4MRXA

Crystal structure of y138f obelin mutant from obelia longissima at 1.72 angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
190
structure length
188
Chain Sequence
AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDDGSGTITLDEWKAFGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Structures of the Ca2+-regulated photoprotein obelin Y138F mutant before and after bioluminescence support the catalytic function of a water molecule in the reaction
doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 75
structure length 188
sequence length 190
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mrxA00
1Y0VH 3VRQA 4HRHA 1B8RA 1XFZO 1XYDA 2JC2A 3NSLA 1YRTB 2JT3A 1JF2A 1WLMA 1AK8A 3BOWA 3NSKA 2KAXA 3O78A 1CM4A 1YUUA 2Y1MA 4FQOA 2LP3A 1ALWA 1S1EA 1TNQA 1WY9A 1DJHA 3I5HB 1KFUS 1Y6WA 3TZ1A 1DJIA 4A4CA 1LVCD 2F3YA 5KU1A 2JNFA 2ZRSA 4YGAA 2LUCA 4CFQA 4ETOA 2JQ6A 1N2DA 1TNWA 2K0JA 1IQ3A 1JBAA 1XFUO 2BKHB 3RLZA 1JWDA 1RK9A 1MUXA 1XA5A 1K94A 3SG6A 1F4OA 2JTTA 1W7JB 1XFWO 2I94A 1FF1A 1JF0A 2K7CA 1B7TY 1BJFA 1WRKA 2LUXA 3QRXA 2BL0B 1SL8A 3FWCA 1BOCA 1X02A 2LV7A 3HCMA 3SG7A 1CDMA 3DVKA 2JULA 1Y1AA 2QPTA 1CTRA 2OPOA 3CWGA 2KOTA 4MBEA 1SPYA 2HQ8A 3LK1A 2ZFDA 1RWYA 2HF5A 2B1UA 1PSRA 1PK0D 1U5IA 2JRFA 2M7LA 1IJ6A 3BUMB 4N5XA 1ZOTB 3BQ3A 1SMGA 4C0JA 1S26D 1BG1A 1B47A 1CMGA 1WLZA 3BUNB 4MN0A 1AJ4A 3I5IC 2PMYA 3KPXA 2M7NA 1OSAA 1CMFA 3BUWB 1GGZA 2H61C 2JU0A 4USLA 1B8LA 3VROA 1TNPA 4E68A 1K9KA 3F45A 1IKUA 5ER5A 1F71A 2OS8C 3EK4A 3HX4A 2F33A 5I2OA 4OVNF 1PALA 2CXJA 1SRAA 1OMDA 1HQVA 5CSFA 1KFXS 2KYFA 3BOWB 1RROA 1B9AA 2Q91A 3M0WA 1ZMZA 1ZFSA 1M39A 3K21A 1UUSA 3PN7C 1UP5A 5DKRA 1ZUZA 3E3RA 2L4IA 1DVIA 1H4BA 1V1FA 1TOPA 1Y1XA 3I5FC 2MHHA 4L9MA 2BCXA 2GGZA 1IG5A 2K8MB 4YI9A 1SCVA 3RM1A 1DJYA 5AXIA 1IJ5A 1XK4A 2O5GA 2WORA 2LVJA 2F2OA 1KCYA 1TIZA 2FCDA 1J7OA 1KWOC 3PALA 1XVJA 2CT9A 4IL1A 2CCMA 1CNPA 5DKQA 2CBLA 1IH0A 1S5GZ 2EC6B 1QLSA 4GPLB 1BU3A 4BY5A 2A4JA 1J7RA 2KAYA 1UHJA 4PHMA 3CTNA 4YRUA 1S6CA 3JVTB 1OZOA 1SL9A 3EVRA 2MLEC 3AAKA 1GJYA 4PE4A 1PVAA 2ZNEA 3DD4A 1Y1UA 1BODA 1M45A 4QJ5B 2Y5IA 3DF0A 2F2PA 2SCPA 2WCBA 2KBMA 3PSRA 4XYNA 5HKWA 1CFCA 4PHKA 1BT6A 1K95A 1NX1A 3EKJA 5CSNA 2LAPA 1MWNA 4AOMA 1NSHA 5FYXA 1CDNA 3JTDC 4ORBB 4GNKB 1XFXO 1SNLA 1JSAA 1NWDA 4DIRA 2KSPA 3FS7A 4MLWA 4D1EA 1DF0A 4WRIA 2LVKA 2ZNDA 4YGCB 1DGUA 3AKAA 5AEQA 1XFVO 2M3WA 3VRRA 4WQ3A 3O4YA 3KF9A 3TUYB 1MQ1A 2K61A 1UHKA 1PULA 2Y1NA 3O2PA 3CR2A 3DVJA 1A75B 4ZCUA 1DT7B 4XJKB 1DMOA 2KI4B 1A03A 3SG4A 3WHUB 1K96A 3MSEB 1UWOA 1OQPA 1UURA 1V1GA 2FCEA 3OP0A 3SIAA 3WXAA 5I2QA 1ZACA 1FPWA 5DKNA 3SJSA 4PHJA 4HSZA 1SR6B 1KK8C 1L2OC 4UPGA 1IQ5A 2MJWB 2D8NA 5AFPA 1K90D 2JPTA 4ZCVA 1NX3A 1VRKA 4YBHB 1CFDA 1QX5B 1YUTA 1KFUL 1AUIB 2V53A 5HLOA 2OTGC 4OR9B 5B8IB 4NQGA 1SY9A 2KQ6A 3AKBA 5K89A 2M97A 4M2PA 1GGWA 1QXPA 2BECA 2L0PA 2HETA 3IQOA 2QACA 1SL7A 1PSBA 5ER4X 1HT9A 1WDCC 3CZTX 4GFTA 1QJTA 4A4BA 1YTZC 2M8UA 1KQMC 2K7BA 2HPSA 4C0KA 3LLEA 2KHNA 1F54A 4R1EA 3DF0B 3IF7A 3LCPC 2M1UA 1G8IA 1K2HA 4I5KA 1F8HA 2ZRTA 2NZ0A 2DOQA 1M46A 4GUKA 2G2BA 3CS1A 1MHOA 1J7PA 4I5JA 5CSJA 1UHHA 4NDCA 2K7OA 1A4PA 2I7AA 5AERA 3OHMB 2WOSA 1JFJA 2FOTA 1S5GY 1DF0B 1XFYO 4HRGA 2K7DA 2LMUA 3I5GB 4P5OE 1SCMB 1LXFC 5GQQC 2LC5A 2PSRA 1B1GA 1NCZA 1SKTA 2JNXA 4MVFA 1NP8A 1QV0A 2R2IA 1RTP1 2G9BA 4DS7A 2ZKMX 1K93D 2NCOA 1TRFA 3BUOB 1OE9B 1WRLA 2MRDA 2WNDA 2K2FA 1A75A 1QVIY 4AQJA 1KFXL 4XJKA 5G08A 2H2KA 5BPJA 1C7VA 3CR5X 2KGBC 2LMVA 3CLNA 1EH2A 1LA3A 1TCFA 3OB1B 4Q04A 5HKZA 1EXRA 1JUOA 1R2UA 1J1DA 2NLNA 4BY4A 4F0ZB 1FI5A 1M31A 3A8RA 1BR4B 1QATA 3GOFA 2LANA 4I5NB 3ICBA 1YX8A 2L2EA 3PM8A 4PHNA 1J55A 5JOLA 5JJGA 3ZNIA 4N1GA 4CFRA 2KI6C 1IWQA 2AAOA 4CPVA 1J1EA 1CLBA 4GGFC 1RJVA 3I5HC 2Y4QA 2LLSA 4JPZB 1H8BA 1SK6D 2RGIA 2VRGA 2BBNA 1EG3A 2M9GA 4GBAA 1A29A 3VGOA 4QJ3B 4PCWA 1NX2A 1YR5A 2LLUA 1MXLC 2KFHA 2KQYA 1ALVA 1BMOA 2MBXA 2EHBA 1MXEA 2L4HA 1OMVA 2F8PA 2LE9B 2BE6A 2WCFA 1QV1A 2BL0C 4DRWA 1QVIZ 3I5IB 1Q80A 4PE0A 1QIVA 2E6WA 4YGEB 2KFFA 2F3ZA 3WNXB 1DJXA 1NIWA 4FTGA 1TCOB 3CR4X 3KO0A 2EGDA 2M1KB 2KDHA 4OKHA 4MZJA 2BE4A 1MF8B 2BKIB 4YGDB 1JC2A 1S36A 2KFGA 2OS8B 3D0YA 1LA0A 2BCAA 2L50A 1YX7A 3KEVA 2PVBA 3PFVA 1CFPA 1FI6A 1D1OA 2LVIA 3OX5A 4ICBA 1F55A 4ORCB 1IGVA 1YRUB 2K2AA 2LHIA 4YGBB 1AVSA 3I5GC 4QJ4B 5KTYA 4MRYA 1BLQA 3PN7B 1WRZA 1CKKA 3SIBA 4OCIA 2ZN9A 3TDZA 1QTXA 3SG3A 3TDUA 3VRNA 2KGRA 1TN4A 3EKHA 1S6JA 3I5FB 2LLTA 1PRWA 5KSZA 2IS9A 3NSOA 1KSOA 2COLB 1A2XA 1K9PA 1TNXA 2O60A 3C1VA 1NCYA 3GK4X 1UHIA 3TS5B 1KWOB 3BUXB 5PALA 2BCBA 4DUQA 1NCXA 2L5XB 3BXKA 5HLVA 2KYCA 4TNCA 1NX0A 3EK7A 2FJUB 4I5LB 1QS7A 2CTNA 3SG2A 1CDLA 1J7QA 5IBWA 4GAOA 5CSIA 2KNEA 2TN4A 1R6PA 3DVMA 4JWQA 3EVVA 2JT8A 1QIWA 1IRJA 2JZIA 1B8CA 1KK7Y 1N65A 1F70A 2JTZA 2EC6C 3O6BA 3OX6A 2LHLA 3IQQA 3JTDB 5TNCA 1AHRA 5D7FA 3JVTC 2ISDA 2M49B 2MAZA 3PLFB 4WQ2A 3NXAA 1CLMA 4CIDA 5D69A 3D0YB 2AMIA 2H61A 5F6TA 3BYAA 2KBIA 4GGNA 1L7ZA 2WC8A 1QX2A 1G4YR 2M29A 2PRUA 2JWWA 5HYDA 2AUCA 1SBJA 2MA2A 1EL4A 2L98A 1LINA 1OOJA 3ZWHA 1AJ5A 1CLLA 2GV5A 1DJWA 1FW4A 2KI6D 4MEWA 4HREE 1PVBA 2M0RA 3GK2A 1CDPA 5AANA 3LL8B 2I2RE 1SW8A 1JFKA 2LCPA 1B4CA 1S6IA 3KHEA 1KSMA 2SASA 5CPVA 3TUYC 3H4SE 1KK8B 1L2OB 4P2YB 1CB1A 1G33A 4OV2A 1TTXA 2JT0A 2L51A 4YI8A 3LK0A 3SG5A 1KK7Z 2NCPA 1F4QA 2HQWA 2LP2A 2NXQA 1OMRA 2E30A 2JXLA 2KI4C 2OTGB 1B7TZ 2LMTA 3PATA 1UHNA 4AQIA 1QX7A 3FWBA 2MLFC 1EJ3A 4PDZA 1EG4A 1WDCB 2LVVA 4JQ0D 4GGFA 3EVUA 1KQMB 1KQVA 1SR6C 3CGAA 3DVEA 1RFJA 1XK4C 4ORAB 1YVLA 2I18A 1NPQA 4PE1A 1C07A 1N0YA 1NUBA 2GGMA 2P6BB 1RECA 1DTLA 1ODBA 4PE7A 3TS5C 3FIAA 2KAVA 4MRXA 5J3XA 3EK8A 4MZLA 4NDBA 2WCEA 3VRPA 2CNPA 3NSIA 4CLNA 1LKJA 1W7IB 1SYMA 2JXCA 3TDIA 4DCKA 4N1FA 1CM1A 1MR8A 1DJGA 1K9UA 1S3PA 1E8AA 1XO5A 2PASA 1OZSA 1U5IB 5HKYA 1QASA 3WHTB 4C0LA 2PALA 2Q4UA 1QLKA 3D10A 4MSPA 1FBVA 1YURA 1BF5A 2LM5A 1DJZA 4PALA 1M63B 2LNKA 4M2QA 3AAJA 3GK1A 1GQMA 2BBMA 4U8DA 1AP4A 2ZN8A 1CFFA 4M2OA 1C7WA 5I8NA 3A4UB 1YVHA 1SCMC 4NDDA 1DGVA 1K8UA 5I2LA 1YUSA 2JOJA 1BR1B 4MZKA 1NYAA 3OB2B
