4MRXA

Crystal structure of y138f obelin mutant from obelia longissima at 1.72 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
190
structure length
188
Chain Sequence
AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDDGSGTITLDEWKAFGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Obelin
publication title Structures of the Ca2+-regulated photoprotein obelin Y138F mutant before and after bioluminescence support the catalytic function of a water molecule in the reaction
doi rcsb
source organism Obelia longissima
total genus 75
structure length 188
sequence length 190
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mrxA00
1DF0B 3EK7A 1M45A 2BCXA 1OZOA 4MLWA 1K95A 5HKZA 1FF1A 2COLB 2L2EA 4FTGA 1JWDA 1TNXA 2EGDA 1DJZA 1EXRA 2P6BB 2L0PA 2K7BA 1PRWA 2BCBA 3JTDB 1S5GZ 4GBAA 2NXQA 4ORBB 3WNXB 3LCPC 1TNPA 3PLFB 1QASA 2K8MB 1RECA 3OB2B 4A4BA 3OB1B 2LVKA 1N65A 1NSHA 2GGMA 3LK1A 3SG6A 4ETOA 4BY4A 1IRJA 5B8IB 1PALA 1BODA 2JC2A 4MVFA 1VRKA 2KAYA 1KQMC 4CPVA 2MLEC 1J7QA 2CBLA 2LV7A 2NCOA 4GPLB 4N1GA 1CNPA 2I94A 2KBMA 3H4SE 1EH2A 4MN0A 1B4CA 1UUSA 4PHJA 5AXIA 4YGAA 1MXLC 1RWYA 1BMOA 3D10A 1CM4A 2KNEA 5CSIA 5AANA 1DJWA 2L4HA 2KSPA 1HQVA 4C0LA 2WCEA 1K96A 2KFFA 1QX5B 2R2IA 1AK8A 1K90D 3VROA 1KSOA 3BQ3A 1TN4A 1XYDA 4YGCB 2KDHA 3NSKA 1KK7Y 1LA0A 1OMDA 1YRUB 2LMUA 5AEQA 2CCMA 1KFUL 3FS7A 2L5XB 4MSPA 4MRYA 1MUXA 5KTYA 1SY9A 3BOWA 1UHHA 1JBAA 3O2PA 1MQ1A 3JVTC 3AKBA 3GK4X 1B7TY 1SMGA 1KQVA 5KU1A 2KAVA 1WRZA 3LL8B 4GUKA 2WC8A 2BL0C 4I5KA 1X02A 4PHMA 2LLTA 1TCOB 2EHBA 1TIZA 2KI4B 1EG3A 2L98A 1NCYA 2ZFDA 5DKRA 1V1FA 1B47A 1TNQA 2M97A 1EJ3A 1WDCB 2ZKMX 1ALVA 1CTRA 2NLNA 3NSIA 4ORAB 2JWWA 1Y0VH 2Y4QA 1DJIA 2L50A 2LLUA 3BUNB 4WQ3A 1DF0A 4HRHA 3LLEA 2Y5IA 1WY9A 1E8AA 3EVVA 1NX3A 5BPJA 2ZNDA 1CMGA 2KFGA 1K9PA 2ZN9A 1UWOA 1EG4A 5HKYA 1JF0A 2Y1MA 1MR8A 5FYXA 5G08A 1SW8A 2WCFA 3GK2A 3A4UB 2L51A 1CKKA 2WNDA 4DUQA 1TCFA 2KOTA 2M9GA 3CR5X 4MRXA 1CDMA 1L2OC 2WORA 3TS5C 1CLBA 3OX5A 3BYAA 1SNLA 2KQYA 1JF2A 2JT0A 1FI5A 4NDDA 3DF0B 3DVJA 4JWQA 3I5IB 2OTGC 1BG1A 1SR6C 4NDCA 4YI8A 1C7WA 2JOJA 2JTTA 1L2OB 3TZ1A 2PRUA 4OR9B 1W7IB 1DJXA 1QS7A 3I5FC 1UP5A 3NSOA 3SG3A 1LKJA 2K7CA 1A29A 1MXEA 2E6WA 3KEVA 3PATA 5F6TA 3VGOA 3PM8A 1JFKA 4C0JA 3PN7B 1XFUO 1IWQA 4D1EA 3OP0A 5CSNA 1JC2A 1JSAA 4I5NB 1BR4B 2G9BA 3AAJA 3FIAA 4OKHA 1CFFA 2BE4A 1A4PA 1OZSA 4YGBB 2OS8C 1NYAA 3I5FB 5PALA 1DJGA 2BCAA 4PE1A 1TNWA 2WCBA 1RROA 1IKUA 1ALWA 1F70A 4DCKA 2K2FA 1KK8B 1KWOC 4DS7A 2Q4UA 4R1EA 2JXLA 1XFWO 1YX8A 1B9AA 2LP2A 3F45A 4M2OA 1J7PA 2LUXA 1Y1AA 2H61C 1UURA 3SG5A 1CFCA 4PHNA 1IG5A 1KK7Z 2MA2A 3EKJA 1Y1XA 2PSRA 2M1UA 3TDZA 4CFRA 4AQJA 1JUOA 1SCMC 1K2HA 1QLSA 5TNCA 3AAKA 1SL7A 1YUTA 1NP8A 4P5OE 1FW4A 4GFTA 2PALA 1B1GA 1B7TZ 4M2QA 1NCXA 5GQQC 1UHJA 2H2KA 5CPVA 1ZMZA 1RJVA 4MEWA 1YUSA 2LMVA 3TDIA 4BY5A 2AMIA 1QATA 2CXJA 2KGBC 2I2RE 1KQMB 2I18A 1RTP1 1CFDA 4OVNF 5ER5A 1NIWA 2JXCA 2JZIA 1K93D 2LVVA 3DF0A 1PVBA 2LHIA 4NDBA 4USLA 1BOCA 3O78A 1J55A 3E3RA 4YGDB 3CWGA 1OSAA 3ICBA 1S1EA 2QACA 1XK4A 4IL1A 1ZOTB 1OE9B 1S6IA 2LNKA 2HF5A 2F2PA 2SCPA 1CDNA 3PFVA 2AAOA 3IF7A 5HLOA 2M1KB 2E30A 1W7JB 1J7OA 2KBIA 4GGFA 1WRLA 5KSZA 1F4OA 2HQWA 1IJ5A 1XA5A 3C1VA 3JVTB 4PE0A 3BUWB 2GV5A 3CS1A 1OQPA 4E68A 2JT8A 4A4CA 2F8PA 1KFXS 2BL0B 3DVKA 2ISDA 2F3YA 3IQOA 2G2BA 1AJ4A 1LVCD 2K0JA 2LVJA 1B8CA 3VRRA 4JPZB 3BUMB 3OX6A 3FWBA 1QVIY 1J1DA 1SYMA 4MBEA 3IQQA 1QX7A 2M49B 3TDUA 1YVLA 1D1OA 1B8RA 2KGRA 2LE9B 1PULA 1AJ5A 1DVIA 3MSEB 3ZNIA 1RFJA 2M8UA 3WHTB 2CTNA 2FOTA 1C07A 4UPGA 1K8UA 1QIVA 2LLSA 4U8DA 4YRUA 4M2PA 1CM1A 1CB1A 2EC6C 2WOSA 3EKHA 1QTXA 1WLMA 2K2AA 3D0YB 1XFYO 1ZUZA 3KO0A 4XYNA 5DKQA 4QJ5B 1JFJA 4PE4A 4QJ3B 2LUCA 3LK0A 2PMYA 2MRDA 1L7ZA 2K7DA 2O5GA 1R2UA 3KHEA 2KFHA 2BBMA 1PVAA 2KHNA 3RLZA 2JNXA 3O4YA 1B8LA 2BBNA 3TS5B 4DRWA 1AHRA 2TN4A 3HX4A 1V1GA 4MZJA 4P2YB 3PSRA 1TTXA 1DJHA 1NX1A 2PVBA 2OTGB 1ZFSA 5ER4X 1SR6B 3TUYC 4MZKA 4HRGA 2LHLA 4YI9A 3O6BA 2I7AA 5CSJA 2NCPA 4XJKB 4Q04A 3I5HC 1Q80A 4FQOA 3QRXA 1YTZC 4I5JA 2M29A 4C0KA 2FCEA 1G33A 1YRTB 3NXAA 4L9MA 3I5GC 1KFUS 2KYCA 5I2OA 1DGUA 2M7NA 3CR2A 3EVUA 3NSLA 4CIDA 1UHNA 2JQ6A 1MHOA 1NPQA 1DT7B 3SG4A 2A4JA 1CFPA 1NUBA 1F55A 5K89A 2Y1NA 2SASA 2OS8B 3EK4A 4ZCUA 3JTDC 1CMFA 4ORCB 5AERA 1U5IB 3SG7A 5JOLA 4TNCA 1A75B 1FI6A 1YVHA 4YGEB 1BU3A 1KWOB 3I5GB 2CNPA 2JU0A 1CDLA 4CLNA 2FJUB 4F0ZB 1J7RA 5I2QA 2MJWB 1BJFA 1H4BA 5CSFA 2KYFA 3VRPA 2B1UA 1QXPA 2VRGA 1GJYA 2KI6C 3CR4X 1SCMB 1F71A 2JRFA 4QJ4B 4DIRA 1QX2A 3HCMA 1BR1B 2Q91A 1EL4A 4YBHB 1SK6D 2K61A 2HETA 2KAXA 1J1EA 1M46A 1DMOA 1ODBA 1YR5A 2AUCA 3GOFA 2ZNEA 2LM5A 1IQ5A 1M31A 2LANA 3D0YA 1S3PA 2OPOA 2L4IA 4WRIA 1DJYA 2BECA 1UHIA 3DD4A 4PHKA 1XFXO 1QVIZ 1PK0D 2MAZA 2MHHA 4AOMA 1S6JA 4I5LB 1G4YR 1GQMA 1IGVA 1NCZA 1N2DA 3A8RA 3WXAA 3CTNA 1F54A 1HT9A 3SIBA 5HYDA 1BLQA 1A03A 1CLMA 4JQ0D 1KSMA 1DTLA 1S5GY 4CFQA 2BKIB 1WRKA 1SL9A 2JT3A 4N1FA 1SPYA 1XVJA 2MBXA 2BE6A 3M0WA 4GAOA 4HREE 4MZLA 3PALA 2KI4C 2ZRSA 4XJKA 1Y6WA 4ZCVA 5J3XA 2LMTA 2MLFC 1NX2A 1MF8B 1XFZO 2BKHB 1CLLA 1WDCC 1WLZA 5HKWA 1AUIB 2K7OA 3GK1A 1S36A 3DVMA 1SL8A 2F3ZA 1N0YA 1R6PA 1AVSA 3ZWHA 1QV1A 2CT9A 2JTZA 3KPXA 2KI6D 4NQGA 3AKAA 2D8NA 3CLNA 1K9KA 4WQ2A 4PCWA 1U5IA 1XFVO 1G8IA 5DKNA 2QPTA 1A75A 3CGAA 2V53A 2ZN8A 1IJ6A 5D69A 1YX7A 1OOJA 4ICBA 1CDPA 1K94A 1LA3A 1LXFC 2H61A 2LP3A 2JPTA 2M3WA 2ZRTA 3BUOB 3BUXB 4PDZA 5HLVA 1SKTA 1TOPA 1FPWA 2FCDA 3K21A 2LC5A 1QJTA 1RK9A 1DGVA 1SBJA 2LAPA 1UHKA 2LVIA 3I5IC 4PE7A 5JJGA 2KQ6A 3SIAA 2RGIA 1IH0A 2GGZA 5I2LA 1BF5A 1SRAA 3VRNA 1M39A 5I8NA 1XO5A 4OV2A 2EC6B 2JULA 3FWCA 1TRFA 1PSRA 1F8HA 2M7LA 4AQIA 1XK4C 1PSBA 3SG2A 1QIWA 4GGNA 4HSZA 4N5XA 3KF9A 1S26D 2HQ8A 3CZTX 4OCIA 1KCYA 1QLKA 1GGWA 3BOWB 3DVEA 1NX0A 5IBWA 4GGFC 3PN7C 1NWDA 2JNFA 2F2OA 5AFPA 3WHUB 1OMVA 1IQ3A 5D7FA 1AP4A 2DOQA 1C7VA 1F4QA 2LCPA 3BXKA 1GGZA 2IS9A 1OMRA 1S6CA 1YURA 3OHMB 3EVRA 3TUYB 1QV0A 4GNKB 2PASA 1KFXL 1SCVA 2O60A 1KK8C 1A2XA 2NZ0A 1LINA 3VRQA 3EK8A 3SJSA 3I5HB 1ZACA 2F33A 2M0RA 2HPSA 4PALA 1BT6A 3RM1A 1FBVA 1MWNA 1M63B 1Y1UA 1YUUA 1H8BA 1K9UA
