYA 3HX4A 4C0KA 4DRWA 3B86A 1SKTA 2BKHB 3DVJA 5HL1A 5KTYA 1K93D 4HRHA 1KK7Y 3DVEA 2OS8B 1IKUA 1NX1A 4MRXA 2WCKA 1IGVA 4XJKB 3KF9A 4XYNA 3SIAA 1CNPA 1FW4A 1KWOC 4I5KA 1R2UA 2M9GA 1RTP1 4FQOA 2LLTA 2Y1MA 2HPSA 1NPQA 1QX2A 1SK6D 4HREE 3EK7A 3EK8A 1M63B 1YRTB 3PJIA 3MSEB 1TCFA 1NX3A 1Y0VH 1Y6WA 4MRYA 4OCIA 5CSNA 1IWQA 2WCHA 2L0PA 3JVTB 2M1KB 4INWA 3B7AA 4CIDA 1S5GZ 1WDCC 1F70A 3FIAA 4Q04A 2Y1NA 1TUJA 2LHLA 1OOGA 2FOTA 3DD4A 1PK0D 2OTGB 1AVSA 2KAVA 3SG6A 2KFHA 1J7OA 3BOWB 2K0JA 3EVVA 3SIBA 1Q80A 1CLLA 2PVBA 1XFYO 2FCDA 1GGWA 3BFAA 3D10A 2MHHA 3BUNB 3KPXA 4ICBA 1TN4A 1FBVA 1N65A 4GBAA 2Y5IA 1DGVA 3UNWA 5FI2A 2CBLA 2ZNDA 1GQMA 3DVMA 2K7BA 2KBMA 2COLB 2AUCA 1TNXA 1S5GY 1TWOA 1KK8B 3M0WA 1TUZA 3SS5A 2BCXA 1DEKA 2GV5A 1MQ1A 2JXLA 1BJFA 1J7PA 3I5GC 3CYZA 1UHKA 3ZNIA 3O4YA 4MBEA 1KCYA 1QVIZ 2LVVA 1RWYA 1KQVA 2BCBA 1K94A 2PQLA 3GOFA 2P70A 1GGZA 3F45A 3CZ1A 1VRKA 2WC8A 2PSRA 1B7TY 3FWBA 3NHTA 1KSMA 5DKRA 3VROA 5PALA 2JULA 4R1EA 4YBHB 2EC6C 3SJSA
chains in the Genus database with same CATH topology
1YUTA 3GK1A 4MVFA 1KWOB 4NDCA 1A75A 2PRUA 4ORBB 5D69A 1DF0A 5AEQA 1YUUA 2GGMA 4WRIA 3ZWHA 5AFPA 1S36A 1CDNA 3RM1A 2K2AA 4YGBB 2CXJA 1K96A 2E30A 4YI9A 1KQMB 1YVHA 1B4CA 4N1FA 2Y4QA 1X02A 2MA2A 3A4UB 5BPJA 1DVIA 1FI6A 1NP8A 1QV0A 1C7VA 2NCOA 2AMIA 1SBJA 1A2XA 1WDCB 4MSPA 1LA3A 1XVJA 1OOJA 1EL4A 1B9AA 1CFCA 2O60A 2L5XB 4YGEB 4BY5A 1OMDA 3PATA 1A75B 1BR1B 1DF0B 4NDBA 3BUOB 4MLWA 1CTRA 3WHTB 1S1EA 2MLFC 1F71A 3PN7C 4NQGA 5I2OA 2JRFA 3SG5A 2BBNA 1QV1A 1D1OA 1U5IA 2CTNA 3DF0B 1CMFA 3BUXB 1OE9B 4ZCUA 1H8BA 1LVCD 1TRFA 1SCMC 2BECA 1YR5A 2EHBA 1AHRA 2LVIA 1JF0A 4OV2A 2F2PA 4OVNF 1J55A 3SG4A 1SR6C 2K61A 3CTNA 2JQ6A 1SL9A 2KQYA 2G2BA 1IQ5A 3BXKA 3I5IB 4CLNA 3VRNA 1SW8A 3SG7A 4PDZA 4PCWA 5AANA 1OQPA 2F3YA 4MEWA 1CFPA 4A4CA 3NSOA 2I2RE 2L98A 4I5NB 5K89A 1SMGA 1K9PA 5AXIA 1XFUO 1CB1A 1E8AA 1MR8A 2BBMA 2WORA 4GPLB 1S6JA 1UHNA 2LM5A 1B8CA 4CPVA 4AQJA 1WRKA 3E3RA 3TDZA 2LMVA 4USLA 1TIZA 2EC6B 5KU1A 2JNFA 4HSZA 3LL8B 3RLZA 5ER4X 2I94A 3OX6A 1MXLC 2CT9A 1XFXO 2ISDA 3SG3A 3CZTX 1QIVA 2ZKMX 2JC2A 5I2LA 3GK4X 5B8IB 1DMOA 2BCAA 3I5FC 1JSAA 1IJ6A 5GQQC 4YGCB 1MXEA 1OSAA 5KSZA 2K7OA 1G4YR 2ZRTA 1PRWA 1YX7A 5G08A 2KGRA 5HYDA 1RJVA 1BOCA 4N1GA 3FWCA 1K90D 1OMVA 3KO0A 1EG4A 1NCZA 2L2EA 1F55A 1QIWA 3SG2A 5I2QA 3EK4A 1JC2A 2PMYA 2FCEA 4QJ4B 1CMGA 1R6PA 2LAPA 1LKJA 4YGAA 1YVLA 1DJYA 1A29A 3PN7B 1Y1AA 5DKQA 2NCPA 4PHJA 1NYAA 1IRJA 1B7TZ 1RFJA 4OKHA 2LV7A 1WY9A 2FJUB 1JFKA 1SCMB 1IH0A 2LUCA 4ORAB 1J7RA 1RK9A 2O5GA 4I5LB 1KSOA 1BMOA 5CPVA 3OB1B 1AK8A 1LA0A 1A4PA 1NIWA 2MAZA 1L2OB 1YX8A 3IQQA 3OP0A 2HQWA 2JT8A 1XFVO 1CDLA 1XYDA 2BKIB 5J3XA 1DGUA 2LVJA 3I5HC 4I5JA 1S26D 1WLZA 3H4SE 2LC5A 2MRDA 4GUKA 3EKJA 2EGDA 3CR5X 4P5OE 5TNCA 2WOSA 4P2YB 2JU0A 4BY4A 1NX0A 1WLMA 4MZLA 1AJ4A 2DOQA 3NSKA 2Q4UA 3AKBA 5DKNA 2LLSA 3EVRA 3I5FB 2L4IA 2JTTA 2ZFDA 4WQ3A 2LE9B 1BR4B 1FI5A 2IS9A 1IJ5A 2GGZA 1CM4A 3TS5C 1TCOB 1S3PA 1MWNA 1NCXA 2KYFA 2M49B 1F54A 1ALWA 1TNWA 2HF5A 1XK4C 4PE1A 1SRAA 1TOPA 1UP5A 2LUXA 3PFVA 4DS7A 4JQ0D 1TTXA 2WNDA 4GNKB 4DUQA 4GAOA 3CS1A 5HLOA 1V1FA 1H4BA 3AAKA 3AAJA 1ZUZA 2JT3A 3CWGA 1WRLA 4YGDB 1ALVA 4M2PA 1PSRA 1XFZO 1YURA 5FYXA 1M45A 2OPOA 1G33A 2H2KA 2JOJA 2KNEA 1UURA 1W7JB 2M29A 2M7NA 3VRPA 5F6TA 1ZACA 3WHUB 4JPZB 5CSJA 1C07A 2MLEC 1PSBA 2F33A 1XO5A 1G8IA 2LVKA 1M46A 4IL1A 3NXAA 4A4BA 1NSHA 3I5GB 3LCPC 2M0RA 3I5HB 2AAOA 4CFRA 4OR9B 3C1VA 5HKZA 1XFWO 3JTDC 1AJ5A 1U5IB 1FPWA 1XK4A 1QJTA 4GFTA 2K7DA 2NLNA 1DJIA 2BE4A 2JZIA 3AKAA 1K8UA 3CR2A 4PE0A 2F3ZA 1QX7A 2HQ8A 3FS7A 2KQ6A 2KYCA 4U8DA 1QATA 1L7ZA 3DVKA 1F8HA 4YI8A 1BU3A 1YRUB 4XJKA 1QLKA 3CGAA 2G9BA 2KI6C 2L51A 2SCPA 1SCVA 3TS5B 2ZNEA 2H61C 4UPGA 1Y1UA 2K8MB 1UHJA 2KFGA 1CDPA 2A4JA 3TUYC 1CLMA 1UHIA 2WCBA 5CSFA 1EH2A 3PALA 3A8RA 2HETA 4N5XA 2M3WA 5AERA 4DIRA 1JWDA 1Y1XA 2KI4C 2WCFA 3BQ3A 3D0YA 4HRGA 1CLBA 1V1GA 2M7LA 1OZSA 2KDHA 2PALA 2LP2A 3QRXA 1DJXA 1PALA 1CFDA 4C0JA 1QS7A 1AP4A 4QJ3B 3BOWA 3O78A 1RECA 2LHIA 2LLUA 1YUSA 2L50A 2BL0C 