3NSLA

Crystal structure of s100a3 c30a+c68a double mutant expressed in insect cell
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
ARPLEQAVAAIVCTFQEYAGRCGDKYKLAQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDAEVDFVEYVRSLACLCLYCHEYFKDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A3
publication title Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3nslA00
1B8LA 5BPJA 1K9PA 5DKRA 3FIAA 2L51A 4E68A 3CS1A 5HLVA 5J3XA 1JFKA 1JC2A 1S6JA 1SMGA 2EHBA 3GK4X 3BUXB 4MZKA 1F8HA 3QRXA 1SL9A 3F45A 1K93D 1IWQA 3NXAA 4HREE 1B1GA 2KBIA 1XFXO 3SIBA 1ALWA 5I2LA 3TUYC 1DF0A 3I5IC 4MVFA 2CBLA 4OV2A 1TIZA 3O78A 2PSRA 1RWYA 3WHUB 4JWQA 1UWOA 1PVBA 1Y0VH 3ZWHA 3CR5X 5HKWA 3DF0B 3EVUA 1DTLA 4GGNA 2WCBA 1CM4A 3E3RA 2A4JA 2OS8C 1UHNA 2AMIA 1BR4B 3FWCA 3C1VA 5D69A 4PHMA 1GJYA 1K9KA 1YVHA 1F4QA 2JQ6A 2Y1NA 3DF0A 3PN7C 3WXAA 5I2OA 2O60A 1KFUL 3EK7A 1B8CA 1GGZA 3HX4A 4PHJA 1CDMA 1YX7A 1CDPA 1XA5A 1DF0B 1G8IA 1B9AA 2V53A 1MR8A 3AKBA 1DMOA 2PMYA 1KFUS 1SCMB 2ZNEA 3OB1B 1NUBA 1A03A 2F2PA 1OZOA 2M0RA 2JXLA 4P2YB 1B4CA 2CXJA 1Y1XA 4MLWA 1DJYA 1ZMZA 1NSHA 2MHHA 3PLFB 2BKHB 3SG7A 1XK4A 1SBJA 2LM5A 1OMRA 1DGVA 1PULA 1Y1UA 1TCOB 1W7IB 4GFTA 4L9MA 4A4BA 5DKNA 4DIRA 3H4SE 1JF2A 1BOCA 2JZIA 1WRKA 4ORBB 5F6TA 2KOTA 1OSAA 2L0PA 1V1GA 3TZ1A 1RJVA 1SL8A 2ZRTA 1AK8A 1CFFA 3I5HC 1C07A 2Y5IA 4MRYA 2FCDA 1WY9A 1M46A 2Y1MA 5KTYA 3VRNA 2M97A 4MEWA 4QJ4B 2KGRA 2IS9A 1A75A 1J55A 4OR9B 2CT9A 1F71A 1SRAA 1S6CA 1MWNA 5HKYA 1N65A 1B7TY 1RFJA 5AANA 4UPGA 2BE4A 1Y1AA 1RK9A 3TDIA 1C7VA 5HYDA 2QPTA 3JVTC 1BODA 2ZFDA 2E6WA 1CLMA 1QJTA 2BL0C 4I5LB 1SCMC 2M1KB 3FS7A 1S36A 2K7BA 1ZOTB 2JPTA 4Q04A 4NDDA 1TN4A 3DD4A 1QX5B 4NDCA 4USLA 1Q80A 2JOJA 3D0YA 5FYXA 1KSMA 1IJ5A 3VRQA 2NCPA 3SIAA 2I2RE 1FPWA 1TNPA 1A75B 1PSBA 4D1EA 1J7OA 3I5FC 2ZRSA 2COLB 1G4YR 2KFHA 3O2PA 1FI5A 1JBAA 1YTZC 4I5KA 1NYAA 1NX0A 2LP2A 3AAKA 1YUTA 3BUMB 2K0JA 3BUNB 1KWOC 2KYFA 1TNXA 1DJHA 2Q4UA 4F0ZB 1LXFC 2FJUB 1TRFA 3VROA 1TCFA 1WRZA 4CIDA 1SKTA 3CLNA 5AERA 2L50A 3O4YA 2MAZA 1IH0A 2LUCA 2KAXA 3SG5A 1IQ3A 3BUOB 1GQMA 1DJGA 1M39A 4GGFA 1PK0D 3KHEA 3D0YB 1S3PA 3A4UB 1K2HA 1AP4A 1QIVA 1QX2A 1DJIA 5KSZA 3PM8A 3SG6A 1FI6A 2NCOA 4ETOA 3LL8B 4GAOA 2PASA 2JNFA 1FF1A 2LUXA 3EVRA 3OB2B 3WHTB 5B8IB 2HETA 2KNEA 2WCEA 3A8RA 1NX1A 2WCFA 1XO5A 1KFXS 1ODBA 3AAJA 4OCIA 2JRFA 2JTTA 2M7NA 1UHKA 3HCMA 1SPYA 4M2QA 1J7QA 2M8UA 2HPSA 1YUUA 1B7TZ 4HSZA 1XYDA 1CFDA 1EG3A 1LA3A 2OTGC 3CWGA 1BG1A 4AQIA 1S5GY 2RGIA 2MRDA 2HF5A 2LCPA 2EC6B 2Q91A 1J7PA 3CGAA 4YBHB 5HLOA 1QV0A 1DGUA 1YVLA 2QACA 4CFQA 1QVIY 2M29A 1KK7Y 4ZCUA 1HT9A 1LINA 4WQ3A 4PDZA 1JFJA 4FTGA 2JU0A 2B1UA 4GBAA 1BMOA 2WOSA 2LMVA 4PALA 2LP3A 2MLFC 1LA0A 2MLEC 2CTNA 2SCPA 2F2OA 2KI4B 2LMUA 1F55A 4MN0A 2KAVA 1KK8B 1K8UA 1CMFA 1J7RA 1L2OB 3PFVA 1UURA 1S1EA 4OVNF 2AUCA 3CZTX 4YGCB 4MZLA 3KO0A 4DUQA 2ZNDA 1RTP1 1OZSA 1SY9A 1BR1B 5CSJA 2NLNA 4GUKA 1BT6A 1IGVA 1R6PA 3OHMB 4XYNA 1CFPA 1EXRA 5KU1A 3D10A 2K7DA 2LHIA 4YGAA 2CNPA 2GGMA 2HQWA 4YGDB 4ICBA 2LVJA 2Y4QA 1SYMA 1HQVA 2LLSA 3DVKA 2TN4A 5TNCA 2MJWB 4PHNA 3PATA 1UHHA 4YI9A 2I18A 2BBMA 2BBNA 1NWDA 4MBEA 1OE9B 1QS7A 1GGWA 5I2QA 4GNKB 1TOPA 3RM1A 5DKQA 3CR2A 1WRLA 3KF9A 2PALA 4GPLB 2BCBA 2K2FA 3IQOA 3OX6A 3NSKA 1MUXA 1S6IA 1YUSA 2JTZA 4PE4A 4BY4A 1S5GZ 3ZNIA 1SK6D 1PALA 3TDUA 2AAOA 4N5XA 1MQ1A 2JC2A 1ZACA 1SW8A 1XFWO 2HQ8A 1JSAA 3TS5B 1QVIZ 1J1DA 2JXCA 4JQ0D 1KK7Z 1D1OA 1DJWA 1ZFSA 2ISDA 1AVSA 3SG4A 4YRUA 2JWWA 4DS7A 2KHNA 3O6BA 4CFRA 1QASA 5ER5A 1EJ3A 5ER4X 4A4CA 1F70A 1U5IA 5CSIA 1N2DA 2F33A 2ZKMX 4OKHA 4YGEB 4I5NB 4HRGA 4PE1A 1BF5A 2O5GA 2F3ZA 1V1FA 2JNXA 3EK8A 2LV7A 3I5GB 5HKZA 1XVJA 2FOTA 1XFYO 1BLQA 2GV5A 3OP0A 1BU3A 3VGOA 4NDBA 1F4OA 3TUYB 1Y6WA 1PRWA 1YRUB 2R2IA 3DVEA 4YI8A 1XK4C 2LLTA 1TNQA 2ZN8A 2M7LA 3DVMA 4C0JA 2K2AA 1AJ5A 3BXKA 1UHIA 4QJ3B 1UUSA 1UP5A 2FCEA 1NCZA 4YGBB 5D7FA 1G33A 2OS8B 4I5JA 1U5IB 1KFXL 4IL1A 2LNKA 5CSFA 1JUOA 1PVAA 1SL7A 2SASA 3PN7B 1CM1A 1K96A 3VRRA 5GQQC 1BJFA 5JJGA 4M2OA 2NXQA 1A29A 1E8AA 4QJ5B 2KAYA 3SJSA 3RLZA 5K89A 3SG3A 3CR4X 4DRWA 4CPVA 2LE9B 2I7AA 4AQJA 2G9BA 3PSRA 2VRGA 4WQ2A 1CMGA 4PHKA 5AEQA 1CLBA 2KQYA 1XFVO 1TNWA 3IF7A 3BYAA 3KPXA 1IKUA 1R2UA 4BY5A 4C0LA 3LLEA 5CPVA 2CCMA 1NX3A 1JF0A 3I5GC 2KI6C 4C0KA 2PVBA 1SR6B 2KQ6A 1XFUO 4FQOA 3IQQA 1K94A 3GK2A 2LHLA 2L4HA 1XFZO 3GK1A 1AJ4A 2F8PA 3K21A 1CTRA 1IJ6A 3ICBA 1C7WA 1TTXA 3BQ3A 4MZJA 1QXPA 2ZN9A 2BE6A 4PE0A 1CNPA 3OX5A 3I5HB 1K9UA 1MXLC 4ORCB 1RECA 2LMTA 1CFCA 2PRUA 1QLKA 2KFFA 2K7CA 3VRPA 1QATA 2KBMA 1KQMB 2EGDA 2LAPA 2L5XB 3EKHA 1DVIA 4NQGA 1RROA 3LK1A 4JPZB 1M45A 2GGZA 3EKJA 1IQ5A 4HRHA 2BKIB 2H61A 3WNXB 1A4PA 1CLLA 1OOJA 5AFPA 1FBVA 3CTNA 1EL4A 1QTXA 2KSPA 4GGFC 1X02A 3JVTB 1WLMA 2KFGA 1MF8B 2BL0B 1QLSA 1NP8A 1QIWA 1EH2A 1QV1A 1AHRA 3AKAA 3BOWA 1N0YA 2M9GA 3M0WA 5CSNA 3EK4A 1NX2A 2LVVA 5AXIA 3BUWB 2NZ0A 1YX8A 2EC6C 3LCPC 3SG2A 2LANA 2M3WA 1K90D 4M2PA 1H8BA 4TNCA 4ORAB 2MBXA 3GOFA 4U8DA 2KI6D 1SR6C 3I5FB 1UHJA 2LC5A 3PALA 2L98A 3TDZA 2LVKA 1H4BA 2F3YA 2E30A 4XJKA 1KWOB 4PE7A 3JTDB 1SNLA 3NSLA 1F54A 1S26D 2JT3A 2KI4C 2L4IA 2BECA 2L2EA 2K8MB 1NPQA 1WLZA 2DOQA 1KK8C 1WDCB 2KGBC 1K95A 2WC8A 5I8NA 4R1EA 1L2OC 2H2KA 3BOWB 1KQMC 3EVVA 2M1UA 1QX7A 1CB1A 1JWDA 2BCAA 3NSIA 1CDNA 1L7ZA 1NIWA 1W7JB 1IRJA 2LLUA 2JT0A 1AUIB 1B8RA 1NCXA 1IG5A 1ZUZA 3FWBA 4XJKB 1M63B 5JOLA 1KSOA 1J1EA 2KDHA 1LKJA 1SCVA 2I94A 1VRKA 1NCYA 2JT8A 3KEVA 1YRTB 4N1FA 4CLNA 4N1GA 1MXEA 3DVJA 1M31A 1CKKA 2K61A 3I5IB 2G2BA 1DJZA 1YURA 1YR5A 4WRIA 2K7OA 1A2XA 2MA2A 3LK0A 1OMDA 2H61C 2OTGB 2LVIA 4MSPA 1ALVA 1MHOA 1OQPA 4MRXA 4AOMA 4DCKA 3JTDC 3MSEB 3NSOA 5IBWA 5PALA 1OMVA 2M49B 1WDCC 1KCYA 1EG4A 2JULA 1FW4A 2P6BB 4PCWA 1KQVA 1B47A 2OPOA 1DT7B 1DJXA 2KYCA 3TS5C 5G08A 2WNDA 4ZCVA 4P5OE 2D8NA 1CDLA 1PSRA 2WORA 1LVCD 2BCXA