chains in the Genus database with same CATH superfamily
1DF0B 3EK7A 1M45A 2BCXA 1OZOA 4MLWA 1K95A 5HKZA 1FF1A 2COLB 2L2EA 4FTGA 1JWDA 1TNXA 2EGDA 1DJZA 1EXRA 2P6BB 2L0PA 2K7BA 3VB1A 1PRWA 2BCBA 3JTDB 1S5GZ 4GBAA 2NXQA 4ORBB 3WNXB 3LCPC 1TNPA 3PLFB 3UO9A 1QASA 3S0DA 2K8MB 1RECA 3OB2B 4A4BA 3OB1B 3S0EA 3S0FA 2LVKA 1N65A 1NSHA 2GGMA 3LK1A 3SG6A 4ETOA 4BY4A 1IRJA 5B8IB 1PALA 1BODA 2JC2A 1Z2CB 4MVFA 2WCKA 1VRKA 2KAYA 1KQMC 1Z4HA 2MLEC 4CPVA 2CBLA 2LV7A 1J7QA 2NCOA 4GPLB 4N1GA 1CNPA 1TUZA 2I94A 2KBMA 3H4SE 4MN0A 1B4CA 1EH2A 1UUSA 4PHJA 5AXIA 4YGAA 1MXLC 1RWYA 1BMOA 3D10A 1CM4A 2KNEA 5CSIA 5AANA 1DJWA 2L4HA 1DC1A 2KSPA 3BFHA 1HQVA 1C3ZA 4C0LA 2WCEA 1K96A 2KFFA 1QX5B 2R2IA 1AK8A 1K90D 3VROA 1KSOA 3BQ3A 1OW4A 1TN4A 1XYDA 4YGCB 2KDHA 3NSKA 1KK7Y 1LA0A 1OMDA 1YRUB 2LMUA 5AEQA 2CCMA 1KFUL 3FS7A 2L5XB 4MSPA 4MRYA 1MUXA 5KTYA 1SY9A 3BOWA 1UHHA 1JBAA 3O2PA 5FI6A 1MQ1A 3JVTC 3AKBA 3GK4X 1B7TY 1SMGA 1KQVA 5KU1A 2KAVA 1WRZA 3LL8B 4INWA 4GUKA 2WC8A 2BL0C 2KLEA 4I5KA 1X02A 3OGNA 4PHMA 2LLTA 1TCOB 2EHBA 1TIZA 2KI4B 1EG3A 2L98A 1NCYA 2ZFDA 5DKRA 1V1FA 1B47A 3SS3A 1TWOA 1TNQA 2M97A 1EJ3A 1WDCB 2ZKMX 1ALVA 1CTRA 1T14A 2NLNA 3NSIA 4ORAB 2JWWA 1Y0VH 2Y4QA 1DJIA 2L50A 2LLUA 3BUNB 4WQ3A 1DF0A 4HRHA 3LLEA 2JPOA 2Y5IA 3CABA 1WY9A 3CZ0A 1E8AA 3EVVA 4INXA 1NX3A 5BPJA 2ZNDA 3B88A 1CMGA 2KFGA 1K9PA 3Q8IA 2ZN9A 1UWOA 3B7AA 1EG4A 5HKYA 1JF0A 2Y1MA 1MR8A 5FYXA 2KLDA 5G08A 1SW8A 2WCFA 3GK2A 3A4UB 2L51A 1CKKA 2WNDA 4DUQA 1TCFA 2KOTA 2M9GA 3CR5X 2QEBA 4MRXA 1CDMA 1L2OC 2WORA 3TS5C 1SSEB 1CLBA 3OX5A 3BYAA 1SNLA 2KQYA 1JF2A 2JT0A 1FI5A 4NDDA 3DF0B 3DVJA 4JWQA 3I5IB 4FQTA 2OTGC 1BG1A 3R1OA 1SR6C 4NDCA 4YI8A 1C7WA 2JOJA 3L47A 2JTTA 2H8VA 1L2OB 3EG5B 3TZ1A 2PRUA 4OR9B 1W9ZA 1W7IB 1DJXA 1QS7A 3I5FC 3NHIA 1UP5A 3NSOA 3SG3A 1LKJA 2K7CA 1A29A 1MXEA 2E6WA 3KEVA 3PATA 5F6TA 3VGOA 3PM8A 2P70A 1JFKA 4C0JA 3PN7B 1OOFA 1IWQA 1XFUO 3OP0A 5CSNA 4D1EA 5HL1A 1JC2A 1JSAA 4I5NB 1BR4B 2G9BA 3AAJA 3FIAA 3K1EA 3NHTA 4OKHA 2BE4A 1CFFA 1A4PA 1OZSA 4YGBB 2OS8C 1NYAA 3I5FB 5PALA 1DJGA 2BCAA 2WC5A 1TNWA 2WCBA 1RROA 4PE1A 1ALWA 1IKUA 1F70A 4DCKA 2K2FA 1KK8B 1KWOC 4DS7A 2Q4UA 4R1EA 2JXLA 1XFWO 1YX8A 1B9AA 2LP2A 3F45A 4M2OA 1J7PA 2LUXA 1Y1AA 2H61C 1UURA 3SG5A 1CFCA 2WC6A 4PHNA 1IG5A 1KK7Z 2MA2A 3EKJA 1Y1XA 2PSRA 2M1UA 3TDZA 4CFRA 4AQJA 1JUOA 3V2LA 2FJYA 1SCMC 1K2HA 1QLSA 5TNCA 3AAKA 1SL7A 1YUTA 1NP8A 4P5OE 1IIOA 1FW4A 4GFTA 2PALA 1B1GA 1B7TZ 4M2QA 1NCXA 5GQQC 1UHJA 2H2KA 5CPVA 1ZMZA 1RJVA 4MEWA 1YUSA 3D74A 2LMVA 3TDIA 4BY5A 4OZDA 2AMIA 1QATA 3S0GA 2CXJA 2KGBC 2I2RE 1KQMB 2I18A 1RTP1 1CFDA 4OVNF 5ER5A 3O4XA 1NIWA 2JXCA 2WCMA 2JZIA 1K93D 2LVVA 3DF0A 1PVBA 2LHIA 4NDBA 1GM0A 4USLA 1BOCA 3O78A 1J55A 3E3RA 3R72A 4YGDB 3CWGA 1OSAA 3ICBA 1C3YA 1S1EA 2QACA 3PM2A 3DXLA 1XK4A 4IL1A 1ZOTB 1OE9B 1S6IA 3NGVA 2QEHA 2LNKA 2HF5A 2F2PA 2SCPA 3PJIA 3PFVA 1CDNA 2AAOA 3IF7A 5HLOA 2M1KB 2E30A 1W7JB 3RZSA 2WCJA 1J7OA 2KBIA 4GGFA 3CZ1A 1WRLA 4PT1A 5KSZA 1F4OA 2HQWA 1IJ5A 1XA5A 3C1VA 3JVTB 4PE0A 3BUWB 2GV5A 3CS1A 1OQPA 4E68A 2JT8A 4A4CA 2F8PA 1KFXS 3B6XA 2BL0B 3DVKA 2ISDA 2F3YA 3IQOA 2G2BA 1AJ4A 1LVCD 2K0JA 2LVJA 1B8CA 3VRRA 4JPZB 3BUMB 3OX6A 3FWBA 1QVIY 1J1DA 1SYMA 4MBEA 3IQQA 1QX7A 2M49B 3TDUA 1YVLA 1D1OA 1B8RA 2KGRA 2LE9B 1PULA 1AJ5A 1DVIA 3MSEB 3ZNIA 1RFJA 2M8UA 3B87A 2CTNA 3WHTB 4JD9A 2FOTA 1C07A 4UPGA 1K8UA 1QIVA 2LLSA 4U8DA 3BFAA 4YRUA 4M2PA 1CM1A 1CB1A 2EC6C 2WOSA 3EKHA 1QTXA 1WLMA 2K2AA 3D0YB 1XFYO 1ZUZA 3KO0A 4XYNA 5DKQA 4QJ5B 1JFJA 3SS4A 1OOHA 4PE4A 5EL2A 4QJ3B 2LUCA 3LK0A 2PMYA 2MRDA 1L7ZA 2K7DA 2O5GA 1DEKA 1R2UA 5DICA 1DELA 3KHEA 2KFHA 5I94A 1PVAA 2BBMA 2KHNA 3RLZA 2GTEA 2JNXA 3O4YA 1B8LA 3FE8A 2BBNA 3TS5B 4DRWA 1AHRA 2TN4A 3HX4A 1V1GA 4MZJA 3D73A 3DYEA 3R1PA 4P2YB 3CYZA 3PSRA 1TTXA 1DJHA 1NX1A 2PVBA 2OTGB 1ZFSA 5ER4X 1SR6B 2WCHA 3TUYC 4MZKA 4HRGA 2LHLA 4YI9A 3O6BA 2I7AA 3FE9A 5CSJA 2NCPA 4XJKB 1LS8A 4Q04A 3I5HC 1Q80A 4FQOA 3QRXA 2P71A 1YTZC 4I5JA 2M29A 4C0KA 2FCEA 1G33A 1YRTB 3NXAA 4L9MA 3I5GC 1KFUS 2KYCA 1QWVA 5I2OA 1DGUA 2M7NA 3CR2A 3EVUA 3NSLA 4CIDA 1UHNA 4IJ7A 2JQ6A 1MHOA 1NPQA 1DT7B 3SG4A 2A4JA 1CFPA 1NUBA 2YGUA 5K89A 1F55A 3L4LA 2Y1NA 2SASA 2OS8B 3EK4A 4ZCUA 3JTDC 1CMFA 4ORCB 5AERA 1U5IB 3SG7A 5JOLA 4TNCA 1A75B 1FI6A 1YVHA 4YGEB 1BU3A 1KWOB 3I5GB 2CNPA 2JU0A 1CDLA 3D76A 4JKTA 4CLNA 2FJUB 3DZTA 4F0ZB 1J7RA 5I2QA 1OOGA 2MJWB 1BJFA 1H4BA 5CSFA 1TUJA 2KYFA 3VRPA 2B1UA 1QXPA 2VRGA 1GJYA 2KI6C 3CR4X 1SCMB 1F71A 2JRFA 4QJ4B 4DIRA 1QX2A 3HCMA 3BJHA 1BR1B 2Q91A 1EL4A 2WCLA 1SK6D 2ERBA 2K61A 2HETA 3QMEA 4YBHB 2KAXA 1J1EA 1M46A 1DMOA 1ODBA 1YR5A 2AUCA 3GOFA 2ZNEA 1P28A 2LM5A 1IQ5A 3IVTA 1M31A 2LANA 3D0YA 1S3PA 2OPOA 2L4IA 4WRIA 1DJYA 4KYNA 2BECA 1UHIA 3DD4A 4PHKA 1XFXO 1QVIZ 1PK0D 2MAZA 2MHHA 4AOMA 1S6JA 4I5LB 1G4YR 1GQMA 1IGVA 1NCZA 1N2DA 3A8RA 3FE6A 3WXAA 3CTNA 5FI2A 