4E68A 1SPYA 2LP3A 1KQMC 2P6BB 5JOLA 5IBWA 2NZ0A 1J1DA 1HQVA 1FF1A 2M8UA 2LCPA 3PM8A 4ZCVA 1OMRA 2QPTA 2R2IA 1SR6B 4GGFC 3D0YB 3IF7A 1SYMA 2JT0A 1MUXA 1QXPA 4AQIA 2B1UA 1K2HA 2KAXA 2F2OA 2RGIA 1HT9A 4DCKA 4F0ZB 2L4HA 2JXCA 1CDMA 1QTXA 3O2PA 4ORCB 2H61A 2BE6A 2LMTA 3KHEA 4TNCA 2Q91A 3WNXB 3JTDB 2KAYA 2I18A 4MZKA 1DJGA 5I8NA 4FTGA 4GGNA 2QACA 1TNQA 2TN4A 1ODBA 4MZJA 1SL7A 1M31A 1PVBA 1RROA 2WCEA 4NDDA 4PHMA 1NUBA 1DTLA 1C7WA 1JBAA 1F4QA 2K2FA 2V53A 2KGBC 1SY9A 1KFUS 1DJWA 1CM1A 1EG3A 1UHHA 3CR4X 3I5IC 3NSLA 4PHKA 1S6CA 3EKHA 5D7FA 1B8LA 2ZRSA 3TUYB 1JF2A 3VRQA 1SL8A 1AUIB 1NX2A 3VRRA 2JWWA 1LINA 4GGFA 4CFQA 2KI4B 3WXAA 2LNKA 1M39A 3PSRA 5HKWA 1NWDA 3VGOA 2ZN8A 1ZFSA 2LANA 1B8RA 1UUSA 2E6WA 2OS8C 1S6IA 3LLEA 4PALA 2MBXA 1CFFA 3O6BA 2CCMA 1JUOA 1PVAA 1KFUL 3LK0A 1BG1A 1YTZC 1DJZA 1K9KA 1TNPA 2JPTA 3BUMB 4D1EA 2ZN9A 2KSPA 2BL0B 3OB2B 3GK2A 3DF0A 2KOTA 2VRGA 1QLSA 2JTZA 3IQOA 2KBIA 2PASA 1QVIY 3PLFB 4ETOA 3TDUA 1N0YA 3JVTC 2I7AA 2JNXA 5HKYA 2D8NA 3HCMA 1J1EA 2CNPA 2SASA 1MF8B 1IQ3A 1BF5A 4M2QA 1KFXS 2F8PA 1CKKA 4QJ5B 2KI6D 4M2OA 1BLQA 1J7QA 1W7IB 1WRZA 5HLVA 5CSIA 2OTGC 3NSIA 1B1GA 1QASA 4C0LA 3BYAA 2MJWB 1K9UA 3TDIA 2KFFA 3CLNA 3OX5A 1PULA 1KK7Z 4JWQA 4YRUA 1ZOTB 5ER5A 2M97A 3BUWB 1DJHA 1QX5B 3KEVA 1F4OA 1LXFC 1MHOA 3OHMB 4MN0A 1A03A 1JFJA 1OZOA 2NXQA 1SNLA 1DT7B 1EJ3A 1UWOA 2LMUA 1BODA 1B47A 4AOMA 2M1UA 4L9MA 2K7CA 4WQ2A 3LK1A 2KHNA 5JJGA 4PE7A 1KFXL 1KK8C 1L2OC 3ICBA 3K21A 1BT6A 1N2DA 3TZ1A 4PE4A 1K95A 4PHNA 1EXRA 3EVUA 1IG5A 1ZMZA 1GJYA 1XA5A 1NCYA 3HX4A 4C0KA 4DRWA 3DVJA 1SKTA 2BKHB 5KTYA 1K93D 4HRHA 1KK7Y 3DVEA 2OS8B 1IKUA 1NX1A 4MRXA 1IGVA 4XJKB 3KF9A 4XYNA 3SIAA 1CNPA 1FW4A 1KWOC 4I5KA 1R2UA 2M9GA 1RTP1 4FQOA 2LLTA 2Y1MA 2HPSA 1NPQA 1QX2A 1SK6D 4HREE 3EK7A 3EK8A 1M63B 1YRTB 3MSEB 1TCFA 1NX3A 1Y0VH 1Y6WA 4MRYA 4OCIA 5CSNA 1IWQA 2L0PA 3JVTB 2M1KB 4CIDA 1S5GZ 1WDCC 1F70A 3FIAA 4Q04A 2Y1NA 2LHLA 2FOTA 3DD4A 1PK0D 2OTGB 1AVSA 2KAVA 3SG6A 2KFHA 1J7OA 3BOWB 2K0JA 3EVVA 3SIBA 1Q80A 1CLLA 2PVBA 1XFYO 2FCDA 1GGWA 3D10A 2MHHA 3BUNB 3KPXA 4ICBA 1TN4A 1FBVA 1N65A 4GBAA 2Y5IA 1DGVA 2CBLA 2ZNDA 1GQMA 3DVMA 2K7BA 2KBMA 2COLB 2AUCA 1TNXA 1S5GY 1KK8B 3M0WA 2BCXA 2GV5A 1MQ1A 2JXLA 1BJFA 1J7PA 3I5GC 1UHKA 3ZNIA 3O4YA 4MBEA 1KCYA 1QVIZ 2LVVA 1RWYA 1KQVA 2BCBA 1K94A 3GOFA 1GGZA 3F45A 1VRKA 2WC8A 2PSRA 1B7TY 3FWBA 1KSMA 5DKRA 3VROA 5PALA 2JULA 4R1EA 4YBHB 2EC6C 3SJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUT A;  3GK1 A;  4MVF A;  1KWO B;  4NDC A;  1A75 A;  2PRU A;  4ORB B;  5D69 A;  1DF0 A;  5AEQ A;  1YUU A;  2GGM A;  4WRI A;  3ZWH A;  5AFP A;  1S36 A;  1CDN A;  3RM1 A;  2K2A A;  4YGB B;  2CXJ A;  1K96 A;  2E30 A;  4YI9 A;  1KQM B;  1YVH A;  1B4C A;  4N1F A;  2Y4Q A;  1X02 A;  2MA2 A;  3A4U B;  5BPJ A;  1DVI A;  1FI6 A;  1NP8 A;  1QV0 A;  1C7V A;  2NCO A;  2AMI A;  1SBJ A;  1A2X A;  1WDC B;  4MSP A;  1LA3 A;  1XVJ A;  1OOJ A;  1EL4 A;  1B9A A;  1CFC A;  2O60 A;  2L5X B;  4YGE B;  4BY5 A;  1OMD A;  3PAT A;  1A75 B;  1BR1 B;  1DF0 B;  4NDB A;  3BUO B;  4MLW A;  1CTR A;  3WHT B;  1S1E A;  2MLF C;  1F71 A;  3PN7 C;  4NQG A;  5I2O A;  2JRF A;  3SG5 A;  2BBN A;  1QV1 A;  1D1O A;  1U5I A;  2CTN A;  3DF0 B;  1CMF A;  3BUX B;  1OE9 B;  4ZCU A;  1H8B A;  1LVC D;  1TRF A;  1SCM C;  2BEC A;  1YR5 A;  2EHB A;  1AHR A;  2LVI A;  1JF0 A;  4OV2 A;  2F2P A;  4OVN F;  1J55 A;  3SG4 A;  1SR6 C;  2K61 A;  3CTN A;  2JQ6 A;  1SL9 A;  2KQY A;  2G2B A;  1IQ5 A;  3BXK A;  3I5I B;  4CLN A;  3VRN A;  1SW8 A;  3SG7 A;  4PDZ A;  4PCW A;  5AAN A;  1OQP A;  2F3Y A;  4MEW A;  1CFP A;  4A4C A;  3NSO A;  2I2R E;  2L98 A;  4I5N B;  5K89 A;  1SMG A;  1K9P A;  5AXI A;  1XFU O;  1CB1 A;  1E8A A;  1MR8 A;  2BBM A;  2WOR A;  4GPL B;  1S6J A;  1UHN A;  2LM5 A;  1B8C A;  4CPV A;  4AQJ A;  1WRK A;  3E3R A;  3TDZ A;  2LMV A;  4USL A;  1TIZ A;  2EC6 B;  5KU1 A;  2JNF A;  4HSZ A;  3LL8 B;  3RLZ A;  5ER4 X;  2I94 A;  3OX6 A;  1MXL C;  2CT9 A;  1XFX O;  2ISD A;  3SG3 A;  3CZT X;  1QIV A;  2ZKM