chains in the Genus database with same CATH superfamily
1Y0VH 3VRQA 4HRHA 1B8RA 4JKTA 1XFZO 3B7AA 3R1OA 3NHIA 1XYDA 2JC2A 3NSLA 1YRTB 2JT3A 3RZSA 1JF2A 3SS5A 1WLMA 1AK8A 1OOHA 5EL2A 3BOWA 3FE6A 3NSKA 5FI6A 2KAXA 3O78A 3S0AA 1DC1A 1CM4A 1YUUA 2Y1MA 4FQOA 2LP3A 1ALWA 1S1EA 1TNQA 1WY9A 1DJHA 3I5HB 1KFUS 1Y6WA 3TZ1A 1DJIA 4A4CA 1LVCD 2F3YA 5KU1A 2WC6A 2JNFA 2ZRSA 4YGAA 2LUCA 4CFQA 4ETOA 2JQ6A 1N2DA 1TNWA 2K0JA 1IQ3A 1JBAA 1XFUO 2BKHB 3RLZA 1JWDA 1RK9A 1MUXA 2P71A 1XA5A 1K94A 3Q8IA 1F4OA 3SG6A 2JTTA 3CZ0A 1W7JB 1XFWO 2I94A 1FF1A 1JF0A 2K7CA 1B7TY 1BJFA 1WRKA 2LUXA 3B88A 3QRXA 2WC5A 2BL0B 1SL8A 3FWCA 1BOCA 1X02A 2LV7A 3HCMA 3SG7A 1CDMA 3DVKA 2JULA 1Y1AA 2QPTA 1CTRA 1Z2CB 2OPOA 3CWGA 2KOTA 2PYQA 4MBEA 1SPYA 2HQ8A 3LK1A 1C3ZA 4F7FA 2ZFDA 1RWYA 2HF5A 2B1UA 1PSRA 1PK0D 1U5IA 2JRFA 2M7LA 1IJ6A 3BUMB 4N5XA 1ZOTB 3BQ3A 5FI2A 1SMGA 4C0JA 1S26D 1BG1A 1B47A 1CMGA 1WLZA 3BUNB 4MN0A 1AJ4A 3I5IC 2PMYA 3KPXA 2M7NA 5DICA 1OSAA 1CMFA 3BUWB 5D3OA 1W9ZA 1GGZA 2H61C 2JU0A 4USLA 1B8LA 3VROA 1TNPA 4E68A 1K9KA 3F45A 1IKUA 5ER5A 1F71A 2OS8C 3EK4A 3HX4A 2F33A 5I2OA 4OVNF 1PALA 2CXJA 1SRAA 1OMDA 1HQVA 1OOFA 3BJHA 5CSFA 1KFXS 2KYFA 3BOWB 1RROA 1B9AA 2Q91A 3M0WA 1ZMZA 1ZFSA 1M39A 3K21A 1UUSA 3PN7C 1UP5A 5DKRA 2WCHA 1ZUZA 3E3RA 2L4IA 1DVIA 1H4BA 1V1FA 1TOPA 1Y1XA 3I5FC 2MHHA 4L9MA 3S0FA 2BCXA 2GGZA 1IG5A 2K8MB 4YI9A 1SCVA 3RM1A 1DJYA 5AXIA 1IJ5A 1XK4A 2O5GA 2WORA 2LVJA 2F2OA 1KCYA 1TIZA 2FCDA 1J7OA 1KWOC 3PALA 1XVJA 2CT9A 4IL1A 2CCMA 1CNPA 5DKQA 2CBLA 1IH0A 1S5GZ 2EC6B 1QLSA 4GPLB 1BU3A 1OOIX 4BY5A 2A4JA 1J7RA 2KAYA 1UHJA 3QMEA 4PHMA 3CTNA 4YRUA 1S6CA 3JVTB 1OZOA 1SL9A 3EVRA 2MLEC 3AAKA 1GJYA 4PE4A 1PVAA 2ZNEA 3DD4A 1Y1UA 1BODA 1M45A 4QJ5B 2Y5IA 3DF0A 4KYNA 3BFHA 2F2PA 2SCPA 2WCBA 2KBMA 3PSRA 2H8VA 4XYNA 5HKWA 1CFCA 2KLDA 4PHKA 3UNWA 1BT6A 1K95A 1NX1A 1OW4A 3EKJA 5CSNA 2LAPA 1MWNA 4AOMA 1NSHA 5FYXA 1CDNA 3IVTA 3JTDC 4ORBB 4GNKB 3D74A 1XFXO 1SNLA 1JSAA 1NWDA 4DIRA 2KSPA 3BFBA 3FS7A 4MLWA 4D1EA 1DF0A 4OZDA 4WRIA 2LVKA 2ZNDA 4YGCB 1DGUA 3AKAA 2WCLA 5AEQA 1XFVO 2M3WA 3VRRA 3PJIA 4WQ3A 1OOGA 3O4YA 3KF9A 3TUYB 2WCMA 3R72A 1MQ1A 2K61A 1UHKA 1PULA 2Y1NA 2P70A 3O2PA 3CR2A 3DVJA 4JD9A 1A75B 3S0DA 4ZCUA 1DT7B 4XJKB 1DMOA 2KI4B 1A03A 3SG4A 3WHUB 1K96A 3MSEB 1UWOA 1OQPA 1UURA 1V1GA 2FCEA 3OP0A 3SIAA 3WXAA 5I2QA 1ZACA 3DXLA 1FPWA 5DKNA 3SJSA 4PHJA 4HSZA 3B87A 1SR6B 1KK8C 1L2OC 4UPGA 1IQ5A 2MJWB 2ERBA 2D8NA 2KLEA 3NGVA 1K90D 2JPTA 4ZCVA 5AFPA 1NX3A 1VRKA 4YBHB 1CFDA 1QX5B 1YUTA 1KFUL 1AUIB 2V53A 3OBVA 2OTGC 4OR9B 2L2CA 5HLOA 5B8IB 4NQGA 1LS8A 1SY9A 2KQ6A 3AKBA 2M97A 4M2PA 5K89A 1GGWA 1QXPA 2BECA 2L0PA 2HETA 3IQOA 2QACA 1SL7A 1PSBA 2WCKA 5ER4X 1HT9A 1WDCC 3CZTX 4GFTA 1QJTA 4A4BA 1YTZC 2M8UA 1KQMC 2K7BA 2HPSA 3S0BA 4C0KA 3LLEA 2KHNA 1F54A 4R1EA 3DF0B 3IF7A 3LCPC 2M1UA 2BAPA 1G8IA 1K2HA 4I5KA 1F8HA 2ZRTA 1TWOA 2NZ0A 2DOQA 1M46A 4GUKA 2G2BA 3CS1A 1MHOA 1J7PA 4I5JA 5CSJA 1UHHA 4NDCA 2K7OA 1A4PA 2I7AA 2PQLA 3OHMB 5AERA 2WOSA 1TUJA 1JFJA 2FOTA 1S5GY 1DF0B 1XFYO 4HRGA 2K7DA 2LMUA 3I5GB 3R1PA 4P5OE 1SCMB 1LXFC 5GQQC 2LC5A 2PSRA 3L47A 1B1GA 1NCZA 3CABA 1DELA 2QEOA 1SKTA 2JNXA 4MVFA 1NP8A 1QV0A 2GTEA 2R2IA 1XFRA 1RTP1 2G9BA 4DS7A 2ZKMX 2FJYA 4PT1A 1K93D 2NCOA 1TRFA 3BUOB 1OE9B 1WRLA 2MRDA 2WNDA 2K2FA 1A75A 1QVIY 4AQJA 3CZ1A 1KFXL 4XJKA 5G08A 2H2KA 5BPJA 1C7VA 3CR5X 2KGBC 2LMVA 3CLNA 1EH2A 1LA3A 1TCFA 3OB1B 4Q04A 5HKZA 1EXRA 1JUOA 1R2UA 1J1DA 1Z4HA 2NLNA 4BY4A 4F0ZB 1FI5A 1M31A 3A8RA 1BR4B 1QATA 3GOFA 2LANA 4I5NB 3ICBA 1YX8A 2L2EA 3PM8A 4PHNA 1J55A 5JOLA 3BFAA 5JJGA 3ZNIA 4N1GA 4CFRA 2KI6C 1IWQA 2AAOA 4CPVA 1J1EA 1CLBA 4GGFC 1RJVA 3I5HC 2Y4QA 2LLSA 4JPZB 1H8BA 1SK6D 2RGIA 2VRGA 2BBNA 1EG3A 2M9GA 4INWA 4GBAA 1A29A 3CDNA 3VGOA 5HL1A 4QJ3B 4PCWA 1NX2A 1YR5A 2LLUA 1MXLC 2KFHA 2KQYA 1ALVA 1BMOA 3D73A 2MBXA 2EHBA 1MXEA 2L4HA 1OMVA 2F8PA 2LE9B 2BE6A 2BNXA 2WCFA 1QV1A 2BL0C 4DRWA 1P28A 1QVIZ 3I5IB 1Q80A 4PE0A 1QIVA 2E6WA 4YGEB 2KFFA 2F3ZA 3WNXB 1DJXA 1NIWA 4FTGA 1TCOB 3CR4X 3KO0A 3N7HA 2EGDA 2M1KB 2KDHA 4OKHA 4MZJA 1MF8B 2BE4A 2BKIB 4YGDB 3D78A 3NHTA 1S36A 2KFGA 2OS8B 3D0YA 1JC2A 1LA0A 2BCAA 2L50A 1YX7A 2WCJA 2PVBA 3KEVA 3PFVA 1CFPA 3DYEA 1FI6A 1D1OA 2LVIA 3OX5A 4ICBA 1F55A 4ORCB 1IGVA 1YRUB 2K2AA 2LHIA 4YGBB 1AVSA 3I5GC 3B86A 4QJ4B 5KTYA 2L5YA 4MRYA 1BLQA 3PN7B 1WRZA 1CKKA 3L4AA 3SIBA 4OCIA 2ZN9A 3TDZA 1QTXA 3SG3A 3TDUA 3VRNA 2KGRA 1TN4A 3CZ2A 3EKHA 1S6JA 3I5FB 2LLTA 1PRWA 1ORGA 2QEHA 4IJ7A 5KSZA 2IS9A 3NSOA 1KSOA 2COLB 1A2XA 5FI7A 1K9PA 1TNXA 2O60A 3C1VA 1NCYA 3S0GA 3GK4X 1UHIA 3TS5B 1KWOB 3BUXB 5PALA 2BCBA 4DUQA 1IIOA 1NCXA 2L5XB 3BXKA 5HLVA 2KYCA 4TNCA 1NX0A 2KPHA 3EK7A 2FJUB 4I5LB 1QS7A 2CTNA 3SG2A 1CDLA 1J7QA 5IBWA 4GAOA 5CSIA 2KNEA 2TN4A 1R6PA 1QWVA 3DVMA 4JWQA 3UO9A 3EVVA 2JT8A 1QIWA 1IRJA 2JZIA 1B8CA 1KK7Y 1N65A 1F70A 2JTZA 3B6XA 2EC6C 3SS3A 3O6BA 3OX6A 