1F54A 1HT9A 3SIBA 5HYDA 1BLQA 1A03A 3R1VA 1CLMA 4JQ0D 1KSMA 1DTLA 1S5GY 4CFQA 2BKIB 1WRKA 1SL9A 2JT3A 4N1FA 1SPYA 1XVJA 2MBXA 2BE6A 3M0WA 4GAOA 4HREE 4MZLA 3D75A 3PALA 2KI4C 2K60A 2ZRSA 4XJKA 1Y6WA 4ZCVA 5J3XA 5D3OA 2LMTA 2MLFC 3UNWA 1NX2A 3S0BA 1MF8B 1XFZO 2BKHB 1CLLA 1WDCC 1WLZA 3CDNA 5HKWA 1AUIB 2K7OA 3N7HA 1OOIX 3GK1A 1S36A 3DVMA 1SL8A 3DY9A 2F3ZA 1N0YA 1R6PA 1AVSA 2PYQA 3SS5A 3ZWHA 1QV1A 2CT9A 2JTZA 3KPXA 2KI6D 4NQGA 3AKAA 2D8NA 3CLNA 1K9KA 4WQ2A 4PCWA 1U5IA 1XFVO 1G8IA 5DKNA 2QPTA 1A75A 3CGAA 2V53A 2ZN8A 1IJ6A 2PQLA 5D69A 3CZ2A 1YX7A 1OOJA 4ICBA 1CDPA 1K94A 1LA3A 1LXFC 2H61A 2LP3A 2JPTA 2M3WA 2ZRTA 3BUOB 3BUXB 3D78A 4PDZA 5HLVA 1SKTA 1TOPA 2QEOA 1FPWA 2FCDA 3K21A 2LC5A 1QJTA 1RK9A 1DGVA 1SBJA 2LAPA 1UHKA 2LVIA 3I5IC 4PE7A 5JJGA 2KQ6A 3SIAA 2RGIA 1IH0A 2GGZA 5I2LA 1BF5A 1SRAA 3VRNA 1M39A 5I8NA 1XO5A 4OV2A 2EC6B 2JULA 2L5YA 3FWCA 1TRFA 1PSRA 1F8HA 2BAPA 2M7LA 4AQIA 1DQEA 2L2CA 1XK4C 1PSBA 3SG2A 2QEVA 1QIWA 3B86A 4GGNA 4HSZA 4N5XA 3KF9A 5FI7A 1S26D 2HQ8A 3CZTX 4OCIA 3BFBA 1KCYA 1QLKA 3OBVA 1GGWA 3BOWB 1ORGA 3DVEA 1NX0A 5IBWA 4GGFC 3PN7C 1NWDA 2QDIA 2JNFA 2F2OA 5AFPA 3WHUB 1OMVA 1IQ3A 5D7FA 1AP4A 2DOQA 1C7VA 1F4QA 2LCPA 3BXKA 1GGZA 2IS9A 1OMRA 1S6CA 1YURA 3S0AA 2BNXA 3OHMB 3EVRA 3TUYB 1QV0A 4GNKB 2PASA 1KFXL 1SCVA 4F7FA 2O60A 1KK8C 1A2XA 2NZ0A 1LINA 3VRQA 3D77A 3EK8A 3SJSA 3I5HB 1ZACA 3L4AA 2F33A 2M0RA 2HPSA 4PALA 1BT6A 3RM1A 1FBVA 1MWNA 1M63B 1XFRA 1Y1UA 1YUUA 1H8BA 1K9UA 2KPHA
chains in the Genus database with same CATH topology
1DF0B 3EK7A 1M45A 2BCXA 1OZOA 4MLWA 1K95A 5HKZA 1FF1A 2COLB 2L2EA 4FTGA 1JWDA 1TNXA 2EGDA 1DJZA 1EXRA 2P6BB 2L0PA 2K7BA 1PRWA 2BCBA 3JTDB 1S5GZ 4GBAA 2NXQA 4ORBB 3WNXB 3LCPC 1TNPA 3PLFB 1QASA 2K8MB 1RECA 3OB2B 4A4BA 3OB1B 2LVKA 1N65A 1NSHA 2GGMA 3LK1A 3SG6A 4ETOA 4BY4A 1IRJA 5B8IB 1PALA 1BODA 2JC2A 4MVFA 1VRKA 2KAYA 1KQMC 4CPVA 2MLEC 1J7QA 2CBLA 2LV7A 2NCOA 4GPLB 4N1GA 1CNPA 2I94A 2KBMA 3H4SE 1EH2A 4MN0A 1B4CA 1UUSA 4PHJA 5AXIA 4YGAA 1MXLC 1RWYA 1BMOA 3D10A 1CM4A 2KNEA 5CSIA 5AANA 1DJWA 2L4HA 2KSPA 1HQVA 4C0LA 2WCEA 1K96A 2KFFA 1QX5B 2R2IA 1AK8A 1K90D 3VROA 1KSOA 3BQ3A 1TN4A 1XYDA 4YGCB 2KDHA 3NSKA 1KK7Y 1LA0A 1OMDA 1YRUB 2LMUA 5AEQA 2CCMA 1KFUL 3FS7A 2L5XB 4MSPA 4MRYA 1MUXA 5KTYA 1SY9A 3BOWA 1UHHA 1JBAA 3O2PA 1MQ1A 3JVTC 3AKBA 3GK4X 1B7TY 1SMGA 1KQVA 5KU1A 2KAVA 1WRZA 3LL8B 4GUKA 2WC8A 2BL0C 4I5KA 1X02A 4PHMA 2LLTA 1TCOB 2EHBA 1TIZA 2KI4B 1EG3A 2L98A 1NCYA 2ZFDA 5DKRA 1V1FA 1B47A 1TNQA 2M97A 1EJ3A 1WDCB 2ZKMX 1ALVA 1CTRA 2NLNA 3NSIA 4ORAB 2JWWA 1Y0VH 2Y4QA 1DJIA 2L50A 2LLUA 3BUNB 4WQ3A 1DF0A 4HRHA 3LLEA 2Y5IA 1WY9A 1E8AA 3EVVA 1NX3A 5BPJA 2ZNDA 1CMGA 2KFGA 1K9PA 2ZN9A 1UWOA 1EG4A 5HKYA 1JF0A 2Y1MA 1MR8A 5FYXA 5G08A 1SW8A 2WCFA 3GK2A 3A4UB 2L51A 1CKKA 2WNDA 4DUQA 1TCFA 2KOTA 2M9GA 3CR5X 4MRXA 1CDMA 1L2OC 2WORA 3TS5C 1CLBA 3OX5A 3BYAA 1SNLA 2KQYA 1JF2A 2JT0A 1FI5A 4NDDA 3DF0B 3DVJA 4JWQA 3I5IB 2OTGC 1BG1A 1SR6C 4NDCA 4YI8A 1C7WA 2JOJA 2JTTA 1L2OB 3TZ1A 2PRUA 4OR9B 1W7IB 1DJXA 1QS7A 3I5FC 1UP5A 3NSOA 3SG3A 1LKJA 2K7CA 1A29A 1MXEA 2E6WA 3KEVA 3PATA 5F6TA 3VGOA 3PM8A 1JFKA 4C0JA 3PN7B 1XFUO 1IWQA 4D1EA 3OP0A 5CSNA 1JC2A 1JSAA 4I5NB 1BR4B 2G9BA 3AAJA 3FIAA 4OKHA 1CFFA 2BE4A 1A4PA 1OZSA 4YGBB 2OS8C 1NYAA 3I5FB 5PALA 1DJGA 2BCAA 4PE1A 1TNWA 2WCBA 1RROA 1IKUA 1ALWA 1F70A 4DCKA 2K2FA 1KK8B 1KWOC 4DS7A 2Q4UA 4R1EA 2JXLA 1XFWO 1YX8A 1B9AA 2LP2A 3F45A 4M2OA 1J7PA 2LUXA 1Y1AA 2H61C 1UURA 3SG5A 1CFCA 4PHNA 1IG5A 1KK7Z 2MA2A 3EKJA 1Y1XA 2PSRA 2M1UA 3TDZA 4CFRA 4AQJA 1JUOA 1SCMC 1K2HA 1QLSA 5TNCA 3AAKA 1SL7A 1YUTA 1NP8A 4P5OE 1FW4A 4GFTA 2PALA 1B1GA 1B7TZ 4M2QA 1NCXA 5GQQC 1UHJA 2H2KA 5CPVA 1ZMZA 1RJVA 4MEWA 1YUSA 2LMVA 3TDIA 4BY5A 2AMIA 1QATA 2CXJA 2KGBC 2I2RE 1KQMB 2I18A 1RTP1 1CFDA 4OVNF 5ER5A 1NIWA 2JXCA 2JZIA 1K93D 2LVVA 3DF0A 1PVBA 2LHIA 4NDBA 4USLA 1BOCA 3O78A 1J55A 3E3RA 4YGDB 3CWGA 1OSAA 3ICBA 1S1EA 2QACA 1XK4A 4IL1A 1ZOTB 1OE9B 1S6IA 2LNKA 2HF5A 2F2PA 2SCPA 1CDNA 3PFVA 2AAOA 3IF7A 5HLOA 2M1KB 2E30A 1W7JB 1J7OA 2KBIA 4GGFA 1WRLA 5KSZA 1F4OA 2HQWA 1IJ5A 1XA5A 3C1VA 3JVTB 4PE0A 3BUWB 2GV5A 3CS1A 1OQPA 4E68A 2JT8A 4A4CA 2F8PA 1KFXS 2BL0B 3DVKA 2ISDA 2F3YA 3IQOA 2G2BA 1AJ4A 1LVCD 2K0JA 2LVJA 1B8CA 3VRRA 4JPZB 3BUMB 3OX6A 3FWBA 1QVIY 1J1DA 1SYMA 4MBEA 3IQQA 1QX7A 2M49B 3TDUA 1YVLA 1D1OA 1B8RA 2KGRA 2LE9B 1PULA 1AJ5A 1DVIA 3MSEB 3ZNIA 1RFJA 2M8UA 3WHTB 2CTNA 2FOTA 1C07A 4UPGA 1K8UA 1QIVA 2LLSA 4U8DA 4YRUA 4M2PA 1CM1A 1CB1A 2EC6C 2WOSA 3EKHA 1QTXA 1WLMA 2K2AA 3D0YB 1XFYO 1ZUZA 3KO0A 4XYNA 5DKQA 4QJ5B 1JFJA 4PE4A 4QJ3B 2LUCA 3LK0A 2PMYA 2MRDA 1L7ZA 2K7DA 2O5GA 1R2UA 3KHEA 2KFHA 2BBMA 1PVAA 2KHNA 3RLZA 2JNXA 3O4YA 1B8LA 2BBNA 3TS5B 4DRWA 1AHRA 2TN4A 3HX4A 1V1GA 4MZJA 4P2YB 3PSRA 1TTXA 1DJHA 1NX1A 2PVBA 2OTGB 1ZFSA 5ER4X 1SR6B 3TUYC 4MZKA 4HRGA 2LHLA 4YI9A 3O6BA 2I7AA 5CSJA 2NCPA 4XJKB 4Q04A 3I5HC 1Q80A 4FQOA 3QRXA 1YTZC 4I5JA 2M29A 4C0KA 2FCEA 1G33A 1YRTB 3NXAA 4L9MA 3I5GC 1KFUS 2KYCA 5I2OA 1DGUA 2M7NA 3CR2A 3EVUA 3NSLA 4CIDA 1UHNA 2JQ6A 1MHOA 1NPQA 1DT7B 3SG4A 2A4JA 1CFPA 1NUBA 1F55A 5K89A 2Y1NA 2SASA 2OS8B 3EK4A 4ZCUA 3JTDC 1CMFA 4ORCB 5AERA 1U5IB 3SG7A 5JOLA 4TNCA 1A75B 1FI6A 1YVHA 4YGEB 1BU3A 1KWOB 3I5GB 2CNPA 2JU0A 1CDLA 4CLNA 2FJUB 4F0ZB 1J7RA 5I2QA 2MJWB 1BJFA 1H4BA 5CSFA 2KYFA 3VRPA 2B1UA 1QXPA 2VRGA 1GJYA 2KI6C 3CR4X 1SCMB 1F71A 2JRFA 4QJ4B 4DIRA 1QX2A 3HCMA 1BR1B 2Q91A 1EL4A 4YBHB 1SK6D 2K61A 2HETA 2KAXA 1J1EA 1M46A 1DMOA 1ODBA 1YR5A 