chains in the Genus database with same CATH superfamily
1B8LA 5BPJA 1K9PA 5DKRA 3FIAA 2L51A 4E68A 3CS1A 5HLVA 5J3XA 1JFKA 1JC2A 1S6JA 1SMGA 2EHBA 3GK4X 3BUXB 4MZKA 1F8HA 3QRXA 1SL9A 3F45A 1K93D 1IWQA 3NXAA 4HREE 1B1GA 2KBIA 1XFXO 3SIBA 1ALWA 5I2LA 3TUYC 3R1PA 1DF0A 3I5IC 4MVFA 2CBLA 4OV2A 1TIZA 3O78A 2PSRA 1RWYA 3WHUB 3DYEA 1UWOA 4JWQA 1PVBA 1Y0VH 3ZWHA 4F7FA 3CR5X 5HKWA 3DF0B 3EVUA 1DTLA 4GGNA 2WCBA 1CM4A 3E3RA 3S0FA 2A4JA 2OS8C 1UHNA 5D3OA 2AMIA 3QMEA 1BR4B 3FWCA 3C1VA 5D69A 4PHMA 1GJYA 1K9KA 1YVHA 1F4QA 2JQ6A 2Y1NA 3DF0A 3K1EA 3PN7C 5DICA 3WXAA 4INWA 3B86A 2O60A 1KFUL 3EK7A 1DEKA 1B8CA 1GGZA 2WC5A 3HX4A 4PHJA 1CDMA 1YX7A 1CDPA 1XA5A 1DF0B 1G8IA 1B9AA 2V53A 1MR8A 3AKBA 2H8VA 1DMOA 2PMYA 1KFUS 1SCMB 2ZNEA 3D76A 3L4AA 3D78A 3OB1B 1NUBA 3VB1A 2F2PA 1OZOA 2M0RA 2JXLA 2PQLA 4P2YB 2CXJA 1Y1XA 4MLWA 1B4CA 1DJYA 1ZMZA 1NSHA 2MHHA 3PLFB 2BKHB 3SG7A 1XK4A 1SBJA 2LM5A 1OMRA 1DGVA 1PULA 1Y1UA 1TCOB 1W7IB 4GFTA 4L9MA 4A4BA 1SSEB 5DKNA 3H4SE 4DIRA 1JF2A 1BOCA 2JZIA 1WRKA 4ORBB 5F6TA 2KOTA 1OSAA 2BAPA 2L0PA 1V1GA 3TZ1A 1RJVA 1SL8A 2ZRTA 5FI6A 1AK8A 3I5HC 1CFFA 3DY9A 1C07A 2Y5IA 4MRYA 2FCDA 1WY9A 1M46A 2Y1MA 5KTYA 3VRNA 2M97A 4MEWA 4QJ4B 1TWOA 2IS9A 2KGRA 3BFBA 1A75A 4KYNA 1J55A 4OR9B 2CT9A 1F71A 1SRAA 1S6CA 1P28A 1MWNA 5HKYA 1N65A 1B7TY 1RFJA 5AANA 2P71A 4UPGA 2BE4A 1Y1AA 4IJ7A 1RK9A 2WCKA 3RZSA 3TDIA 1C7VA 5HYDA 2QPTA 3JVTC 1BODA 2ZFDA 2E6WA 1CLMA 3SS5A 1QJTA 2BL0C 4I5LB 1SCMC 2M1KB 3FS7A 1S36A 2K7BA 1ZOTB 2JPTA 4Q04A 5I2OA 4NDDA 1TN4A 3B88A 3DD4A 1QX5B 4NDCA 4USLA 1Q80A 2JOJA 3D0YA 3Q8IA 1KSMA 1IJ5A 5FYXA 3VRQA 2NCPA 3SIAA 2I2RE 1FPWA 1TNPA 1T14A 1A75B 1PSBA 4D1EA 1J7OA 3I5FC 2ZRSA 2COLB 1G4YR 2KFHA 3O2PA 1FI5A 1JBAA 1YTZC 4I5KA 1NYAA 1NX0A 2LP2A 3AAKA 1YUTA 3BUMB 2K0JA 3BUNB 1KWOC 2KYFA 1TNXA 1DJHA 2Q4UA 4F0ZB 1LXFC 2FJUB 1TRFA 3VROA 4OZDA 1TCFA 1WRZA 4CIDA 1SKTA 1OOIX 3CLNA 5AERA 2L50A 3O4YA 2MAZA 1IH0A 4FQTA 2LUCA 2KAXA 3SG5A 1IQ3A 3BUOB 1GQMA 1DJGA 1M39A 4GGFA 1PK0D 2KPHA 3KHEA 3D0YB 1S3PA 3A4UB 5FI2A 1K2HA 1AP4A 1QIVA 1QX2A 3B7AA 1DJIA 3UNWA 3PM8A 3SG6A 5KSZA 1FI6A 2L2CA 2NCOA 4ETOA 2WC6A 3LL8B 4GAOA 2PASA 2JNFA 1FF1A 2K60A 2LUXA 3EVRA 3OB2B 3WHTB 4PT1A 5B8IB 2HETA 2KNEA 2WCEA 3A8RA 1NX1A 1C3ZA 2WCFA 1XO5A 1KFXS 1ODBA 3AAJA 4OCIA 2JRFA 2JTTA 2M7NA 1UHKA 3HCMA 3SS4A 1SPYA 4M2QA 1J7QA 2M8UA 2HPSA 1YUUA 1B7TZ 3FE6A 3BFHA 3BFAA 4HSZA 1XYDA 1CFDA 1EG3A 1LA3A 1XFRA 2OTGC 2QEHA 3CWGA 1BG1A 4AQIA 1S5GY 2RGIA 2MRDA 1DELA 2HF5A 2KLDA 2LCPA 2EC6B 2Q91A 1J7PA 1Z4HA 3CGAA 4YBHB 5HLOA 1QV0A 1DGUA 1YVLA 2QACA 4CFQA 1QVIY 2M29A 1DC1A 1KK7Y 4ZCUA 1HT9A 1LINA 4WQ3A 5I94A 4PDZA 1QWVA 3CZ2A 3N7HA 1JFJA 4FTGA 2JU0A 2B1UA 4GBAA 1BMOA 2WOSA 2LMVA 4PALA 2LP3A 2MLFC 1LA0A 3PM2A 2MLEC 2CTNA 2SCPA 3FE8A 2F2OA 2KI4B 1TUZA 2LMUA 1F55A 4MN0A 2KAVA 1KK8B 1K8UA 1CMFA 1J7RA 1L2OB 3PFVA 1UURA 4INXA 1S1EA 4OVNF 2AUCA 4JD9A 3CZTX 4YGCB 4MZLA 3KO0A 2QEBA 4DUQA 2ZNDA 3NHTA 1RTP1 3SS3A 1OZSA 1SY9A 1BR1B 5CSJA 2NLNA 4GUKA 1BT6A 1IGVA 1R6PA 3OHMB 4XYNA 1CFPA 1EXRA 5KU1A 3D10A 2K7DA 2LHIA 2WCLA 3FE9A 4YGAA 2CNPA 2GGMA 2HQWA 4YGDB 4ICBA 2LVJA 2Y4QA 1SYMA 1HQVA 2LLSA 3DVKA 2TN4A 1Z2CB 5TNCA 1GM0A 2MJWB 3B6XA 4PHNA 3CYZA 3PATA 3S0EA 1UHHA 2WCJA 2QDIA 4YI9A 2I18A 2BBMA 2BBNA 1NWDA 4MBEA 1OE9B 2QEOA 1QS7A 1GGWA 5I2QA 4GNKB 3DZTA 1TOPA 1W9ZA 3RM1A 5DKQA 3CR2A 1WRLA 3KF9A 1C3YA 2PALA 4GPLB 2BCBA 2K2FA 3IQOA 3OX6A 3NSKA 1MUXA 1S6IA 1YUSA 2JTZA 3R1VA 4PE4A 4BY4A 3EG5B 1S5GZ 3ZNIA 1SK6D 1PALA 3L4LA 3TDUA 2AAOA 4N5XA 1MQ1A 2JC2A 1ZACA 1SW8A 1XFWO 2HQ8A 1JSAA 3O4XA 3TS5B 1QVIZ 1J1DA 2JXCA 4JQ0D 1KK7Z 2P70A 2QEVA 4JKTA 1D1OA 1DJWA 3D75A 1ZFSA 2ISDA 1AVSA 3OBVA 3SG4A 2JWWA 4YRUA 4DS7A 2KHNA 3O6BA 4CFRA 3D77A 5HL1A 1QASA 5ER5A 1EJ3A 5ER4X 4A4CA 1F70A 1U5IA 5CSIA 1N2DA 2F33A 2ZKMX 4OKHA 4YGEB 4I5NB 4HRGA 1OOHA 4PE1A 1BF5A 2O5GA 2F3ZA 1V1FA 2JNXA 3EK8A 2LV7A 3I5GB 5HKZA 1XVJA 2FOTA 1XFYO 1BLQA 2GV5A 3OP0A 1BU3A 3VGOA 4NDBA 1F4OA 3TUYB 3S0DA 1Y6WA 1PRWA 1YRUB 2R2IA 3DVEA 4YI8A 3V2LA 1ORGA 1XK4C 2LLTA 1A03A 1TNQA 2ZN8A 3D74A 2M7LA 3DVMA 4C0JA 2K2AA 1AJ5A 3BXKA 1UHIA 4QJ3B 1UUSA 1UP5A 2FCEA 1NCZA 4YGBB 5D7FA 1G33A 2OS8B 4I5JA 1U5IB 1KFXL 4IL1A 2LNKA 5CSFA 1JUOA 1PVAA 1SL7A 2SASA 3PN7B 1CM1A 1K96A 3VRRA 5GQQC 1BJFA 5JJGA 4M2OA 2NXQA 1A29A 1E8AA 4QJ5B 2KAYA 2FJYA 3RLZA 3SJSA 5K89A 3SG3A 3CR4X 4DRWA 4CPVA 2LE9B 2I7AA 2BNXA 4AQJA 2G9BA 3PSRA 2VRGA 4WQ2A 1CMGA 4PHKA 1OOGA 5AEQA 1CLBA 2KQYA 1XFVO 1TNWA 1IIOA 3IF7A 3BYAA 1OOFA 3KPXA 3R72A 3S0AA 1IKUA 1R2UA 4BY5A 4C0LA 3LLEA 5CPVA 2CCMA 1NX3A 1JF0A 3I5GC 2KI6C 4C0KA 2PVBA 1SR6B 2KQ6A 1XFUO 4FQOA 3IQQA 1K94A 3GK2A 2LHLA 2WCHA 2L4HA 1XFZO 3GK1A 1AJ4A 2F8PA 3K21A 1CTRA 1IJ6A 3ICBA 3B87A 1C7WA 5FI7A 1TTXA 3BQ3A 4MZJA 1QXPA 2ZN9A 2BE6A 4PE0A 1CNPA 3OX5A 3I5HB 1K9UA 1MXLC 4ORCB 1RECA 2LMTA 1CFCA 2PRUA 1QLKA 3PJIA 2KFFA 3IVTA 2K7CA 3VRPA 1QATA 2ERBA 3D73A 2KBMA 1KQMB 2EGDA 2LAPA 2L5XB 3EKHA 3OGNA 1DVIA 3BJHA 4NQGA 1RROA 3LK1A 4JPZB 1M45A 2GGZA 3EKJA 1IQ5A 4HRHA 2BKIB 2H61A 3WNXB 1A4PA 1CLLA 1OOJA 5AFPA 1FBVA 