3NSLA

Crystal structure of s100a3 c30a+c68a double mutant expressed in insect cell
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
ARPLEQAVAAIVCTFQEYAGRCGDKYKLAQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDAEVDFVEYVRSLACLCLYCHEYFKDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A3
publication title Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3nslA00
1S3PA 2F3YA 3FIAA 3VROA 5KTYA 1ZMZA 1EG3A 1LVCD 1MXLC 2JT8A 2PVBA 3C1VA 2F2OA 3EVUA 3JVTB 3PALA 1BR4B 4F0ZB 1JFKA 3BYAA 2WCFA 2KBIA 1RFJA 2LVVA 3SG7A 2EHBA 5B8IB 2LAPA 1H8BA 2G2BA 1SNLA 4A4BA 2LNKA 1DGVA 1AVSA 3EKHA 3CZTX 1DJWA 1SR6C 2JZIA 2MLEC 1JBAA 1BR1B 4OR9B 1TRFA 2JTTA 2WOSA 2ZKMX 2EGDA 2KQ6A 4XJKB 2JRFA 2L4IA 2K7OA 1LA0A 2H61C 1SK6D 4ORAB 5F6TA 1SYMA 1IGVA 2COLB 1NCZA 2LUXA 2WC8A 4I5KA 4ETOA 1NCXA 1CNPA 1CM4A 2JOJA 5JJGA 2Y4QA 1JF2A 3QRXA 3O6BA 2M9GA 1XYDA 4XYNA 1OMRA 5HYDA 1ODBA 3I5FB 2FCEA 2D8NA 1KFXL 3I5FC 2KFGA 3PATA 4HSZA 4QJ3B 4CFQA 1DJIA 1KQMB 2LCPA 4PE7A 1DJXA 1SBJA 1Y1AA 1XO5A 5CSNA 1J1DA 1ALWA 1G8IA 2BBNA 4MRXA 2O5GA 1BG1A 4MZLA 1PALA 2LP3A 1Y1XA 1QTXA 2M8UA 3ZWHA 5TNCA 1TCFA 4C0KA 1DJGA 4NDDA 5HLOA 1W7IB 2M1UA 4YRUA 2LANA 4USLA 4E68A 1IH0A 3K21A 2L98A 1J7PA 2MHHA 4OVNF 2BKIB 3HX4A 4C0JA 1A75B 1CLMA 2JU0A 4MN0A 4P5OE 1L2OC 1SCMB 3DVEA 1CLBA 2KFHA 3HCMA 3NSOA 4GAOA 4MSPA 1QS7A 1ZACA 1KQVA 1D1OA 2L0PA 4Q04A 2JXLA 1UURA 1YRUB 1J7QA 1PULA 2KGRA 3FWBA 3GK2A 5I2LA 1KK8B 1YUSA 4OV2A 2F2PA 4YGEB 1SKTA 1EG4A 1G33A 2NLNA 5IBWA 2LVIA 1IKUA 3LLEA 1SL9A 3BUMB 4PHJA 1F8HA 5HLVA 1AUIB 4U8DA 1TTXA 2LHIA 2BCXA 2M1KB 4YI8A 1L7ZA 3CR2A 3CS1A 3CR4X 3OP0A 2KHNA 1NPQA 5JOLA 2ZFDA 4P2YB 2QACA 1GGWA 4PALA 2I2RE 1Y1UA 3I5HB 4N5XA 1EL4A 3EK8A 1A03A 2RGIA 1K94A 3OB1B 1OMDA 3KHEA 1A4PA 1PSBA 1U5IA 2OPOA 3D0YA 5AANA 3EKJA 2MRDA 2ZNDA 4BY5A 2MLFC 1C7VA 1IJ5A 1RJVA 2HETA 2K61A 1QXPA 2JNXA 5KSZA 2M0RA 1S5GY 2I94A 1LKJA 3SG3A 4YGDB 1WRLA 2BCBA 1XVJA 2ZRSA 4GGNA 3O78A 3VRPA 1LA3A 2JXCA 1YUTA 1QLKA 1XFZO 2LLTA 3NSLA 4M2OA 4GBAA 3SJSA 1UHIA 2OTGB 2HQWA 2BECA 1YTZC 1TIZA 1B8RA 1JF0A 4MRYA 3TUYC 2K7BA 3ICBA 1K8UA 1B8LA 3WHTB 2KGBC 1YX8A 2LVJA 3CTNA 5D7FA 3SIBA 2KQYA 2F3ZA 4QJ5B 4ORCB 1NX2A 4PE0A 3DVJA 3AAJA 3DVMA 3EK4A 2KNEA 3AAKA 3BUWB 4YGCB 2IS9A 1MR8A 2NCPA 1K90D 3JVTC 1NX0A 1CDMA 1IRJA 2EC6B 4HRGA 4DUQA 2SASA 1V1GA 2EC6C 1K9KA 3JTDB 3F45A 2LE9B 4A4CA 1LXFC 3CWGA 2BCAA 4NQGA 2BE6A 1K9PA 2LLUA 1OE9B 3RLZA 1B7TY 3IF7A 3TDUA 3NSIA 2LMTA 1K95A 1KSOA 2GGZA 4HRHA 4BY4A 2LHLA 3TS5B 1HT9A 1WDCB 5K89A 2HPSA 1YURA 4YGBB 3CLNA 2LUCA 3OX5A 2PSRA 3SG6A 1B47A 3LCPC 3PLFB 5I8NA 4JWQA 2MBXA 2E6WA 1QIVA 4TNCA 5HKYA 1MWNA 5FYXA 3BUNB 1F54A 1RWYA 1UHNA 5I2OA 1M45A 4N1GA 5GQQC 1KQMC 1FBVA 4ZCUA 2QPTA 2JT0A 4GGFC 1BJFA 1F4QA 1YX7A 4JQ0D 4M2QA 1QV1A 3BQ3A 2ZNEA 4MZJA 1UHHA 3A8RA 2HQ8A 1IQ3A 5DKRA 2KI6D 1RTP1 3WNXB 1FF1A 3CR5X 3LK1A 2K2FA 2KFFA 1N2DA 3DF0A 3EVRA 3GK4X 3I5IB 4PE4A 1XFXO 1KFUL 1Y6WA 1DF0A 3TDZA 4AQIA 1SCMC 1J7OA 4YI9A 1TCOB 2WNDA 2LLSA 4M2PA 1M63B 4DS7A 2Y5IA 4CFRA 2M97A 2BL0B 2K8MB 3DD4A 1K96A 3WHUB 1BMOA 1N0YA 1AK8A 3RM1A 4PCWA 1W7JB 3O4YA 1CMFA 1SCVA 1K2HA 2K0JA 5G08A 5I2QA 1XFUO 1K9UA 1KK8C 1NCYA 2VRGA 4NDCA 5D69A 4WQ2A 2KYFA 1ZFSA 1CDNA 2M29A 3SG4A 3LL8B 1F70A 2FCDA 3EK7A 1CFCA 1OOJA 4I5NB 1WLZA 1C7WA 2PRUA 2WCEA 1KK7Z 