2LHLA 3FE9A 3IQQA 3JTDB 5TNCA 1AHRA 5D7FA 3JVTC 2ISDA 2M49B 2MAZA 3PLFB 4WQ2A 3NXAA 1CLMA 4CIDA 1DQEA 5D69A 3CYZA 3OGNA 3D0YB 2AMIA 2H61A 4INXA 3BYAA 1SSEB 2KBIA 4GGNA 5F6TA 1L7ZA 2WC8A 1QX2A 1G4YR 2M29A 2PRUA 2JWWA 5HYDA 2AUCA 1SBJA 3D75A 2MA2A 1EL4A 2L98A 1LINA 1OOJA 3ZWHA 1AJ5A 1CLLA 2GV5A 1DJWA 1FW4A 2KI6D 4MEWA 3S0EA 4HREE 1PVBA 2M0RA 3GK2A 1CDPA 4FQTA 5AANA 3LL8B 2I2RE 1SW8A 1JFKA 2LCPA 1B4CA 1S6IA 3KHEA 1KSMA 2SASA 3R1VA 5CPVA 3TUYC 3H4SE 1KK8B 1L2OB 4P2YB 1CB1A 1G33A 4OV2A 1TTXA 2JT0A 2L51A 4YI8A 3LK0A 3SG5A 1KK7Z 2NCPA 1F4QA 2HQWA 2LP2A 2NXQA 1OMRA 2E30A 2JXLA 3VB1A 1TUZA 2KI4C 1B7TZ 2LMTA 2OTGB 3PATA 1UHNA 1GM0A 1C3YA 4AQIA 1QX7A 3FWBA 2MLFC 1EJ3A 3FE8A 1EG4A 1DEKA 1WDCB 2LVVA 4JQ0D 4PDZA 3DY9A 3EVUA 4GGFA 1KQMB 1KQVA 1SR6C 3CGAA 3DVEA 1RFJA 1XK4C 4ORAB 1YVLA 2I18A 3DZTA 1NPQA 4PE1A 1C07A 3K1EA 2K60A 1N0YA 1NUBA 2GGMA 2P6BB 1RECA 1DTLA 1ODBA 4PE7A 3TS5C 3FIAA 1T14A 2KAVA 4MRXA 5J3XA 3EK8A 4MZLA 4NDBA 2WCEA 3VRPA 2JPOA 2CNPA 3NSIA 4CLNA 3SS4A 1LKJA 1W7IB 1SYMA 2JXCA 3TDIA 4DCKA 4N1FA 3V2LA 1CM1A 3L4LA 1MR8A 1DJGA 1K9UA 1S3PA 2QEVA 1E8AA 1XO5A 2PASA 3D76A 1OZSA 1U5IB 5HKYA 1QASA 3WHTB 2YGUA 3D77A 4C0LA 2PALA 2Q4UA 1QLKA 2QEBA 3D10A 1FBVA 1YURA 4MSPA 2LM5A 1DJZA 4PALA 1BF5A 1M63B 2QDIA 3PM2A 2LNKA 4M2QA 3AAJA 3GK1A 1GQMA 2BBMA 4U8DA 1AP4A 2ZN8A 3O4XA 1CFFA 4M2OA 1C7WA 5I8NA 3A4UB 1YVHA 1SCMC 4NDDA 1DGVA 1K8UA 5I2LA 1YUSA 2JOJA 1BR1B 4MZKA 3EG5B 5I94A 1NYAA 3OB2B
chains in the Genus database with same CATH topology
1Y0VH 3VRQA 4HRHA 1B8RA 1XFZO 1XYDA 2JC2A 3NSLA 1YRTB 2JT3A 1JF2A 1WLMA 1AK8A 3BOWA 3NSKA 2KAXA 3O78A 1CM4A 1YUUA 2Y1MA 4FQOA 2LP3A 1ALWA 1S1EA 1TNQA 1WY9A 1DJHA 3I5HB 1KFUS 1Y6WA 3TZ1A 1DJIA 4A4CA 1LVCD 2F3YA 5KU1A 2JNFA 2ZRSA 4YGAA 2LUCA 4CFQA 4ETOA 2JQ6A 1N2DA 1TNWA 2K0JA 1IQ3A 1JBAA 1XFUO 2BKHB 3RLZA 1JWDA 1RK9A 1MUXA 1XA5A 1K94A 3SG6A 1F4OA 2JTTA 1W7JB 1XFWO 2I94A 1FF1A 1JF0A 2K7CA 1B7TY 1BJFA 1WRKA 2LUXA 3QRXA 2BL0B 1SL8A 3FWCA 1BOCA 1X02A 2LV7A 3HCMA 3SG7A 1CDMA 3DVKA 2JULA 1Y1AA 2QPTA 1CTRA 2OPOA 3CWGA 2KOTA 4MBEA 1SPYA 2HQ8A 3LK1A 2ZFDA 1RWYA 2HF5A 2B1UA 1PSRA 1PK0D 1U5IA 2JRFA 2M7LA 1IJ6A 3BUMB 4N5XA 1ZOTB 3BQ3A 1SMGA 4C0JA 1S26D 1BG1A 1B47A 1CMGA 1WLZA 3BUNB 4MN0A 1AJ4A 3I5IC 2PMYA 3KPXA 2M7NA 1OSAA 1CMFA 3BUWB 1GGZA 2H61C 2JU0A 4USLA 1B8LA 3VROA 1TNPA 4E68A 1K9KA 3F45A 1IKUA 5ER5A 1F71A 2OS8C 3EK4A 3HX4A 2F33A 5I2OA 4OVNF 1PALA 2CXJA 1SRAA 1OMDA 1HQVA 5CSFA 1KFXS 2KYFA 3BOWB 1RROA 1B9AA 2Q91A 3M0WA 1ZMZA 1ZFSA 1M39A 3K21A 1UUSA 3PN7C 1UP5A 5DKRA 1ZUZA 3E3RA 2L4IA 1DVIA 1H4BA 1V1FA 1TOPA 1Y1XA 3I5FC 2MHHA 4L9MA 2BCXA 2GGZA 1IG5A 2K8MB 4YI9A 1SCVA 3RM1A 1DJYA 5AXIA 1IJ5A 1XK4A 2O5GA 2WORA 2LVJA 2F2OA 1KCYA 1TIZA 2FCDA 1J7OA 1KWOC 3PALA 1XVJA 2CT9A 4IL1A 2CCMA 1CNPA 5DKQA 2CBLA 1IH0A 1S5GZ 2EC6B 1QLSA 4GPLB 1BU3A 4BY5A 2A4JA 1J7RA 2KAYA 1UHJA 4PHMA 3CTNA 4YRUA 1S6CA 3JVTB 1OZOA 1SL9A 3EVRA 2MLEC 3AAKA 1GJYA 4PE4A 1PVAA 2ZNEA 3DD4A 1Y1UA 1BODA 1M45A 4QJ5B 2Y5IA 3DF0A 2F2PA 2SCPA 2WCBA 2KBMA 3PSRA 4XYNA 5HKWA 1CFCA 4PHKA 1BT6A 1K95A 1NX1A 3EKJA 5CSNA 2LAPA 1MWNA 4AOMA 1NSHA 5FYXA 1CDNA 3JTDC 4ORBB 4GNKB 1XFXO 1SNLA 1JSAA 1NWDA 4DIRA 2KSPA 3FS7A 4MLWA 4D1EA 1DF0A 4WRIA 2LVKA 2ZNDA 4YGCB 1DGUA 3AKAA 5AEQA 1XFVO 2M3WA 3VRRA 4WQ3A 3O4YA 3KF9A 3TUYB 1MQ1A 2K61A 1UHKA 1PULA 2Y1NA 3O2PA 3CR2A 3DVJA 1A75B 4ZCUA 1DT7B 4XJKB 1DMOA 2KI4B 1A03A 3SG4A 3WHUB 1K96A 3MSEB 1UWOA 1OQPA 1UURA 1V1GA 2FCEA 3OP0A 3SIAA 3WXAA 5I2QA 1ZACA 1FPWA 5DKNA 3SJSA 4PHJA 4HSZA 1SR6B 1KK8C 1L2OC 4UPGA 1IQ5A 2MJWB 2D8NA 5AFPA 1K90D 2JPTA 4ZCVA 1NX3A 1VRKA 4YBHB 1CFDA 1QX5B 1YUTA 1KFUL 1AUIB 2V53A 5HLOA 2OTGC 4OR9B 5B8IB 4NQGA 1SY9A 2KQ6A 3AKBA 5K89A 2M97A 4M2PA 1GGWA 1QXPA 2BECA 2L0PA 2HETA 3IQOA 2QACA 1SL7A 1PSBA 5ER4X 1HT9A 1WDCC 3CZTX 4GFTA 1QJTA 4A4BA 1YTZC 2M8UA 1KQMC 2K7BA 2HPSA 4C0KA 3LLEA 2KHNA 1F54A 4R1EA 3DF0B 3IF7A 3LCPC 2M1UA 1G8IA 1K2HA 4I5KA 1F8HA 2ZRTA 2NZ0A 2DOQA 1M46A 4GUKA 2G2BA 3CS1A 1MHOA 1J7PA 4I5JA 5CSJA 1UHHA 4NDCA 2K7OA 1A4PA 2I7AA 5AERA 3OHMB 2WOSA 1JFJA 2FOTA 1S5GY 1DF0B 1XFYO 4HRGA 2K7DA 2LMUA 3I5GB 4P5OE 1SCMB 1LXFC 5GQQC 2LC5A 2PSRA 1B1GA 1NCZA 1SKTA 2JNXA 4MVFA 1NP8A 1QV0A 2R2IA 1RTP1 2G9BA 4DS7A 2ZKMX 1K93D 2NCOA 1TRFA 3BUOB 1OE9B 1WRLA 2MRDA 2WNDA 2K2FA 1A75A 1QVIY 4AQJA 1KFXL 4XJKA 5G08A 2H2KA 5BPJA 1C7VA 3CR5X 2KGBC 2LMVA 3CLNA 1EH2A 1LA3A 1TCFA 3OB1B 4Q04A 5HKZA 1EXRA 1JUOA 1R2UA 1J1DA 2NLNA 4BY4A 4F0ZB 1FI5A 1M31A 3A8RA 1BR4B 1QATA 3GOFA 2LANA 4I5NB 3ICBA 1YX8A 2L2EA 3PM8A 4PHNA 1J55A 5JOLA 5JJGA 3ZNIA 4N1GA 4CFRA 2KI6C 1IWQA 2AAOA 4CPVA 1J1EA 1CLBA 4GGFC 1RJVA 3I5HC 2Y4QA 2LLSA 4JPZB 1H8BA 1SK6D 2RGIA 2VRGA 2BBNA 1EG3A 2M9GA 4GBAA 1A29A 3VGOA 4QJ3B 4PCWA 1NX2A 1YR5A 2LLUA 1MXLC 2KFHA 2KQYA 1ALVA 1BMOA 2MBXA 2EHBA 1MXEA 2L4HA 1OMVA 2F8PA 2LE9B 2BE6A 2WCFA 1QV1A 2BL0C 4DRWA 1QVIZ 3I5IB 1Q80A 4PE0A 1QIVA 2E6WA 4YGEB 2KFFA 2F3ZA 3WNXB 1DJXA 1NIWA 4FTGA 1TCOB 3CR4X 3KO0A 2EGDA 2M1KB 2KDHA 4OKHA 4MZJA 2BE4A 1MF8B 2BKIB 4YGDB 1JC2A 1S36A 2KFGA 2OS8B 3D0YA 1LA0A 2BCAA 2L50A 1YX7A 3KEVA 2PVBA 3PFVA 1CFPA 1FI6A 1D1OA 2LVIA 3OX5A 4ICBA 1F55A 4ORCB 1IGVA 1YRUB 2K2AA 2LHIA 4YGBB 1AVSA 3I5GC 4QJ4B 5KTYA 4MRYA 1BLQA 3PN7B 1WRZA 1CKKA 3SIBA 4OCIA 2ZN9A 3TDZA 1QTXA 3SG3A 3TDUA 3VRNA 2KGRA 1TN4A 3EKHA 1S6JA 3I5FB 2LLTA 1PRWA 5KSZA 2IS9A 3NSOA 1KSOA 2COLB 1A2XA 1K9PA 1TNXA 2O60A 3C1VA 1NCYA 3GK4X 1UHIA 3TS5B 1KWOB 3BUXB 5PALA 2BCBA 4DUQA 1NCXA 2L5XB 