3CTNA 3DXLA 1EL4A 1QTXA 2KSPA 4GGFC 1X02A 3JVTB 1WLMA 2KFGA 1MF8B 2BL0B 1QLSA 1NP8A 1QIWA 1EH2A 1QV1A 1AHRA 3AKAA 3BOWA 3L47A 1N0YA 3NHIA 2M9GA 3M0WA 5CSNA 3EK4A 3NGVA 1NX2A 2LVVA 5AXIA 1DQEA 2NZ0A 1YX8A 2EC6C 3BUWB 3LCPC 3SG2A 2LANA 2M3WA 1K90D 4M2PA 1H8BA 3UO9A 4TNCA 4ORAB 2MBXA 3GOFA 4U8DA 2KI6D 1SR6C 3I5FB 1UHJA 2LC5A 3PALA 2L98A 3TDZA 2LVKA 1H4BA 2F3YA 2E30A 4XJKA 1KWOB 4PE7A 5EL2A 3JTDB 1SNLA 3NSLA 1F54A 3CZ1A 1S26D 2JT3A 2KI4C 2L4IA 2BECA 2WCMA 2L2EA 2K8MB 1NPQA 1WLZA 2DOQA 1KK8C 1WDCB 2KGBC 1K95A 2WC8A 5I8NA 4R1EA 1L2OC 2H2KA 3BOWB 1KQMC 3EVVA 2M1UA 1QX7A 2L5YA 1CB1A 1JWDA 2BCAA 2PYQA 3NSIA 1CDNA 1L7ZA 1NIWA 1W7JB 1IRJA 2LLUA 2JT0A 1AUIB 1B8RA 1NCXA 1IG5A 1ZUZA 3FWBA 4XJKB 1M63B 5JOLA 3S0BA 1KSOA 1J1EA 2KDHA 1LKJA 1SCVA 2I94A 1VRKA 1NCYA 2GTEA 2JT8A 1YRTB 3KEVA 4N1FA 4N1GA 1MXEA 3S0GA 1TUJA 4CLNA 3DVJA 1M31A 1CKKA 2K61A 3I5IB 2G2BA 1DJZA 1YURA 1YR5A 4WRIA 2K7OA 1A2XA 2MA2A 3LK0A 1OMDA 2H61C 2OTGB 2LVIA 4MSPA 1ALVA 1MHOA 1OQPA 2JPOA 4MRXA 4AOMA 3CZ0A 3R1OA 1LS8A 4DCKA 3JTDC 3MSEB 2YGUA 3NSOA 2KLEA 5IBWA 5PALA 1OMVA 2M49B 1WDCC 1KCYA 1EG4A 2JULA 3CABA 1FW4A 2P6BB 4PCWA 1KQVA 1B47A 2OPOA 1DT7B 1DJXA 2KYCA 3TS5C 5G08A 2WNDA 4ZCVA 4P5OE 2D8NA 1CDLA 3CDNA 1OW4A 1PSRA 2WORA 1LVCD 2BCXA
chains in the Genus database with same CATH topology
1B8LA 5BPJA 1K9PA 5DKRA 3FIAA 2L51A 4E68A 3CS1A 5HLVA 5J3XA 1JFKA 1JC2A 1S6JA 1SMGA 2EHBA 3GK4X 3BUXB 4MZKA 1F8HA 3QRXA 1SL9A 3F45A 1K93D 1IWQA 3NXAA 4HREE 1B1GA 2KBIA 1XFXO 3SIBA 1ALWA 5I2LA 3TUYC 1DF0A 3I5IC 4MVFA 2CBLA 4OV2A 1TIZA 3O78A 2PSRA 1RWYA 3WHUB 4JWQA 1UWOA 1PVBA 1Y0VH 3ZWHA 3CR5X 5HKWA 3DF0B 3EVUA 1DTLA 4GGNA 2WCBA 1CM4A 3E3RA 2A4JA 2OS8C 1UHNA 2AMIA 1BR4B 3FWCA 3C1VA 5D69A 4PHMA 1GJYA 1K9KA 1YVHA 1F4QA 2JQ6A 2Y1NA 3DF0A 3PN7C 3WXAA 5I2OA 2O60A 1KFUL 3EK7A 1B8CA 1GGZA 3HX4A 4PHJA 1CDMA 1YX7A 1CDPA 1XA5A 1DF0B 1G8IA 1B9AA 2V53A 1MR8A 3AKBA 1DMOA 2PMYA 1KFUS 1SCMB 2ZNEA 3OB1B 1NUBA 1A03A 2F2PA 1OZOA 2M0RA 2JXLA 4P2YB 1B4CA 2CXJA 1Y1XA 4MLWA 1DJYA 1ZMZA 1NSHA 2MHHA 3PLFB 2BKHB 3SG7A 1XK4A 1SBJA 2LM5A 1OMRA 1DGVA 1PULA 1Y1UA 1TCOB 1W7IB 4GFTA 4L9MA 4A4BA 5DKNA 4DIRA 3H4SE 1JF2A 1BOCA 2JZIA 1WRKA 4ORBB 5F6TA 2KOTA 1OSAA 2L0PA 1V1GA 3TZ1A 1RJVA 1SL8A 2ZRTA 1AK8A 1CFFA 3I5HC 1C07A 2Y5IA 4MRYA 2FCDA 1WY9A 1M46A 2Y1MA 5KTYA 3VRNA 2M97A 4MEWA 4QJ4B 2KGRA 2IS9A 1A75A 1J55A 4OR9B 2CT9A 1F71A 1SRAA 1S6CA 1MWNA 5HKYA 1N65A 1B7TY 1RFJA 5AANA 4UPGA 2BE4A 1Y1AA 1RK9A 3TDIA 1C7VA 5HYDA 2QPTA 3JVTC 1BODA 2ZFDA 2E6WA 1CLMA 1QJTA 2BL0C 4I5LB 1SCMC 2M1KB 3FS7A 1S36A 2K7BA 1ZOTB 2JPTA 4Q04A 4NDDA 1TN4A 3DD4A 1QX5B 4NDCA 4USLA 1Q80A 2JOJA 3D0YA 5FYXA 1KSMA 1IJ5A 3VRQA 2NCPA 3SIAA 2I2RE 1FPWA 1TNPA 1A75B 1PSBA 4D1EA 1J7OA 3I5FC 2ZRSA 2COLB 1G4YR 2KFHA 3O2PA 1FI5A 1JBAA 1YTZC 4I5KA 1NYAA 1NX0A 2LP2A 3AAKA 1YUTA 3BUMB 2K0JA 3BUNB 1KWOC 2KYFA 1TNXA 1DJHA 2Q4UA 4F0ZB 1LXFC 2FJUB 1TRFA 3VROA 1TCFA 1WRZA 4CIDA 1SKTA 3CLNA 5AERA 2L50A 3O4YA 2MAZA 1IH0A 2LUCA 2KAXA 3SG5A 1IQ3A 3BUOB 1GQMA 1DJGA 1M39A 4GGFA 1PK0D 3KHEA 3D0YB 1S3PA 3A4UB 1K2HA 1AP4A 1QIVA 1QX2A 1DJIA 5KSZA 3PM8A 3SG6A 1FI6A 2NCOA 4ETOA 3LL8B 4GAOA 2PASA 2JNFA 1FF1A 2LUXA 3EVRA 3OB2B 3WHTB 5B8IB 2HETA 2KNEA 2WCEA 3A8RA 1NX1A 2WCFA 1XO5A 1KFXS 1ODBA 3AAJA 4OCIA 2JRFA 2JTTA 2M7NA 1UHKA 3HCMA 1SPYA 4M2QA 1J7QA 2M8UA 2HPSA 1YUUA 1B7TZ 4HSZA 1XYDA 1CFDA 1EG3A 1LA3A 2OTGC 3CWGA 1BG1A 4AQIA 1S5GY 2RGIA 2MRDA 2HF5A 2LCPA 2EC6B 2Q91A 1J7PA 3CGAA 4YBHB 5HLOA 1QV0A 1DGUA 1YVLA 2QACA 4CFQA 1QVIY 2M29A 1KK7Y 4ZCUA 1HT9A 1LINA 4WQ3A 4PDZA 1JFJA 4FTGA 2JU0A 2B1UA 4GBAA 1BMOA 2WOSA 2LMVA 4PALA 2LP3A 2MLFC 1LA0A 2MLEC 2CTNA 2SCPA 2F2OA 2KI4B 2LMUA 1F55A 4MN0A 2KAVA 1KK8B 1K8UA 1CMFA 1J7RA 1L2OB 3PFVA 1UURA 1S1EA 4OVNF 2AUCA 3CZTX 4YGCB 4MZLA 3KO0A 4DUQA 2ZNDA 1RTP1 1OZSA 1SY9A 1BR1B 5CSJA 2NLNA 4GUKA 1BT6A 1IGVA 1R6PA 3OHMB 4XYNA 1CFPA 1EXRA 5KU1A 3D10A 2K7DA 2LHIA 4YGAA 2CNPA 2GGMA 2HQWA 4YGDB 4ICBA 2LVJA 2Y4QA 1SYMA 1HQVA 2LLSA 3DVKA 2TN4A 5TNCA 2MJWB 4PHNA 3PATA 1UHHA 4YI9A 2I18A 2BBMA 2BBNA 1NWDA 4MBEA 1OE9B 1QS7A 1GGWA 5I2QA 4GNKB 1TOPA 3RM1A 5DKQA 3CR2A 1WRLA 3KF9A 2PALA 4GPLB 2BCBA 2K2FA 3IQOA 3OX6A 3NSKA 1MUXA 1S6IA 1YUSA 2JTZA 4PE4A 4BY4A 1S5GZ 3ZNIA 1SK6D 1PALA 3TDUA 2AAOA 4N5XA 1MQ1A 2JC2A 1ZACA 1SW8A 1XFWO 2HQ8A 1JSAA 3TS5B 1QVIZ 1J1DA 2JXCA 4JQ0D 1KK7Z 1D1OA 1DJWA 1ZFSA 2ISDA 1AVSA 3SG4A 4YRUA 2JWWA 4DS7A 2KHNA 3O6BA 4CFRA 1QASA 5ER5A 1EJ3A 5ER4X 4A4CA 1F70A 1U5IA 5CSIA 1N2DA 2F33A 2ZKMX 4OKHA 4YGEB 4I5NB 4HRGA 4PE1A 1BF5A 2O5GA 2F3ZA 1V1FA 2JNXA 3EK8A 2LV7A 3I5GB 5HKZA 1XVJA 2FOTA 1XFYO 1BLQA 2GV5A 3OP0A 1BU3A 3VGOA 4NDBA 1F4OA 3TUYB 1Y6WA 1PRWA 1YRUB 2R2IA 3DVEA 4YI8A 1XK4C 2LLTA 1TNQA 2ZN8A 2M7LA 3DVMA 4C0JA 2K2AA 1AJ5A 3BXKA 1UHIA 4QJ3B 1UUSA 1UP5A 2FCEA 1NCZA 4YGBB 5D7FA 1G33A 2OS8B 4I5JA 1U5IB 1KFXL 4IL1A 2LNKA 5CSFA 1JUOA 1PVAA 1SL7A 2SASA 3PN7B 1CM1A 1K96A 3VRRA 5GQQC 1BJFA 5JJGA 4M2OA 2NXQA 1A29A 1E8AA 4QJ5B 2KAYA 3SJSA 3RLZA 5K89A 3SG3A 3CR4X 4DRWA 4CPVA 2LE9B 2I7AA 4AQJA 2G9BA 3PSRA 2VRGA 4WQ2A 1CMGA 4PHKA 5AEQA 1CLBA 2KQYA 1XFVO 1TNWA 3IF7A 3BYAA 3KPXA 1IKUA 1R2UA 4BY5A 4C0LA 3LLEA 5CPVA 2CCMA 1NX3A 1JF0A 3I5GC 2KI6C 4C0KA 2PVBA 1SR6B 2KQ6A 1XFUO 4FQOA 3IQQA 1K94A 3GK2A 2LHLA 2L4HA 1XFZO 3GK1A 1AJ4A 2F8PA 3K21A 1CTRA 1IJ6A 3ICBA 1C7WA 1TTXA 3BQ3A 4MZJA 1QXPA 2ZN9A 2BE6A 4PE0A 1CNPA 3OX5A 3I5HB 1K9UA 1MXLC 4ORCB 1RECA 2LMTA 1CFCA 2PRUA 