1J55A 5J3XA 1Y0VH 1SRAA 1GQMA 2B1UA 3A4UB 1QLSA 1KFXS 4I5LB 2NCOA 2KI6C 3PN7B 1N65A 3KEVA 1CDLA 3I5HC 4PDZA 1UHKA 2CT9A 1WRZA 4MBEA 2BE4A 5AFPA 1LINA 1KWOB 1WRKA 4PHKA 1R6PA 5BPJA 2JNFA 3M0WA 1B8CA 2SCPA 4FTGA 2KYCA 2WCBA 1TNWA 2CXJA 1QVIZ 3I5GB 1TOPA 2Y1MA 3VRQA 2M3WA 3CGAA 1U5IB 1NX3A 2TN4A 3D0YB 1V1FA 3OX6A 1C07A 4R1EA 2KDHA 4WQ3A 5CSJA 1EH2A 1ZUZA 2M49B 1KFUS 4MVFA 4MZKA 3PSRA 1YUUA 2OTGC 3BXKA 1CKKA 1QASA 4FQOA 5ER4X 2LMVA 3MSEB 4DCKA 1J7RA 4GNKB 1CMGA 2JQ6A 2PALA 1WY9A 1BT6A 3E3RA 2JC2A 1OZSA 2MA2A 2V53A 4OCIA 1FPWA 1XFWO 4IL1A 2AAOA 4CLNA 1EJ3A 1NP8A 4YGAA 1QV0A 1QJTA 3GOFA 1XK4C 5CPVA 2KI4B 2OS8B 1DMOA 3FWCA 3BOWA 4PHNA 3NSKA 1RECA 4JPZB 2JT3A 1DTLA 3JTDC 1IG5A 1A29A 1S5GZ 2ZN9A 4DRWA 4WRIA 2L51A 3TZ1A 4GUKA 2M7NA 2L5XB 1CDPA 3FS7A 1YVHA 2NZ0A 2Q4UA 1NYAA 4UPGA 1CFDA 1OSAA 1NSHA 1UP5A 4N1FA 3TS5C 3H4SE 1YVLA 1NUBA 2LM5A 5HKZA 5AEQA 1JC2A 1WDCC 2ISDA 1MF8B 1DJHA 2KAVA 2LMUA 1KSMA 2AUCA 5DKQA 2GV5A 2LC5A 3LK0A 5KU1A 2AMIA 1F71A 4XJKA 1FI5A 2H61A 3VRNA 1H4BA 2WORA 1SR6B 5CSIA 4DIRA 1QIWA 1GJYA 1CLLA 4PHMA 2P6BB 2ZRTA 1DJYA 4GFTA 1CM1A 1NWDA 3IQQA 3KF9A 1OMVA 2CTNA 1B9AA 1UWOA 2MJWB 2I18A 2CNPA 1J1EA 1YR5A 4ORBB 2R2IA 3EVVA 3VGOA 2KAYA 4AOMA 1TNPA 1CFFA 1B7TZ 1F4OA 1X02A 2FJUB 1A2XA 1R2UA 3PM8A 1AJ4A 1QX2A 1GGZA 3OB2B 2F33A 2FOTA 3I5IC 4GGFA 2E30A 4OKHA 2KOTA 1XA5A 1JWDA 4MLWA 1RROA 1K93D 1IJ6A 4PE1A 1MUXA 4CIDA 1TNXA 1QX5B 1DT7B 1OZOA 1EXRA 2PASA 3WXAA 1HQVA 1B4CA 3DF0B 1CTRA 2H2KA 2PMYA 1QX7A 1S6CA 1IWQA 4QJ4B 2JWWA 2BL0C 2L4HA 5AXIA 3SIAA 4I5JA 2ZN8A 1DF0B 3AKBA 1M46A 1XFVO 1PSRA 2K2AA 1A75A 1DGUA 1KK7Y 2A4JA 1NIWA 3NXAA 4GPLB 3KO0A 1S36A 4C0LA 2BKHB 1F55A 1MHOA 1XFYO 3BUOB 1BODA 3GK1A 1JUOA 1SL7A 1E8AA 1RK9A 1YRTB 3KPXA 2Y1NA 1DVIA 4L9MA 1UUSA 1L2OB 4YBHB 5HKWA 3IQOA 3VRRA 2DOQA 4MEWA 1S26D 1PVBA 2JPTA 1M31A 1DJZA 5CSFA 1ZOTB 5AERA 1BLQA 3ZNIA 3BUXB 2K7DA 1IQ5A 3PN7C 1QVIY 4D1EA 2K7CA 3SG5A 2M7LA 1KWOC 3PFVA 1NX1A 2GGMA 5PALA 2L2EA 2LV7A 1SPYA 1AJ5A 4CPVA 1JSAA 2KBMA 1CFPA 1BF5A 3I5GC 3SG2A 1UHJA 1PK0D 3OHMB 2KAXA 4ZCVA 2CCMA 1CB1A 1S6IA 1PVAA 1TN4A 2BBMA 4NDBA 3O2PA 2I7AA 1M39A 2MAZA 1QATA 1AP4A 1FI6A 1Q80A 2KSPA 1B1GA 1KCYA 1S1EA 5DKNA 1SMGA 1ALVA 1SW8A 1BOCA 1AHRA 2L50A 1S6JA 1G4YR 1JFJA 1TNQA 2LVKA 3TDIA 1OQPA 1FW4A 2KI4C 2OS8C 1SL8A 1MXEA 3AKAA 1BU3A 1MQ1A 1VRKA 3TUYB 1PRWA 2G9BA 1SY9A 3DVKA 2F8PA 2NXQA 3BOWB 2O60A 1XK4A 2JTZA 2Q91A 2LP2A 2CBLA 2JULA 1WLMA 3D10A 5ER5A 4ICBA 4HREE 2HF5A 4AQJA
chains in the Genus database with same CATH superfamily
1S3PA 2F3YA 3FIAA 3VROA 5KTYA 1ZMZA 1EG3A 1LVCD 1MXLC 2JT8A 2PVBA 3C1VA 2F2OA 3EVUA 3JVTB 2KLEA 1BR4B 3PALA 4F0ZB 1JFKA 1P28A 3BYAA 2WCFA 2KBIA 1RFJA 2LVVA 2QEVA 3SG7A 2EHBA 5B8IB 2LAPA 1H8BA 2G2BA 1SNLA 2QEOA 4A4BA 2LNKA 1DGVA 1AVSA 3EKHA 3CZTX 1DJWA 1SR6C 2JZIA 2MLEC 1JBAA 1BR1B 2P71A 4OR9B 1TRFA 2JTTA 2WOSA 2ZKMX 3V2LA 2EGDA 2KQ6A 4XJKB 2JRFA 2L4IA 2K7OA 3K1EA 3S0GA 1LA0A 2H61C 1SK6D 4ORAB 1SSEB 5F6TA 1SYMA 1IGVA 2COLB 1NCZA 2LUXA 2WC8A 4I5KA 4ETOA 1NCXA 5HL1A 1CNPA 1CM4A 2JOJA 5JJGA 2Y4QA 1JF2A 3QRXA 1Z4HA 2M9GA 3O6BA 1XYDA 1ORGA 1XFRA 4XYNA 1OMRA 5HYDA 3O4XA 2P70A 1ODBA 3B6XA 2FCEA 2D8NA 1KFXL 3I5FB 2KFGA 3I5FC 3PATA 4HSZA 4QJ3B 4CFQA 1DJIA 1KQMB 2LCPA 4PE7A 1DJXA 2BNXA 1SBJA 1Y1AA 1XO5A 5CSNA 1J1DA 1ALWA 