3BXKA 5HLVA 2KYCA 4TNCA 1NX0A 3EK7A 2FJUB 4I5LB 1QS7A 2CTNA 3SG2A 1CDLA 1J7QA 5IBWA 4GAOA 5CSIA 2KNEA 2TN4A 1R6PA 3DVMA 4JWQA 3EVVA 2JT8A 1QIWA 1IRJA 2JZIA 1B8CA 1KK7Y 1N65A 1F70A 2JTZA 2EC6C 3O6BA 3OX6A 2LHLA 3IQQA 3JTDB 5TNCA 1AHRA 5D7FA 3JVTC 2ISDA 2M49B 2MAZA 3PLFB 4WQ2A 3NXAA 1CLMA 4CIDA 5D69A 3D0YB 2AMIA 2H61A 5F6TA 3BYAA 2KBIA 4GGNA 1L7ZA 2WC8A 1QX2A 1G4YR 2M29A 2PRUA 2JWWA 5HYDA 2AUCA 1SBJA 2MA2A 1EL4A 2L98A 1LINA 1OOJA 3ZWHA 1AJ5A 1CLLA 2GV5A 1DJWA 1FW4A 2KI6D 4MEWA 4HREE 1PVBA 2M0RA 3GK2A 1CDPA 5AANA 3LL8B 2I2RE 1SW8A 1JFKA 2LCPA 1B4CA 1S6IA 3KHEA 1KSMA 2SASA 5CPVA 3TUYC 3H4SE 1KK8B 1L2OB 4P2YB 1CB1A 1G33A 4OV2A 1TTXA 2JT0A 2L51A 4YI8A 3LK0A 3SG5A 1KK7Z 2NCPA 1F4QA 2HQWA 2LP2A 2NXQA 1OMRA 2E30A 2JXLA 2KI4C 2OTGB 1B7TZ 2LMTA 3PATA 1UHNA 4AQIA 1QX7A 3FWBA 2MLFC 1EJ3A 4PDZA 1EG4A 1WDCB 2LVVA 4JQ0D 4GGFA 3EVUA 1KQMB 1KQVA 1SR6C 3CGAA 3DVEA 1RFJA 1XK4C 4ORAB 1YVLA 2I18A 1NPQA 4PE1A 1C07A 1N0YA 1NUBA 2GGMA 2P6BB 1RECA 1DTLA 1ODBA 4PE7A 3TS5C 3FIAA 2KAVA 4MRXA 5J3XA 3EK8A 4MZLA 4NDBA 2WCEA 3VRPA 2CNPA 3NSIA 4CLNA 1LKJA 1W7IB 1SYMA 2JXCA 3TDIA 4DCKA 4N1FA 1CM1A 1MR8A 1DJGA 1K9UA 1S3PA 1E8AA 1XO5A 2PASA 1OZSA 1U5IB 5HKYA 1QASA 3WHTB 4C0LA 2PALA 2Q4UA 1QLKA 3D10A 4MSPA 1FBVA 1YURA 1BF5A 2LM5A 1DJZA 4PALA 1M63B 2LNKA 4M2QA 3AAJA 3GK1A 1GQMA 2BBMA 4U8DA 1AP4A 2ZN8A 1CFFA 4M2OA 1C7WA 5I8NA 3A4UB 1YVHA 1SCMC 4NDDA 1DGVA 1K8UA 5I2LA 1YUSA 2JOJA 1BR1B 4MZKA 1NYAA 3OB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0V H;  3VRQ A;  4HRH A;  1B8R A;  1XFZ O;  1XYD A;  2JC2 A;  3NSL A;  1YRT B;  2JT3 A;  1JF2 A;  1WLM A;  1AK8 A;  3BOW A;  3NSK A;  2KAX A;  3O78 A;  1CM4 A;  1YUU A;  2Y1M A;  4FQO A;  2LP3 A;  1ALW A;  1S1E A;  1TNQ A;  1WY9 A;  1DJH A;  3I5H B;  1KFU S;  1Y6W A;  3TZ1 A;  1DJI A;  4A4C A;  1LVC D;  2F3Y A;  5KU1 A;  2JNF A;  2ZRS A;  4YGA A;  2LUC A;  4CFQ A;  4ETO A;  2JQ6 A;  1N2D A;  1TNW A;  2K0J A;  1IQ3 A;  1JBA A;  1XFU O;  2BKH B;  3RLZ A;  1JWD A;  1RK9 A;  1MUX A;  1XA5 A;  1K94 A;  3SG6 A;  1F4O A;  2JTT A;  1W7J B;  1XFW O;  2I94 A;  1FF1 A;  1JF0 A;  2K7C A;  1B7T Y;  1BJF A;  1WRK A;  2LUX A;  3QRX A;  2BL0 B;  1SL8 A;  3FWC A;  1BOC A;  1X02 A;  2LV7 A;  3HCM A;  3SG7 A;  1CDM A;  3DVK A;  2JUL A;  1Y1A A;  2QPT A;  1CTR A;  2OPO A;  3CWG A;  2KOT A;  4MBE A;  1SPY A;  2HQ8 A;  3LK1 A;  2ZFD A;  1RWY A;  2HF5 A;  2B1U A;  1PSR A;  1PK0 D;  1U5I A;  2JRF A;  2M7L A;  1IJ6 A;  3BUM B;  4N5X A;  1ZOT B;  3BQ3 A;  1SMG A;  4C0J A;  1S26 D;  1BG1 A;  1B47 A;  1CMG A;  1WLZ A;  3BUN B;  4MN0 A;  1AJ4 A;  3I5I C;  2PMY A;  3KPX A;  2M7N A;  1OSA A;  1CMF A;  3BUW B;  1GGZ A;  2H61 C;  2JU0 A;  4USL A;  1B8L A;  3VRO A;  1TNP A;  4E68 A;  1K9K A;  3F45 A;  1IKU A;  5ER5 A;  1F71 A;  2OS8 C;  3EK4 A;  3HX4 A;  2F33 A;  5I2O A;  4OVN F;  1PAL A;  2CXJ A;  1SRA A;  1OMD A;  1HQV A;  5CSF A;  1KFX S;  2KYF A;  3BOW B;  1RRO A;  1B9A A;  2Q91 A;  3M0W A;  1ZMZ A;  1ZFS A;  1M39 A;  3K21 A;  1UUS A;  3PN7 C;  1UP5 A;  5DKR A;  1ZUZ A;  3E3R A;  2L4I A;  1DVI A;  1H4B A;  1V1F A;  1TOP A;  1Y1X A;  3I5F C;  2MHH A;  4L9M A;  2BCX A;  2GGZ A;  1IG5 A;  2K8M B;  4YI9 A;  1SCV A;  3RM1 A;  1DJY A;  5AXI A;  1IJ5 A;  1XK4 A;  2O5G A;  2WOR A;  2LVJ A;  2F2O A;  1KCY A;  1TIZ A;  2FCD A;  1J7O A;  1KWO C;  3PAL A;  1XVJ A;  2CT9 A;  4IL1 A;  2CCM A;  1CNP A;  5DKQ A;  2CBL A;  1IH0 A;  1S5G Z;  2EC6 B;  1QLS A;  4GPL B;  1BU3 A;  4BY5 A;  2A4J A;  1J7R A;  2KAY A;  1UHJ A;  4PHM A;  3CTN A;  4YRU A;  1S6C A;  3JVT B;  1OZO A;  1SL9 A;  3EVR A;  2MLE C;  3AAK A;  1GJY A;  4PE4 A;  1PVA A;  2ZNE A;  3DD4 A;  1Y1U A;  1BOD A;  1M45 A;  4QJ5 B;  2Y5I A;  3DF0 A;  2F2P A;  2SCP A;  2WCB A;  2KBM A;  3PSR A;  4XYN A;  5HKW A;  1CFC A;  4PHK A;  1BT6 A;  1K95 A;  1NX1 A;  3EKJ A;  5CSN A;  2LAP A;  1MWN A;  4AOM A;  1NSH A;  5FYX A;  1CDN A;  3JTD C;  4ORB B;  4GNK B;  1XFX O;  1SNL A;  1JSA A;  1NWD A;  4DIR A;  2KSP A;  3FS7 A;  4MLW A;  4D1E A;  1DF0 A;  4WRI A;  2LVK A;  2ZND A;  4YGC B;  1DGU A;  3AKA A;  5AEQ A;  1XFV O;  2M3W A;  3VRR A;  4WQ3 A;  3O4Y A;  3KF9 A;  3TUY B;  1MQ1 A;  2K61 A;  1UHK A;  1PUL A;  2Y1N A;  3O2P A;  3CR2 A;  3DVJ A;  1A75 B;  4ZCU A;  1DT7 B;  4XJK B;  1DMO A;  2KI4 B;  1A03 A;  3SG4 A;  3WHU B;  1K96 A;  3MSE B;  1UWO A;  1OQP A;  1UUR A;  1V1G A;  2FCE A;  3OP0 A;  3SIA A;  3WXA A;  5I2Q A;  1ZAC A;  1FPW A;  5DKN A;  3SJS A;  4PHJ A;  4HSZ A;  1SR6 B;  1KK8 C;  1L2O C;  4UPG A;  1IQ5 A;  2MJW B;  2D8N A;  5AFP A;  1K90 D;  2JPT A;  4ZCV A;  1NX3 A;  1VRK A;  4YBH B;  1CFD A;  1QX5 B;  1YUT A;  1KFU L;  1AUI B;  2V53 A;  5HLO A;  2OTG C;  4OR9 B;  5B8I B;  4NQG A;  1SY9 A;  2KQ6 A;  3AKB A;  5K89 A;  2M97 A;  4M2P A;  1GGW A;  1QXP A;  2BEC A;  2L0P A;  2HET A;  3IQO A;  2QAC A;  1SL7 A;  1PSB A;  5ER4 X;  1HT9 A;  1WDC C;  3CZT X;  4GFT A;  1QJT A;  4A4B A;  1YTZ C;  2M8U A;  1KQM C;  2K7B A;  2HPS A;  4C0K A;  3LLE A;  2KHN A;  1F54 A;  4R1E A;  3DF0 B;  3IF7 A;  3LCP C;  2M1U A;  1G8I A;  1K2H A;  4I5K A;  1F8H A;  2ZRT A;  2NZ0 A;  2DOQ A;  1M46 A;  4GUK A;  2G2B A;  3CS1 A;  1MHO A;  1J7P A;  4I5J A;  5CSJ A;  1UHH A;  4NDC A;  2K7O A;  1A4P A;  2I7A A;  5AER A;  3OHM B;  2WOS A;  1JFJ A;  2FOT A;  1S5G Y;  1DF0 B;  1XFY O;  4HRG A;  2K7D A;  2LMU A;  3I5G B;  4P5O E;  1SCM B;  1LXF C;  5GQQ C;  2LC5 A;  2PSR