X;  2JC2 A;  5I2L A;  3GK4 X;  5B8I B;  1DMO A;  2BCA A;  3I5F C;  1JSA A;  1IJ6 A;  5GQQ C;  4YGC B;  1MXE A;  1OSA A;  5KSZ A;  2K7O A;  1G4Y R;  2ZRT A;  1PRW A;  1YX7 A;  5G08 A;  2KGR A;  5HYD A;  1RJV A;  1BOC A;  4N1G A;  3FWC A;  1K90 D;  1OMV A;  3KO0 A;  1EG4 A;  1NCZ A;  2L2E A;  1F55 A;  1QIW A;  3SG2 A;  5I2Q A;  3EK4 A;  1JC2 A;  2PMY A;  2FCE A;  4QJ4 B;  1CMG A;  1R6P A;  2LAP A;  1LKJ A;  4YGA A;  1YVL A;  1DJY A;  1A29 A;  3PN7 B;  1Y1A A;  5DKQ A;  2NCP A;  4PHJ A;  1NYA A;  1IRJ A;  1B7T Z;  1RFJ A;  4OKH A;  2LV7 A;  1WY9 A;  2FJU B;  1JFK A;  1SCM B;  1IH0 A;  2LUC A;  4ORA B;  1J7R A;  1RK9 A;  2O5G A;  4I5L B;  1KSO A;  1BMO A;  5CPV A;  3OB1 B;  1AK8 A;  1LA0 A;  1A4P A;  1NIW A;  2MAZ A;  1L2O B;  1YX8 A;  3IQQ A;  3OP0 A;  2HQW A;  2JT8 A;  1XFV O;  1CDL A;  1XYD A;  2BKI B;  5J3X A;  1DGU A;  2LVJ A;  3I5H C;  4I5J A;  1S26 D;  1WLZ A;  3H4S E;  2LC5 A;  2MRD A;  4GUK A;  3EKJ A;  2EGD A;  3CR5 X;  4P5O E;  5TNC A;  2WOS A;  4P2Y B;  2JU0 A;  4BY4 A;  1NX0 A;  1WLM A;  4MZL A;  1AJ4 A;  2DOQ A;  3NSK A;  2Q4U A;  3AKB A;  5DKN A;  2LLS A;  3EVR A;  3I5F B;  2L4I A;  2JTT A;  2ZFD A;  4WQ3 A;  2LE9 B;  1BR4 B;  1FI5 A;  2IS9 A;  1IJ5 A;  2GGZ A;  1CM4 A;  3TS5 C;  1TCO B;  1S3P A;  1MWN A;  1NCX A;  2KYF A;  2M49 B;  1F54 A;  1ALW A;  1TNW A;  2HF5 A;  1XK4 C;  4PE1 A;  1SRA A;  1TOP A;  1UP5 A;  2LUX A;  3PFV A;  4DS7 A;  4JQ0 D;  1TTX A;  2WND A;  4GNK B;  4DUQ A;  4GAO A;  3CS1 A;  5HLO A;  1V1F A;  1H4B A;  3AAK A;  3AAJ A;  1ZUZ A;  2JT3 A;  3CWG A;  1WRL A;  4YGD B;  1ALV A;  4M2P A;  1PSR A;  1XFZ O;  1YUR A;  5FYX A;  1M45 A;  2OPO A;  1G33 A;  2H2K A;  2JOJ A;  2KNE A;  1UUR A;  1W7J B;  2M29 A;  2M7N A;  3VRP A;  5F6T A;  1ZAC A;  3WHU B;  4JPZ B;  5CSJ A;  1C07 A;  2MLE C;  1PSB A;  2F33 A;  1XO5 A;  1G8I A;  2LVK A;  1M46 A;  4IL1 A;  3NXA A;  4A4B A;  1NSH A;  3I5G B;  3LCP C;  2M0R A;  3I5H B;  2AAO A;  4CFR A;  4OR9 B;  3C1V A;  5HKZ A;  1XFW O;  3JTD C;  1AJ5 A;  1U5I B;  1FPW A;  1XK4 A;  1QJT A;  4GFT A;  2K7D A;  2NLN A;  1DJI A;  2BE4 A;  2JZI A;  3AKA A;  1K8U A;  3CR2 A;  4PE0 A;  2F3Z A;  1QX7 A;  2HQ8 A;  3FS7 A;  2KQ6 A;  2KYC A;  4U8D A;  1QAT A;  1L7Z A;  3DVK A;  1F8H A;  4YI8 A;  1BU3 A;  1YRU B;  4XJK A;  1QLK A;  3CGA A;  2G9B A;  2KI6 C;  2L51 A;  2SCP A;  1SCV A;  3TS5 B;  2ZNE A;  2H61 C;  4UPG A;  1Y1U A;  2K8M B;  1UHJ A;  2KFG A;  1CDP A;  2A4J A;  3TUY C;  1CLM A;  1UHI A;  2WCB A;  5CSF A;  1EH2 A;  3PAL A;  3A8R A;  2HET A;  4N5X A;  2M3W A;  5AER A;  4DIR A;  1JWD A;  1Y1X A;  2KI4 C;  2WCF A;  3BQ3 A;  3D0Y A;  4HRG A;  1CLB A;  1V1G A;  2M7L A;  1OZS A;  2KDH A;  2PAL A;  2LP2 A;  3QRX A;  1DJX A;  1PAL A;  1CFD A;  4C0J A;  1QS7 A;  1AP4 A;  4QJ3 B;  3BOW A;  3O78 A;  1REC A;  2LHI A;  2LLU A;  1YUS A;  2L50 A;  2BL0 C;  4E68 A;  1SPY A;  2LP3 A;  1KQM C;  2P6B B;  5JOL A;  5IBW A;  2NZ0 A;  1J1D A;  1HQV A;  1FF1 A;  2M8U A;  2LCP A;  3PM8 A;  4ZCV A;  1OMR A;  2QPT A;  2R2I A;  1SR6 B;  4GGF C;  3D0Y B;  3IF7 A;  1SYM A;  2JT0 A;  1MUX A;  1QXP A;  4AQI A;  2B1U A;  1K2H A;  2KAX A;  2F2O A;  2RGI A;  1HT9 A;  4DCK A;  4F0Z B;  2L4H A;  2JXC A;  1CDM A;  1QTX A;  3O2P A;  4ORC B;  2H61 A;  2BE6 A;  2LMT A;  3KHE A;  4TNC A;  2Q91 A;  3WNX B;  3JTD B;  2KAY A;  2I18 A;  4MZK A;  1DJG A;  5I8N A;  4FTG A;  4GGN A;  2QAC A;  1TNQ A;  2TN4 A;  1ODB A;  4MZJ A;  1SL7 A;  1M31 A;  1PVB A;  1RRO A;  2WCE A;  4NDD A;  4PHM A;  1NUB A;  1DTL A;  1C7W A;  1JBA A;  1F4Q A;  2K2F A;  2V53 A;  2KGB C;  1SY9 A;  1KFU S;  1DJW A;  1CM1 A;  1EG3 A;  1UHH A;  3CR4 X;  3I5I C;  3NSL A;  4PHK A;  1S6C A;  3EKH A;  5D7F A;  1B8L A;  2ZRS A;  3TUY B;  1JF2 A;  3VRQ A;  1SL8 A;  1AUI B;  1NX2 A;  3VRR A;  2JWW A;  1LIN A;  4GGF A;  4CFQ A;  2KI4 B;  3WXA A;  2LNK A;  1M39 A;  3PSR A;  5HKW A;  1NWD A;  3VGO A;  2ZN8 A;  1ZFS A;  2LAN A;  1B8R A;  1UUS A;  2E6W A;  2OS8 C;  1S6I A;  3LLE