1G8IA 2BBNA 4MRXA 2O5GA 3EG5B 5DICA 1BG1A 1C3YA 1GM0A 4MZLA 1PALA 2LP3A 1Y1XA 1QTXA 2M8UA 3ZWHA 5TNCA 1TCFA 4C0KA 3OBVA 1DJGA 4NDDA 5HLOA 1W7IB 2M1UA 4YRUA 3S0AA 2LANA 4USLA 3BFBA 4E68A 1IH0A 3UNWA 2WC6A 2L98A 3K21A 1J7PA 2MHHA 4OVNF 2BKIB 3HX4A 4C0JA 1A75B 1CLMA 2JU0A 2WC5A 4MN0A 4P5OE 1L2OC 1SCMB 3DVEA 1TWOA 3B88A 4PT1A 2KFHA 3HCMA 3PJIA 3NSOA 3SS5A 3R1PA 4GAOA 4MSPA 1QS7A 1ZACA 1KQVA 1D1OA 2L0PA 4Q04A 2JXLA 1UURA 1YRUB 1J7QA 1PULA 3D76A 2KGRA 3FWBA 3GK2A 5I2LA 1KK8B 1YUSA 4OV2A 2F2PA 4YGEB 1DELA 1SKTA 1EG4A 1G33A 2NLNA 5IBWA 1IIOA 2LVIA 1IKUA 3LLEA 1SL9A 3BUMB 1DEKA 4PHJA 1F8HA 3S0FA 5HLVA 1AUIB 4U8DA 1TTXA 2LHIA 3B86A 3L4LA 2BCXA 2M1KB 3R72A 1L7ZA 3CR2A 4YI8A 3CS1A 3CR4X 3OP0A 2KHNA 1NPQA 5JOLA 2ZFDA 4P2YB 2QACA 1GGWA 2L5YA 2I2RE 1Y1UA 3I5HB 3N7HA 1EL4A 3EK8A 4N5XA 4PALA 2RGIA 1K94A 1A03A 3OB1B 1OMDA 3KHEA 1A4PA 1PSBA 1U5IA 2OPOA 3D0YA 5AANA 1W9ZA 4F7FA 3EKJA 2MRDA 2ZNDA 4BY5A 2MLFC 3QMEA 3D73A 1IJ5A 1C7VA 1RJVA 2HETA 2K61A 1QXPA 2L2CA 2JNXA 5KSZA 2M0RA 1S5GY 2I94A 1LKJA 3SG3A 4YGDB 1WRLA 2BCBA 1XVJA 2ZRSA 4GGNA 3O78A 3VRPA 1LA3A 2JXCA 1YUTA 1QLKA 1XFZO 2BAPA 2LLTA 3NSLA 4M2OA 4GBAA 3SJSA 1UHIA 2OTGB 2HQWA 2BECA 1YTZC 1TIZA 1B8RA 1JF0A 4MRYA 3TUYC 2K7BA 3ICBA 1K8UA 2K60A 1B8LA 3WHTB 2KGBC 1YX8A 2LVJA 3CTNA 5D7FA 3SIBA 2KQYA 2F3ZA 3S0BA 4QJ5B 4ORCB 1NX2A 4PE0A 3DVJA 3AAJA 3DVMA 3EK4A 2KNEA 2WCJA 3AAKA 3BUWB 4YGCB 2IS9A 1MR8A 2NCPA 1K90D 3JVTC 1NX0A 1CDMA 1IRJA 2EC6B 4HRGA 4DUQA 2SASA 1V1GA 2EC6C 1K9KA 3JTDB 4JKTA 3F45A 2LE9B 4A4CA 1LXFC 3CWGA 2BCAA 4NQGA 2BE6A 1K9PA 2LLUA 1OE9B 3RLZA 1B7TY 3IF7A 3TDUA 3NSIA 2LMTA 1K95A 1KSOA 2GGZA 4HRHA 4BY4A 2LHLA 3TS5B 1TUJA 1HT9A 1WDCB 5K89A 2HPSA 1YURA 3D74A 4YGBB 3CLNA 2LUCA 2QDIA 2PSRA 3OX5A 1B47A 3LCPC 3PLFB 3SG6A 5I8NA 4JWQA 2MBXA 1CLBA 2E6WA 1QIVA 4TNCA 5HKYA 1MWNA 5FYXA 3BUNB 1F54A 1RWYA 1UHNA 5I2OA 1M45A 4N1GA 3CDNA 5GQQC 1KQMC 2PQLA 3CZ2A 1FBVA 4ZCUA 2QPTA 2JT0A 4GGFC 1BJFA 1F4QA 1YX7A 4JQ0D 4M2QA 1QV1A 3BQ3A 2ZNEA 4MZJA 2KLDA 3FE9A 1UHHA 3A8RA 2HQ8A 1IQ3A 5DKRA 2KI6D 2QEBA 1RTP1 3NHIA 3WNXB 1FF1A 3B87A 3CR5X 3LK1A 2K2FA 2KFFA 1N2DA 3DF0A 3EVRA 3GK4X 3I5IB 4PE4A 1XFXO 2WCHA 1KFUL 1Y6WA 1DF0A 2ERBA 3TDZA 4AQIA 4INXA 1SCMC 1J7OA 4YI9A 1TCOB 2WNDA 2LLSA 4M2PA 1M63B 5FI6A 4DS7A 2Y5IA 4CFRA 2M97A 2BL0B 2K8MB 3DD4A 1K96A 3WHUB 1OOGA 1BMOA 1N0YA 1AK8A 3RM1A 4PCWA 1OOFA 1W7JB 3O4YA 1CMFA 1SCVA 1K2HA 2K0JA 5G08A 5I2QA 1XFUO 1K9UA 1KK8C 1NCYA 2VRGA 4NDCA 5D69A 4WQ2A 2KYFA 1ZFSA 1CDNA 2M29A 3SG4A 3LL8B 1F70A 2FCDA 3EK7A 1CFCA 1OOJA 4I5NB 1WLZA 1C7WA 3D77A 2PRUA 2WCEA 1KK7Z 1J55A 5J3XA 1Y0VH 1SRAA 1GQMA 2B1UA 3A4UB 1QLSA 1KFXS 3R1VA 4I5LB 2NCOA 2KI6C 3PN7B 1N65A 3KEVA 1CDLA 3I5HC 4PDZA 1UHKA 2CT9A 1WRZA 4MBEA 2BE4A 5AFPA 1LINA 1KWOB 3FE6A 1WRKA 4PHKA 4IJ7A 1R6PA 5BPJA 2JNFA 3M0WA 1B8CA 2SCPA 4FTGA 3BFHA 2KYCA 2WCBA 1TNWA 2CXJA 1QVIZ 3I5GB 1TOPA 2Y1MA 3VRQA 2M3WA 3CGAA 1U5IB 1NX3A 2TN4A 3D0YB 2WCKA 1V1FA 3OX6A 1C07A 4R1EA 2KDHA 4WQ3A 5CSJA 1EH2A 1ZUZA 2M49B 1KFUS 4MVFA 3NGVA 4MZKA 3VB1A 3PSRA 1YUUA 2OTGC 3BXKA 1CKKA 1QASA 4FQOA 5ER4X 2LMVA 3MSEB 4DCKA 3Q8IA 1J7RA 3DY9A 4GNKB 1CMGA 2JQ6A 2PALA 5FI7A 5D3OA 2KPHA 1WY9A 1BT6A 3E3RA 5FI2A 1OW4A 1OOHA 1OZSA 2JC2A 2MA2A 2V53A 4OCIA 1XFWO 3S0EA 4IL1A 1FPWA 2AAOA 4CLNA 1EJ3A 1NP8A 4YGAA 1QV0A 