A;  1B1G A;  1NCZ A;  1SKT A;  2JNX A;  4MVF A;  1NP8 A;  1QV0 A;  2R2I A;  1RTP 1;  2G9B A;  4DS7 A;  2ZKM X;  1K93 D;  2NCO A;  1TRF A;  3BUO B;  1OE9 B;  1WRL A;  2MRD A;  2WND A;  2K2F A;  1A75 A;  1QVI Y;  4AQJ A;  1KFX L;  4XJK A;  5G08 A;  2H2K A;  5BPJ A;  1C7V A;  3CR5 X;  2KGB C;  2LMV A;  3CLN A;  1EH2 A;  1LA3 A;  1TCF A;  3OB1 B;  4Q04 A;  5HKZ A;  1EXR A;  1JUO A;  1R2U A;  1J1D A;  2NLN A;  4BY4 A;  4F0Z B;  1FI5 A;  1M31 A;  3A8R A;  1BR4 B;  1QAT A;  3GOF A;  2LAN A;  4I5N B;  3ICB A;  1YX8 A;  2L2E A;  3PM8 A;  4PHN A;  1J55 A;  5JOL A;  5JJG A;  3ZNI A;  4N1G A;  4CFR A;  2KI6 C;  1IWQ A;  2AAO A;  4CPV A;  1J1E A;  1CLB A;  4GGF C;  1RJV A;  3I5H C;  2Y4Q A;  2LLS A;  4JPZ B;  1H8B A;  1SK6 D;  2RGI A;  2VRG A;  2BBN A;  1EG3 A;  2M9G A;  4GBA A;  1A29 A;  3VGO A;  4QJ3 B;  4PCW A;  1NX2 A;  1YR5 A;  2LLU A;  1MXL C;  2KFH A;  2KQY A;  1ALV A;  1BMO A;  2MBX A;  2EHB A;  1MXE A;  2L4H A;  1OMV A;  2F8P A;  2LE9 B;  2BE6 A;  2WCF A;  1QV1 A;  2BL0 C;  4DRW A;  1QVI Z;  3I5I B;  1Q80 A;  4PE0 A;  1QIV A;  2E6W A;  4YGE B;  2KFF A;  2F3Z A;  3WNX B;  1DJX A;  1NIW A;  4FTG A;  1TCO B;  3CR4 X;  3KO0 A;  2EGD A;  2M1K B;  2KDH A;  4OKH A;  4MZJ A;  2BE4 A;  1MF8 B;  2BKI B;  4YGD B;  1JC2 A;  1S36 A;  2KFG A;  2OS8 B;  3D0Y A;  1LA0 A;  2BCA A;  2L50 A;  1YX7 A;  3KEV A;  2PVB A;  3PFV A;  1CFP A;  1FI6 A;  1D1O A;  2LVI A;  3OX5 A;  4ICB A;  1F55 A;  4ORC B;  1IGV A;  1YRU B;  2K2A A;  2LHI A;  4YGB B;  1AVS A;  3I5G C;  4QJ4 B;  5KTY A;  4MRY A;  1BLQ A;  3PN7 B;  1WRZ A;  1CKK A;  3SIB A;  4OCI A;  2ZN9 A;  3TDZ A;  1QTX A;  3SG3 A;  3TDU A;  3VRN A;  2KGR A;  1TN4 A;  3EKH A;  1S6J A;  3I5F B;  2LLT A;  1PRW A;  5KSZ A;  2IS9 A;  3NSO A;  1KSO A;  2COL B;  1A2X A;  1K9P A;  1TNX A;  2O60 A;  3C1V A;  1NCY A;  3GK4 X;  1UHI A;  3TS5 B;  1KWO B;  3BUX B;  5PAL A;  2BCB A;  4DUQ A;  1NCX A;  2L5X B;  3BXK A;  5HLV A;  2KYC A;  4TNC A;  1NX0 A;  3EK7 A;  2FJU B;  4I5L B;  1QS7 A;  2CTN A;  3SG2 A;  1CDL A;  1J7Q A;  5IBW A;  4GAO A;  5CSI A;  2KNE A;  2TN4 A;  1R6P A;  3DVM A;  4JWQ A;  3EVV A;  2JT8 A;  1QIW A;  1IRJ A;  2JZI A;  1B8C A;  1KK7 Y;  1N65 A;  1F70 A;  2JTZ A;  2EC6 C;  3O6B A;  3OX6 A;  2LHL A;  3IQQ A;  3JTD B;  5TNC A;  1AHR A;  5D7F A;  3JVT C;  2ISD A;  2M49 B;  2MAZ A;  3PLF B;  4WQ2 A;  3NXA A;  1CLM A;  4CID A;  5D69 A;  3D0Y B;  2AMI A;  2H61 A;  5F6T A;  3BYA A;  2KBI A;  4GGN A;  1L7Z A;  2WC8 A;  1QX2 A;  1G4Y R;  2M29 A;  2PRU A;  2JWW A;  5HYD A;  2AUC A;  1SBJ A;  2MA2 A;  1EL4 A;  2L98 A;  1LIN A;  1OOJ A;  3ZWH A;  1AJ5 A;  1CLL A;  2GV5 A;  1DJW A;  1FW4 A;  2KI6 D;  4MEW A;  4HRE E;  1PVB A;  2M0R A;  3GK2 A;  1CDP A;  5AAN A;  3LL8 B;  2I2R E;  1SW8 A;  1JFK A;  2LCP A;  1B4C A;  1S6I A;  3KHE A;  1KSM A;  2SAS A;  5CPV A;  3TUY C;  3H4S E;  1KK8 B;  1L2O B;  4P2Y B;  1CB1 A;  1G33 A;  4OV2 A;  1TTX A;  2JT0 A;  2L51 A;  4YI8 A;  3LK0 A;  3SG5 A;  1KK7 Z;  2NCP A;  1F4Q A;  2HQW A;  2LP2 A;  2NXQ A;  1OMR A;  2E30 A;  2JXL A;  2KI4 C;  2OTG B;  1B7T Z;  2LMT A;  3PAT A;  1UHN A;  4AQI A;  1QX7 A;  3FWB A;  2MLF C;  1EJ3 A;  4PDZ A;  1EG4 A;  1WDC B;  2LVV A;  4JQ0 D;  4GGF A;  3EVU A;  1KQM B;  1KQV A;  1SR6 C;  3CGA A;  3DVE A;  1RFJ A;  1XK4 C;  4ORA B;  1YVL A;  2I18 A;  1NPQ A;  4PE1 A;  1C07 A;  1N0Y A;  1NUB A;  2GGM A;  2P6B B;  1REC A;  1DTL A;  1ODB A;  4PE7 A;  3TS5 C;  3FIA A;  2KAV A;  4MRX A;  5J3X A;  3EK8 A;  4MZL A;  4NDB A;  2WCE A;  3VRP A;  2CNP A;  3NSI A;  4CLN A;  1LKJ A;  1W7I B;  1SYM A;  2JXC A;  3TDI A;  4DCK A;  4N1F A;  1CM1 A;  1MR8 A;  1DJG A;  1K9U A;  1S3P A;  1E8A A;  1XO5 A;  2PAS A;  1OZS A;  1U5I B;  5HKY A;  1QAS A;  3WHT B;  4C0L A;  2PAL A;  2Q4U A;  1QLK A;  3D10 A;  4MSP A;  1FBV A;  1YUR A;  1BF5 A;  2LM5 A;  1DJZ A;  4PAL A;  1M63 B;  2LNK A;  4M2Q A;  3AAJ A;  3GK1 A;  1GQM A;  2BBM A;  4U8D A;  1AP4 A;  2ZN8 A;  1CFF A;  4M2O A;  1C7W A;  5I8N A;  3A4U B;  1YVH A;  1SCM C;  4NDD A;  1DGV A;  1K8U A;  5I2L A;  1YUS A;  2JOJ A;  1BR1 B;  4MZK A;  1NYA A;  3OB2 B; 
#chains in the Genus database with same CATH topology
 1Y0V H;  3VRQ A;  4HRH A;  1B8R A;  4JKT A;  1XFZ O;  3B7A A;  3R1O A;  3NHI A;  1XYD A;  2JC2 A;  3NSL A;  1YRT B;  2JT3 A;  3RZS A;  1JF2 A;  3SS5 A;  1WLM A;  1AK8 A;  1OOH A;  5EL2 A;  3BOW A;  3FE6 A;  3NSK A;  5FI6 A;  2KAX A;  3O78 A;  3S0A A;  1DC1 A;  1CM4 A;  1YUU A;  2Y1M A;  4FQO A;  2LP3 A;  1ALW A;  1S1E A;  1TNQ A;  1WY9 A;  1DJH A;  3I5H B;  1KFU S;  1Y6W A;  3TZ1 A;  1DJI A;  4A4C A;  1LVC D;  2F3Y A;  5KU1 A;  2WC6 A;  2JNF A;  2ZRS A;  4YGA A;  2LUC A;  4CFQ A;  4ETO A;  2JQ6 A;  1N2D A;  1TNW A;  2K0J A;  1IQ3 A;  1JBA A;  1XFU O;  2BKH B;  3RLZ A;  1JWD A;  1RK9 A;  1MUX A;  2P71 A;  1XA5 A;  1K94 A;  3Q8I A;  1F4O A;  3SG6 A;  2JTT A;  3CZ0 A;  1W7J B;  1XFW O;  2I94 A;  1FF1 A;  1JF0 A;  2K7C A;  1B7T Y;  1BJF A;  1WRK A;  2LUX A;  3B88 A;  3QRX A;  2WC5 A;  2BL0 B;  1SL8 A;  3FWC A;  1BOC A;  1X02 A;  2LV7 A;  3HCM A;  3SG7 A;  1CDM A;  3DVK A;  2JUL A;  1Y1A A;  2QPT A;  1CTR A;  1Z2C B;  2OPO A;  3CWG A;  2KOT A;  2PYQ A;  4MBE A;  1SPY A;  2HQ8 A;  3LK1 A;  1C3Z A;  4F7F A;  2ZFD A;  1RWY A;  2HF5 A;  2B1U A;  1PSR A;  1PK0 D;  1U5I A;  2JRF A;  2M7L A;  1IJ6 A;  3BUM B;  4N5X A;  1ZOT B;  3BQ3 A;  5FI2 A;  1SMG A;  4C0J A;  