A;  4PAL A;  2MBX A;  1CFF A;  3O6B A;  2CCM A;  1JUO A;  1PVA A;  1KFU L;  3LK0 A;  1BG1 A;  1YTZ C;  1DJZ A;  1K9K A;  1TNP A;  2JPT A;  3BUM B;  4D1E A;  2ZN9 A;  2KSP A;  2BL0 B;  3OB2 B;  3GK2 A;  3DF0 A;  2KOT A;  2VRG A;  1QLS A;  2JTZ A;  3IQO A;  2KBI A;  2PAS A;  1QVI Y;  3PLF B;  4ETO A;  3TDU A;  1N0Y A;  3JVT C;  2I7A A;  2JNX A;  5HKY A;  2D8N A;  3HCM A;  1J1E A;  2CNP A;  2SAS A;  1MF8 B;  1IQ3 A;  1BF5 A;  4M2Q A;  1KFX S;  2F8P A;  1CKK A;  4QJ5 B;  2KI6 D;  4M2O A;  1BLQ A;  1J7Q A;  1W7I B;  1WRZ A;  5HLV A;  5CSI A;  2OTG C;  3NSI A;  1B1G A;  1QAS A;  4C0L A;  3BYA A;  2MJW B;  1K9U A;  3TDI A;  2KFF A;  3CLN A;  3OX5 A;  1PUL A;  1KK7 Z;  4JWQ A;  4YRU A;  1ZOT B;  5ER5 A;  2M97 A;  3BUW B;  1DJH A;  1QX5 B;  3KEV A;  1F4O A;  1LXF C;  1MHO A;  3OHM B;  4MN0 A;  1A03 A;  1JFJ A;  1OZO A;  2NXQ A;  1SNL A;  1DT7 B;  1EJ3 A;  1UWO A;  2LMU A;  1BOD A;  1B47 A;  4AOM A;  2M1U A;  4L9M A;  2K7C A;  4WQ2 A;  3LK1 A;  2KHN A;  5JJG A;  4PE7 A;  1KFX L;  1KK8 C;  1L2O C;  3ICB A;  3K21 A;  1BT6 A;  1N2D A;  3TZ1 A;  4PE4 A;  1K95 A;  4PHN A;  1EXR A;  3EVU A;  1IG5 A;  1ZMZ A;  1GJY A;  1XA5 A;  1NCY A;  3HX4 A;  4C0K A;  4DRW A;  3DVJ A;  1SKT A;  2BKH B;  5KTY A;  1K93 D;  4HRH A;  1KK7 Y;  3DVE A;  2OS8 B;  1IKU A;  1NX1 A;  4MRX A;  1IGV A;  4XJK B;  3KF9 A;  4XYN A;  3SIA A;  1CNP A;  1FW4 A;  1KWO C;  4I5K A;  1R2U A;  2M9G A;  1RTP 1;  4FQO A;  2LLT A;  2Y1M A;  2HPS A;  1NPQ A;  1QX2 A;  1SK6 D;  4HRE E;  3EK7 A;  3EK8 A;  1M63 B;  1YRT B;  3MSE B;  1TCF A;  1NX3 A;  1Y0V H;  1Y6W A;  4MRY A;  4OCI A;  5CSN A;  1IWQ A;  2L0P A;  3JVT B;  2M1K B;  4CID A;  1S5G Z;  1WDC C;  1F70 A;  3FIA A;  4Q04 A;  2Y1N A;  2LHL A;  2FOT A;  3DD4 A;  1PK0 D;  2OTG B;  1AVS A;  2KAV A;  3SG6 A;  2KFH A;  1J7O A;  3BOW B;  2K0J A;  3EVV A;  3SIB A;  1Q80 A;  1CLL A;  2PVB A;  1XFY O;  2FCD A;  1GGW A;  3D10 A;  2MHH A;  3BUN B;  3KPX A;  4ICB A;  1TN4 A;  1FBV A;  1N65 A;  4GBA A;  2Y5I A;  1DGV A;  2CBL A;  2ZND A;  1GQM A;  3DVM A;  2K7B A;  2KBM A;  2COL B;  2AUC A;  1TNX A;  1S5G Y;  1KK8 B;  3M0W A;  2BCX A;  2GV5 A;  1MQ1 A;  2JXL A;  1BJF A;  1J7P A;  3I5G C;  1UHK A;  3ZNI A;  3O4Y A;  4MBE A;  1KCY A;  1QVI Z;  2LVV A;  1RWY A;  1KQV A;  2BCB A;  1K94 A;  3GOF A;  1GGZ A;  3F45 A;  1VRK A;  2WC8 A;  2PSR A;  1B7T Y;  3FWB A;  1KSM A;  5DKR A;  3VRO A;  5PAL A;  2JUL A;  4R1E A;  4YBH B;  2EC6 C;  3SJS A; 
#chains in the Genus database with same CATH topology
 1YUT A;  3GK1 A;  4MVF A;  3D76 A;  1KWO B;  4NDC A;  1A75 A;  2PRU A;  4ORB B;  5D69 A;  1DF0 A;  5AEQ A;  1YUU A;  2GGM A;  4WRI A;  3ZWH A;  5AFP A;  1S36 A;  1CDN A;  3RM1 A;  2K2A A;  4YGB B;  2CXJ A;  1K96 A;  2E30 A;  4YI9 A;  1KQM B;  1YVH A;  1B4C A;  4N1F A;  2Y4Q A;  1X02 A;  2MA2 A;  3A4U B;  5BPJ A;  1DVI A;  1FI6 A;  1NP8 A;  1QV0 A;  1C7V A;  1T14 A;  2NCO A;  2AMI A;  1SBJ A;  1A2X A;  1WDC B;  4MSP A;  1LA3 A;  1XVJ A;  3SS4 A;  1OOJ A;  2GTE A;  1EL4 A;  1B9A A;  1CFC A;  2O60 A;  2L5X B;  4YGE B;  4BY5 A;  1OMD A;  3CDN A;  3PAT A;  1A75 B;  1BR1 B;  1DF0 B;  3CAB A;  4NDB A;  3BUO B;  4MLW A;  1CTR A;  3WHT B;  1S1E A;  2MLF C;  1F71 A;  3PN7 C;  4NQG A;  5I2O A;  2JRF A;  3SS3 A;  2BBN A;  3SG5 A;  1QV1 A;  1D1O A;  1U5I A;  2CTN A;  3DF0 B;  1CMF A;  3BUX B;  3D77 A;  4F7F A;  1OE9 B;  4ZCU A;  1H8B A;  1LVC D;  1TRF A;  1SCM C;  2BEC A;  1OOH A;  1YR5 A;  2EHB A;  1AHR A;  1XFR A;  1JF0 A;  2LVI A;  4OV2 A;  2QEV A;  2F2P A;  4OVN F;  1J55 A;  3SG4 A;  1SR6 C;  2K61 A;  3CTN A;  2JQ6 A;  1SL9 A;  2KQY A;  2G2B A;  1IQ5 A;  3BXK A;  3I5I B;  4CLN A;  3VRN A;  1SW8 A;  3SG7 A;  4JD9 A;  4PDZ A;  4PCW A;  5AAN A;  1OQP A;  2F3Y A;  4MEW A;  1CFP A;  4A4C A;  2PYQ A;  3NSO A;  2I2R E;  2L98 A;  2BNX A;  4I5N B;  5K89 A;  1SMG A;  1K9P A;  5AXI A;  1XFU O;  1CB1 A;  1E8A A;  1MR8 A;  2BBM A;  2WOR A;  4GPL B;  1S6J A;  1UHN A;  2LM5 A;  1B8C A;  3UO9 