1QLKA 2KFFA 2K7CA 3VRPA 1QATA 2KBMA 1KQMB 2EGDA 2LAPA 2L5XB 3EKHA 1DVIA 4NQGA 1RROA 3LK1A 4JPZB 1M45A 2GGZA 3EKJA 1IQ5A 4HRHA 2BKIB 2H61A 3WNXB 1A4PA 1CLLA 1OOJA 5AFPA 1FBVA 3CTNA 1EL4A 1QTXA 2KSPA 4GGFC 1X02A 3JVTB 1WLMA 2KFGA 1MF8B 2BL0B 1QLSA 1NP8A 1QIWA 1EH2A 1QV1A 1AHRA 3AKAA 3BOWA 1N0YA 2M9GA 3M0WA 5CSNA 3EK4A 1NX2A 2LVVA 5AXIA 3BUWB 2NZ0A 1YX8A 2EC6C 3LCPC 3SG2A 2LANA 2M3WA 1K90D 4M2PA 1H8BA 4TNCA 4ORAB 2MBXA 3GOFA 4U8DA 2KI6D 1SR6C 3I5FB 1UHJA 2LC5A 3PALA 2L98A 3TDZA 2LVKA 1H4BA 2F3YA 2E30A 4XJKA 1KWOB 4PE7A 3JTDB 1SNLA 3NSLA 1F54A 1S26D 2JT3A 2KI4C 2L4IA 2BECA 2L2EA 2K8MB 1NPQA 1WLZA 2DOQA 1KK8C 1WDCB 2KGBC 1K95A 2WC8A 5I8NA 4R1EA 1L2OC 2H2KA 3BOWB 1KQMC 3EVVA 2M1UA 1QX7A 1CB1A 1JWDA 2BCAA 3NSIA 1CDNA 1L7ZA 1NIWA 1W7JB 1IRJA 2LLUA 2JT0A 1AUIB 1B8RA 1NCXA 1IG5A 1ZUZA 3FWBA 4XJKB 1M63B 5JOLA 1KSOA 1J1EA 2KDHA 1LKJA 1SCVA 2I94A 1VRKA 1NCYA 2JT8A 3KEVA 1YRTB 4N1FA 4CLNA 4N1GA 1MXEA 3DVJA 1M31A 1CKKA 2K61A 3I5IB 2G2BA 1DJZA 1YURA 1YR5A 4WRIA 2K7OA 1A2XA 2MA2A 3LK0A 1OMDA 2H61C 2OTGB 2LVIA 4MSPA 1ALVA 1MHOA 1OQPA 4MRXA 4AOMA 4DCKA 3JTDC 3MSEB 3NSOA 5IBWA 5PALA 1OMVA 2M49B 1WDCC 1KCYA 1EG4A 2JULA 1FW4A 2P6BB 4PCWA 1KQVA 1B47A 2OPOA 1DT7B 1DJXA 2KYCA 3TS5C 5G08A 2WNDA 4ZCVA 4P5OE 2D8NA 1CDLA 1PSRA 2WORA 1LVCD 2BCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8L A;  5BPJ A;  1K9P A;  5DKR A;  3FIA A;  2L51 A;  4E68 A;  3CS1 A;  5HLV A;  5J3X A;  1JFK A;  1JC2 A;  1S6J A;  1SMG A;  2EHB A;  3GK4 X;  3BUX B;  4MZK A;  1F8H A;  3QRX A;  1SL9 A;  3F45 A;  1K93 D;  1IWQ A;  3NXA A;  4HRE E;  1B1G A;  2KBI A;  1XFX O;  3SIB A;  1ALW A;  5I2L A;  3TUY C;  1DF0 A;  3I5I C;  4MVF A;  2CBL A;  4OV2 A;  1TIZ A;  3O78 A;  2PSR A;  1RWY A;  3WHU B;  4JWQ A;  1UWO A;  1PVB A;  1Y0V H;  3ZWH A;  3CR5 X;  5HKW A;  3DF0 B;  3EVU A;  1DTL A;  4GGN A;  2WCB A;  1CM4 A;  3E3R A;  2A4J A;  2OS8 C;  1UHN A;  2AMI A;  1BR4 B;  3FWC A;  3C1V A;  5D69 A;  4PHM A;  1GJY A;  1K9K A;  1YVH A;  1F4Q A;  2JQ6 A;  2Y1N A;  3DF0 A;  3PN7 C;  3WXA A;  5I2O A;  2O60 A;  1KFU L;  3EK7 A;  1B8C A;  1GGZ A;  3HX4 A;  4PHJ A;  1CDM A;  1YX7 A;  1CDP A;  1XA5 A;  1DF0 B;  1G8I A;  1B9A A;  2V53 A;  1MR8 A;  3AKB A;  1DMO A;  2PMY A;  1KFU S;  1SCM B;  2ZNE A;  3OB1 B;  1NUB A;  1A03 A;  2F2P A;  1OZO A;  2M0R A;  2JXL A;  4P2Y B;  1B4C A;  2CXJ A;  1Y1X A;  4MLW A;  1DJY A;  1ZMZ A;  1NSH A;  2MHH A;  3PLF B;  2BKH B;  3SG7 A;  1XK4 A;  1SBJ A;  2LM5 A;  1OMR A;  1DGV A;  1PUL A;  1Y1U A;  1TCO B;  1W7I B;  4GFT A;  4L9M A;  4A4B A;  5DKN A;  4DIR A;  3H4S E;  1JF2 A;  1BOC A;  2JZI A;  1WRK A;  4ORB B;  5F6T A;  2KOT A;  1OSA A;  2L0P A;  1V1G A;  3TZ1 A;  1RJV A;  1SL8 A;  2ZRT A;  1AK8 A;  1CFF A;  3I5H C;  1C07 A;  2Y5I A;  4MRY A;  2FCD A;  1WY9 A;  1M46 A;  2Y1M A;  5KTY A;  3VRN A;  2M97 A;  4MEW A;  4QJ4 B;  2KGR A;  2IS9 A;  1A75 A;  1J55 A;  4OR9 B;  2CT9 A;  1F71 A;  1SRA A;  1S6C A;  1MWN A;  5HKY A;  1N65 A;  1B7T Y;  1RFJ A;  5AAN A;  4UPG A;  2BE4 A;  1Y1A A;  1RK9 A;  3TDI A;  1C7V A;  5HYD A;  2QPT A;  3JVT C;  1BOD A;  2ZFD A;  2E6W A;  1CLM A;  1QJT A;  2BL0 C;  4I5L B;  1SCM C;  2M1K B;  3FS7 A;  1S36 A;  2K7B A;  1ZOT B;  2JPT A;  4Q04 A;  4NDD A;  1TN4 A;  3DD4 A;  1QX5 B;  4NDC A;  4USL A;  1Q80 A;  2JOJ A;  3D0Y A;  5FYX A;  1KSM A;  1IJ5 A;  3VRQ A;  2NCP A;  3SIA A;  2I2R E;  1FPW A;  1TNP A;  1A75 B;  1PSB A;  4D1E A;  1J7O A;  3I5F C;  2ZRS A;  2COL B;  1G4Y R;  2KFH A;  3O2P A;  1FI5 A;  1JBA A;  1YTZ C;  4I5K A;  1NYA A;  1NX0 A;  2LP2 A;  3AAK A;  1YUT A;  3BUM B;  2K0J A;  3BUN B;  1KWO C;  2KYF A;  1TNX A;  1DJH A;  2Q4U A;  4F0Z B;  1LXF C;  2FJU B;  1TRF A;  3VRO A;  1TCF A;  1WRZ A;  4CID A;  1SKT A;  3CLN A;  5AER A;  2L50 A;  3O4Y A;  2MAZ A;  1IH0 A;  2LUC A;  2KAX A;  3SG5 A;  1IQ3 A;  3BUO B;  1GQM A;  1DJG A;  1M39 A;  4GGF A;  1PK0 D;  3KHE A;  3D0Y B;  1S3P A;  3A4U B;  1K2H A;  1AP4 A;  1QIV A;  1QX2 A;  1DJI A;  5KSZ A;  3PM8 A;  3SG6 A;  1FI6 A;  2NCO A;  4ETO A;  3LL8 B;  4GAO A;  2PAS A;  2JNF A;  1FF1 A;  2LUX A;  3EVR A;  3OB2 B;  3WHT B;  5B8I B;  2HET A;  2KNE A;  2WCE A;  3A8R A;  1NX1 A;  2WCF A;  1XO5 A;  1KFX S;  1ODB A;  3AAJ A;  4OCI A;  2JRF A;  2JTT A;  2M7N A;  1UHK A;  3HCM A;  1SPY A;  4M2Q A;  1J7Q A;  2M8U A;  2HPS A;  1YUU A;  1B7T Z;  4HSZ A;  1XYD A;  1CFD A;  1EG3 A;  1LA3 A;  2OTG C;  3CWG A;  1BG1 A;  4AQI A;  1S5G Y;  2RGI A;  2MRD A;  2HF5 A;  2LCP A;  2EC6 B;  2Q91 A;  1J7P A;  3CGA A;  4YBH B;  5HLO A;  1QV0 A;  1DGU A;  1YVL A;  2QAC A;  4CFQ A;  1QVI Y;  2M29 A;  1KK7 Y;  4ZCU A;  1HT9 A;  1LIN A;  4WQ3 A;  4PDZ A;  1JFJ A;  4FTG A;  2JU0 A;  2B1U A;  4GBA A;  1BMO A;  2WOS A;  2LMV A;  4PAL A;  2LP3 A;  2MLF C;  1LA0 A;  2MLE C;  2CTN A;  2SCP A;  2F2O A;  2KI4 B;  2LMU A;  1F55 A;  4MN0 A;  2KAV A;  1KK8 B;  1K8U A;  1CMF A;  1J7R A;  1L2O B;  3PFV A;  1UUR A;  1S1E A;  4OVN F;  2AUC A;  3CZT X;  4YGC B;  4MZL A;  3KO0 A;  4DUQ A;  2ZND A;  1RTP 1;  1OZS A;  1SY9 A;  1BR1 B;  5CSJ A;  2NLN A;  4GUK A;  1BT6 A;  1IGV A;  1R6P A;  3OHM B;  4XYN A;  1CFP A;  1EXR A;  5KU1 A;  3D10 A;  2K7D A;  2LHI A;  4YGA A;  2CNP A;  2GGM A;  2HQW A;  4YGD B;  4ICB A;  2LVJ A;  2Y4Q A;  1SYM A;  1HQV A;  2LLS A;  3DVK A;  2TN4 A;  5TNC A;  2MJW B;  4PHN A;  3PAT A;  1UHH A;  4YI9 A;  2I18 A;  2BBM