1QJTA 3GOFA 1XK4C 5CPVA 2KI4B 2OS8B 1TUZA 3FWCA 3BOWA 4PHNA 1DMOA 3IVTA 3NSKA 1RECA 3OGNA 4JPZB 2JT3A 3NHTA 1C3ZA 1DTLA 3JTDC 1IG5A 1A29A 1S5GZ 2ZN9A 3DYEA 4WRIA 4DRWA 2L51A 3TZ1A 4GUKA 2M7NA 2L5XB 2PYQA 1CDPA 3FS7A 1YVHA 2NZ0A 2Q4UA 1NYAA 4UPGA 1CFDA 1OSAA 3DXLA 1NSHA 1UP5A 4N1FA 3TS5C 3H4SE 1YVLA 1NUBA 2LM5A 3FE8A 5HKZA 5AEQA 3S0DA 1WDCC 4KYNA 2ISDA 3CABA 4OZDA 1JC2A 1MF8B 1DJHA 2KAVA 3UO9A 2LMUA 1KSMA 2AUCA 5DKQA 2GV5A 2LC5A 3LK0A 5KU1A 2AMIA 1F71A 4XJKA 1FI5A 2H61A 3VRNA 1H4BA 2WORA 1SR6B 5CSIA 4DIRA 1QIWA 1LS8A 2JPOA 1GJYA 1CLLA 4PHMA 2P6BB 2ZRTA 1DJYA 4GFTA 1CM1A 1NWDA 3IQQA 3KF9A 1OMVA 2CTNA 1B9AA 1UWOA 2MJWB 2I18A 2CNPA 1J1EA 1YR5A 4ORBB 3CZ0A 2R2IA 3EVVA 3VGOA 2KAYA 4AOMA 1TNPA 1CFFA 1B7TZ 1F4OA 1X02A 2FJUB 1A2XA 3R1OA 1R2UA 3PM8A 1AJ4A 1QX2A 4JD9A 1GGZA 3OB2B 2F33A 2FOTA 3I5IC 4GGFA 2E30A 4OKHA 2KOTA 1XA5A 1JWDA 4MLWA 1RROA 3SS4A 1K93D 1IJ6A 1Z2CB 4PE1A 1MUXA 3D78A 4CIDA 1TNXA 1QX5B 1DT7B 1OZOA 1EXRA 2PASA 3WXAA 1HQVA 1B4CA 3DF0B 2WCMA 1CTRA 2H2KA 2PMYA 1QX7A 1S6CA 1IWQA 2YGUA 4QJ4B 2JWWA 2BL0C 2L4HA 5AXIA 3SIAA 4I5JA 2ZN8A 1DF0B 3DZTA 5EL2A 3AKBA 2WCLA 1M46A 1XFVO 1PSRA 2K2AA 1A75A 1DGUA 1KK7Y 2A4JA 1NIWA 3NXAA 4GPLB 3KO0A 1S36A 4C0LA 2BKHB 1DC1A 1F55A 1MHOA 1XFYO 3BUOB 1BODA 3GK1A 1JUOA 1SL7A 1E8AA 1RK9A 1YRTB 3KPXA 2Y1NA 1DVIA 4L9MA 1UUSA 1L2OB 4YBHB 5HKWA 3IQOA 3BJHA 3VRRA 2DOQA 4MEWA 1S26D 1PVBA 5I94A 2JPTA 1M31A 1DJZA 5CSFA 1ZOTB 3L47A 4INWA 5AERA 1BLQA 3ZNIA 3BUXB 1DQEA 1IQ5A 2K7DA 3PN7C 1QVIY 3RZSA 4D1EA 2K7CA 3SG5A 2M7LA 1KWOC 3PFVA 3PM2A 1NX1A 2GGMA 5PALA 2L2EA 2LV7A 1SPYA 1AJ5A 4CPVA 1JSAA 2KBMA 1CFPA 1BF5A 3I5GC 3SG2A 1UHJA 4FQTA 1PK0D 3OHMB 2KAXA 4ZCVA 2CCMA 1CB1A 1S6IA 1PVAA 3CZ1A 1TN4A 2BBMA 4NDBA 3O2PA 2I7AA 1M39A 2MAZA 1QWVA 1QATA 3BFAA 1AP4A 1Q80A 3B7AA 1FI6A 2KSPA 1B1GA 1KCYA 1S1EA 2GTEA 5DKNA 1SMGA 1ALVA 1SW8A 3SS3A 1BOCA 1AHRA 2L50A 1S6JA 1G4YR 2H8VA 1JFJA 2QEHA 1TNQA 2LVKA 3TDIA 1OQPA 3L4AA 1FW4A 2KI4C 2FJYA 1SL8A 1MXEA 2OS8C 3AKAA 3D75A 1OOIX 3CYZA 1BU3A 1MQ1A 1VRKA 3TUYB 1PRWA 2G9BA 1SY9A 3DVKA 2F8PA 2NXQA 1T14A 2O60A 3BOWB 1XK4A 2JTZA 2Q91A 2LP2A 2CBLA 2JULA 1WLMA 3D10A 5ER5A 4ICBA 4HREE 2HF5A 4AQJA
chains in the Genus database with same CATH topology
1S3PA 2F3YA 3FIAA 3VROA 5KTYA 1ZMZA 1EG3A 1LVCD 1MXLC 2JT8A 2PVBA 3C1VA 2F2OA 3EVUA 3JVTB 3PALA 1BR4B 4F0ZB 1JFKA 3BYAA 2WCFA 2KBIA 1RFJA 2LVVA 3SG7A 2EHBA 5B8IB 2LAPA 1H8BA 2G2BA 1SNLA 4A4BA 2LNKA 1DGVA 1AVSA 3EKHA 3CZTX 1DJWA 1SR6C 2JZIA 2MLEC 1JBAA 1BR1B 4OR9B 1TRFA 2JTTA 2WOSA 2ZKMX 2EGDA 2KQ6A 4XJKB 2JRFA 2L4IA 2K7OA 1LA0A 2H61C 1SK6D 4ORAB 5F6TA 1SYMA 1IGVA 2COLB 1NCZA 2LUXA 2WC8A 4I5KA 4ETOA 1NCXA 1CNPA 1CM4A 2JOJA 5JJGA 2Y4QA 1JF2A 3QRXA 3O6BA 2M9GA 1XYDA 4XYNA 1OMRA 5HYDA 1ODBA 3I5FB 2FCEA 2D8NA 1KFXL 3I5FC 2KFGA 3PATA 4HSZA 4QJ3B 4CFQA 1DJIA 1KQMB 2LCPA 4PE7A 1DJXA 1SBJA 1Y1AA 1XO5A 5CSNA 1J1DA 1ALWA 1G8IA 2BBNA 4MRXA 2O5GA 1BG1A 4MZLA 1PALA 2LP3A 1Y1XA 1QTXA 2M8UA 3ZWHA 5TNCA 1TCFA 4C0KA 1DJGA 4NDDA 5HLOA 1W7IB 2M1UA 4YRUA 2LANA 4USLA 4E68A 1IH0A 3K21A 2L98A 1J7PA 2MHHA 4OVNF 2BKIB 3HX4A 4C0JA 1A75B 1CLMA 2JU0A 4MN0A 4P5OE 1L2OC 1SCMB 3DVEA 1CLBA 2KFHA 3HCMA 3NSOA 4GAOA 4MSPA 1QS7A 1ZACA 1KQVA 1D1OA 2L0PA 4Q04A 2JXLA 1UURA 1YRUB 1J7QA 1PULA 2KGRA 3FWBA 3GK2A 5I2LA 1KK8B 1YUSA 