A;  4PT1 A;  4AQJ A;  4CPV A;  1WRK A;  3E3R A;  3TDZ A;  2LMV A;  4USL A;  1W9Z A;  1TIZ A;  2EC6 B;  5KU1 A;  2JNF A;  4HSZ A;  3LL8 B;  3RLZ A;  5ER4 X;  4INX A;  2I94 A;  3OX6 A;  1MXL C;  2CT9 A;  1XFX O;  2ISD A;  3RZS A;  3SG3 A;  3CZT X;  1QIV A;  2ZKM X;  2JC2 A;  5DIC A;  3GK4 X;  5I2L A;  5B8I B;  1DMO A;  2QEB A;  1QWV A;  2BCA A;  3I5F C;  1JSA A;  1IJ6 A;  5GQQ C;  4YGC B;  1MXE A;  3D74 A;  1OSA A;  5KSZ A;  2K7O A;  1G4Y R;  2ZRT A;  1PRW A;  1YX7 A;  5G08 A;  2KGR A;  5HYD A;  1RJV A;  2QDI A;  1BOC A;  3NGV A;  4N1G A;  3FWC A;  1K90 D;  1OMV A;  3KO0 A;  1EG4 A;  1NCZ A;  2L2E A;  1F55 A;  1QIW A;  3SG2 A;  5I2Q A;  3EK4 A;  1JC2 A;  2PMY A;  2FCE A;  4QJ4 B;  1CMG A;  1R6P A;  2LAP A;  1LKJ A;  4YGA A;  1YVL A;  3NHI A;  1DJY A;  1A29 A;  3PN7 B;  1Y1A A;  5DKQ A;  2NCP A;  4PHJ A;  1NYA A;  3S0D A;  1IRJ A;  1B7T Z;  1RFJ A;  4OKH A;  3B88 A;  2LV7 A;  1WY9 A;  2FJU B;  1JFK A;  1SCM B;  1IH0 A;  2LUC A;  3QME A;  4ORA B;  2L5Y A;  3S0E A;  1J7R A;  1RK9 A;  2O5G A;  4I5L B;  1KSO A;  1BMO A;  5CPV A;  3OB1 B;  1AK8 A;  1LA0 A;  1A4P A;  1NIW A;  2MAZ A;  1L2O B;  1YX8 A;  2WCL A;  3IQQ A;  3OP0 A;  2HQW A;  2JT8 A;  1XFV O;  3B87 A;  1CDL A;  4IJ7 A;  1ORG A;  1XYD A;  2BKI B;  5J3X A;  1DGU A;  3FE8 A;  5D3O A;  2LVJ A;  3I5H C;  4I5J A;  2WCM A;  1S26 D;  1WLZ A;  3DZT A;  2LC5 A;  2MRD A;  3H4S E;  4GUK A;  3EKJ A;  2EGD A;  3CR5 X;  1Z4H A;  4P5O E;  5TNC A;  2WOS A;  4P2Y B;  2BAP A;  2JU0 A;  4BY4 A;  1NX0 A;  1WLM A;  2QEH A;  4MZL A;  1AJ4 A;  2DOQ A;  3NSK A;  2Q4U A;  4JKT A;  3AKB A;  5DKN A;  2LLS A;  3EVR A;  3FE9 A;  3I5F B;  2L4I A;  2JTT A;  2ZFD A;  4WQ3 A;  1GM0 A;  2LE9 B;  1BR4 B;  1FI5 A;  2IS9 A;  1IJ5 A;  2GGZ A;  3V2L A;  1CM4 A;  3TS5 C;  1TCO B;  1S3P A;  1MWN A;  1NCX A;  2KYF A;  2M49 B;  1F54 A;  1ALW A;  1TNW A;  2HF5 A;  1XK4 C;  4PE1 A;  1SRA A;  1TOP A;  1UP5 A;  2LUX A;  3PFV A;  4DS7 A;  4JQ0 D;  1TTX A;  2WND A;  4GNK B;  3S0B A;  4DUQ A;  4GAO A;  3CS1 A;  5HLO A;  1V1F A;  1H4B A;  3AAK A;  3AAJ A;  1ZUZ A;  2JT3 A;  3CWG A;  1C3Y A;  2P71 A;  3CZ2 A;  1WRL A;  4YGD B;  1ALV A;  4M2P A;  1DQE A;  1PSR A;  1XFZ O;  1YUR A;  5FYX A;  1M45 A;  2OPO A;  1G33 A;  2H2K A;  2JOJ A;  2KNE A;  1UUR A;  1W7J B;  2M29 A;  2M7N A;  3VRP A;  3D78 A;  5F6T A;  1ZAC A;  3WHU B;  4JPZ B;  5CSJ A;  1C07 A;  2MLE C;  1PSB A;  2F33 A;  2KPH A;  2KLD A;  1XO5 A;  1G8I A;  2LVK A;  1M46 A;  4IL1 A;  3DYE A;  3NXA A;  3L4L A;  4A4B A;  1NSH A;  3I5G B;  3LCP C;  3OBV A;  2M0R A;  3IVT A;  3I5H B;  2AAO A;  5EL2 A;  4OR9 B;  4CFR A;  3EG5 B;  3C1V A;  5HKZ A;  1XFW O;  3JTD C;  1AJ5 A;  1U5I B;  3O4X A;  1XK4 A;  1QJT A;  1FPW A;  4GFT A;  2K7D A;  2NLN A;  1DJI A;  2BE4 A;  3K1E A;  2JZI A;  3AKA A;  1K8U A;  3CR2 A;  4PE0 A;  2F3Z A;  1QX7 A;  2HQ8 A;  3FS7 A;  2JPO A;  2FJY A;  2KQ6 A;  2KYC A;  4U8D A;  1QAT A;  1L7Z A;  3DVK A;  1F8H A;  4YI8 A;  1BU3 A;  1YRU B;  4XJK A;  1QLK A;  3CGA A;  2G9B A;  2WCJ A;  2KI6 C;  2L51 A;  2SCP A;  3R1P A;  1P28 A;  1SCV A;  3TS5 B;  2ZNE A;  2H61 C;  4UPG A;  1Y1U A;  2K8M B;  1UHJ A;  2KFG A;  1CDP A;  2A4J A;  3TUY C;  1CLM A;  1SSE B;  1UHI A;  2WCB A;  5CSF A;  1EH2 A;  3PAL A;  3A8R A;  2HET A;  4N5X A;  2M3W A;  5AER A;  4DIR A;  1JWD A;  1Y1X A;  2KI4 C;  2WCF A;  3BQ3 A;  3D0Y A;  4HRG A;  1CLB A;  1V1G A;  3CZ0 A;  2M7L A;  3BFH A;  1OZS A;  3BJH A;  2KDH A;  2PAL A;  2LP2 A;  3S0A A;  3QRX A;  1DJX A;  1PAL A;  1CFD A;  4C0J A;  1QS7 A;  2KLE A;  1AP4 A;  4QJ3 B;  3VB1 A;  3BOW A;  3O78 A;  1REC A;  2LHI A;  3L47 A;  2LLU A;  1YUS A;  2L50 A;  2BL0 C;  4E68 A;  1SPY A;  2LP3 A;  1KQM C;  2P6B B;  5JOL A;  5IBW A;  1LS8 A;  2NZ0 A;  1J1D A;  1HQV A;  1FF1 A;  2M8U A;  2LCP A;  3PM8 A;  4ZCV A;  1OMR A;  2QPT A;  2R2I A;  1SR6 B;  4GGF C;  3D0Y B;  3IF7 A;  1SYM A;  2JT0 A;  1MUX A;  1QXP A;  4AQI A;  2B1U A;  1K2H A;  2KAX A;  2F2O A;  2RGI A;  1HT9 