A;  2BBN A;  1NWD A;  4MBE A;  1OE9 B;  1QS7 A;  1GGW A;  5I2Q A;  4GNK B;  1TOP A;  3RM1 A;  5DKQ A;  3CR2 A;  1WRL A;  3KF9 A;  2PAL A;  4GPL B;  2BCB A;  2K2F A;  3IQO A;  3OX6 A;  3NSK A;  1MUX A;  1S6I A;  1YUS A;  2JTZ A;  4PE4 A;  4BY4 A;  1S5G Z;  3ZNI A;  1SK6 D;  1PAL A;  3TDU A;  2AAO A;  4N5X A;  1MQ1 A;  2JC2 A;  1ZAC A;  1SW8 A;  1XFW O;  2HQ8 A;  1JSA A;  3TS5 B;  1QVI Z;  1J1D A;  2JXC A;  4JQ0 D;  1KK7 Z;  1D1O A;  1DJW A;  1ZFS A;  2ISD A;  1AVS A;  3SG4 A;  4YRU A;  2JWW A;  4DS7 A;  2KHN A;  3O6B A;  4CFR A;  1QAS A;  5ER5 A;  1EJ3 A;  5ER4 X;  4A4C A;  1F70 A;  1U5I A;  5CSI A;  1N2D A;  2F33 A;  2ZKM X;  4OKH A;  4YGE B;  4I5N B;  4HRG A;  4PE1 A;  1BF5 A;  2O5G A;  2F3Z A;  1V1F A;  2JNX A;  3EK8 A;  2LV7 A;  3I5G B;  5HKZ A;  1XVJ A;  2FOT A;  1XFY O;  1BLQ A;  2GV5 A;  3OP0 A;  1BU3 A;  3VGO A;  4NDB A;  1F4O A;  3TUY B;  1Y6W A;  1PRW A;  1YRU B;  2R2I A;  3DVE A;  4YI8 A;  1XK4 C;  2LLT A;  1TNQ A;  2ZN8 A;  2M7L A;  3DVM A;  4C0J A;  2K2A A;  1AJ5 A;  3BXK A;  1UHI A;  4QJ3 B;  1UUS A;  1UP5 A;  2FCE A;  1NCZ A;  4YGB B;  5D7F A;  1G33 A;  2OS8 B;  4I5J A;  1U5I B;  1KFX L;  4IL1 A;  2LNK A;  5CSF A;  1JUO A;  1PVA A;  1SL7 A;  2SAS A;  3PN7 B;  1CM1 A;  1K96 A;  3VRR A;  5GQQ C;  1BJF A;  5JJG A;  4M2O A;  2NXQ A;  1A29 A;  1E8A A;  4QJ5 B;  2KAY A;  3SJS A;  3RLZ A;  5K89 A;  3SG3 A;  3CR4 X;  4DRW A;  4CPV A;  2LE9 B;  2I7A A;  4AQJ A;  2G9B A;  3PSR A;  2VRG A;  4WQ2 A;  1CMG A;  4PHK A;  5AEQ A;  1CLB A;  2KQY A;  1XFV O;  1TNW A;  3IF7 A;  3BYA A;  3KPX A;  1IKU A;  1R2U A;  4BY5 A;  4C0L A;  3LLE A;  5CPV A;  2CCM A;  1NX3 A;  1JF0 A;  3I5G C;  2KI6 C;  4C0K A;  2PVB A;  1SR6 B;  2KQ6 A;  1XFU O;  4FQO A;  3IQQ A;  1K94 A;  3GK2 A;  2LHL A;  2L4H A;  1XFZ O;  3GK1 A;  1AJ4 A;  2F8P A;  3K21 A;  1CTR A;  1IJ6 A;  3ICB A;  1C7W A;  1TTX A;  3BQ3 A;  4MZJ A;  1QXP A;  2ZN9 A;  2BE6 A;  4PE0 A;  1CNP A;  3OX5 A;  3I5H B;  1K9U A;  1MXL C;  4ORC B;  1REC A;  2LMT A;  1CFC A;  2PRU A;  1QLK A;  2KFF A;  2K7C A;  3VRP A;  1QAT A;  2KBM A;  1KQM B;  2EGD A;  2LAP A;  2L5X B;  3EKH A;  1DVI A;  4NQG A;  1RRO A;  3LK1 A;  4JPZ B;  1M45 A;  2GGZ A;  3EKJ A;  1IQ5 A;  4HRH A;  2BKI B;  2H61 A;  3WNX B;  1A4P A;  1CLL A;  1OOJ A;  5AFP A;  1FBV A;  3CTN A;  1EL4 A;  1QTX A;  2KSP A;  4GGF C;  1X02 A;  3JVT B;  1WLM A;  2KFG A;  1MF8 B;  2BL0 B;  1QLS A;  1NP8 A;  1QIW A;  1EH2 A;  1QV1 A;  1AHR A;  3AKA A;  3BOW A;  1N0Y A;  2M9G A;  3M0W A;  5CSN A;  3EK4 A;  1NX2 A;  2LVV A;  5AXI A;  3BUW B;  2NZ0 A;  1YX8 A;  2EC6 C;  3LCP C;  3SG2 A;  2LAN A;  2M3W A;  1K90 D;  4M2P A;  1H8B A;  4TNC A;  4ORA B;  2MBX A;  3GOF A;  4U8D A;  2KI6 D;  1SR6 C;  3I5F B;  1UHJ A;  2LC5 A;  3PAL A;  2L98 A;  3TDZ A;  2LVK A;  1H4B A;  2F3Y A;  2E30 A;  4XJK A;  1KWO B;  4PE7 A;  3JTD B;  1SNL A;  3NSL A;  1F54 A;  1S26 D;  2JT3 A;  2KI4 C;  2L4I A;  2BEC A;  2L2E A;  2K8M B;  1NPQ A;  1WLZ A;  2DOQ A;  1KK8 C;  1WDC B;  2KGB C;  1K95 A;  2WC8 A;  5I8N A;  4R1E A;  1L2O C;  2H2K A;  3BOW B;  1KQM C;  3EVV A;  2M1U A;  1QX7 A;  1CB1 A;  1JWD A;  2BCA A;  3NSI A;  1CDN A;  1L7Z A;  1NIW A;  1W7J B;  1IRJ A;  2LLU A;  2JT0 A;  1AUI B;  1B8R A;  1NCX A;  1IG5 A;  1ZUZ A;  3FWB A;  4XJK B;  1M63 B;  5JOL A;  1KSO A;  1J1E A;  2KDH A;  1LKJ A;  1SCV A;  2I94 A;  1VRK A;  1NCY A;  2JT8 A;  3KEV A;  1YRT B;  4N1F A;  4CLN A;  4N1G A;  1MXE A;  3DVJ A;  1M31 A;  1CKK A;  2K61 A;  3I5I B;  2G2B A;  1DJZ A;  1YUR A;  1YR5 A;  4WRI A;  2K7O A;  1A2X A;  2MA2 A;  3LK0 A;  1OMD A;  2H61 C;  2OTG B;  2LVI A;  4MSP A;  1ALV A;  1MHO A;  1OQP A;  4MRX A;  4AOM A;  4DCK A;  3JTD C;  3MSE B;  3NSO A;  5IBW A;  5PAL A;  1OMV A;  2M49 B;  1WDC C;  1KCY A;  1EG4 A;  2JUL A;  1FW4 A;  2P6B B;  4PCW A;  1KQV A;  1B47 A;  2OPO A;  1DT7 B;  1DJX A;  2KYC A;  3TS5 C;  5G08 A;  2WND A;  4ZCV A;  4P5O E;  2D8N A;  1CDL A;  1PSR A;  2WOR A;  1LVC D;  2BCX A; 
#chains in the Genus database with same CATH topology
 1B8L A;  5BPJ A;  1K9P A;  5DKR A;  3FIA A;  2L51 A;  4E68 A;  3CS1 A;  5HLV A;  5J3X A;  1JFK A;  1JC2 A;  1S6J A;  1SMG A;  2EHB A;  3GK4 X;  3BUX B;  4MZK A;  1F8H A;  3QRX A;  1SL9 A;  3F45 A;  1K93 D;  1IWQ A;  3NXA A;  4HRE E;  1B1G A;  2KBI A;  1XFX O;  3SIB A;  1ALW A;  5I2L A;  3TUY C;  3R1P A;  1DF0 A;  3I5I C;  4MVF A;  2CBL A;  4OV2 A;  1TIZ A;  3O78 A;  2PSR A;  1RWY A;  3WHU B;  3DYE A;  1UWO A;  4JWQ A;  1PVB A;  1Y0V H;  3ZWH A;  4F7F A;  3CR5 X;  5HKW A;  3DF0 B;  3EVU A;  1DTL A;  4GGN A;  2WCB A;  1CM4 A;  3E3R A;  3S0F A;  2A4J A;  2OS8 C;  1UHN A;  5D3O A;  2AMI A;  3QME A;  1BR4 B;  3FWC A;  3C1V A;  5D69 A;  4PHM A;  1GJY A;  1K9K A;  1YVH A;  1F4Q A;  2JQ6 A;  2Y1N A;  3DF0 A;  3K1E A;  3PN7 C;  5DIC A;  3WXA A;  4INW A;  3B86 A;  2O60 A;  1KFU L;  3EK7 A;  1DEK A;  1B8C A;  1GGZ A;  2WC5 A;  3HX4 A;  4PHJ A;  1CDM A;  1YX7 A;  1CDP A;  1XA5 A;  1DF0 B;  1G8I A;  1B9A A;  2V53 A;  1MR8 A;  3AKB A;  2H8V A;  1DMO A;  2PMY A;  1KFU S;  1SCM B;  2ZNE A;  3D76 A;  3L4A A;  3D78 A;  3OB1 B;  1NUB A;  3VB1 A;  2F2P A;  1OZO A;  2M0R A;  2JXL A;  2PQL A;  4P2Y B;  2CXJ A;  1Y1X A;  4MLW A;  1B4C A;  1DJY A;  1ZMZ A;  1NSH A;  2MHH A;  3PLF B;  2BKH B;  3SG7 A;  1XK4 A;  1SBJ A;  2LM5 A;  1OMR A;  1DGV A;  1PUL A;  1Y1U A;  