2AUCA 3GOFA 2ZNEA 2LM5A 1IQ5A 1M31A 2LANA 3D0YA 1S3PA 2OPOA 2L4IA 4WRIA 1DJYA 2BECA 1UHIA 3DD4A 4PHKA 1XFXO 1QVIZ 1PK0D 2MAZA 2MHHA 4AOMA 1S6JA 4I5LB 1G4YR 1GQMA 1IGVA 1NCZA 1N2DA 3A8RA 3WXAA 3CTNA 1F54A 1HT9A 3SIBA 5HYDA 1BLQA 1A03A 1CLMA 4JQ0D 1KSMA 1DTLA 1S5GY 4CFQA 2BKIB 1WRKA 1SL9A 2JT3A 4N1FA 1SPYA 1XVJA 2MBXA 2BE6A 3M0WA 4GAOA 4HREE 4MZLA 3PALA 2KI4C 2ZRSA 4XJKA 1Y6WA 4ZCVA 5J3XA 2LMTA 2MLFC 1NX2A 1MF8B 1XFZO 2BKHB 1CLLA 1WDCC 1WLZA 5HKWA 1AUIB 2K7OA 3GK1A 1S36A 3DVMA 1SL8A 2F3ZA 1N0YA 1R6PA 1AVSA 3ZWHA 1QV1A 2CT9A 2JTZA 3KPXA 2KI6D 4NQGA 3AKAA 2D8NA 3CLNA 1K9KA 4WQ2A 4PCWA 1U5IA 1XFVO 1G8IA 5DKNA 2QPTA 1A75A 3CGAA 2V53A 2ZN8A 1IJ6A 5D69A 1YX7A 1OOJA 4ICBA 1CDPA 1K94A 1LA3A 1LXFC 2H61A 2LP3A 2JPTA 2M3WA 2ZRTA 3BUOB 3BUXB 4PDZA 5HLVA 1SKTA 1TOPA 1FPWA 2FCDA 3K21A 2LC5A 1QJTA 1RK9A 1DGVA 1SBJA 2LAPA 1UHKA 2LVIA 3I5IC 4PE7A 5JJGA 2KQ6A 3SIAA 2RGIA 1IH0A 2GGZA 5I2LA 1BF5A 1SRAA 3VRNA 1M39A 5I8NA 1XO5A 4OV2A 2EC6B 2JULA 3FWCA 1TRFA 1PSRA 1F8HA 2M7LA 4AQIA 1XK4C 1PSBA 3SG2A 1QIWA 4GGNA 4HSZA 4N5XA 3KF9A 1S26D 2HQ8A 3CZTX 4OCIA 1KCYA 1QLKA 1GGWA 3BOWB 3DVEA 1NX0A 5IBWA 4GGFC 3PN7C 1NWDA 2JNFA 2F2OA 5AFPA 3WHUB 1OMVA 1IQ3A 5D7FA 1AP4A 2DOQA 1C7VA 1F4QA 2LCPA 3BXKA 1GGZA 2IS9A 1OMRA 1S6CA 1YURA 3OHMB 3EVRA 3TUYB 1QV0A 4GNKB 2PASA 1KFXL 1SCVA 2O60A 1KK8C 1A2XA 2NZ0A 1LINA 3VRQA 3EK8A 3SJSA 3I5HB 1ZACA 2F33A 2M0RA 2HPSA 4PALA 1BT6A 3RM1A 1FBVA 1MWNA 1M63B 1Y1UA 1YUUA 1H8BA 1K9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF0 B;  3EK7 A;  1M45 A;  2BCX A;  1OZO A;  4MLW A;  1K95 A;  5HKZ A;  1FF1 A;  2COL B;  2L2E A;  4FTG A;  1JWD A;  1TNX A;  2EGD A;  1DJZ A;  1EXR A;  2P6B B;  2L0P A;  2K7B A;  1PRW A;  2BCB A;  3JTD B;  1S5G Z;  4GBA A;  2NXQ A;  4ORB B;  3WNX B;  3LCP C;  1TNP A;  3PLF B;  1QAS A;  2K8M B;  1REC A;  3OB2 B;  4A4B A;  3OB1 B;  2LVK A;  1N65 A;  1NSH A;  2GGM A;  3LK1 A;  3SG6 A;  4ETO A;  4BY4 A;  1IRJ A;  5B8I B;  1PAL A;  1BOD A;  2JC2 A;  4MVF A;  1VRK A;  2KAY A;  1KQM C;  4CPV A;  2MLE C;  1J7Q A;  2CBL A;  2LV7 A;  2NCO A;  4GPL B;  4N1G A;  1CNP A;  2I94 A;  2KBM A;  3H4S E;  1EH2 A;  4MN0 A;  1B4C A;  1UUS A;  4PHJ A;  5AXI A;  4YGA A;  1MXL C;  1RWY A;  1BMO A;  3D10 A;  1CM4 A;  2KNE A;  5CSI A;  5AAN A;  1DJW A;  2L4H A;  2KSP A;  1HQV A;  4C0L A;  2WCE A;  1K96 A;  2KFF A;  1QX5 B;  2R2I A;  1AK8 A;  1K90 D;  3VRO A;  1KSO A;  3BQ3 A;  1TN4 A;  1XYD A;  4YGC B;  2KDH A;  3NSK A;  1KK7 Y;  1LA0 A;  1OMD A;  1YRU B;  2LMU A;  5AEQ A;  2CCM A;  1KFU L;  3FS7 A;  2L5X B;  4MSP A;  4MRY A;  1MUX A;  5KTY A;  1SY9 A;  3BOW A;  1UHH A;  1JBA A;  3O2P A;  1MQ1 A;  3JVT C;  3AKB A;  3GK4 X;  1B7T Y;  1SMG A;  1KQV A;  5KU1 A;  2KAV A;  1WRZ A;  3LL8 B;  4GUK A;  2WC8 A;  2BL0 C;  4I5K A;  1X02 A;  4PHM A;  2LLT A;  1TCO B;  2EHB A;  1TIZ A;  2KI4 B;  1EG3 A;  2L98 A;  1NCY A;  2ZFD A;  5DKR A;  1V1F A;  1B47 A;  1TNQ A;  2M97 A;  1EJ3 A;  1WDC B;  2ZKM X;  1ALV A;  1CTR A;  2NLN A;  3NSI A;  4ORA B;  2JWW A;  1Y0V H;  2Y4Q A;  1DJI A;  2L50 A;  2LLU A;  3BUN B;  4WQ3 A;  1DF0 A;  4HRH A;  3LLE A;  2Y5I A;  1WY9 A;  1E8A A;  3EVV A;  1NX3 A;  5BPJ A;  2ZND A;  1CMG A;  2KFG A;  1K9P A;  2ZN9 A;  1UWO A;  1EG4 A;  5HKY A;  1JF0 A;  2Y1M A;  1MR8 A;  5FYX A;  5G08 A;  1SW8 A;  2WCF A;  3GK2 A;  3A4U B;  2L51 A;  1CKK A;  2WND A;  4DUQ A;  1TCF A;  2KOT A;  2M9G A;  3CR5 X;  4MRX A;  1CDM A;  1L2O C;  2WOR A;  3TS5 C;  1CLB A;  3OX5 A;  3BYA A;  1SNL A;  2KQY A;  1JF2 A;  2JT0 A;  1FI5 A;  4NDD A;  3DF0 B;  3DVJ A;  4JWQ A;  3I5I B;  2OTG C;  1BG1 A;  1SR6 C;  4NDC A;  4YI8 A;  1C7W A;  2JOJ A;  2JTT A;  1L2O B;  3TZ1 A;  2PRU A;  4OR9 B;  1W7I B;  1DJX A;  1QS7 A;  3I5F C;  1UP5 A;  3NSO A;  3SG3 A;  1LKJ A;  2K7C A;  1A29 A;  1MXE A;  2E6W A;  3KEV A;  3PAT A;  5F6T A;  3VGO A;  3PM8 A;  1JFK A;  4C0J A;  3PN7 B;  1XFU O;  1IWQ A;  4D1E A;  3OP0 A;  5CSN A;  1JC2 A;  1JSA A;  4I5N B;  1BR4 B;  2G9B A;  3AAJ A;  3FIA A;  4OKH A;  1CFF A;  2BE4 A;  1A4P A;  1OZS A;  4YGB B;  2OS8 C;  1NYA A;  3I5F B;  5PAL A;  1DJG A;  2BCA A;  4PE1 A;  1TNW A;  2WCB A;  1RRO A;  1IKU A;  1ALW A;  1F70 A;  4DCK A;  2K2F A;  1KK8 B;  1KWO C;  4DS7 A;  2Q4U A;  4R1E A;  2JXL A;  1XFW O;  1YX8 A;  1B9A A;  2LP2 A;  3F45 A;  4M2O A;  1J7P A;  2LUX A;  1Y1A A;  2H61 C;  1UUR A;  3SG5 A;  1CFC A;  4PHN A;  1IG5 A;  1KK7 Z;  2MA2 A;  3EKJ A;  1Y1X A;  2PSR A;  2M1U A;  3TDZ A;  4CFR A;  4AQJ A;  1JUO A;  1SCM C;  1K2H A;  1QLS A;  5TNC A;  3AAK A;  1SL7 A;  1YUT A;  1NP8 A;  4P5O E;  1FW4 A;  4GFT A;  2PAL A;  1B1G A;  1B7T Z;  4M2Q A;  1NCX A;  5GQQ C;  1UHJ A;  2H2K A;  5CPV A;  1ZMZ A;  1RJV A;  4MEW A;  1YUS A;  2LMV A;  3TDI A;  4BY5 A;  2AMI A;  1QAT A;  2CXJ A;  2KGB C;  2I2R E;  1KQM B;  2I18 A;  1RTP 1;  1CFD A;  4OVN F;  5ER5 A;  1NIW A;  2JXC A;  2JZI A;  1K93 D;  2LVV A;  3DF0 A;  1PVB A;  2LHI A;  4NDB A;  4USL A;  1BOC A;  3O78 A;  1J55 A;  3E3R A;  4YGD B;  3CWG A;  1OSA A;  3ICB A;  1S1E A;  2QAC A;  1XK4 A;  4IL1 A;  1ZOT B;  1OE9 B;  1S6I A;  2LNK A;  2HF5 A;  2F2P A;  2SCP A;  1CDN A;  3PFV A;  2AAO A;  3IF7 A;  5HLO A;  2M1K B;  2E30 A;  1W7J B;  1J7O A;  2KBI A;  4GGF A;  1WRL A;  5KSZ A;  1F4O A;  2HQW A;  1IJ5 A;  1XA5 A;  3C1V A;  3JVT B;  4PE0 A;  3BUW B;  2GV5 A;  3CS1 A;  1OQP A;  4E68 A;  2JT8 A;  4A4C A;  2F8P A;  1KFX S;  2BL0 