A;  4DCK A;  4F0Z B;  2K60 A;  2JXC A;  2L4H A;  1CDM A;  1QTX A;  3O2P A;  4ORC B;  2H61 A;  2BE6 A;  2LMT A;  3KHE A;  4TNC A;  2Q91 A;  4OZD A;  3WNX B;  3JTD B;  2KAY A;  2I18 A;  4FQT A;  4MZK A;  1DJG A;  5I8N A;  4FTG A;  4GGN A;  2QAC A;  1TNQ A;  2TN4 A;  1ODB A;  4MZJ A;  1SL7 A;  1M31 A;  1PVB A;  1RRO A;  2WCE A;  4NDD A;  4PHM A;  5FI7 A;  1NUB A;  1DTL A;  3D73 A;  1C7W A;  1JBA A;  1F4Q A;  2K2F A;  2V53 A;  2KGB C;  1SY9 A;  1KFU S;  3DY9 A;  1Z2C B;  1DJW A;  1CM1 A;  1EG3 A;  1UHH A;  3CR4 X;  3I5I C;  3NSL A;  4PHK A;  1S6C A;  3OGN A;  3D75 A;  3Q8I A;  2QEO A;  3EKH A;  2ERB A;  5D7F A;  1B8L A;  2ZRS A;  3TUY B;  1JF2 A;  3VRQ A;  3L4A A;  1SL8 A;  1AUI B;  1NX2 A;  3VRR A;  2JWW A;  1LIN A;  4GGF A;  4CFQ A;  2KI4 B;  3WXA A;  2LNK A;  1M39 A;  3PSR A;  5HKW A;  1NWD A;  3VGO A;  2ZN8 A;  1ZFS A;  2LAN A;  1B8R A;  1UUS A;  2E6W A;  1OW4 A;  5I94 A;  2OS8 C;  1S6I A;  3LLE A;  4PAL A;  2MBX A;  1CFF A;  3R72 A;  3O6B A;  2CCM A;  1JUO A;  1PVA A;  1KFU L;  3LK0 A;  1BG1 A;  1YTZ C;  1DJZ A;  1K9K A;  3BFB A;  1TNP A;  2JPT A;  3BUM B;  1DC1 A;  4D1E A;  2ZN9 A;  2KSP A;  2BL0 B;  3OB2 B;  3GK2 A;  3DF0 A;  2KOT A;  2VRG A;  1QLS A;  2JTZ A;  3IQO A;  2KBI A;  2PAS A;  1QVI Y;  3PLF B;  3R1V A;  1C3Z A;  4ETO A;  3TDU A;  1N0Y A;  3JVT C;  2I7A A;  2JNX A;  5HKY A;  2D8N A;  3HCM A;  1J1E A;  3N7H A;  2CNP A;  2SAS A;  1MF8 B;  1IQ3 A;  1BF5 A;  4M2Q A;  1KFX S;  2F8P A;  3S0F A;  3DXL A;  4QJ5 B;  1CKK A;  2KI6 D;  4M2O A;  3S0G A;  1BLQ A;  1W7I B;  3R1O A;  1J7Q A;  1WRZ A;  5HLV A;  5CSI A;  2OTG C;  3NSI A;  1B1G A;  1QAS A;  4C0L A;  3BYA A;  1OOF A;  2MJW B;  1K9U A;  2H8V A;  2KFF A;  3CLN A;  3OX5 A;  1PUL A;  1KK7 Z;  4JWQ A;  4KYN A;  3TDI A;  1ZOT B;  4YRU A;  5ER5 A;  2L2C A;  2M97 A;  3BUW B;  1DJH A;  1QX5 B;  3KEV A;  1DEL A;  1F4O A;  1LXF C;  1MHO A;  3OHM B;  4MN0 A;  1A03 A;  1IIO A;  1JFJ A;  1OZO A;  2NXQ A;  2WC5 A;  1SNL A;  1DT7 B;  1EJ3 A;  1UWO A;  2LMU A;  1BOD A;  1B47 A;  4AOM A;  3PM2 A;  2M1U A;  2WC6 A;  2K7C A;  3B6X A;  2YGU A;  2KHN A;  3FE6 A;  3LK1 A;  4L9M A;  4WQ2 A;  4PE7 A;  5JJG A;  1KFX L;  1KK8 C;  1L2O C;  3ICB A;  3K21 A;  1BT6 A;  1N2D A;  1OOI X;  3TZ1 A;  4PE4 A;  1K95 A;  4PHN A;  1EXR A;  3EVU A;  1IG5 A;  1ZMZ A;  1GJY A;  1XA5 A;  5FI6 A;  1NCY A;  3HX4 A;  4C0K A;  4DRW A;  3B86 A;  1SKT A;  2BKH B;  3DVJ A;  5HL1 A;  5KTY A;  1K93 D;  4HRH A;  1KK7 Y;  3DVE A;  2OS8 B;  1IKU A;  1NX1 A;  4MRX A;  2WCK A;  1IGV A;  4XJK B;  3KF9 A;  4XYN A;  3SIA A;  1CNP A;  1FW4 A;  1KWO C;  4I5K A;  1R2U A;  2M9G A;  1RTP 1;  4FQO A;  2LLT A;  2Y1M A;  2HPS A;  1NPQ A;  1QX2 A;  1SK6 D;  4HRE E;  3EK7 A;  3EK8 A;  1M63 B;  1YRT B;  3PJI A;  3MSE B;  1TCF A;  1NX3 A;  1Y0V H;  1Y6W A;  4MRY A;  4OCI A;  5CSN A;  1IWQ A;  2WCH A;  2L0P A;  3JVT B;  2M1K B;  4INW A;  3B7A A;  4CID A;  1S5G Z;  1WDC C;  1F70 A;  3FIA A;  4Q04 A;  2Y1N A;  1TUJ A;  2LHL A;  1OOG A;  2FOT A;  3DD4 A;  1PK0 D;  2OTG B;  1AVS A;  2KAV A;  3SG6 A;  2KFH A;  1J7O A;  3BOW B;  2K0J A;  3EVV A;  3SIB A;  1Q80 A;  1CLL A;  2PVB A;  1XFY O;  2FCD A;  1GGW A;  3BFA A;  3D10 A;  2MHH A;  3BUN B;  3KPX A;  4ICB A;  1TN4 A;  1FBV A;  1N65 A;  4GBA A;  2Y5I A;  1DGV A;  3UNW A;  5FI2 A;  2CBL A;  2ZND A;  1GQM A;  3DVM A;  2K7B A;  2KBM A;  2COL B;  2AUC A;  1TNX A;  1S5G Y;  1TWO A;  1KK8 B;  3M0W A;  1TUZ A;  3SS5 A;  2BCX A;  1DEK A;  2GV5 A;  1MQ1 A;  2JXL A;  1BJF A;  1J7P A;  3I5G C;  3CYZ A;  1UHK A;  3ZNI A;  3O4Y A;  4MBE A;  1KCY A;  1QVI Z;  2LVV A;  1RWY A;  1KQV A;  2BCB A;  1K94 A;  2PQL A;  3GOF A;  2P70 A;  1GGZ A;  3F45 A;  3CZ1 A;  1VRK A;  2WC8 A;  2PSR A;  1B7T Y;  3FWB A;  3NHT A;  1KSM A;  5DKR A;  3VRO A;  5PAL A;  2JUL A;  4R1E A;  4YBH B;  2EC6 C;  3SJS A; 
#chains in the Genus database with same CATH homology