1TCO B;  1W7I B;  4GFT A;  4L9M A;  4A4B A;  1SSE B;  5DKN A;  3H4S E;  4DIR A;  1JF2 A;  1BOC A;  2JZI A;  1WRK A;  4ORB B;  5F6T A;  2KOT A;  1OSA A;  2BAP A;  2L0P A;  1V1G A;  3TZ1 A;  1RJV A;  1SL8 A;  2ZRT A;  5FI6 A;  1AK8 A;  3I5H C;  1CFF A;  3DY9 A;  1C07 A;  2Y5I A;  4MRY A;  2FCD A;  1WY9 A;  1M46 A;  2Y1M A;  5KTY A;  3VRN A;  2M97 A;  4MEW A;  4QJ4 B;  1TWO A;  2IS9 A;  2KGR A;  3BFB A;  1A75 A;  4KYN A;  1J55 A;  4OR9 B;  2CT9 A;  1F71 A;  1SRA A;  1S6C A;  1P28 A;  1MWN A;  5HKY A;  1N65 A;  1B7T Y;  1RFJ A;  5AAN A;  2P71 A;  4UPG A;  2BE4 A;  1Y1A A;  4IJ7 A;  1RK9 A;  2WCK A;  3RZS A;  3TDI A;  1C7V A;  5HYD A;  2QPT A;  3JVT C;  1BOD A;  2ZFD A;  2E6W A;  1CLM A;  3SS5 A;  1QJT A;  2BL0 C;  4I5L B;  1SCM C;  2M1K B;  3FS7 A;  1S36 A;  2K7B A;  1ZOT B;  2JPT A;  4Q04 A;  5I2O A;  4NDD A;  1TN4 A;  3B88 A;  3DD4 A;  1QX5 B;  4NDC A;  4USL A;  1Q80 A;  2JOJ A;  3D0Y A;  3Q8I A;  1KSM A;  1IJ5 A;  5FYX A;  3VRQ A;  2NCP A;  3SIA A;  2I2R E;  1FPW A;  1TNP A;  1T14 A;  1A75 B;  1PSB A;  4D1E A;  1J7O A;  3I5F C;  2ZRS A;  2COL B;  1G4Y R;  2KFH A;  3O2P A;  1FI5 A;  1JBA A;  1YTZ C;  4I5K A;  1NYA A;  1NX0 A;  2LP2 A;  3AAK A;  1YUT A;  3BUM B;  2K0J A;  3BUN B;  1KWO C;  2KYF A;  1TNX A;  1DJH A;  2Q4U A;  4F0Z B;  1LXF C;  2FJU B;  1TRF A;  3VRO A;  4OZD A;  1TCF A;  1WRZ A;  4CID A;  1SKT A;  1OOI X;  3CLN A;  5AER A;  2L50 A;  3O4Y A;  2MAZ A;  1IH0 A;  4FQT A;  2LUC A;  2KAX A;  3SG5 A;  1IQ3 A;  3BUO B;  1GQM A;  1DJG A;  1M39 A;  4GGF A;  1PK0 D;  2KPH A;  3KHE A;  3D0Y B;  1S3P A;  3A4U B;  5FI2 A;  1K2H A;  1AP4 A;  1QIV A;  1QX2 A;  3B7A A;  1DJI A;  3UNW A;  3PM8 A;  3SG6 A;  5KSZ A;  1FI6 A;  2L2C A;  2NCO A;  4ETO A;  2WC6 A;  3LL8 B;  4GAO A;  2PAS A;  2JNF A;  1FF1 A;  2K60 A;  2LUX A;  3EVR A;  3OB2 B;  3WHT B;  4PT1 A;  5B8I B;  2HET A;  2KNE A;  2WCE A;  3A8R A;  1NX1 A;  1C3Z A;  2WCF A;  1XO5 A;  1KFX S;  1ODB A;  3AAJ A;  4OCI A;  2JRF A;  2JTT A;  2M7N A;  1UHK A;  3HCM A;  3SS4 A;  1SPY A;  4M2Q A;  1J7Q A;  2M8U A;  2HPS A;  1YUU A;  1B7T Z;  3FE6 A;  3BFH A;  3BFA A;  4HSZ A;  1XYD A;  1CFD A;  1EG3 A;  1LA3 A;  1XFR A;  2OTG C;  2QEH A;  3CWG A;  1BG1 A;  4AQI A;  1S5G Y;  2RGI A;  2MRD A;  1DEL A;  2HF5 A;  2KLD A;  2LCP A;  2EC6 B;  2Q91 A;  1J7P A;  1Z4H A;  3CGA A;  4YBH B;  5HLO A;  1QV0 A;  1DGU A;  1YVL A;  2QAC A;  4CFQ A;  1QVI Y;  2M29 A;  1DC1 A;  1KK7 Y;  4ZCU A;  1HT9 A;  1LIN A;  4WQ3 A;  5I94 A;  4PDZ A;  1QWV A;  3CZ2 A;  3N7H A;  1JFJ A;  4FTG A;  2JU0 A;  2B1U A;  4GBA A;  1BMO A;  2WOS A;  2LMV A;  4PAL A;  2LP3 A;  2MLF C;  1LA0 A;  3PM2 A;  2MLE C;  2CTN A;  2SCP A;  3FE8 A;  2F2O A;  2KI4 B;  1TUZ A;  2LMU A;  1F55 A;  4MN0 A;  2KAV A;  1KK8 B;  1K8U A;  1CMF A;  1J7R A;  1L2O B;  3PFV A;  1UUR A;  4INX A;  1S1E A;  4OVN F;  2AUC A;  4JD9 A;  3CZT X;  4YGC B;  4MZL A;  3KO0 A;  2QEB A;  4DUQ A;  2ZND A;  3NHT A;  1RTP 1;  3SS3 A;  1OZS A;  1SY9 A;  1BR1 B;  5CSJ A;  2NLN A;  4GUK A;  1BT6 A;  1IGV A;  1R6P A;  3OHM B;  4XYN A;  1CFP A;  1EXR A;  5KU1 A;  3D10 A;  2K7D A;  2LHI A;  2WCL A;  3FE9 A;  4YGA A;  2CNP A;  2GGM A;  2HQW A;  4YGD B;  4ICB A;  2LVJ A;  2Y4Q A;  1SYM A;  1HQV A;  2LLS A;  3DVK A;  2TN4 A;  1Z2C B;  5TNC A;  1GM0 A;  2MJW B;  3B6X A;  4PHN A;  3CYZ A;  3PAT A;  3S0E A;  1UHH A;  2WCJ A;  2QDI A;  4YI9 A;  2I18 A;  2BBM A;  2BBN A;  1NWD A;  4MBE A;  1OE9 B;  2QEO A;  1QS7 A;  1GGW A;  5I2Q A;  4GNK B;  3DZT A;  1TOP A;  1W9Z A;  3RM1 A;  5DKQ A;  3CR2 A;  1WRL A;  3KF9 A;  1C3Y A;  2PAL A;  4GPL B;  2BCB A;  2K2F A;  3IQO A;  3OX6 A;  3NSK A;  1MUX A;  1S6I A;  1YUS A;  2JTZ A;  3R1V A;  4PE4 A;  4BY4 A;  3EG5 B;  1S5G Z;  3ZNI A;  1SK6 D;  1PAL A;  3L4L A;  3TDU A;  2AAO A;  4N5X A;  1MQ1 A;  2JC2 A;  1ZAC A;  1SW8 A;  1XFW O;  2HQ8 A;  1JSA A;  3O4X A;  3TS5 B;  1QVI Z;  1J1D A;  2JXC A;  4JQ0 D;  1KK7 Z;  2P70 A;  2QEV A;  4JKT A;  1D1O A;  1DJW A;  3D75 A;  1ZFS A;  2ISD A;  1AVS A;  3OBV A;  3SG4 A;  2JWW A;  4YRU A;  4DS7 A;  2KHN A;  3O6B A;  4CFR A;  3D77 A;  5HL1 A;  1QAS A;  5ER5 A;  1EJ3 A;  5ER4 X;  4A4C A;  1F70 A;  1U5I A;  5CSI A;  1N2D A;  2F33 A;  2ZKM X;  4OKH A;  4YGE B;  4I5N B;  4HRG A;  1OOH A;  4PE1 A;  1BF5 A;  2O5G A;  2F3Z A;  1V1F A;  2JNX A;  3EK8 A;  2LV7 A;  3I5G B;  5HKZ A;  1XVJ A;  2FOT A;  1XFY O;  1BLQ A;  2GV5 A;  3OP0 A;  1BU3 A;  3VGO A;  4NDB A;  1F4O A;  3TUY B;  3S0D A;  1Y6W A;  1PRW A;  1YRU B;  2R2I A;  3DVE A;  4YI8 A;  3V2L A;  1ORG A;  1XK4 C;  2LLT A;  1A03 A;  1TNQ A;  2ZN8 A;  3D74 A;  2M7L A;  3DVM A;  4C0J A;  2K2A A;  1AJ5 A;  3BXK A;  1UHI A;  4QJ3 B;  1UUS A;  1UP5 A;  2FCE A;  1NCZ A;  4YGB B;  5D7F A;  1G33 A;  2OS8 B;  4I5J A;  1U5I B;  1KFX L;  4IL1 A;  2LNK A;  5CSF A;  1JUO A;  1PVA A;  1SL7 A;  2SAS A;  3PN7 B;  1CM1 A;  1K96 A;  3VRR A;  5GQQ C;  1BJF A;  5JJG A;  4M2O A;  2NXQ A;  1A29 A;  1E8A A;  4QJ5 B;  2KAY A;  2FJY A;  3RLZ A;  3SJS A;  5K89 A;  3SG3 A;  3CR4 X;  4DRW A;  4CPV A;  2LE9 B;  2I7A A;  2BNX A;  4AQJ A;  2G9B A;  3PSR A;  2VRG A;  4WQ2 A;  1CMG A;  4PHK A;  1OOG A;  5AEQ A;  1CLB A;  2KQY A;  1XFV O;  1TNW A;  1IIO A;  3IF7 A;  3BYA A;  1OOF A;  3KPX A;  3R72 A;  3S0A A;  1IKU A;  1R2U A;  4BY5 A;  4C0L A;  3LLE A;  5CPV A;  2CCM A;  1NX3 A;  1JF0 A;  3I5G C;  