B;  3DVK A;  2ISD A;  2F3Y A;  3IQO A;  2G2B A;  1AJ4 A;  1LVC D;  2K0J A;  2LVJ A;  1B8C A;  3VRR A;  4JPZ B;  3BUM B;  3OX6 A;  3FWB A;  1QVI Y;  1J1D A;  1SYM A;  4MBE A;  3IQQ A;  1QX7 A;  2M49 B;  3TDU A;  1YVL A;  1D1O A;  1B8R A;  2KGR A;  2LE9 B;  1PUL A;  1AJ5 A;  1DVI A;  3MSE B;  3ZNI A;  1RFJ A;  2M8U A;  3WHT B;  2CTN A;  2FOT A;  1C07 A;  4UPG A;  1K8U A;  1QIV A;  2LLS A;  4U8D A;  4YRU A;  4M2P A;  1CM1 A;  1CB1 A;  2EC6 C;  2WOS A;  3EKH A;  1QTX A;  1WLM A;  2K2A A;  3D0Y B;  1XFY O;  1ZUZ A;  3KO0 A;  4XYN A;  5DKQ A;  4QJ5 B;  1JFJ A;  4PE4 A;  4QJ3 B;  2LUC A;  3LK0 A;  2PMY A;  2MRD A;  1L7Z A;  2K7D A;  2O5G A;  1R2U A;  3KHE A;  2KFH A;  2BBM A;  1PVA A;  2KHN A;  3RLZ A;  2JNX A;  3O4Y A;  1B8L A;  2BBN A;  3TS5 B;  4DRW A;  1AHR A;  2TN4 A;  3HX4 A;  1V1G A;  4MZJ A;  4P2Y B;  3PSR A;  1TTX A;  1DJH A;  1NX1 A;  2PVB A;  2OTG B;  1ZFS A;  5ER4 X;  1SR6 B;  3TUY C;  4MZK A;  4HRG A;  2LHL A;  4YI9 A;  3O6B A;  2I7A A;  5CSJ A;  2NCP A;  4XJK B;  4Q04 A;  3I5H C;  1Q80 A;  4FQO A;  3QRX A;  1YTZ C;  4I5J A;  2M29 A;  4C0K A;  2FCE A;  1G33 A;  1YRT B;  3NXA A;  4L9M A;  3I5G C;  1KFU S;  2KYC A;  5I2O A;  1DGU A;  2M7N A;  3CR2 A;  3EVU A;  3NSL A;  4CID A;  1UHN A;  2JQ6 A;  1MHO A;  1NPQ A;  1DT7 B;  3SG4 A;  2A4J A;  1CFP A;  1NUB A;  1F55 A;  5K89 A;  2Y1N A;  2SAS A;  2OS8 B;  3EK4 A;  4ZCU A;  3JTD C;  1CMF A;  4ORC B;  5AER A;  1U5I B;  3SG7 A;  5JOL A;  4TNC A;  1A75 B;  1FI6 A;  1YVH A;  4YGE B;  1BU3 A;  1KWO B;  3I5G B;  2CNP A;  2JU0 A;  1CDL A;  4CLN A;  2FJU B;  4F0Z B;  1J7R A;  5I2Q A;  2MJW B;  1BJF A;  1H4B A;  5CSF A;  2KYF A;  3VRP A;  2B1U A;  1QXP A;  2VRG A;  1GJY A;  2KI6 C;  3CR4 X;  1SCM B;  1F71 A;  2JRF A;  4QJ4 B;  4DIR A;  1QX2 A;  3HCM A;  1BR1 B;  2Q91 A;  1EL4 A;  4YBH B;  1SK6 D;  2K61 A;  2HET A;  2KAX A;  1J1E A;  1M46 A;  1DMO A;  1ODB A;  1YR5 A;  2AUC A;  3GOF A;  2ZNE A;  2LM5 A;  1IQ5 A;  1M31 A;  2LAN A;  3D0Y A;  1S3P A;  2OPO A;  2L4I A;  4WRI A;  1DJY A;  2BEC A;  1UHI A;  3DD4 A;  4PHK A;  1XFX O;  1QVI Z;  1PK0 D;  2MAZ A;  2MHH A;  4AOM A;  1S6J A;  4I5L B;  1G4Y R;  1GQM A;  1IGV A;  1NCZ A;  1N2D A;  3A8R A;  3WXA A;  3CTN A;  1F54 A;  1HT9 A;  3SIB A;  5HYD A;  1BLQ A;  1A03 A;  1CLM A;  4JQ0 D;  1KSM A;  1DTL A;  1S5G Y;  4CFQ A;  2BKI B;  1WRK A;  1SL9 A;  2JT3 A;  4N1F A;  1SPY A;  1XVJ A;  2MBX A;  2BE6 A;  3M0W A;  4GAO A;  4HRE E;  4MZL A;  3PAL A;  2KI4 C;  2ZRS A;  4XJK A;  1Y6W A;  4ZCV A;  5J3X A;  2LMT A;  2MLF C;  1NX2 A;  1MF8 B;  1XFZ O;  2BKH B;  1CLL A;  1WDC C;  1WLZ A;  5HKW A;  1AUI B;  2K7O A;  3GK1 A;  1S36 A;  3DVM A;  1SL8 A;  2F3Z A;  1N0Y A;  1R6P A;  1AVS A;  3ZWH A;  1QV1 A;  2CT9 A;  2JTZ A;  3KPX A;  2KI6 D;  4NQG A;  3AKA A;  2D8N A;  3CLN A;  1K9K A;  4WQ2 A;  4PCW A;  1U5I A;  1XFV O;  1G8I A;  5DKN A;  2QPT A;  1A75 A;  3CGA A;  2V53 A;  2ZN8 A;  1IJ6 A;  5D69 A;  1YX7 A;  1OOJ A;  4ICB A;  1CDP A;  1K94 A;  1LA3 A;  1LXF C;  2H61 A;  2LP3 A;  2JPT A;  2M3W A;  2ZRT A;  3BUO B;  3BUX B;  4PDZ A;  5HLV A;  1SKT A;  1TOP A;  1FPW A;  2FCD A;  3K21 A;  2LC5 A;  1QJT A;  1RK9 A;  1DGV A;  1SBJ A;  2LAP A;  1UHK A;  2LVI A;  3I5I C;  4PE7 A;  5JJG A;  2KQ6 A;  3SIA A;  2RGI A;  1IH0 A;  2GGZ A;  5I2L A;  1BF5 A;  1SRA A;  3VRN A;  1M39 A;  5I8N A;  1XO5 A;  4OV2 A;  2EC6 B;  2JUL A;  3FWC A;  1TRF A;  1PSR A;  1F8H A;  2M7L A;  4AQI A;  1XK4 C;  1PSB A;  3SG2 A;  1QIW A;  4GGN A;  4HSZ A;  4N5X A;  3KF9 A;  1S26 D;  2HQ8 A;  3CZT X;  4OCI A;  1KCY A;  1QLK A;  1GGW A;  3BOW B;  3DVE A;  1NX0 A;  5IBW A;  4GGF C;  3PN7 C;  1NWD A;  2JNF A;  2F2O A;  5AFP A;  3WHU B;  1OMV A;  1IQ3 A;  5D7F A;  1AP4 A;  2DOQ A;  1C7V A;  1F4Q A;  2LCP A;  3BXK A;  1GGZ A;  2IS9 A;  1OMR A;  1S6C A;  1YUR A;  3OHM B;  3EVR A;  3TUY B;  1QV0 A;  4GNK B;  2PAS A;  1KFX L;  1SCV A;  2O60 A;  1KK8 C;  1A2X A;  2NZ0 A;  1LIN A;  3VRQ A;  3EK8 A;  3SJS A;  3I5H B;  1ZAC A;  2F33 A;  2M0R A;  2HPS A;  4PAL A;  1BT6 A;  3RM1 A;  1FBV A;  1MWN A;  1M63 B;  1Y1U A;  1YUU A;  1H8B A;  1K9U A; 
#chains in the Genus database with same CATH topology
 1DF0 B;  3EK7 A;  1M45 A;  2BCX A;  1OZO A;  4MLW A;  1K95 A;  5HKZ A;  1FF1 A;  2COL B;  2L2E A;  4FTG A;  1JWD A;  1TNX A;  2EGD A;  1DJZ A;  1EXR A;  2P6B B;  2L0P A;  2K7B A;  3VB1 A;  1PRW A;  2BCB A;  3JTD B;  1S5G Z;  4GBA A;  2NXQ A;  4ORB B;  3WNX B;  3LCP C;  1TNP A;  3PLF B;  3UO9 A;  1QAS A;  3S0D A;  2K8M B;  1REC A;  3OB2 B;  4A4B A;  3OB1 B;  3S0E A;  3S0F A;  2LVK A;  1N65 A;  1NSH A;  2GGM A;  3LK1 A;  3SG6 A;  4ETO A;  4BY4 A;  1IRJ A;  5B8I B;  1PAL A;  1BOD A;  2JC2 A;  1Z2C B;  4MVF A;  2WCK A;  1VRK A;  2KAY A;  1KQM C;  1Z4H A;  2MLE C;  4CPV A;  2CBL A;  2LV7 A;  1J7Q A;  2NCO A;  4GPL B;  4N1G A;  1CNP A;  1TUZ A;  2I94 A;  2KBM A;  3H4S E;  4MN0 A;  1B4C A;  1EH2 A;  1UUS A;  4PHJ A;  5AXI A;  4YGA A;  1MXL C;  1RWY A;  1BMO A;  3D10 A;  1CM4 A;  2KNE A;  5CSI A;  5AAN A;  1DJW A;  2L4H A;  1DC1 A;  2KSP A;  3BFH A;  1HQV A;  1C3Z A;  4C0L A;  2WCE A;  1K96 A;  2KFF A;  1QX5 B;  2R2I A;  1AK8 A;  1K90 D;  3VRO A;  1KSO A;  3BQ3 A;  1OW4 A;  1TN4 A;  1XYD A;  4YGC B;  2KDH A;  3NSK A;  1KK7 Y;  1LA0 A;  1OMD A;  1YRU B;  2LMU A;  5AEQ A;  2CCM A;  1KFU L;  3FS7 A;  2L5X B;  4MSP A;  4MRY A;  1MUX A;  5KTY A;  1SY9 A;  