1S26 D;  1BG1 A;  1B47 A;  1CMG A;  1WLZ A;  3BUN B;  4MN0 A;  1AJ4 A;  3I5I C;  2PMY A;  3KPX A;  2M7N A;  5DIC A;  1OSA A;  1CMF A;  3BUW B;  5D3O A;  1W9Z A;  1GGZ A;  2H61 C;  2JU0 A;  4USL A;  1B8L A;  3VRO A;  1TNP A;  4E68 A;  1K9K A;  3F45 A;  1IKU A;  5ER5 A;  1F71 A;  2OS8 C;  3EK4 A;  3HX4 A;  2F33 A;  5I2O A;  4OVN F;  1PAL A;  2CXJ A;  1SRA A;  1OMD A;  1HQV A;  1OOF A;  3BJH A;  5CSF A;  1KFX S;  2KYF A;  3BOW B;  1RRO A;  1B9A A;  2Q91 A;  3M0W A;  1ZMZ A;  1ZFS A;  1M39 A;  3K21 A;  1UUS A;  3PN7 C;  1UP5 A;  5DKR A;  2WCH A;  1ZUZ A;  3E3R A;  2L4I A;  1DVI A;  1H4B A;  1V1F A;  1TOP A;  1Y1X A;  3I5F C;  2MHH A;  4L9M A;  3S0F A;  2BCX A;  2GGZ A;  1IG5 A;  2K8M B;  4YI9 A;  1SCV A;  3RM1 A;  1DJY A;  5AXI A;  1IJ5 A;  1XK4 A;  2O5G A;  2WOR A;  2LVJ A;  2F2O A;  1KCY A;  1TIZ A;  2FCD A;  1J7O A;  1KWO C;  3PAL A;  1XVJ A;  2CT9 A;  4IL1 A;  2CCM A;  1CNP A;  5DKQ A;  2CBL A;  1IH0 A;  1S5G Z;  2EC6 B;  1QLS A;  4GPL B;  1BU3 A;  1OOI X;  4BY5 A;  2A4J A;  1J7R A;  2KAY A;  1UHJ A;  3QME A;  4PHM A;  3CTN A;  4YRU A;  1S6C A;  3JVT B;  1OZO A;  1SL9 A;  3EVR A;  2MLE C;  3AAK A;  1GJY A;  4PE4 A;  1PVA A;  2ZNE A;  3DD4 A;  1Y1U A;  1BOD A;  1M45 A;  4QJ5 B;  2Y5I A;  3DF0 A;  4KYN A;  3BFH A;  2F2P A;  2SCP A;  2WCB A;  2KBM A;  3PSR A;  2H8V A;  4XYN A;  5HKW A;  1CFC A;  2KLD A;  4PHK A;  3UNW A;  1BT6 A;  1K95 A;  1NX1 A;  1OW4 A;  3EKJ A;  5CSN A;  2LAP A;  1MWN A;  4AOM A;  1NSH A;  5FYX A;  1CDN A;  3IVT A;  3JTD C;  4ORB B;  4GNK B;  3D74 A;  1XFX O;  1SNL A;  1JSA A;  1NWD A;  4DIR A;  2KSP A;  3BFB A;  3FS7 A;  4MLW A;  4D1E A;  1DF0 A;  4OZD A;  4WRI A;  2LVK A;  2ZND A;  4YGC B;  1DGU A;  3AKA A;  2WCL A;  5AEQ A;  1XFV O;  2M3W A;  3VRR A;  3PJI A;  4WQ3 A;  1OOG A;  3O4Y A;  3KF9 A;  3TUY B;  2WCM A;  3R72 A;  1MQ1 A;  2K61 A;  1UHK A;  1PUL A;  2Y1N A;  2P70 A;  3O2P A;  3CR2 A;  3DVJ A;  4JD9 A;  1A75 B;  3S0D A;  4ZCU A;  1DT7 B;  4XJK B;  1DMO A;  2KI4 B;  1A03 A;  3SG4 A;  3WHU B;  1K96 A;  3MSE B;  1UWO A;  1OQP A;  1UUR A;  1V1G A;  2FCE A;  3OP0 A;  3SIA A;  3WXA A;  5I2Q A;  1ZAC A;  3DXL A;  1FPW A;  5DKN A;  3SJS A;  4PHJ A;  4HSZ A;  3B87 A;  1SR6 B;  1KK8 C;  1L2O C;  4UPG A;  1IQ5 A;  2MJW B;  2ERB A;  2D8N A;  2KLE A;  3NGV A;  1K90 D;  2JPT A;  4ZCV A;  5AFP A;  1NX3 A;  1VRK A;  4YBH B;  1CFD A;  1QX5 B;  1YUT A;  1KFU L;  1AUI B;  2V53 A;  3OBV A;  2OTG C;  4OR9 B;  2L2C A;  5HLO A;  5B8I B;  4NQG A;  1LS8 A;  1SY9 A;  2KQ6 A;  3AKB A;  2M97 A;  4M2P A;  5K89 A;  1GGW A;  1QXP A;  2BEC A;  2L0P A;  2HET A;  3IQO A;  2QAC A;  1SL7 A;  1PSB A;  2WCK A;  5ER4 X;  1HT9 A;  1WDC C;  3CZT X;  4GFT A;  1QJT A;  4A4B A;  1YTZ C;  2M8U A;  1KQM C;  2K7B A;  2HPS A;  3S0B A;  4C0K A;  3LLE A;  2KHN A;  1F54 A;  4R1E A;  3DF0 B;  3IF7 A;  3LCP C;  2M1U A;  2BAP A;  1G8I A;  1K2H A;  4I5K A;  1F8H A;  2ZRT A;  1TWO A;  2NZ0 A;  2DOQ A;  1M46 A;  4GUK A;  2G2B A;  3CS1 A;  1MHO A;  1J7P A;  4I5J A;  5CSJ A;  1UHH A;  4NDC A;  2K7O A;  1A4P A;  2I7A A;  2PQL A;  3OHM B;  5AER A;  2WOS A;  1TUJ A;  1JFJ A;  2FOT A;  1S5G Y;  1DF0 B;  1XFY O;  4HRG A;  2K7D A;  2LMU A;  3I5G B;  3R1P A;  4P5O E;  1SCM B;  1LXF C;  5GQQ C;  2LC5 A;  2PSR A;  3L47 A;  1B1G A;  1NCZ A;  3CAB A;  1DEL A;  2QEO A;  1SKT A;  2JNX A;  4MVF A;  1NP8 A;  1QV0 A;  2GTE A;  2R2I A;  1XFR A;  1RTP 1;  2G9B A;  4DS7 A;  2ZKM X;  2FJY A;  4PT1 A;  1K93 D;  2NCO A;  1TRF A;  3BUO B;  1OE9 B;  1WRL A;  2MRD A;  2WND A;  2K2F A;  1A75 A;  1QVI Y;  4AQJ A;  3CZ1 A;  1KFX L;  4XJK A;  5G08 A;  2H2K A;  5BPJ A;  1C7V A;  3CR5 X;  2KGB C;  2LMV A;  3CLN A;  1EH2 A;  1LA3 A;  1TCF A;  3OB1 B;  4Q04 A;  5HKZ A;  1EXR A;  1JUO A;  1R2U A;  1J1D A;  1Z4H A;  2NLN A;  4BY4 A;  4F0Z B;  1FI5 A;  1M31 A;  3A8R A;  1BR4 B;  1QAT A;  3GOF A;  2LAN A;  4I5N B;  3ICB A;  1YX8 A;  2L2E A;  3PM8 A;  4PHN A;  1J55 A;  5JOL A;  3BFA A;  5JJG A;  3ZNI A;  4N1G A;  4CFR A;  2KI6 C;  1IWQ A;  2AAO A;  4CPV A;  1J1E A;  1CLB A;  4GGF C;  1RJV A;  3I5H C;  2Y4Q A;  2LLS A;  4JPZ B;  1H8B A;  1SK6 D;  2RGI A;  2VRG A;  2BBN A;  1EG3 A;  2M9G A;  4INW A;  4GBA A;  1A29 A;  3CDN A;  3VGO A;  5HL1 A;  4QJ3 B;  4PCW A;  1NX2 A;  1YR5 A;  2LLU A;  1MXL C;  2KFH A;  2KQY A;  1ALV A;  1BMO A;  3D73 A;  2MBX A;  2EHB A;  1MXE A;  2L4H A;  1OMV A;  2F8P A;  2LE9 B;  2BE6 A;  2BNX A;  2WCF A;  1QV1 A;  2BL0 C;  4DRW A;  1P28 A;  1QVI Z;  3I5I B;  1Q80 A;  4PE0 A;  1QIV A;  2E6W A;  4YGE B;  2KFF A;  2F3Z A;  3WNX B;  1DJX A;  1NIW A;  4FTG A;  1TCO B;  3CR4 X;  3KO0 A;  3N7H A;  2EGD A;  2M1K B;  2KDH A;  4OKH A;  4MZJ A;  1MF8 B;  2BE4 A;  2BKI B;  4YGD B;  3D78 A;  3NHT A;  1S36 A;  2KFG A;  2OS8 B;  3D0Y A;  1JC2 A;  1LA0 A;  2BCA A;  2L50 A;  1YX7 A;  2WCJ A;  2PVB A;  3KEV A;  3PFV A;  1CFP A;  3DYE A;  1FI6 A;  1D1O A;  2LVI A;  3OX5 A;  4ICB A;  1F55 A;  4ORC B;  1IGV A;  1YRU B;  2K2A A;  2LHI A;  4YGB B;  1AVS A;  3I5G C;  3B86 A;  4QJ4 B;  5KTY A;  2L5Y A;  4MRY A;  1BLQ A;  3PN7 B;  1WRZ A;  1CKK A;  3L4A A;  3SIB A;  4OCI A;  2ZN9 A;  3TDZ A;  1QTX A;  3SG3 A;  3TDU A;  3VRN A;  2KGR A;  1TN4 A;  3CZ2 A;  3EKH A;  1S6J A;  3I5F B;  2LLT A;  1PRW A;  1ORG A;  2QEH A;  4IJ7 A;  5KSZ A;  2IS9 A;  3NSO A;  1KSO A;  2COL B;  1A2X A;  5FI7 A;  1K9P A;  1TNX A;  2O60 A;  3C1V A;  