2KI6 C;  4C0K A;  2PVB A;  1SR6 B;  2KQ6 A;  1XFU O;  4FQO A;  3IQQ A;  1K94 A;  3GK2 A;  2LHL A;  2WCH A;  2L4H A;  1XFZ O;  3GK1 A;  1AJ4 A;  2F8P A;  3K21 A;  1CTR A;  1IJ6 A;  3ICB A;  3B87 A;  1C7W A;  5FI7 A;  1TTX A;  3BQ3 A;  4MZJ A;  1QXP A;  2ZN9 A;  2BE6 A;  4PE0 A;  1CNP A;  3OX5 A;  3I5H B;  1K9U A;  1MXL C;  4ORC B;  1REC A;  2LMT A;  1CFC A;  2PRU A;  1QLK A;  3PJI A;  2KFF A;  3IVT A;  2K7C A;  3VRP A;  1QAT A;  2ERB A;  3D73 A;  2KBM A;  1KQM B;  2EGD A;  2LAP A;  2L5X B;  3EKH A;  3OGN A;  1DVI A;  3BJH A;  4NQG A;  1RRO A;  3LK1 A;  4JPZ B;  1M45 A;  2GGZ A;  3EKJ A;  1IQ5 A;  4HRH A;  2BKI B;  2H61 A;  3WNX B;  1A4P A;  1CLL A;  1OOJ A;  5AFP A;  1FBV A;  3CTN A;  3DXL A;  1EL4 A;  1QTX A;  2KSP A;  4GGF C;  1X02 A;  3JVT B;  1WLM A;  2KFG A;  1MF8 B;  2BL0 B;  1QLS A;  1NP8 A;  1QIW A;  1EH2 A;  1QV1 A;  1AHR A;  3AKA A;  3BOW A;  3L47 A;  1N0Y A;  3NHI A;  2M9G A;  3M0W A;  5CSN A;  3EK4 A;  3NGV A;  1NX2 A;  2LVV A;  5AXI A;  1DQE A;  2NZ0 A;  1YX8 A;  2EC6 C;  3BUW B;  3LCP C;  3SG2 A;  2LAN A;  2M3W A;  1K90 D;  4M2P A;  1H8B A;  3UO9 A;  4TNC A;  4ORA B;  2MBX A;  3GOF A;  4U8D A;  2KI6 D;  1SR6 C;  3I5F B;  1UHJ A;  2LC5 A;  3PAL A;  2L98 A;  3TDZ A;  2LVK A;  1H4B A;  2F3Y A;  2E30 A;  4XJK A;  1KWO B;  4PE7 A;  5EL2 A;  3JTD B;  1SNL A;  3NSL A;  1F54 A;  3CZ1 A;  1S26 D;  2JT3 A;  2KI4 C;  2L4I A;  2BEC A;  2WCM A;  2L2E A;  2K8M B;  1NPQ A;  1WLZ A;  2DOQ A;  1KK8 C;  1WDC B;  2KGB C;  1K95 A;  2WC8 A;  5I8N A;  4R1E A;  1L2O C;  2H2K A;  3BOW B;  1KQM C;  3EVV A;  2M1U A;  1QX7 A;  2L5Y A;  1CB1 A;  1JWD A;  2BCA A;  2PYQ A;  3NSI A;  1CDN A;  1L7Z A;  1NIW A;  1W7J B;  1IRJ A;  2LLU A;  2JT0 A;  1AUI B;  1B8R A;  1NCX A;  1IG5 A;  1ZUZ A;  3FWB A;  4XJK B;  1M63 B;  5JOL A;  3S0B A;  1KSO A;  1J1E A;  2KDH A;  1LKJ A;  1SCV A;  2I94 A;  1VRK A;  1NCY A;  2GTE A;  2JT8 A;  1YRT B;  3KEV A;  4N1F A;  4N1G A;  1MXE A;  3S0G A;  1TUJ A;  4CLN A;  3DVJ A;  1M31 A;  1CKK A;  2K61 A;  3I5I B;  2G2B A;  1DJZ A;  1YUR A;  1YR5 A;  4WRI A;  2K7O A;  1A2X A;  2MA2 A;  3LK0 A;  1OMD A;  2H61 C;  2OTG B;  2LVI A;  4MSP A;  1ALV A;  1MHO A;  1OQP A;  2JPO A;  4MRX A;  4AOM A;  3CZ0 A;  3R1O A;  1LS8 A;  4DCK A;  3JTD C;  3MSE B;  2YGU A;  3NSO A;  2KLE A;  5IBW A;  5PAL A;  1OMV A;  2M49 B;  1WDC C;  1KCY A;  1EG4 A;  2JUL A;  3CAB A;  1FW4 A;  2P6B B;  4PCW A;  1KQV A;  1B47 A;  2OPO A;  1DT7 B;  1DJX A;  2KYC A;  3TS5 C;  5G08 A;  2WND A;  4ZCV A;  4P5O E;  2D8N A;  1CDL A;  3CDN A;  1OW4 A;  1PSR A;  2WOR A;  1LVC D;  2BCX A; 
#chains in the Genus database with same CATH homology
 1B8L A;  5BPJ A;  1K9P A;  5DKR A;  3FIA A;  2L51 A;  4E68 A;  3CS1 A;  5HLV A;  5J3X A;  1JFK A;  1JC2 A;  1S6J A;  1SMG A;  2EHB A;  3GK4 X;  3BUX B;  4MZK A;  1F8H A;  3QRX A;  1SL9 A;  3F45 A;  1K93 D;  1IWQ A;  3NXA A;  4HRE E;  1B1G A;  2KBI A;  1XFX O;  3SIB A;  1ALW A;  5I2L A;  3TUY C;  1DF0 A;  3I5I C;  4MVF A;  2CBL A;  4OV2 A;  1TIZ A;  3O78 A;  2PSR A;  1RWY A;  3WHU B;  4JWQ A;  1UWO A;  1PVB A;  1Y0V H;  3ZWH A;  3CR5 X;  5HKW A;  3DF0 B;  3EVU A;  1DTL A;  4GGN A;  2WCB A;  1CM4 A;  3E3R A;  2A4J A;  2OS8 C;  1UHN A;  2AMI A;  1BR4 B;  3FWC A;  3C1V A;  5D69 A;  4PHM A;  1GJY A;  1K9K A;  1YVH A;  1F4Q A;  2JQ6 A;  2Y1N A;  3DF0 A;  3PN7 C;  3WXA A;  5I2O A;  2O60 A;  1KFU L;  3EK7 A;  1B8C A;  1GGZ A;  3HX4 A;  4PHJ A;  1CDM A;  1YX7 A;  1CDP A;  1XA5 A;  1DF0 B;  1G8I A;  1B9A A;  2V53 A;  1MR8 A;  3AKB A;  1DMO A;  2PMY A;  1KFU S;  1SCM B;  2ZNE A;  3OB1 B;  1NUB A;  1A03 A;  2F2P A;  1OZO A;  2M0R A;  2JXL A;  4P2Y B;  1B4C A;  2CXJ A;  1Y1X A;  4MLW A;  1DJY A;  1ZMZ A;  1NSH A;  2MHH A;  3PLF B;  2BKH B;  3SG7 A;  1XK4 A;  1SBJ A;  2LM5 A;  1OMR A;  1DGV A;  1PUL A;  1Y1U A;  1TCO B;  1W7I B;  4GFT A;  4L9M A;  4A4B A;  5DKN A;  4DIR A;  3H4S E;  1JF2 A;  1BOC A;  2JZI A;  1WRK A;  4ORB B;  5F6T A;  2KOT A;  1OSA A;  2L0P A;  1V1G A;  3TZ1 A;  1RJV A;  1SL8 A;  2ZRT A;  1AK8 A;  1CFF A;  3I5H C;  1C07 A;  2Y5I A;  4MRY A;  2FCD A;  1WY9 A;  1M46 A;  2Y1M A;  5KTY A;  3VRN A;  2M97 A;  4MEW A;  4QJ4 B;  2KGR A;  2IS9 A;  1A75 A;  1J55 A;  4OR9 B;  2CT9 A;  1F71 A;  1SRA A;  1S6C A;  1MWN A;  5HKY A;  1N65 A;  1B7T Y;  1RFJ A;  5AAN A;  4UPG A;  2BE4 A;  1Y1A A;  1RK9 A;  3TDI A;  1C7V A;  5HYD A;  2QPT A;  3JVT C;  1BOD A;  2ZFD A;  2E6W A;  1CLM A;  1QJT A;  2BL0 C;  4I5L B;  1SCM C;  2M1K B;  3FS7 A;  1S36 A;  2K7B A;  1ZOT B;  2JPT A;  4Q04 A;  4NDD A;  1TN4 A;  3DD4 A;  1QX5 B;  4NDC A;  4USL A;  1Q80 A;  2JOJ A;  3D0Y A;  5FYX A;  1KSM A;  1IJ5 A;  3VRQ A;  2NCP A;  3SIA A;  2I2R E;  1FPW A;  1TNP A;  1A75 B;  1PSB A;  4D1E A;  1J7O A;  3I5F C;  2ZRS A;  2COL B;  1G4Y R;  2KFH A;  3O2P A;  1FI5 A;  1JBA A;  1YTZ C;  4I5K A;  1NYA A;  1NX0 A;  2LP2 A;  3AAK A;  1YUT A;  3BUM B;  2K0J A;  3BUN B;  1KWO C;  2KYF A;  1TNX A;  1DJH A;  2Q4U A;  4F0Z B;  1LXF C;  2FJU B;  1TRF A;  3VRO A;  1TCF A;  1WRZ A;  4CID A;  1SKT A;  3CLN A;  5AER A;  2L50 A;  3O4Y A;  2MAZ A;  1IH0 A;  2LUC A;  2KAX A;  3SG5 A;  1IQ3 A;  3BUO B;  1GQM A;  1DJG A;  1M39 A;  4GGF A;  1PK0 D;  3KHE A;  3D0Y B;  1S3P A;  3A4U B;  1K2H A;  1AP4 A;  1QIV A;  1QX2 A;  1DJI A;  5KSZ A;  3PM8 A;  3SG6 A;  1FI6 A;  2NCO A;  4ETO A;  3LL8 