 1YUT A;  3GK1 A;  4MVF A;  1KWO B;  4NDC A;  1A75 A;  2PRU A;  4ORB B;  5D69 A;  1DF0 A;  5AEQ A;  1YUU A;  2GGM A;  4WRI A;  3ZWH A;  5AFP A;  1S36 A;  1CDN A;  3RM1 A;  2K2A A;  4YGB B;  2CXJ A;  1K96 A;  2E30 A;  4YI9 A;  1KQM B;  1YVH A;  1B4C A;  4N1F A;  2Y4Q A;  1X02 A;  2MA2 A;  3A4U B;  5BPJ A;  1DVI A;  1FI6 A;  1NP8 A;  1QV0 A;  1C7V A;  2NCO A;  2AMI A;  1SBJ A;  1A2X A;  1WDC B;  4MSP A;  1LA3 A;  1XVJ A;  1OOJ A;  1EL4 A;  1B9A A;  1CFC A;  2O60 A;  2L5X B;  4YGE B;  4BY5 A;  1OMD A;  3PAT A;  1A75 B;  1BR1 B;  1DF0 B;  4NDB A;  3BUO B;  4MLW A;  1CTR A;  3WHT B;  1S1E A;  2MLF C;  1F71 A;  3PN7 C;  4NQG A;  5I2O A;  2JRF A;  3SG5 A;  2BBN A;  1QV1 A;  1D1O A;  1U5I A;  2CTN A;  3DF0 B;  1CMF A;  3BUX B;  1OE9 B;  4ZCU A;  1H8B A;  1LVC D;  1TRF A;  1SCM C;  2BEC A;  1YR5 A;  2EHB A;  1AHR A;  2LVI A;  1JF0 A;  4OV2 A;  2F2P A;  4OVN F;  1J55 A;  3SG4 A;  1SR6 C;  2K61 A;  3CTN A;  2JQ6 A;  1SL9 A;  2KQY A;  2G2B A;  1IQ5 A;  3BXK A;  3I5I B;  4CLN A;  3VRN A;  1SW8 A;  3SG7 A;  4PDZ A;  4PCW A;  5AAN A;  1OQP A;  2F3Y A;  4MEW A;  1CFP A;  4A4C A;  3NSO A;  2I2R E;  2L98 A;  4I5N B;  5K89 A;  1SMG A;  1K9P A;  5AXI A;  1XFU O;  1CB1 A;  1E8A A;  1MR8 A;  2BBM A;  2WOR A;  4GPL B;  1S6J A;  1UHN A;  2LM5 A;  1B8C A;  4CPV A;  4AQJ A;  1WRK A;  3E3R A;  3TDZ A;  2LMV A;  4USL A;  1TIZ A;  2EC6 B;  5KU1 A;  2JNF A;  4HSZ A;  3LL8 B;  3RLZ A;  5ER4 X;  2I94 A;  3OX6 A;  1MXL C;  2CT9 A;  1XFX O;  2ISD A;  3SG3 A;  3CZT X;  1QIV A;  2ZKM X;  2JC2 A;  5I2L A;  3GK4 X;  5B8I B;  1DMO A;  2BCA A;  3I5F C;  1JSA A;  1IJ6 A;  5GQQ C;  4YGC B;  1MXE A;  1OSA A;  5KSZ A;  2K7O A;  1G4Y R;  2ZRT A;  1PRW A;  1YX7 A;  5G08 A;  2KGR A;  5HYD A;  1RJV A;  1BOC A;  4N1G A;  3FWC A;  1K90 D;  1OMV A;  3KO0 A;  1EG4 A;  1NCZ A;  2L2E A;  1F55 A;  1QIW A;  3SG2 A;  5I2Q A;  3EK4 A;  1JC2 A;  2PMY A;  2FCE A;  4QJ4 B;  1CMG A;  1R6P A;  2LAP A;  1LKJ A;  4YGA A;  1YVL A;  1DJY A;  1A29 A;  3PN7 B;  1Y1A A;  5DKQ A;  2NCP A;  4PHJ A;  1NYA A;  1IRJ A;  1B7T Z;  1RFJ A;  4OKH A;  2LV7 A;  1WY9 A;  2FJU B;  1JFK A;  1SCM B;  1IH0 A;  2LUC A;  4ORA B;  1J7R A;  1RK9 A;  2O5G A;  4I5L B;  1KSO A;  1BMO A;  5CPV A;  3OB1 B;  1AK8 A;  1LA0 A;  1A4P A;  1NIW A;  2MAZ A;  1L2O B;  1YX8 A;  3IQQ A;  3OP0 A;  2HQW A;  2JT8 A;  1XFV O;  1CDL A;  1XYD A;  2BKI B;  5J3X A;  1DGU A;  2LVJ A;  3I5H C;  4I5J A;  1S26 D;  1WLZ A;  3H4S E;  2LC5 A;  2MRD A;  4GUK A;  3EKJ A;  2EGD A;  3CR5 X;  4P5O E;  5TNC A;  2WOS A;  4P2Y B;  2JU0 A;  4BY4 A;  1NX0 A;  1WLM A;  4MZL A;  1AJ4 A;  2DOQ A;  3NSK A;  2Q4U A;  3AKB A;  5DKN A;  2LLS A;  3EVR A;  3I5F B;  2L4I A;  2JTT A;  2ZFD A;  4WQ3 A;  2LE9 B;  1BR4 B;  1FI5 A;  2IS9 A;  1IJ5 A;  2GGZ A;  1CM4 A;  3TS5 C;  1TCO B;  1S3P A;  1MWN A;  1NCX A;  2KYF A;  2M49 B;  1F54 A;  1ALW A;  1TNW A;  2HF5 A;  1XK4 C;  4PE1 A;  1SRA A;  1TOP A;  1UP5 A;  2LUX A;  3PFV A;  4DS7 A;  4JQ0 D;  1TTX A;  2WND A;  4GNK B;  4DUQ A;  4GAO A;  3CS1 A;  5HLO A;  1V1F A;  1H4B A;  3AAK A;  3AAJ A;  1ZUZ A;  2JT3 A;  3CWG A;  1WRL A;  4YGD B;  1ALV A;  4M2P A;  1PSR A;  1XFZ O;  1YUR A;  5FYX A;  1M45 A;  2OPO A;  1G33 A;  2H2K A;  2JOJ A;  2KNE A;  1UUR A;  1W7J B;  2M29 A;  2M7N A;  3VRP A;  5F6T A;  1ZAC A;  3WHU B;  4JPZ B;  5CSJ A;  1C07 A;  2MLE C;  1PSB A;  2F33 A;  1XO5 A;  1G8I A;  2LVK A;  1M46 A;  4IL1 A;  3NXA A;  4A4B A;  1NSH A;  3I5G B;  3LCP C;  2M0R A;  3I5H B;  2AAO A;  4CFR A;  4OR9 B;  3C1V A;  5HKZ A;  1XFW O;  3JTD C;  1AJ5 A;  1U5I B;  1FPW A;  1XK4 A;  1QJT A;  4GFT A;  2K7D A;  2NLN A;  1DJI A;  2BE4 A;  2JZI A;  3AKA A;  1K8U A;  3CR2 A;  4PE0 A;  2F3Z A;  1QX7 A;  2HQ8 A;  3FS7 A;  2KQ6 A;  2KYC A;  4U8D A;  1QAT A;  1L7Z A;  3DVK A;  1F8H A;  4YI8 A;  1BU3 A;  1YRU B;  4XJK A;  1QLK A;  3CGA A;  2G9B A;  2KI6 C;  2L51 A;  2SCP A;  1SCV A;  3TS5 B;  2ZNE A;  2H61 C;  4UPG A;  1Y1U A;  2K8M B;  1UHJ A;  2KFG A;  1CDP A;  2A4J A;  3TUY C;  1CLM A;  1UHI A;  2WCB A;  5CSF A;  1EH2 A;  3PAL