4OV2A 2F2PA 4YGEB 1SKTA 1EG4A 1G33A 2NLNA 5IBWA 2LVIA 1IKUA 3LLEA 1SL9A 3BUMB 4PHJA 1F8HA 5HLVA 1AUIB 4U8DA 1TTXA 2LHIA 2BCXA 2M1KB 4YI8A 1L7ZA 3CR2A 3CS1A 3CR4X 3OP0A 2KHNA 1NPQA 5JOLA 2ZFDA 4P2YB 2QACA 1GGWA 4PALA 2I2RE 1Y1UA 3I5HB 4N5XA 1EL4A 3EK8A 1A03A 2RGIA 1K94A 3OB1B 1OMDA 3KHEA 1A4PA 1PSBA 1U5IA 2OPOA 3D0YA 5AANA 3EKJA 2MRDA 2ZNDA 4BY5A 2MLFC 1C7VA 1IJ5A 1RJVA 2HETA 2K61A 1QXPA 2JNXA 5KSZA 2M0RA 1S5GY 2I94A 1LKJA 3SG3A 4YGDB 1WRLA 2BCBA 1XVJA 2ZRSA 4GGNA 3O78A 3VRPA 1LA3A 2JXCA 1YUTA 1QLKA 1XFZO 2LLTA 3NSLA 4M2OA 4GBAA 3SJSA 1UHIA 2OTGB 2HQWA 2BECA 1YTZC 1TIZA 1B8RA 1JF0A 4MRYA 3TUYC 2K7BA 3ICBA 1K8UA 1B8LA 3WHTB 2KGBC 1YX8A 2LVJA 3CTNA 5D7FA 3SIBA 2KQYA 2F3ZA 4QJ5B 4ORCB 1NX2A 4PE0A 3DVJA 3AAJA 3DVMA 3EK4A 2KNEA 3AAKA 3BUWB 4YGCB 2IS9A 1MR8A 2NCPA 1K90D 3JVTC 1NX0A 1CDMA 1IRJA 2EC6B 4HRGA 4DUQA 2SASA 1V1GA 2EC6C 1K9KA 3JTDB 3F45A 2LE9B 4A4CA 1LXFC 3CWGA 2BCAA 4NQGA 2BE6A 1K9PA 2LLUA 1OE9B 3RLZA 1B7TY 3IF7A 3TDUA 3NSIA 2LMTA 1K95A 1KSOA 2GGZA 4HRHA 4BY4A 2LHLA 3TS5B 1HT9A 1WDCB 5K89A 2HPSA 1YURA 4YGBB 3CLNA 2LUCA 3OX5A 2PSRA 3SG6A 1B47A 3LCPC 3PLFB 5I8NA 4JWQA 2MBXA 2E6WA 1QIVA 4TNCA 5HKYA 1MWNA 5FYXA 3BUNB 1F54A 1RWYA 1UHNA 5I2OA 1M45A 4N1GA 5GQQC 1KQMC 1FBVA 4ZCUA 2QPTA 2JT0A 4GGFC 1BJFA 1F4QA 1YX7A 4JQ0D 4M2QA 1QV1A 3BQ3A 2ZNEA 4MZJA 1UHHA 3A8RA 2HQ8A 1IQ3A 5DKRA 2KI6D 1RTP1 3WNXB 1FF1A 3CR5X 3LK1A 2K2FA 2KFFA 1N2DA 3DF0A 3EVRA 3GK4X 3I5IB 4PE4A 1XFXO 1KFUL 1Y6WA 1DF0A 3TDZA 4AQIA 1SCMC 1J7OA 4YI9A 1TCOB 2WNDA 2LLSA 4M2PA 1M63B 4DS7A 2Y5IA 4CFRA 2M97A 2BL0B 2K8MB 3DD4A 1K96A 3WHUB 1BMOA 1N0YA 1AK8A 3RM1A 4PCWA 1W7JB 3O4YA 1CMFA 1SCVA 1K2HA 2K0JA 5G08A 5I2QA 1XFUO 1K9UA 1KK8C 1NCYA 2VRGA 4NDCA 5D69A 4WQ2A 2KYFA 1ZFSA 1CDNA 2M29A 3SG4A 3LL8B 1F70A 2FCDA 3EK7A 1CFCA 1OOJA 4I5NB 1WLZA 1C7WA 2PRUA 2WCEA 1KK7Z 1J55A 5J3XA 1Y0VH 1SRAA 1GQMA 2B1UA 3A4UB 1QLSA 1KFXS 4I5LB 2NCOA 2KI6C 3PN7B 1N65A 3KEVA 1CDLA 3I5HC 4PDZA 1UHKA 2CT9A 1WRZA 4MBEA 2BE4A 5AFPA 1LINA 1KWOB 1WRKA 4PHKA 1R6PA 5BPJA 2JNFA 3M0WA 1B8CA 2SCPA 4FTGA 2KYCA 2WCBA 1TNWA 2CXJA 1QVIZ 3I5GB 1TOPA 2Y1MA 3VRQA 2M3WA 3CGAA 1U5IB 1NX3A 2TN4A 3D0YB 1V1FA 3OX6A 1C07A 4R1EA 2KDHA 4WQ3A 5CSJA 1EH2A 1ZUZA 2M49B 1KFUS 4MVFA 4MZKA 3PSRA 1YUUA 2OTGC 3BXKA 1CKKA 1QASA 4FQOA 5ER4X 2LMVA 3MSEB 4DCKA 1J7RA 4GNKB 1CMGA 2JQ6A 2PALA 1WY9A 1BT6A 3E3RA 2JC2A 1OZSA 2MA2A 2V53A 4OCIA 1FPWA 1XFWO 4IL1A 2AAOA 4CLNA 1EJ3A 1NP8A 4YGAA 1QV0A 1QJTA 3GOFA 1XK4C 5CPVA 2KI4B 2OS8B 1DMOA 3FWCA 3BOWA 4PHNA 3NSKA 1RECA 4JPZB 2JT3A 1DTLA 3JTDC 1IG5A 1A29A 1S5GZ 2ZN9A 4DRWA 4WRIA 2L51A 3TZ1A 4GUKA 2M7NA 2L5XB 1CDPA 3FS7A 1YVHA 2NZ0A 2Q4UA 1NYAA 4UPGA 1CFDA 1OSAA 1NSHA 1UP5A 4N1FA 3TS5C 3H4SE 1YVLA 1NUBA 2LM5A 5HKZA 5AEQA 1JC2A 1WDCC 2ISDA 1MF8B 1DJHA 2KAVA 2LMUA 1KSMA 2AUCA 5DKQA 2GV5A 2LC5A 3LK0A 5KU1A 2AMIA 1F71A 4XJKA 1FI5A 2H61A 3VRNA 1H4BA 2WORA 1SR6B 5CSIA 4DIRA 1QIWA 1GJYA 1CLLA 4PHMA 2P6BB 2ZRTA 1DJYA 4GFTA 1CM1A 1NWDA 3IQQA 3KF9A 1OMVA 2CTNA 1B9AA 1UWOA 2MJWB 2I18A 2CNPA 1J1EA 1YR5A 4ORBB 2R2IA 3EVVA 3VGOA 2KAYA 4AOMA 1TNPA 1CFFA 1B7TZ 1F4OA 1X02A 2FJUB 1A2XA 1R2UA 3PM8A 1AJ4A 1QX2A 1GGZA 3OB2B 2F33A 2FOTA 3I5IC 4GGFA 2E30A 4OKHA 2KOTA 1XA5A 1JWDA 4MLWA 1RROA 1K93D 1IJ6A 4PE1A 1MUXA 4CIDA 1TNXA 1QX5B 1DT7B 1OZOA 1EXRA 2PASA 3WXAA 1HQVA 