3BOW A;  1UHH A;  1JBA A;  3O2P A;  5FI6 A;  1MQ1 A;  3JVT C;  3AKB A;  3GK4 X;  1B7T Y;  1SMG A;  1KQV A;  5KU1 A;  2KAV A;  1WRZ A;  3LL8 B;  4INW A;  4GUK A;  2WC8 A;  2BL0 C;  2KLE A;  4I5K A;  1X02 A;  3OGN A;  4PHM A;  2LLT A;  1TCO B;  2EHB A;  1TIZ A;  2KI4 B;  1EG3 A;  2L98 A;  1NCY A;  2ZFD A;  5DKR A;  1V1F A;  1B47 A;  3SS3 A;  1TWO A;  1TNQ A;  2M97 A;  1EJ3 A;  1WDC B;  2ZKM X;  1ALV A;  1CTR A;  1T14 A;  2NLN A;  3NSI A;  4ORA B;  2JWW A;  1Y0V H;  2Y4Q A;  1DJI A;  2L50 A;  2LLU A;  3BUN B;  4WQ3 A;  1DF0 A;  4HRH A;  3LLE A;  2JPO A;  2Y5I A;  3CAB A;  1WY9 A;  3CZ0 A;  1E8A A;  3EVV A;  4INX A;  1NX3 A;  5BPJ A;  2ZND A;  3B88 A;  1CMG A;  2KFG A;  1K9P A;  3Q8I A;  2ZN9 A;  1UWO A;  3B7A A;  1EG4 A;  5HKY A;  1JF0 A;  2Y1M A;  1MR8 A;  5FYX A;  2KLD A;  5G08 A;  1SW8 A;  2WCF A;  3GK2 A;  3A4U B;  2L51 A;  1CKK A;  2WND A;  4DUQ A;  1TCF A;  2KOT A;  2M9G A;  3CR5 X;  2QEB A;  4MRX A;  1CDM A;  1L2O C;  2WOR A;  3TS5 C;  1SSE B;  1CLB A;  3OX5 A;  3BYA A;  1SNL A;  2KQY A;  1JF2 A;  2JT0 A;  1FI5 A;  4NDD A;  3DF0 B;  3DVJ A;  4JWQ A;  3I5I B;  4FQT A;  2OTG C;  1BG1 A;  3R1O A;  1SR6 C;  4NDC A;  4YI8 A;  1C7W A;  2JOJ A;  3L47 A;  2JTT A;  2H8V A;  1L2O B;  3EG5 B;  3TZ1 A;  2PRU A;  4OR9 B;  1W9Z A;  1W7I B;  1DJX A;  1QS7 A;  3I5F C;  3NHI A;  1UP5 A;  3NSO A;  3SG3 A;  1LKJ A;  2K7C A;  1A29 A;  1MXE A;  2E6W A;  3KEV A;  3PAT A;  5F6T A;  3VGO A;  3PM8 A;  2P70 A;  1JFK A;  4C0J A;  3PN7 B;  1OOF A;  1IWQ A;  1XFU O;  3OP0 A;  5CSN A;  4D1E A;  5HL1 A;  1JC2 A;  1JSA A;  4I5N B;  1BR4 B;  2G9B A;  3AAJ A;  3FIA A;  3K1E A;  3NHT A;  4OKH A;  2BE4 A;  1CFF A;  1A4P A;  1OZS A;  4YGB B;  2OS8 C;  1NYA A;  3I5F B;  5PAL A;  1DJG A;  2BCA A;  2WC5 A;  1TNW A;  2WCB A;  1RRO A;  4PE1 A;  1ALW A;  1IKU A;  1F70 A;  4DCK A;  2K2F A;  1KK8 B;  1KWO C;  4DS7 A;  2Q4U A;  4R1E A;  2JXL A;  1XFW O;  1YX8 A;  1B9A A;  2LP2 A;  3F45 A;  4M2O A;  1J7P A;  2LUX A;  1Y1A A;  2H61 C;  1UUR A;  3SG5 A;  1CFC A;  2WC6 A;  4PHN A;  1IG5 A;  1KK7 Z;  2MA2 A;  3EKJ A;  1Y1X A;  2PSR A;  2M1U A;  3TDZ A;  4CFR A;  4AQJ A;  1JUO A;  3V2L A;  2FJY A;  1SCM C;  1K2H A;  1QLS A;  5TNC A;  3AAK A;  1SL7 A;  1YUT A;  1NP8 A;  4P5O E;  1IIO A;  1FW4 A;  4GFT A;  2PAL A;  1B1G A;  1B7T Z;  4M2Q A;  1NCX A;  5GQQ C;  1UHJ A;  2H2K A;  5CPV A;  1ZMZ A;  1RJV A;  4MEW A;  1YUS A;  3D74 A;  2LMV A;  3TDI A;  4BY5 A;  4OZD A;  2AMI A;  1QAT A;  3S0G A;  2CXJ A;  2KGB C;  2I2R E;  1KQM B;  2I18 A;  1RTP 1;  1CFD A;  4OVN F;  5ER5 A;  3O4X A;  1NIW A;  2JXC A;  2WCM A;  2JZI A;  1K93 D;  2LVV A;  3DF0 A;  1PVB A;  2LHI A;  4NDB A;  1GM0 A;  4USL A;  1BOC A;  3O78 A;  1J55 A;  3E3R A;  3R72 A;  4YGD B;  3CWG A;  1OSA A;  3ICB A;  1C3Y A;  1S1E A;  2QAC A;  3PM2 A;  3DXL A;  1XK4 A;  4IL1 A;  1ZOT B;  1OE9 B;  1S6I A;  3NGV A;  2QEH A;  2LNK A;  2HF5 A;  2F2P A;  2SCP A;  3PJI A;  3PFV A;  1CDN A;  2AAO A;  3IF7 A;  5HLO A;  2M1K B;  2E30 A;  1W7J B;  3RZS A;  2WCJ A;  1J7O A;  2KBI A;  4GGF A;  3CZ1 A;  1WRL A;  4PT1 A;  5KSZ A;  1F4O A;  2HQW A;  1IJ5 A;  1XA5 A;  3C1V A;  3JVT B;  4PE0 A;  3BUW B;  2GV5 A;  3CS1 A;  1OQP A;  4E68 A;  2JT8 A;  4A4C A;  2F8P A;  1KFX S;  3B6X A;  2BL0 B;  3DVK A;  2ISD A;  2F3Y A;  3IQO A;  2G2B A;  1AJ4 A;  1LVC D;  2K0J A;  2LVJ A;  1B8C A;  3VRR A;  4JPZ B;  3BUM B;  3OX6 A;  3FWB A;  1QVI Y;  1J1D A;  1SYM A;  4MBE A;  3IQQ A;  1QX7 A;  2M49 B;  3TDU A;  1YVL A;  1D1O A;  1B8R A;  2KGR A;  2LE9 B;  1PUL A;  1AJ5 A;  1DVI A;  3MSE B;  3ZNI A;  1RFJ A;  2M8U A;  3B87 A;  2CTN A;  3WHT B;  4JD9 A;  2FOT A;  1C07 A;  4UPG A;  1K8U A;  1QIV A;  2LLS A;  4U8D A;  3BFA A;  4YRU A;  4M2P A;  1CM1 A;  1CB1 A;  2EC6 C;  2WOS A;  3EKH A;  1QTX A;  1WLM A;  2K2A A;  3D0Y B;  1XFY O;  1ZUZ A;  3KO0 A;  4XYN A;  5DKQ A;  4QJ5 B;  1JFJ A;  3SS4 A;  1OOH A;  4PE4 A;  5EL2 A;  4QJ3 B;  2LUC A;  3LK0 A;  2PMY A;  2MRD A;  1L7Z A;  2K7D A;  2O5G A;  1DEK A;  1R2U A;  5DIC A;  1DEL A;  3KHE A;  2KFH A;  5I94 A;  1PVA A;  2BBM A;  2KHN A;  3RLZ A;  2GTE A;  2JNX A;  3O4Y A;  1B8L A;  3FE8 A;  2BBN A;  3TS5 B;  4DRW A;  1AHR A;  2TN4 A;  3HX4 A;  1V1G A;  4MZJ A;  3D73 A;  3DYE A;  3R1P A;  4P2Y B;  3CYZ A;  3PSR A;  1TTX A;  1DJH A;  1NX1 A;  2PVB A;  2OTG B;  1ZFS A;  5ER4 X;  1SR6 B;  2WCH A;  3TUY C;  4MZK A;  4HRG A;  2LHL A;  4YI9 A;  3O6B A;  2I7A A;  3FE9 A;  5CSJ A;  2NCP A;  4XJK B;  1LS8 A;  4Q04 A;  3I5H C;  1Q80 A;  4FQO A;  3QRX A;  2P71 A;  1YTZ C;  4I5J A;  2M29 A;  4C0K A;  2FCE A;  1G33 A;  1YRT B;  3NXA A;  4L9M A;  3I5G C;  1KFU S;  2KYC A;  1QWV A;  5I2O A;  1DGU A;  2M7N A;  3CR2 A;  3EVU A;  3NSL A;  4CID A;  1UHN A;  4IJ7 A;  2JQ6 A;  1MHO A;  1NPQ A;  1DT7 B;  3SG4 A;  2A4J A;  1CFP A;  1NUB A;  2YGU A;  5K89 A;  1F55 A;  3L4L A;  2Y1N A;  2SAS A;  2OS8 B;  3EK4 A;  4ZCU A;  3JTD C;  1CMF A;  4ORC B;  5AER A;  1U5I B;  3SG7 A;  5JOL A;  4TNC A;  1A75 B;  1FI6 A;  1YVH A;  4YGE B;  1BU3 A;  1KWO B;  3I5G B;  2CNP A;  2JU0 A;  1CDL A;  3D76 A;  4JKT A;  4CLN A;  2FJU B;  3DZT A;  4F0Z B;  1J7R A;  5I2Q A;  1OOG A;  2MJW B;  1BJF A;  1H4B A;  5CSF A;  1TUJ A;  2KYF A;  3VRP A;  2B1U A;  1QXP A;  2VRG A;  1GJY A;  2KI6 C;  3CR4 X;  1SCM B;  1F71 A;  2JRF A;  4QJ4 B;  4DIR A;  1QX2 A;  3HCM A;  3BJH A;  1BR1 B;  2Q91 A;  1EL4 A;  2WCL