A;  3A8R A;  2HET A;  4N5X A;  2M3W A;  5AER A;  4DIR A;  1JWD A;  1Y1X A;  2KI4 C;  2WCF A;  3BQ3 A;  3D0Y A;  4HRG A;  1CLB A;  1V1G A;  2M7L A;  1OZS A;  2KDH A;  2PAL A;  2LP2 A;  3QRX A;  1DJX A;  1PAL A;  1CFD A;  4C0J A;  1QS7 A;  1AP4 A;  4QJ3 B;  3BOW A;  3O78 A;  1REC A;  2LHI A;  2LLU A;  1YUS A;  2L50 A;  2BL0 C;  4E68 A;  1SPY A;  2LP3 A;  1KQM C;  2P6B B;  5JOL A;  5IBW A;  2NZ0 A;  1J1D A;  1HQV A;  1FF1 A;  2M8U A;  2LCP A;  3PM8 A;  4ZCV A;  1OMR A;  2QPT A;  2R2I A;  1SR6 B;  4GGF C;  3D0Y B;  3IF7 A;  1SYM A;  2JT0 A;  1MUX A;  1QXP A;  4AQI A;  2B1U A;  1K2H A;  2KAX A;  2F2O A;  2RGI A;  1HT9 A;  4DCK A;  4F0Z B;  2L4H A;  2JXC A;  1CDM A;  1QTX A;  3O2P A;  4ORC B;  2H61 A;  2BE6 A;  2LMT A;  3KHE A;  4TNC A;  2Q91 A;  3WNX B;  3JTD B;  2KAY A;  2I18 A;  4MZK A;  1DJG A;  5I8N A;  4FTG A;  4GGN A;  2QAC A;  1TNQ A;  2TN4 A;  1ODB A;  4MZJ A;  1SL7 A;  1M31 A;  1PVB A;  1RRO A;  2WCE A;  4NDD A;  4PHM A;  1NUB A;  1DTL A;  1C7W A;  1JBA A;  1F4Q A;  2K2F A;  2V53 A;  2KGB C;  1SY9 A;  1KFU S;  1DJW A;  1CM1 A;  1EG3 A;  1UHH A;  3CR4 X;  3I5I C;  3NSL A;  4PHK A;  1S6C A;  3EKH A;  5D7F A;  1B8L A;  2ZRS A;  3TUY B;  1JF2 A;  3VRQ A;  1SL8 A;  1AUI B;  1NX2 A;  3VRR A;  2JWW A;  1LIN A;  4GGF A;  4CFQ A;  2KI4 B;  3WXA A;  2LNK A;  1M39 A;  3PSR A;  5HKW A;  1NWD A;  3VGO A;  2ZN8 A;  1ZFS A;  2LAN A;  1B8R A;  1UUS A;  2E6W A;  2OS8 C;  1S6I A;  3LLE A;  4PAL A;  2MBX A;  1CFF A;  3O6B A;  2CCM A;  1JUO A;  1PVA A;  1KFU L;  3LK0 A;  1BG1 A;  1YTZ C;  1DJZ A;  1K9K A;  1TNP A;  2JPT A;  3BUM B;  4D1E A;  2ZN9 A;  2KSP A;  2BL0 B;  3OB2 B;  3GK2 A;  3DF0 A;  2KOT A;  2VRG A;  1QLS A;  2JTZ A;  3IQO A;  2KBI A;  2PAS A;  1QVI Y;  3PLF B;  4ETO A;  3TDU A;  1N0Y A;  3JVT C;  2I7A A;  2JNX A;  5HKY A;  2D8N A;  3HCM A;  1J1E A;  2CNP A;  2SAS A;  1MF8 B;  1IQ3 A;  1BF5 A;  4M2Q A;  1KFX S;  2F8P A;  1CKK A;  4QJ5 B;  2KI6 D;  4M2O A;  1BLQ A;  1J7Q A;  1W7I B;  1WRZ A;  5HLV A;  5CSI A;  2OTG C;  3NSI A;  1B1G A;  1QAS A;  4C0L A;  3BYA A;  2MJW B;  1K9U A;  3TDI A;  2KFF A;  3CLN A;  3OX5 A;  1PUL A;  1KK7 Z;  4JWQ A;  4YRU A;  1ZOT B;  5ER5 A;  2M97 A;  3BUW B;  1DJH A;  1QX5 B;  3KEV A;  1F4O A;  1LXF C;  1MHO A;  3OHM B;  4MN0 A;  1A03 A;  1JFJ A;  1OZO A;  2NXQ A;  1SNL A;  1DT7 B;  1EJ3 A;  1UWO A;  2LMU A;  1BOD A;  1B47 A;  4AOM A;  2M1U A;  4L9M A;  2K7C A;  4WQ2 A;  3LK1 A;  2KHN A;  5JJG A;  4PE7 A;  1KFX L;  1KK8 C;  1L2O C;  3ICB A;  3K21 A;  1BT6 A;  1N2D A;  3TZ1 A;  4PE4 A;  1K95 A;  4PHN A;  1EXR A;  3EVU A;  1IG5 A;  1ZMZ A;  1GJY A;  1XA5 A;  1NCY A;  3HX4 A;  4C0K A;  4DRW A;  3DVJ A;  1SKT A;  2BKH B;  5KTY A;  1K93 D;  4HRH A;  1KK7 Y;  3DVE A;  2OS8 B;  1IKU A;  1NX1 A;  4MRX A;  1IGV A;  4XJK B;  3KF9 A;  4XYN A;  3SIA A;  1CNP A;  1FW4 A;  1KWO C;  4I5K A;  1R2U A;  2M9G A;  1RTP 1;  4FQO A;  2LLT A;  2Y1M A;  2HPS A;  1NPQ A;  1QX2 A;  1SK6 D;  4HRE E;  3EK7 A;  3EK8 A;  1M63 B;  1YRT B;  3MSE B;  1TCF A;  1NX3 A;  1Y0V H;  1Y6W A;  4MRY A;  4OCI A;  5CSN A;  1IWQ A;  2L0P A;  3JVT B;  2M1K B;  4CID A;  1S5G Z;  1WDC C;  1F70 A;  3FIA A;  4Q04 A;  2Y1N A;  2LHL A;  2FOT A;  3DD4 A;  1PK0 D;  2OTG B;  1AVS A;  2KAV A;  3SG6 A;  2KFH A;  1J7O A;  3BOW B;  2K0J A;  3EVV A;  3SIB A;  1Q80 A;  1CLL A;  2PVB A;  1XFY O;  2FCD A;  1GGW A;  3D10 A;  2MHH A;  3BUN B;  3KPX A;  4ICB A;  1TN4 A;  1FBV A;  1N65 A;  4GBA A;  2Y5I A;  1DGV A;  2CBL A;  2ZND A;  1GQM A;  3DVM A;  2K7B A;  2KBM A;  2COL B;  2AUC A;  1TNX A;  1S5G Y;  1KK8 B;  3M0W A;  2BCX A;  2GV5 A;  1MQ1 A;  2JXL A;  1BJF A;  1J7P A;  3I5G C;  1UHK A;  3ZNI A;  3O4Y A;  4MBE A;  1KCY A;  1QVI Z;  2LVV A;  1RWY A;  1KQV A;  2BCB A;  1K94 A;  3GOF A;  1GGZ A;  3F45 A;  1VRK A;  2WC8 A;  2PSR A;  1B7T Y;  3FWB A;  1KSM A;  5DKR A;  3VRO A;  5PAL A;  2JUL A;  4R1E A;  4YBH B;  2EC6 C;  3SJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...