1B4CA 3DF0B 1CTRA 2H2KA 2PMYA 1QX7A 1S6CA 1IWQA 4QJ4B 2JWWA 2BL0C 2L4HA 5AXIA 3SIAA 4I5JA 2ZN8A 1DF0B 3AKBA 1M46A 1XFVO 1PSRA 2K2AA 1A75A 1DGUA 1KK7Y 2A4JA 1NIWA 3NXAA 4GPLB 3KO0A 1S36A 4C0LA 2BKHB 1F55A 1MHOA 1XFYO 3BUOB 1BODA 3GK1A 1JUOA 1SL7A 1E8AA 1RK9A 1YRTB 3KPXA 2Y1NA 1DVIA 4L9MA 1UUSA 1L2OB 4YBHB 5HKWA 3IQOA 3VRRA 2DOQA 4MEWA 1S26D 1PVBA 2JPTA 1M31A 1DJZA 5CSFA 1ZOTB 5AERA 1BLQA 3ZNIA 3BUXB 2K7DA 1IQ5A 3PN7C 1QVIY 4D1EA 2K7CA 3SG5A 2M7LA 1KWOC 3PFVA 1NX1A 2GGMA 5PALA 2L2EA 2LV7A 1SPYA 1AJ5A 4CPVA 1JSAA 2KBMA 1CFPA 1BF5A 3I5GC 3SG2A 1UHJA 1PK0D 3OHMB 2KAXA 4ZCVA 2CCMA 1CB1A 1S6IA 1PVAA 1TN4A 2BBMA 4NDBA 3O2PA 2I7AA 1M39A 2MAZA 1QATA 1AP4A 1FI6A 1Q80A 2KSPA 1B1GA 1KCYA 1S1EA 5DKNA 1SMGA 1ALVA 1SW8A 1BOCA 1AHRA 2L50A 1S6JA 1G4YR 1JFJA 1TNQA 2LVKA 3TDIA 1OQPA 1FW4A 2KI4C 2OS8C 1SL8A 1MXEA 3AKAA 1BU3A 1MQ1A 1VRKA 3TUYB 1PRWA 2G9BA 1SY9A 3DVKA 2F8PA 2NXQA 3BOWB 2O60A 1XK4A 2JTZA 2Q91A 2LP2A 2CBLA 2JULA 1WLMA 3D10A 5ER5A 4ICBA 4HREE 2HF5A 4AQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3P A;  2F3Y A;  3FIA A;  3VRO A;  5KTY A;  1ZMZ A;  1EG3 A;  1LVC D;  1MXL C;  2JT8 A;  2PVB A;  3C1V A;  2F2O A;  3EVU A;  3JVT B;  3PAL A;  1BR4 B;  4F0Z B;  1JFK A;  3BYA A;  2WCF A;  2KBI A;  1RFJ A;  2LVV A;  3SG7 A;  2EHB A;  5B8I B;  2LAP A;  1H8B A;  2G2B A;  1SNL A;  4A4B A;  2LNK A;  1DGV A;  1AVS A;  3EKH A;  3CZT X;  1DJW A;  1SR6 C;  2JZI A;  2MLE C;  1JBA A;  1BR1 B;  4OR9 B;  1TRF A;  2JTT A;  2WOS A;  2ZKM X;  2EGD A;  2KQ6 A;  4XJK B;  2JRF A;  2L4I A;  2K7O A;  1LA0 A;  2H61 C;  1SK6 D;  4ORA B;  5F6T A;  1SYM A;  1IGV A;  2COL B;  1NCZ A;  2LUX A;  2WC8 A;  4I5K A;  4ETO A;  1NCX A;  1CNP A;  1CM4 A;  2JOJ A;  5JJG A;  2Y4Q A;  1JF2 A;  3QRX A;  3O6B A;  2M9G A;  1XYD A;  4XYN A;  1OMR A;  5HYD A;  1ODB A;  3I5F B;  2FCE A;  2D8N A;  1KFX L;  3I5F C;  2KFG A;  3PAT A;  4HSZ A;  4QJ3 B;  4CFQ A;  1DJI A;  1KQM B;  2LCP A;  4PE7 A;  1DJX A;  1SBJ A;  1Y1A A;  1XO5 A;  5CSN A;  1J1D A;  1ALW A;  1G8I A;  2BBN A;  4MRX A;  2O5G A;  1BG1 A;  4MZL A;  1PAL A;  2LP3 A;  1Y1X A;  1QTX A;  2M8U A;  3ZWH A;  5TNC A;  1TCF A;  4C0K A;  1DJG A;  4NDD A;  5HLO A;  1W7I B;  2M1U A;  4YRU A;  2LAN A;  4USL A;  4E68 A;  1IH0 A;  3K21 A;  2L98 A;  1J7P A;  2MHH A;  4OVN F;  2BKI B;  3HX4 A;  4C0J A;  1A75 B;  1CLM A;  2JU0 A;  4MN0 A;  4P5O E;  1L2O C;  1SCM B;  3DVE A;  1CLB A;  2KFH A;  3HCM A;  3NSO A;  4GAO A;  4MSP A;  1QS7 A;  1ZAC A;  1KQV A;  1D1O A;  2L0P A;  4Q04 A;  2JXL A;  1UUR A;  1YRU B;  1J7Q A;  1PUL A;  2KGR A;  3FWB A;  3GK2 A;  5I2L A;  1KK8 B;  1YUS A;  4OV2 A;  2F2P A;  4YGE B;  1SKT A;  1EG4 A;  1G33 A;  2NLN A;  5IBW A;  2LVI A;  1IKU A;  3LLE A;  1SL9 A;  3BUM B;  4PHJ A;  1F8H A;  5HLV A;  1AUI B;  4U8D A;  1TTX A;  2LHI A;  2BCX A;  2M1K B;  4YI8 A;  1L7Z A;  3CR2 A;  3CS1 A;  3CR4 X;  3OP0 A;  2KHN A;  1NPQ A;  5JOL A;  2ZFD A;  4P2Y B;  2QAC A;  1GGW A;  4PAL A;  2I2R E;  1Y1U A;  3I5H B;  4N5X A;  1EL4 A;  3EK8 A;  1A03 A;  2RGI A;  1K94 A;  3OB1 B;  1OMD A;  3KHE A;  1A4P A;  1PSB A;  1U5I A;  2OPO A;  3D0Y A;  5AAN A;  3EKJ A;  2MRD A;  2ZND A;  4BY5 A;  2MLF C;  1C7V A;  1IJ5 A;  1RJV A;  2HET A;  2K61 A;  1QXP A;  2JNX A;  5KSZ A;  2M0R A;  