1NCY A;  3S0G A;  3GK4 X;  1UHI A;  3TS5 B;  1KWO B;  3BUX B;  5PAL A;  2BCB A;  4DUQ A;  1IIO A;  1NCX A;  2L5X B;  3BXK A;  5HLV A;  2KYC A;  4TNC A;  1NX0 A;  2KPH A;  3EK7 A;  2FJU B;  4I5L B;  1QS7 A;  2CTN A;  3SG2 A;  1CDL A;  1J7Q A;  5IBW A;  4GAO A;  5CSI A;  2KNE A;  2TN4 A;  1R6P A;  1QWV A;  3DVM A;  4JWQ A;  3UO9 A;  3EVV A;  2JT8 A;  1QIW A;  1IRJ A;  2JZI A;  1B8C A;  1KK7 Y;  1N65 A;  1F70 A;  2JTZ A;  3B6X A;  2EC6 C;  3SS3 A;  3O6B A;  3OX6 A;  2LHL A;  3FE9 A;  3IQQ A;  3JTD B;  5TNC A;  1AHR A;  5D7F A;  3JVT C;  2ISD A;  2M49 B;  2MAZ A;  3PLF B;  4WQ2 A;  3NXA A;  1CLM A;  4CID A;  1DQE A;  5D69 A;  3CYZ A;  3OGN A;  3D0Y B;  2AMI A;  2H61 A;  4INX A;  3BYA A;  1SSE B;  2KBI A;  4GGN A;  5F6T A;  1L7Z A;  2WC8 A;  1QX2 A;  1G4Y R;  2M29 A;  2PRU A;  2JWW A;  5HYD A;  2AUC A;  1SBJ A;  3D75 A;  2MA2 A;  1EL4 A;  2L98 A;  1LIN A;  1OOJ A;  3ZWH A;  1AJ5 A;  1CLL A;  2GV5 A;  1DJW A;  1FW4 A;  2KI6 D;  4MEW A;  3S0E A;  4HRE E;  1PVB A;  2M0R A;  3GK2 A;  1CDP A;  4FQT A;  5AAN A;  3LL8 B;  2I2R E;  1SW8 A;  1JFK A;  2LCP A;  1B4C A;  1S6I A;  3KHE A;  1KSM A;  2SAS A;  3R1V A;  5CPV A;  3TUY C;  3H4S E;  1KK8 B;  1L2O B;  4P2Y B;  1CB1 A;  1G33 A;  4OV2 A;  1TTX A;  2JT0 A;  2L51 A;  4YI8 A;  3LK0 A;  3SG5 A;  1KK7 Z;  2NCP A;  1F4Q A;  2HQW A;  2LP2 A;  2NXQ A;  1OMR A;  2E30 A;  2JXL A;  3VB1 A;  1TUZ A;  2KI4 C;  1B7T Z;  2LMT A;  2OTG B;  3PAT A;  1UHN A;  1GM0 A;  1C3Y A;  4AQI A;  1QX7 A;  3FWB A;  2MLF C;  1EJ3 A;  3FE8 A;  1EG4 A;  1DEK A;  1WDC B;  2LVV A;  4JQ0 D;  4PDZ A;  3DY9 A;  3EVU A;  4GGF A;  1KQM B;  1KQV A;  1SR6 C;  3CGA A;  3DVE A;  1RFJ A;  1XK4 C;  4ORA B;  1YVL A;  2I18 A;  3DZT A;  1NPQ A;  4PE1 A;  1C07 A;  3K1E A;  2K60 A;  1N0Y A;  1NUB A;  2GGM A;  2P6B B;  1REC A;  1DTL A;  1ODB A;  4PE7 A;  3TS5 C;  3FIA A;  1T14 A;  2KAV A;  4MRX A;  5J3X A;  3EK8 A;  4MZL A;  4NDB A;  2WCE A;  3VRP A;  2JPO A;  2CNP A;  3NSI A;  4CLN A;  3SS4 A;  1LKJ A;  1W7I B;  1SYM A;  2JXC A;  3TDI A;  4DCK A;  4N1F A;  3V2L A;  1CM1 A;  3L4L A;  1MR8 A;  1DJG A;  1K9U A;  1S3P A;  2QEV A;  1E8A A;  1XO5 A;  2PAS A;  3D76 A;  1OZS A;  1U5I B;  5HKY A;  1QAS A;  3WHT B;  2YGU A;  3D77 A;  4C0L A;  2PAL A;  2Q4U A;  1QLK A;  2QEB A;  3D10 A;  1FBV A;  1YUR A;  4MSP A;  2LM5 A;  1DJZ A;  4PAL A;  1BF5 A;  1M63 B;  2QDI A;  3PM2 A;  2LNK A;  4M2Q A;  3AAJ A;  3GK1 A;  1GQM A;  2BBM A;  4U8D A;  1AP4 A;  2ZN8 A;  3O4X A;  1CFF A;  4M2O A;  1C7W A;  5I8N A;  3A4U B;  1YVH A;  1SCM C;  4NDD A;  1DGV A;  1K8U A;  5I2L A;  1YUS A;  2JOJ A;  1BR1 B;  4MZK A;  3EG5 B;  5I94 A;  1NYA A;  3OB2 B; 
#chains in the Genus database with same CATH homology
 1Y0V H;  3VRQ A;  4HRH A;  1B8R A;  1XFZ O;  1XYD A;  2JC2 A;  3NSL A;  1YRT B;  2JT3 A;  1JF2 A;  1WLM A;  1AK8 A;  3BOW A;  3NSK A;  2KAX A;  3O78 A;  1CM4 A;  1YUU A;  2Y1M A;  4FQO A;  2LP3 A;  1ALW A;  1S1E A;  1TNQ A;  1WY9 A;  1DJH A;  3I5H B;  1KFU S;  1Y6W A;  3TZ1 A;  1DJI A;  4A4C A;  1LVC D;  2F3Y A;  5KU1 A;  2JNF A;  2ZRS A;  4YGA A;  2LUC A;  4CFQ A;  4ETO A;  2JQ6 A;  1N2D A;  1TNW A;  2K0J A;  1IQ3 A;  1JBA A;  1XFU O;  2BKH B;  3RLZ A;  1JWD A;  1RK9 A;  1MUX A;  1XA5 A;  1K94 A;  3SG6 A;  1F4O A;  2JTT A;  1W7J B;  1XFW O;  2I94 A;  1FF1 A;  1JF0 A;  2K7C A;  1B7T Y;  1BJF A;  1WRK A;  2LUX A;  3QRX A;  2BL0 B;  1SL8 A;  3FWC A;  1BOC A;  1X02 A;  2LV7 A;  3HCM A;  3SG7 A;  1CDM A;  3DVK A;  2JUL A;  1Y1A A;  2QPT A;  1CTR A;  2OPO A;  3CWG A;  2KOT A;  4MBE A;  1SPY A;  2HQ8 A;  3LK1 A;  2ZFD A;  1RWY A;  2HF5 A;  2B1U A;  1PSR A;  1PK0 D;  1U5I A;  2JRF A;  2M7L A;  1IJ6 A;  3BUM B;  4N5X A;  1ZOT B;  3BQ3 A;  1SMG A;  4C0J A;  1S26 D;  1BG1 A;  1B47 A;  1CMG A;  1WLZ A;  3BUN B;  4MN0 A;  1AJ4 A;  3I5I C;  2PMY A;  3KPX A;  2M7N A;  1OSA A;  1CMF A;  3BUW B;  1GGZ A;  2H61 C;  2JU0 A;  4USL A;  1B8L A;  3VRO A;  1TNP A;  4E68 A;  1K9K A;  3F45 A;  1IKU A;  5ER5 A;  1F71 A;  2OS8 C;  3EK4 A;  3HX4 A;  2F33 A;  5I2O A;  4OVN F;  1PAL A;  2CXJ A;  1SRA A;  1OMD A;  1HQV A;  5CSF A;  1KFX S;  2KYF A;  3BOW B;  1RRO A;  1B9A A;  2Q91 A;  3M0W A;  1ZMZ A;  1ZFS A;  1M39 A;  3K21 A;  1UUS A;  3PN7 C;  1UP5 A;  5DKR A;  1ZUZ A;  3E3R A;  2L4I A;  1DVI A;  1H4B A;  1V1F A;  1TOP A;  1Y1X A;  3I5F C;  2MHH A;  4L9M A;  2BCX A;  2GGZ A;  1IG5 A;  2K8M B;  4YI9 A;  1SCV A;  3RM1 A;  1DJY A;  5AXI A;  1IJ5 A;  1XK4 A;  2O5G A;  2WOR A;  2LVJ A;  2F2O A;  1KCY A;  1TIZ A;  2FCD A;  1J7O A;  1KWO C;  3PAL A;  1XVJ A;  2CT9 A;  4IL1 A;  2CCM A;  1CNP A;  5DKQ A;  2CBL A;  1IH0 A;  1S5G Z;  2EC6 B;  1QLS A;  4GPL B;  1BU3 A;  4BY5 A;  2A4J A;  1J7R A;  2KAY A;  1UHJ A;  4PHM A;  3CTN A;  4YRU A;  1S6C A;  3JVT B;  1OZO A;  1SL9 A;  3EVR A;  2MLE C;  3AAK A;  1GJY A;  4PE4 A;  1PVA A;  2ZNE A;  3DD4 A;  1Y1U A;  1BOD A;  1M45 A;  4QJ5 B;  2Y5I A;  3DF0 A;  2F2P A;  2SCP A;  2WCB A;  2KBM A;  3PSR A;  4XYN A;  5HKW A;  1CFC A;  4PHK A;  1BT6 A;  1K95 A;  1NX1 A;  3EKJ A;  5CSN A;  2LAP A;  1MWN A;  4AOM A;  1NSH A;  5FYX A;  1CDN A;  3JTD C;  4ORB B;  4GNK B;  1XFX O;  1SNL A;  1JSA A;  1NWD A;  4DIR A;  2KSP A;  3FS7 A;  4MLW A;  4D1E A;  1DF0 A;  4WRI A;  2LVK A;  2ZND A;  4YGC B;  1DGU A;  3AKA A;  5AEQ A;  1XFV O;  2M3W A;  3VRR A;  4WQ3 A;  3O4Y A;  3KF9 A;  3TUY B;  1MQ1 A;  2K61 A;  1UHK