B;  4GAO A;  2PAS A;  2JNF A;  1FF1 A;  2LUX A;  3EVR A;  3OB2 B;  3WHT B;  5B8I B;  2HET A;  2KNE A;  2WCE A;  3A8R A;  1NX1 A;  2WCF A;  1XO5 A;  1KFX S;  1ODB A;  3AAJ A;  4OCI A;  2JRF A;  2JTT A;  2M7N A;  1UHK A;  3HCM A;  1SPY A;  4M2Q A;  1J7Q A;  2M8U A;  2HPS A;  1YUU A;  1B7T Z;  4HSZ A;  1XYD A;  1CFD A;  1EG3 A;  1LA3 A;  2OTG C;  3CWG A;  1BG1 A;  4AQI A;  1S5G Y;  2RGI A;  2MRD A;  2HF5 A;  2LCP A;  2EC6 B;  2Q91 A;  1J7P A;  3CGA A;  4YBH B;  5HLO A;  1QV0 A;  1DGU A;  1YVL A;  2QAC A;  4CFQ A;  1QVI Y;  2M29 A;  1KK7 Y;  4ZCU A;  1HT9 A;  1LIN A;  4WQ3 A;  4PDZ A;  1JFJ A;  4FTG A;  2JU0 A;  2B1U A;  4GBA A;  1BMO A;  2WOS A;  2LMV A;  4PAL A;  2LP3 A;  2MLF C;  1LA0 A;  2MLE C;  2CTN A;  2SCP A;  2F2O A;  2KI4 B;  2LMU A;  1F55 A;  4MN0 A;  2KAV A;  1KK8 B;  1K8U A;  1CMF A;  1J7R A;  1L2O B;  3PFV A;  1UUR A;  1S1E A;  4OVN F;  2AUC A;  3CZT X;  4YGC B;  4MZL A;  3KO0 A;  4DUQ A;  2ZND A;  1RTP 1;  1OZS A;  1SY9 A;  1BR1 B;  5CSJ A;  2NLN A;  4GUK A;  1BT6 A;  1IGV A;  1R6P A;  3OHM B;  4XYN A;  1CFP A;  1EXR A;  5KU1 A;  3D10 A;  2K7D A;  2LHI A;  4YGA A;  2CNP A;  2GGM A;  2HQW A;  4YGD B;  4ICB A;  2LVJ A;  2Y4Q A;  1SYM A;  1HQV A;  2LLS A;  3DVK A;  2TN4 A;  5TNC A;  2MJW B;  4PHN A;  3PAT A;  1UHH A;  4YI9 A;  2I18 A;  2BBM A;  2BBN A;  1NWD A;  4MBE A;  1OE9 B;  1QS7 A;  1GGW A;  5I2Q A;  4GNK B;  1TOP A;  3RM1 A;  5DKQ A;  3CR2 A;  1WRL A;  3KF9 A;  2PAL A;  4GPL B;  2BCB A;  2K2F A;  3IQO A;  3OX6 A;  3NSK A;  1MUX A;  1S6I A;  1YUS A;  2JTZ A;  4PE4 A;  4BY4 A;  1S5G Z;  3ZNI A;  1SK6 D;  1PAL A;  3TDU A;  2AAO A;  4N5X A;  1MQ1 A;  2JC2 A;  1ZAC A;  1SW8 A;  1XFW O;  2HQ8 A;  1JSA A;  3TS5 B;  1QVI Z;  1J1D A;  2JXC A;  4JQ0 D;  1KK7 Z;  1D1O A;  1DJW A;  1ZFS A;  2ISD A;  1AVS A;  3SG4 A;  4YRU A;  2JWW A;  4DS7 A;  2KHN A;  3O6B A;  4CFR A;  1QAS A;  5ER5 A;  1EJ3 A;  5ER4 X;  4A4C A;  1F70 A;  1U5I A;  5CSI A;  1N2D A;  2F33 A;  2ZKM X;  4OKH A;  4YGE B;  4I5N B;  4HRG A;  4PE1 A;  1BF5 A;  2O5G A;  2F3Z A;  1V1F A;  2JNX A;  3EK8 A;  2LV7 A;  3I5G B;  5HKZ A;  1XVJ A;  2FOT A;  1XFY O;  1BLQ A;  2GV5 A;  3OP0 A;  1BU3 A;  3VGO A;  4NDB A;  1F4O A;  3TUY B;  1Y6W A;  1PRW A;  1YRU B;  2R2I A;  3DVE A;  4YI8 A;  1XK4 C;  2LLT A;  1TNQ A;  2ZN8 A;  2M7L A;  3DVM A;  4C0J A;  2K2A A;  1AJ5 A;  3BXK A;  1UHI A;  4QJ3 B;  1UUS A;  1UP5 A;  2FCE A;  1NCZ A;  4YGB B;  5D7F A;  1G33 A;  2OS8 B;  4I5J A;  1U5I B;  1KFX L;  4IL1 A;  2LNK A;  5CSF A;  1JUO A;  1PVA A;  1SL7 A;  2SAS A;  3PN7 B;  1CM1 A;  1K96 A;  3VRR A;  5GQQ C;  1BJF A;  5JJG A;  4M2O A;  2NXQ A;  1A29 A;  1E8A A;  4QJ5 B;  2KAY A;  3SJS A;  3RLZ A;  5K89 A;  3SG3 A;  3CR4 X;  4DRW A;  4CPV A;  2LE9 B;  2I7A A;  4AQJ A;  2G9B A;  3PSR A;  2VRG A;  4WQ2 A;  1CMG A;  4PHK A;  5AEQ A;  1CLB A;  2KQY A;  1XFV O;  1TNW A;  3IF7 A;  3BYA A;  3KPX A;  1IKU A;  1R2U A;  4BY5 A;  4C0L A;  3LLE A;  5CPV A;  2CCM A;  1NX3 A;  1JF0 A;  3I5G C;  2KI6 C;  4C0K A;  2PVB A;  1SR6 B;  2KQ6 A;  1XFU O;  4FQO A;  3IQQ A;  1K94 A;  3GK2 A;  2LHL A;  2L4H A;  1XFZ O;  3GK1 A;  1AJ4 A;  2F8P A;  3K21 A;  1CTR A;  1IJ6 A;  3ICB A;  1C7W A;  1TTX A;  3BQ3 A;  4MZJ A;  1QXP A;  2ZN9 A;  2BE6 A;  4PE0 A;  1CNP A;  3OX5 A;  3I5H B;  1K9U A;  1MXL C;  4ORC B;  1REC A;  2LMT A;  1CFC A;  2PRU A;  1QLK A;  2KFF A;  2K7C A;  3VRP A;  1QAT A;  2KBM A;  1KQM B;  2EGD A;  2LAP A;  2L5X B;  3EKH A;  1DVI A;  4NQG A;  1RRO A;  3LK1 A;  4JPZ B;  1M45 A;  2GGZ A;  3EKJ A;  1IQ5 A;  4HRH A;  2BKI B;  2H61 A;  3WNX B;  1A4P A;  1CLL A;  1OOJ A;  5AFP A;  1FBV A;  3CTN A;  1EL4 A;  1QTX A;  2KSP A;  4GGF C;  1X02 A;  3JVT B;  1WLM A;  2KFG A;  1MF8 B;  2BL0 B;  1QLS A;  1NP8 A;  1QIW A;  1EH2 A;  1QV1 A;  1AHR A;  3AKA A;  3BOW A;  1N0Y A;  2M9G A;  3M0W A;  5CSN A;  3EK4 A;  1NX2 A;  2LVV A;  5AXI A;  3BUW B;  2NZ0 A;  1YX8 A;  2EC6 C;  3LCP C;  3SG2 A;  2LAN A;  2M3W A;  1K90 D;  4M2P A;  1H8B A;  4TNC A;  4ORA B;  2MBX A;  3GOF A;  4U8D A;  2KI6 D;  1SR6 C;  3I5F B;  1UHJ A;  2LC5 A;  3PAL A;  2L98 A;  3TDZ A;  2LVK A;  1H4B A;  2F3Y A;  2E30 A;  4XJK A;  1KWO B;  4PE7 A;  3JTD B;  1SNL A;  3NSL A;  1F54 A;  1S26 D;  2JT3 A;  2KI4 C;  2L4I A;  2BEC A;  2L2E A;  2K8M B;  1NPQ A;  1WLZ A;  2DOQ A;  1KK8 C;  1WDC B;  2KGB C;  1K95 A;  2WC8 A;  5I8N A;  4R1E A;  1L2O C;  2H2K A;  3BOW B;  1KQM C;  3EVV A;  2M1U A;  1QX7 A;  1CB1 A;  1JWD A;  2BCA A;  3NSI A;  1CDN A;  1L7Z A;  1NIW A;  1W7J B;  1IRJ A;  2LLU A;  2JT0 A;  1AUI B;  1B8R A;  1NCX A;  1IG5 A;  1ZUZ A;  3FWB A;  4XJK B;  1M63 B;  5JOL A;  1KSO A;  1J1E A;  2KDH A;  1LKJ A;  1SCV A;  2I94 A;  1VRK A;  1NCY A;  2JT8 A;  3KEV A;  1YRT B;  4N1F A;  4CLN A;  4N1G A;  1MXE A;  3DVJ A;  1M31 A;  1CKK A;  2K61 A;  3I5I B;  2G2B A;  1DJZ A;  1YUR A;  1YR5 A;  4WRI A;  2K7O A;  1A2X A;  2MA2 A;  3LK0 A;  1OMD A;  2H61 C;  2OTG B;  2LVI A;  4MSP A;  1ALV A;  1MHO A;  1OQP A;  4MRX A;  4AOM A;  4DCK A;  3JTD C;  3MSE B;  3NSO A;  5IBW A;  5PAL A;  1OMV A;  2M49 B;  1WDC C;  1KCY A;  1EG4 A;  2JUL A;  1FW4 A;  2P6B B;  4PCW A;  1KQV A;  1B47 A;  2OPO A;  1DT7 B;  1DJX A;  2KYC A;  3TS5 C;  5G08 A;  2WND A;  4ZCV A;  4P5O E;  2D8N A;  1CDL A;  1PSR A;  2WOR A;  1LVC D;  2BCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...