1S5G Y;  2I94 A;  1LKJ A;  3SG3 A;  4YGD B;  1WRL A;  2BCB A;  1XVJ A;  2ZRS A;  4GGN A;  3O78 A;  3VRP A;  1LA3 A;  2JXC A;  1YUT A;  1QLK A;  1XFZ O;  2LLT A;  3NSL A;  4M2O A;  4GBA A;  3SJS A;  1UHI A;  2OTG B;  2HQW A;  2BEC A;  1YTZ C;  1TIZ A;  1B8R A;  1JF0 A;  4MRY A;  3TUY C;  2K7B A;  3ICB A;  1K8U A;  1B8L A;  3WHT B;  2KGB C;  1YX8 A;  2LVJ A;  3CTN A;  5D7F A;  3SIB A;  2KQY A;  2F3Z A;  4QJ5 B;  4ORC B;  1NX2 A;  4PE0 A;  3DVJ A;  3AAJ A;  3DVM A;  3EK4 A;  2KNE A;  3AAK A;  3BUW B;  4YGC B;  2IS9 A;  1MR8 A;  2NCP A;  1K90 D;  3JVT C;  1NX0 A;  1CDM A;  1IRJ A;  2EC6 B;  4HRG A;  4DUQ A;  2SAS A;  1V1G A;  2EC6 C;  1K9K A;  3JTD B;  3F45 A;  2LE9 B;  4A4C A;  1LXF C;  3CWG A;  2BCA A;  4NQG A;  2BE6 A;  1K9P A;  2LLU A;  1OE9 B;  3RLZ A;  1B7T Y;  3IF7 A;  3TDU A;  3NSI A;  2LMT A;  1K95 A;  1KSO A;  2GGZ A;  4HRH A;  4BY4 A;  2LHL A;  3TS5 B;  1HT9 A;  1WDC B;  5K89 A;  2HPS A;  1YUR A;  4YGB B;  3CLN A;  2LUC A;  3OX5 A;  2PSR A;  3SG6 A;  1B47 A;  3LCP C;  3PLF B;  5I8N A;  4JWQ A;  2MBX A;  2E6W A;  1QIV A;  4TNC A;  5HKY A;  1MWN A;  5FYX A;  3BUN B;  1F54 A;  1RWY A;  1UHN A;  5I2O A;  1M45 A;  4N1G A;  5GQQ C;  1KQM C;  1FBV A;  4ZCU A;  2QPT A;  2JT0 A;  4GGF C;  1BJF A;  1F4Q A;  1YX7 A;  4JQ0 D;  4M2Q A;  1QV1 A;  3BQ3 A;  2ZNE A;  4MZJ A;  1UHH A;  3A8R A;  2HQ8 A;  1IQ3 A;  5DKR A;  2KI6 D;  1RTP 1;  3WNX B;  1FF1 A;  3CR5 X;  3LK1 A;  2K2F A;  2KFF A;  1N2D A;  3DF0 A;  3EVR A;  3GK4 X;  3I5I B;  4PE4 A;  1XFX O;  1KFU L;  1Y6W A;  1DF0 A;  3TDZ A;  4AQI A;  1SCM C;  1J7O A;  4YI9 A;  1TCO B;  2WND A;  2LLS A;  4M2P A;  1M63 B;  4DS7 A;  2Y5I A;  4CFR A;  2M97 A;  2BL0 B;  2K8M B;  3DD4 A;  1K96 A;  3WHU B;  1BMO A;  1N0Y A;  1AK8 A;  3RM1 A;  4PCW A;  1W7J B;  3O4Y A;  1CMF A;  1SCV A;  1K2H A;  2K0J A;  5G08 A;  5I2Q A;  1XFU O;  1K9U A;  1KK8 C;  1NCY A;  2VRG A;  4NDC A;  5D69 A;  4WQ2 A;  2KYF A;  1ZFS A;  1CDN A;  2M29 A;  3SG4 A;  3LL8 B;  1F70 A;  2FCD A;  3EK7 A;  1CFC A;  1OOJ A;  4I5N B;  1WLZ A;  1C7W A;  2PRU A;  2WCE A;  1KK7 Z;  1J55 A;  5J3X A;  1Y0V H;  1SRA A;  1GQM A;  2B1U A;  3A4U B;  1QLS A;  1KFX S;  4I5L B;  2NCO A;  2KI6 C;  3PN7 B;  1N65 A;  3KEV A;  1CDL A;  3I5H C;  4PDZ A;  1UHK A;  2CT9 A;  1WRZ A;  4MBE A;  2BE4 A;  5AFP A;  1LIN A;  1KWO B;  1WRK A;  4PHK A;  1R6P A;  5BPJ A;  2JNF A;  3M0W A;  1B8C A;  2SCP A;  4FTG A;  2KYC A;  2WCB A;  1TNW A;  2CXJ A;  1QVI Z;  3I5G B;  1TOP A;  2Y1M A;  3VRQ A;  2M3W A;  3CGA A;  1U5I B;  1NX3 A;  2TN4 A;  3D0Y B;  1V1F A;  3OX6 A;  1C07 A;  4R1E A;  2KDH A;  4WQ3 A;  5CSJ A;  1EH2 A;  1ZUZ A;  2M49 B;  1KFU S;  4MVF A;  4MZK A;  3PSR A;  1YUU A;  2OTG C;  3BXK A;  1CKK A;  1QAS A;  4FQO A;  5ER4 X;  2LMV A;  3MSE B;  4DCK A;  1J7R A;  4GNK B;  1CMG A;  2JQ6 A;  2PAL A;  1WY9 A;  1BT6 A;  3E3R A;  2JC2 A;  1OZS A;  2MA2 A;  2V53 A;  4OCI A;  1FPW A;  1XFW O;  4IL1 A;  2AAO A;  4CLN A;  1EJ3 A;  1NP8 A;  4YGA A;  1QV0 A;  1QJT A;  3GOF A;  1XK4 C;  5CPV A;  2KI4 B;  2OS8 B;  1DMO A;  3FWC A;  3BOW A;  4PHN A;  3NSK A;  1REC A;  4JPZ B;  2JT3 A;  1DTL A;  3JTD C;  1IG5 A;  1A29 A;  1S5G Z;  2ZN9 A;  4DRW A;  4WRI A;  2L51 A;  3TZ1 A;  4GUK A;  2M7N A;  2L5X B;  1CDP A;  3FS7 