A;  1PUL A;  2Y1N A;  3O2P A;  3CR2 A;  3DVJ A;  1A75 B;  4ZCU A;  1DT7 B;  4XJK B;  1DMO A;  2KI4 B;  1A03 A;  3SG4 A;  3WHU B;  1K96 A;  3MSE B;  1UWO A;  1OQP A;  1UUR A;  1V1G A;  2FCE A;  3OP0 A;  3SIA A;  3WXA A;  5I2Q A;  1ZAC A;  1FPW A;  5DKN A;  3SJS A;  4PHJ A;  4HSZ A;  1SR6 B;  1KK8 C;  1L2O C;  4UPG A;  1IQ5 A;  2MJW B;  2D8N A;  5AFP A;  1K90 D;  2JPT A;  4ZCV A;  1NX3 A;  1VRK A;  4YBH B;  1CFD A;  1QX5 B;  1YUT A;  1KFU L;  1AUI B;  2V53 A;  5HLO A;  2OTG C;  4OR9 B;  5B8I B;  4NQG A;  1SY9 A;  2KQ6 A;  3AKB A;  5K89 A;  2M97 A;  4M2P A;  1GGW A;  1QXP A;  2BEC A;  2L0P A;  2HET A;  3IQO A;  2QAC A;  1SL7 A;  1PSB A;  5ER4 X;  1HT9 A;  1WDC C;  3CZT X;  4GFT A;  1QJT A;  4A4B A;  1YTZ C;  2M8U A;  1KQM C;  2K7B A;  2HPS A;  4C0K A;  3LLE A;  2KHN A;  1F54 A;  4R1E A;  3DF0 B;  3IF7 A;  3LCP C;  2M1U A;  1G8I A;  1K2H A;  4I5K A;  1F8H A;  2ZRT A;  2NZ0 A;  2DOQ A;  1M46 A;  4GUK A;  2G2B A;  3CS1 A;  1MHO A;  1J7P A;  4I5J A;  5CSJ A;  1UHH A;  4NDC A;  2K7O A;  1A4P A;  2I7A A;  5AER A;  3OHM B;  2WOS A;  1JFJ A;  2FOT A;  1S5G Y;  1DF0 B;  1XFY O;  4HRG A;  2K7D A;  2LMU A;  3I5G B;  4P5O E;  1SCM B;  1LXF C;  5GQQ C;  2LC5 A;  2PSR A;  1B1G A;  1NCZ A;  1SKT A;  2JNX A;  4MVF A;  1NP8 A;  1QV0 A;  2R2I A;  1RTP 1;  2G9B A;  4DS7 A;  2ZKM X;  1K93 D;  2NCO A;  1TRF A;  3BUO B;  1OE9 B;  1WRL A;  2MRD A;  2WND A;  2K2F A;  1A75 A;  1QVI Y;  4AQJ A;  1KFX L;  4XJK A;  5G08 A;  2H2K A;  5BPJ A;  1C7V A;  3CR5 X;  2KGB C;  2LMV A;  3CLN A;  1EH2 A;  1LA3 A;  1TCF A;  3OB1 B;  4Q04 A;  5HKZ A;  1EXR A;  1JUO A;  1R2U A;  1J1D A;  2NLN A;  4BY4 A;  4F0Z B;  1FI5 A;  1M31 A;  3A8R A;  1BR4 B;  1QAT A;  3GOF A;  2LAN A;  4I5N B;  3ICB A;  1YX8 A;  2L2E A;  3PM8 A;  4PHN A;  1J55 A;  5JOL A;  5JJG A;  3ZNI A;  4N1G A;  4CFR A;  2KI6 C;  1IWQ A;  2AAO A;  4CPV A;  1J1E A;  1CLB A;  4GGF C;  1RJV A;  3I5H C;  2Y4Q A;  2LLS A;  4JPZ B;  1H8B A;  1SK6 D;  2RGI A;  2VRG A;  2BBN A;  1EG3 A;  2M9G A;  4GBA A;  1A29 A;  3VGO A;  4QJ3 B;  4PCW A;  1NX2 A;  1YR5 A;  2LLU A;  1MXL C;  2KFH A;  2KQY A;  1ALV A;  1BMO A;  2MBX A;  2EHB A;  1MXE A;  2L4H A;  1OMV A;  2F8P A;  2LE9 B;  2BE6 A;  2WCF A;  1QV1 A;  2BL0 C;  4DRW A;  1QVI Z;  3I5I B;  1Q80 A;  4PE0 A;  1QIV A;  2E6W A;  4YGE B;  2KFF A;  2F3Z A;  3WNX B;  1DJX A;  1NIW A;  4FTG A;  1TCO B;  3CR4 X;  3KO0 A;  2EGD A;  2M1K B;  2KDH A;  4OKH A;  4MZJ A;  2BE4 A;  1MF8 B;  2BKI B;  4YGD B;  1JC2 A;  1S36 A;  2KFG A;  2OS8 B;  3D0Y A;  1LA0 A;  2BCA A;  2L50 A;  1YX7 A;  3KEV A;  2PVB A;  3PFV A;  1CFP A;  1FI6 A;  1D1O A;  2LVI A;  3OX5 A;  4ICB A;  1F55 A;  4ORC B;  1IGV A;  1YRU B;  2K2A A;  2LHI A;  4YGB B;  1AVS A;  3I5G C;  4QJ4 B;  5KTY A;  4MRY A;  1BLQ A;  3PN7 B;  1WRZ A;  1CKK A;  3SIB A;  4OCI A;  2ZN9 A;  3TDZ A;  1QTX A;  3SG3 A;  3TDU A;  3VRN A;  2KGR A;  1TN4 A;  3EKH A;  1S6J A;  3I5F B;  2LLT A;  1PRW A;  5KSZ A;  2IS9 A;  3NSO A;  1KSO A;  2COL B;  1A2X A;  1K9P A;  1TNX A;  2O60 A;  3C1V A;  1NCY A;  3GK4 X;  1UHI A;  3TS5 B;  1KWO B;  3BUX B;  5PAL A;  2BCB A;  4DUQ A;  1NCX A;  2L5X B;  3BXK A;  5HLV A;  2KYC A;  4TNC A;  1NX0 A;  3EK7 A;  2FJU B;  4I5L B;  1QS7 A;  2CTN A;  3SG2 A;  1CDL A;  1J7Q A;  5IBW A;  4GAO A;  5CSI A;  2KNE A;  2TN4 A;  1R6P A;  3DVM A;  4JWQ A;  3EVV A;  2JT8 A;  1QIW A;  1IRJ A;  2JZI A;  1B8C A;  1KK7 Y;  1N65 A;  1F70 A;  2JTZ A;  2EC6 C;  3O6B A;  3OX6 A;  2LHL A;  3IQQ A;  3JTD B;  5TNC A;  1AHR A;  5D7F A;  3JVT C;  2ISD A;  2M49 B;  2MAZ A;  3PLF B;  4WQ2 A;  3NXA A;  1CLM A;  4CID A;  5D69 A;  3D0Y B;  2AMI A;  2H61 A;  5F6T A;  3BYA A;  2KBI A;  4GGN A;  1L7Z A;  2WC8 A;  1QX2 A;  1G4Y R;  2M29 A;  2PRU A;  2JWW A;  5HYD A;  2AUC A;  1SBJ A;  2MA2 A;  1EL4 A;  2L98 A;  1LIN A;  1OOJ A;  3ZWH A;  1AJ5 A;  1CLL A;  2GV5 A;  1DJW A;  1FW4 A;  2KI6 D;  4MEW A;  4HRE E;  1PVB A;  2M0R A;  3GK2 A;  1CDP A;  5AAN A;  3LL8 B;  2I2R E;  1SW8 A;  1JFK A;  2LCP A;  1B4C A;  1S6I A;  3KHE A;  1KSM A;  2SAS A;  5CPV A;  3TUY C;  3H4S E;  1KK8 B;  1L2O B;  4P2Y B;  1CB1 A;  1G33 A;  4OV2 A;  1TTX A;  2JT0 A;  2L51 A;  4YI8 A;  3LK0 A;  3SG5 A;  1KK7 Z;  2NCP A;  1F4Q A;  2HQW A;  2LP2 A;  2NXQ A;  1OMR A;  2E30 A;  2JXL A;  2KI4 C;  2OTG B;  1B7T Z;  2LMT A;  3PAT A;  1UHN A;  4AQI A;  1QX7 A;  3FWB A;  2MLF C;  1EJ3 A;  4PDZ A;  1EG4 A;  1WDC B;  2LVV A;  4JQ0 D;  4GGF A;  3EVU A;  1KQM B;  1KQV A;  1SR6 C;  3CGA A;  3DVE A;  1RFJ A;  1XK4 C;  4ORA B;  1YVL A;  2I18 A;  1NPQ A;  4PE1 A;  1C07 A;  1N0Y A;  1NUB A;  2GGM A;  2P6B B;  1REC A;  1DTL A;  1ODB A;  4PE7 A;  3TS5 C;  3FIA A;  2KAV A;  4MRX A;  5J3X A;  3EK8 A;  4MZL A;  4NDB A;  2WCE A;  3VRP A;  2CNP A;  3NSI A;  4CLN A;  1LKJ A;  1W7I B;  1SYM A;  2JXC A;  3TDI A;  4DCK A;  4N1F A;  1CM1 A;  1MR8 A;  1DJG A;  1K9U A;  1S3P A;  1E8A A;  1XO5 A;  2PAS A;  1OZS A;  1U5I B;  5HKY A;  1QAS A;  3WHT B;  4C0L A;  2PAL A;  2Q4U A;  1QLK A;  3D10 A;  4MSP A;  1FBV A;  1YUR A;  1BF5 A;  2LM5 A;  1DJZ A;  4PAL A;  1M63 B;  2LNK A;  4M2Q A;  3AAJ A;  3GK1 A;  1GQM A;  2BBM A;  4U8D A;  1AP4 A;  2ZN8 A;  1CFF A;  4M2O A;  1C7W A;  5I8N A;  3A4U B;  1YVH A;  1SCM C;  4NDD A;  1DGV A;  1K8U A;  5I2L A;  1YUS A;  2JOJ A;  1BR1 B;  4MZK A;  1NYA A;  3OB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...