A;  1SK6 D;  2ERB A;  2K61 A;  2HET A;  3QME A;  4YBH B;  2KAX A;  1J1E A;  1M46 A;  1DMO A;  1ODB A;  1YR5 A;  2AUC A;  3GOF A;  2ZNE A;  1P28 A;  2LM5 A;  1IQ5 A;  3IVT A;  1M31 A;  2LAN A;  3D0Y A;  1S3P A;  2OPO A;  2L4I A;  4WRI A;  1DJY A;  4KYN A;  2BEC A;  1UHI A;  3DD4 A;  4PHK A;  1XFX O;  1QVI Z;  1PK0 D;  2MAZ A;  2MHH A;  4AOM A;  1S6J A;  4I5L B;  1G4Y R;  1GQM A;  1IGV A;  1NCZ A;  1N2D A;  3A8R A;  3FE6 A;  3WXA A;  3CTN A;  5FI2 A;  1F54 A;  1HT9 A;  3SIB A;  5HYD A;  1BLQ A;  1A03 A;  3R1V A;  1CLM A;  4JQ0 D;  1KSM A;  1DTL A;  1S5G Y;  4CFQ A;  2BKI B;  1WRK A;  1SL9 A;  2JT3 A;  4N1F A;  1SPY A;  1XVJ A;  2MBX A;  2BE6 A;  3M0W A;  4GAO A;  4HRE E;  4MZL A;  3D75 A;  3PAL A;  2KI4 C;  2K60 A;  2ZRS A;  4XJK A;  1Y6W A;  4ZCV A;  5J3X A;  5D3O A;  2LMT A;  2MLF C;  3UNW A;  1NX2 A;  3S0B A;  1MF8 B;  1XFZ O;  2BKH B;  1CLL A;  1WDC C;  1WLZ A;  3CDN A;  5HKW A;  1AUI B;  2K7O A;  3N7H A;  1OOI X;  3GK1 A;  1S36 A;  3DVM A;  1SL8 A;  3DY9 A;  2F3Z A;  1N0Y A;  1R6P A;  1AVS A;  2PYQ A;  3SS5 A;  3ZWH A;  1QV1 A;  2CT9 A;  2JTZ A;  3KPX A;  2KI6 D;  4NQG A;  3AKA A;  2D8N A;  3CLN A;  1K9K A;  4WQ2 A;  4PCW A;  1U5I A;  1XFV O;  1G8I A;  5DKN A;  2QPT A;  1A75 A;  3CGA A;  2V53 A;  2ZN8 A;  1IJ6 A;  2PQL A;  5D69 A;  3CZ2 A;  1YX7 A;  1OOJ A;  4ICB A;  1CDP A;  1K94 A;  1LA3 A;  1LXF C;  2H61 A;  2LP3 A;  2JPT A;  2M3W A;  2ZRT A;  3BUO B;  3BUX B;  3D78 A;  4PDZ A;  5HLV A;  1SKT A;  1TOP A;  2QEO A;  1FPW A;  2FCD A;  3K21 A;  2LC5 A;  1QJT A;  1RK9 A;  1DGV A;  1SBJ A;  2LAP A;  1UHK A;  2LVI A;  3I5I C;  4PE7 A;  5JJG A;  2KQ6 A;  3SIA A;  2RGI A;  1IH0 A;  2GGZ A;  5I2L A;  1BF5 A;  1SRA A;  3VRN A;  1M39 A;  5I8N A;  1XO5 A;  4OV2 A;  2EC6 B;  2JUL A;  2L5Y A;  3FWC A;  1TRF A;  1PSR A;  1F8H A;  2BAP A;  2M7L A;  4AQI A;  1DQE A;  2L2C A;  1XK4 C;  1PSB A;  3SG2 A;  2QEV A;  1QIW A;  3B86 A;  4GGN A;  4HSZ A;  4N5X A;  3KF9 A;  5FI7 A;  1S26 D;  2HQ8 A;  3CZT X;  4OCI A;  3BFB A;  1KCY A;  1QLK A;  3OBV A;  1GGW A;  3BOW B;  1ORG A;  3DVE A;  1NX0 A;  5IBW A;  4GGF C;  3PN7 C;  1NWD A;  2QDI A;  2JNF A;  2F2O A;  5AFP A;  3WHU B;  1OMV A;  1IQ3 A;  5D7F A;  1AP4 A;  2DOQ A;  1C7V A;  1F4Q A;  2LCP A;  3BXK A;  1GGZ A;  2IS9 A;  1OMR A;  1S6C A;  1YUR A;  3S0A A;  2BNX A;  3OHM B;  3EVR A;  3TUY B;  1QV0 A;  4GNK B;  2PAS A;  1KFX L;  1SCV A;  4F7F A;  2O60 A;  1KK8 C;  1A2X A;  2NZ0 A;  1LIN A;  3VRQ A;  3D77 A;  3EK8 A;  3SJS A;  3I5H B;  1ZAC A;  3L4A A;  2F33 A;  2M0R A;  2HPS A;  4PAL A;  1BT6 A;  3RM1 A;  1FBV A;  1MWN A;  1M63 B;  1XFR A;  1Y1U A;  1YUU A;  1H8B A;  1K9U A;  2KPH A; 
#chains in the Genus database with same CATH homology
 1DF0 B;  3EK7 A;  1M45 A;  2BCX A;  1OZO A;  4MLW A;  1K95 A;  5HKZ A;  1FF1 A;  2COL B;  2L2E A;  4FTG A;  1JWD A;  1TNX A;  2EGD A;  1DJZ A;  1EXR A;  2P6B B;  2L0P A;  2K7B A;  1PRW A;  2BCB A;  3JTD B;  1S5G Z;  4GBA A;  2NXQ A;  4ORB B;  3WNX B;  3LCP C;  1TNP A;  3PLF B;  1QAS A;  2K8M B;  1REC A;  3OB2 B;  4A4B A;  3OB1 B;  2LVK A;  1N65 A;  1NSH A;  2GGM A;  3LK1 A;  3SG6 A;  4ETO A;  4BY4 A;  1IRJ A;  5B8I B;  1PAL A;  1BOD A;  2JC2 A;  4MVF A;  1VRK A;  2KAY A;  1KQM C;  4CPV A;  2MLE C;  1J7Q A;  2CBL A;  2LV7 A;  2NCO A;  4GPL B;  4N1G A;  1CNP A;  2I94 A;  2KBM A;  3H4S E;  1EH2 A;  4MN0 A;  1B4C A;  1UUS A;  4PHJ A;  5AXI A;  4YGA A;  1MXL C;  1RWY A;  1BMO A;  3D10 A;  1CM4 A;  2KNE A;  5CSI A;  5AAN A;  1DJW A;  2L4H A;  2KSP A;  1HQV A;  4C0L A;  2WCE A;  1K96 A;  2KFF A;  1QX5 B;  2R2I A;  1AK8 A;  1K90 D;  3VRO A;  1KSO A;  3BQ3 A;  1TN4 A;  1XYD A;  4YGC B;  2KDH A;  3NSK A;  1KK7 Y;  1LA0 A;  1OMD A;  1YRU B;  2LMU A;  5AEQ A;  2CCM A;  1KFU L;  3FS7 A;  2L5X B;  4MSP A;  4MRY A;  1MUX A;  5KTY A;  1SY9 A;  3BOW A;  1UHH A;  1JBA A;  3O2P A;  1MQ1 A;  3JVT C;  3AKB A;  3GK4 X;  1B7T Y;  1SMG A;  1KQV A;  5KU1 A;  2KAV A;  1WRZ A;  3LL8 B;  4GUK A;  2WC8 A;  2BL0 C;  4I5K A;  1X02 A;  4PHM A;  2LLT A;  1TCO B;  2EHB A;  1TIZ A;  2KI4 B;  1EG3 A;  2L98 A;  1NCY A;  2ZFD A;  5DKR A;  1V1F A;  1B47 A;  1TNQ A;  2M97 A;  1EJ3 A;  1WDC B;  2ZKM X;  1ALV A;  1CTR A;  2NLN A;  3NSI A;  4ORA B;  2JWW A;  1Y0V H;  2Y4Q A;  1DJI A;  2L50 A;  2LLU A;  3BUN B;  4WQ3 A;  1DF0 A;  4HRH A;  3LLE A;  2Y5I A;  1WY9 A;  1E8A A;  3EVV A;  1NX3 A;  5BPJ A;  2ZND A;  1CMG A;  2KFG A;  1K9P A;  2ZN9 A;  1UWO A;  1EG4 A;  5HKY A;  1JF0 A;  2Y1M A;  1MR8 A;  5FYX A;  5G08 A;  1SW8 A;  2WCF A;  3GK2 A;  3A4U B;  2L51 A;  1CKK A;  2WND A;  4DUQ A;  1TCF A;  2KOT A;  2M9G A;  3CR5 X;  4MRX A;  1CDM A;  1L2O C;  2WOR A;  3TS5 C;  1CLB A;  3OX5 A;  3BYA A;  1SNL A;  2KQY A;  1JF2 A;  2JT0 A;  1FI5 A;  4NDD A;  3DF0 B;  3DVJ A;  4JWQ A;  3I5I B;  2OTG C;  1BG1 A;  1SR6 C;  4NDC A;  4YI8 A;  1C7W A;  2JOJ A;  2JTT A;  1L2O B;  3TZ1 A;  2PRU A;  4OR9 B;  1W7I B;  1DJX A;  1QS7 A;  3I5F C;  1UP5 A;  3NSO A;  3SG3 A;  1LKJ A;  2K7C A;  1A29 A;  1MXE A;  2E6W A;  3KEV A;  3PAT A;  5F6T A;  3VGO A;  3PM8 A;  1JFK A;  4C0J A;  3PN7 B;  1XFU O;  1IWQ A;  4D1E A;  3OP0 A;  5CSN A;  1JC2 A;  1JSA A;  4I5N B;  1BR4 B;  2G9B A;  3AAJ A;  3FIA A;  4OKH A;  1CFF A;  2BE4 A;  1A4P A;  1OZS A;  4YGB B;  2OS8 C;  1NYA A;  3I5F B;  5PAL A;  1DJG A;  2BCA A;  4PE1 A;  1TNW A;  2WCB A;  1RRO A;  1IKU A;  1ALW A;  1F70 A;  4DCK A;  2K2F A;  1KK8 B;  1KWO C;  4DS7 A;  2Q4U A;  4R1E A;  2JXL A;  1XFW O;  1YX8 A;  1B9A A;  2LP2 A;  3F45 A;  4M2O A;  1J7P A;  2LUX A;  1Y1A A;  2H61 C;  1UUR A;  3SG5 A;  1CFC A;  4PHN A;  1IG5 A;  1KK7 Z;  2MA2 A;  3EKJ A;  1Y1X A;  2PSR A;  2M1U A;  3TDZ A;  4CFR A;  4AQJ A;  1JUO A;  1SCM C;  1K2H A;  1QLS A;  5TNC A;  3AAK A;  1SL7 A;  1YUT A;  1NP8 A;  4P5O E;  1FW4 A;  4GFT A;  2PAL A;  1B1G A;  1B7T Z;  4M2Q A;  1NCX A;  5GQQ C;  1UHJ A;  2H2K A;  5CPV A;  1ZMZ A;  1RJV A;  4MEW A;  1YUS A;  2LMV A;  3TDI A;  4BY5 A;  2AMI A;  1QAT A;  2CXJ A;  2KGB C;  2I2R E;  1KQM B;  2I18 A;  1RTP 1;  1CFD A;  4OVN F;  5ER5 A;  1NIW A;  2JXC A;  2JZI A;  1K93 D;  2LVV A;  3DF0 A;  1PVB A;  2LHI A;  4NDB A;  4USL A;  1BOC A;  3O78 A;  1J55 A;  3E3R A;  4YGD B;  3CWG A;  1OSA A;  3ICB A;  1S1E A;  2QAC A;  1XK4 A;  4IL1 A;  1ZOT B;  1OE9 B;  1S6I A;  2LNK A;  2HF5 A;  2F2P A;  2SCP A;  1CDN A;  3PFV A;  2AAO A;  3IF7 A;  5HLO A;  2M1K B;  2E30 A;  1W7J B;  1J7O A;  2KBI A;  4GGF A;  1WRL A;  5KSZ A;  1F4O A;  2HQW A;  1IJ5 A;  1XA5 A;  3C1V A;  3JVT B;  4PE0 A;  3BUW B;  2GV5 A;  3CS1 A;  1OQP A;  4E68 A;  2JT8 A;  4A4C A;  2F8P A;  1KFX S;  2BL0 B;  3DVK A;  2ISD A;  2F3Y A;  3IQO A;  2G2B A;  1AJ4 A;  1LVC D;  2K0J A;  2LVJ A;  1B8C A;  3VRR A;  4JPZ B;  3BUM B;  3OX6 A;  3FWB A;  1QVI Y;  1J1D A;  1SYM A;  4MBE A;  3IQQ A;  1QX7 A;  2M49 B;  3TDU A;  1YVL A;  1D1O A;  1B8R A;  2KGR A;  2LE9 B;  1PUL A;  1AJ5 A;  1DVI A;  3MSE B;  3ZNI A;  1RFJ A;  2M8U A;  3WHT B;  2CTN A;  2FOT A;  1C07 A;  4UPG A;  1K8U A;  1QIV A;  2LLS A;  4U8D A;  4YRU A;  4M2P A;  1CM1 A;  1CB1 A;  2EC6 C;  2WOS A;  3EKH A;  1QTX A;  1WLM A;  2K2A A;  3D0Y B;  1XFY O;  1ZUZ A;  3KO0 A;  4XYN A;  5DKQ A;  4QJ5 B;  1JFJ A;  4PE4 A;  4QJ3 B;  2LUC A;  3LK0 A;  2PMY A;  2MRD A;  1L7Z A;  2K7D A;  2O5G A;  1R2U A;  3KHE A;  2KFH A;  2BBM A;  1PVA A;  2KHN A;  3RLZ A;  2JNX A;  3O4Y A;  1B8L A;  2BBN A;  3TS5 B;  4DRW A;  1AHR A;  2TN4 A;  3HX4 A;  1V1G A;  4MZJ A;  4P2Y B;  3PSR A;  1TTX A;  1DJH A;  1NX1 A;  2PVB A;  2OTG B;  1ZFS A;  5ER4 X;  1SR6 B;  3TUY C;  4MZK A;  4HRG A;  2LHL A;  4YI9 A;  3O6B A;  2I7A A;  5CSJ A;  2NCP A;  4XJK B;  4Q04 A;  3I5H C;  1Q80 A;  4FQO A;  3QRX A;  1YTZ C;  4I5J A;  2M29 A;  4C0K A;  2FCE A;  1G33 A;  1YRT B;  3NXA A;  4L9M A;  3I5G C;  1KFU S;  2KYC A;  5I2O A;  1DGU A;  2M7N A;  3CR2 A;  3EVU A;  3NSL A;  4CID A;  1UHN A;  2JQ6 A;  1MHO A;  1NPQ A;  1DT7 B;  3SG4 A;  2A4J A;  1CFP A;  1NUB A;  1F55 A;  5K89 A;  2Y1N A;  2SAS A;  2OS8 B;  3EK4 A;  4ZCU A;  3JTD C;  1CMF A;  4ORC B;  5AER A;  1U5I B;  3SG7 A;  5JOL A;  4TNC A;  1A75 B;  1FI6 A;  1YVH A;  4YGE B;  1BU3 A;  1KWO B;  3I5G B;  2CNP A;  2JU0 A;  1CDL A;  4CLN A;  2FJU B;  4F0Z B;  1J7R A;  5I2Q A;  2MJW B;  1BJF A;  1H4B A;  5CSF A;  2KYF A;  3VRP A;  2B1U A;  1QXP A;  2VRG A;  1GJY A;  2KI6 C;  3CR4 X;  1SCM B;  1F71 A;  2JRF A;  4QJ4 B;  4DIR A;  1QX2 A;  3HCM A;  1BR1 B;  2Q91 A;  1EL4 A;  4YBH B;  1SK6 D;  2K61 A;  2HET A;  2KAX A;  1J1E A;  1M46 A;  1DMO A;  1ODB A;  1YR5 A;  2AUC A;  3GOF A;  2ZNE A;  2LM5 A;  1IQ5 A;  1M31 A;  2LAN A;  3D0Y A;  1S3P A;  2OPO A;  2L4I A;  4WRI A;  1DJY A;  2BEC A;  1UHI A;  3DD4 A;  4PHK A;  1XFX O;  1QVI Z;  1PK0 D;  2MAZ A;  2MHH A;  4AOM A;  1S6J A;  4I5L B;  1G4Y R;  1GQM A;  1IGV A;  1NCZ A;  1N2D A;  3A8R A;  3WXA A;  3CTN A;  1F54 A;  1HT9 A;  3SIB A;  5HYD A;  1BLQ A;  1A03 A;  1CLM A;  4JQ0 D;  1KSM A;  1DTL A;  1S5G Y;  4CFQ A;  2BKI B;  1WRK A;  1SL9 A;  2JT3 A;  4N1F A;  1SPY A;  1XVJ A;  2MBX A;  2BE6 A;  3M0W A;  4GAO A;  4HRE E;  4MZL A;  3PAL A;  2KI4 C;  2ZRS A;  4XJK A;  1Y6W A;  4ZCV A;  5J3X A;  2LMT A;  2MLF C;  1NX2 A;  1MF8 B;  1XFZ O;  2BKH B;  1CLL A;  1WDC C;  1WLZ A;  5HKW A;  1AUI B;  2K7O A;  3GK1 A;  1S36 A;  3DVM A;  1SL8 A;  2F3Z A;  1N0Y A;  1R6P A;  1AVS A;  3ZWH A;  1QV1 A;  2CT9 A;  2JTZ A;  3KPX A;  2KI6 D;  4NQG A;  3AKA A;  2D8N A;  3CLN A;  1K9K A;  4WQ2 A;  4PCW A;  1U5I A;  1XFV O;  1G8I A;  5DKN A;  2QPT A;  1A75 A;  3CGA A;  2V53 A;  2ZN8 A;  1IJ6 A;  5D69 A;  1YX7 A;  1OOJ A;  4ICB A;  1CDP A;  1K94 A;  1LA3 A;  1LXF C;  2H61 A;  2LP3 A;  2JPT A;  2M3W A;  2ZRT A;  3BUO B;  3BUX B;  4PDZ A;  5HLV A;  1SKT A;  1TOP A;  1FPW A;  2FCD A;  3K21 A;  2LC5 A;  1QJT A;  1RK9 A;  1DGV A;  1SBJ A;  2LAP A;  1UHK A;  2LVI A;  3I5I C;  4PE7 A;  5JJG A;  2KQ6 A;  3SIA A;  2RGI A;  1IH0 A;  2GGZ A;  5I2L A;  1BF5 A;  1SRA A;  3VRN A;  1M39 A;  5I8N A;  1XO5 A;  4OV2 A;  2EC6 B;  2JUL A;  3FWC A;  1TRF A;  1PSR A;  1F8H A;  2M7L A;  4AQI A;  1XK4 C;  1PSB A;  3SG2 A;  1QIW A;  4GGN A;  4HSZ A;  4N5X A;  3KF9 A;  1S26 D;  2HQ8 A;  3CZT X;  4OCI A;  1KCY A;  1QLK A;  1GGW A;  3BOW B;  3DVE A;  1NX0 A;  5IBW A;  4GGF C;  3PN7 C;  1NWD A;  2JNF A;  2F2O A;  5AFP A;  3WHU B;  1OMV A;  1IQ3 A;  5D7F A;  1AP4 A;  2DOQ A;  1C7V A;  1F4Q A;  2LCP A;  3BXK A;  1GGZ A;  2IS9 A;  1OMR A;  1S6C A;  1YUR A;  3OHM B;  3EVR A;  3TUY B;  1QV0 A;  4GNK B;  2PAS A;  1KFX L;  1SCV A;  2O60 A;  1KK8 C;  1A2X A;  2NZ0 A;  1LIN A;  3VRQ A;  3EK8 A;  3SJS A;  3I5H B;  1ZAC A;  2F33 A;  2M0R A;  2HPS A;  4PAL A;  1BT6 A;  3RM1 A;  1FBV A;  1MWN A;  1M63 B;  1Y1U A;  1YUU A;  1H8B A;  1K9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...