A;  1YVH A;  2NZ0 A;  2Q4U A;  1NYA A;  4UPG A;  1CFD A;  1OSA A;  1NSH A;  1UP5 A;  4N1F A;  3TS5 C;  3H4S E;  1YVL A;  1NUB A;  2LM5 A;  5HKZ A;  5AEQ A;  1JC2 A;  1WDC C;  2ISD A;  1MF8 B;  1DJH A;  2KAV A;  2LMU A;  1KSM A;  2AUC A;  5DKQ A;  2GV5 A;  2LC5 A;  3LK0 A;  5KU1 A;  2AMI A;  1F71 A;  4XJK A;  1FI5 A;  2H61 A;  3VRN A;  1H4B A;  2WOR A;  1SR6 B;  5CSI A;  4DIR A;  1QIW A;  1GJY A;  1CLL A;  4PHM A;  2P6B B;  2ZRT A;  1DJY A;  4GFT A;  1CM1 A;  1NWD A;  3IQQ A;  3KF9 A;  1OMV A;  2CTN A;  1B9A A;  1UWO A;  2MJW B;  2I18 A;  2CNP A;  1J1E A;  1YR5 A;  4ORB B;  2R2I A;  3EVV A;  3VGO A;  2KAY A;  4AOM A;  1TNP A;  1CFF A;  1B7T Z;  1F4O A;  1X02 A;  2FJU B;  1A2X A;  1R2U A;  3PM8 A;  1AJ4 A;  1QX2 A;  1GGZ A;  3OB2 B;  2F33 A;  2FOT A;  3I5I C;  4GGF A;  2E30 A;  4OKH A;  2KOT A;  1XA5 A;  1JWD A;  4MLW A;  1RRO A;  1K93 D;  1IJ6 A;  4PE1 A;  1MUX A;  4CID A;  1TNX A;  1QX5 B;  1DT7 B;  1OZO A;  1EXR A;  2PAS A;  3WXA A;  1HQV A;  1B4C A;  3DF0 B;  1CTR A;  2H2K A;  2PMY A;  1QX7 A;  1S6C A;  1IWQ A;  4QJ4 B;  2JWW A;  2BL0 C;  2L4H A;  5AXI A;  3SIA A;  4I5J A;  2ZN8 A;  1DF0 B;  3AKB A;  1M46 A;  1XFV O;  1PSR A;  2K2A A;  1A75 A;  1DGU A;  1KK7 Y;  2A4J A;  1NIW A;  3NXA A;  4GPL B;  3KO0 A;  1S36 A;  4C0L A;  2BKH B;  1F55 A;  1MHO A;  1XFY O;  3BUO B;  1BOD A;  3GK1 A;  1JUO A;  1SL7 A;  1E8A A;  1RK9 A;  1YRT B;  3KPX A;  2Y1N A;  1DVI A;  4L9M A;  1UUS A;  1L2O B;  4YBH B;  5HKW A;  3IQO A;  3VRR A;  2DOQ A;  4MEW A;  1S26 D;  1PVB A;  2JPT A;  1M31 A;  1DJZ A;  5CSF A;  1ZOT B;  5AER A;  1BLQ A;  3ZNI A;  3BUX B;  2K7D A;  1IQ5 A;  3PN7 C;  1QVI Y;  4D1E A;  2K7C A;  3SG5 A;  2M7L A;  1KWO C;  3PFV A;  1NX1 A;  2GGM A;  5PAL A;  2L2E A;  2LV7 A;  1SPY A;  1AJ5 A;  4CPV A;  1JSA A;  2KBM A;  1CFP A;  1BF5 A;  3I5G C;  3SG2 A;  1UHJ A;  1PK0 D;  3OHM B;  2KAX A;  4ZCV A;  2CCM A;  1CB1 A;  1S6I A;  1PVA A;  1TN4 A;  2BBM A;  4NDB A;  3O2P A;  2I7A A;  1M39 A;  2MAZ A;  1QAT A;  1AP4 A;  1FI6 A;  1Q80 A;  2KSP A;  1B1G A;  1KCY A;  1S1E A;  5DKN A;  1SMG A;  1ALV A;  1SW8 A;  1BOC A;  1AHR A;  2L50 A;  1S6J A;  1G4Y R;  1JFJ A;  1TNQ A;  2LVK A;  3TDI A;  1OQP A;  1FW4 A;  2KI4 C;  2OS8 C;  1SL8 A;  1MXE A;  3AKA A;  1BU3 A;  1MQ1 A;  1VRK A;  3TUY B;  1PRW A;  2G9B A;  1SY9 A;  3DVK A;  2F8P A;  2NXQ A;  3BOW B;  2O60 A;  1XK4 A;  2JTZ A;  2Q91 A;  2LP2 A;  2CBL A;  2JUL A;  1WLM A;  3D10 A;  5ER5 A;  4ICB A;  4HRE E;  2HF5 A;  4AQJ A; 
#chains in the Genus database with same CATH topology
 1S3P A;  2F3Y A;  3FIA A;  3VRO A;  5KTY A;  1ZMZ A;  1EG3 A;  1LVC D;  1MXL C;  2JT8 A;  2PVB A;  3C1V A;  2F2O A;  3EVU A;  3JVT B;  2KLE A;  1BR4 B;  3PAL A;  4F0Z B;  1JFK A;  1P28 A;  3BYA A;  2WCF A;  2KBI A;  1RFJ A;  2LVV A;  2QEV A;  3SG7 A;  2EHB A;  5B8I B;  2LAP A;  1H8B A;  2G2B A;  1SNL A;  2QEO A;  4A4B A;  2LNK A;  1DGV A;  1AVS A;  3EKH A;  3CZT X;  1DJW A;  1SR6 C;  2JZI A;  2MLE C;  1JBA A;  1BR1 B;  2P71 A;  4OR9 B;  1TRF A;  2JTT A;  2WOS A;  2ZKM X;  3V2L A;  2EGD A;  2KQ6 A;  4XJK B;  2JRF A;  2L4I A;  2K7O A;  3K1E A;  3S0G A;  1LA0 A;  2H61 C;  1SK6 D;  4ORA B;  1SSE B;  5F6T A;  1SYM A;  1IGV A;  2COL B;  1NCZ A;  2LUX A;  2WC8 A;  4I5K A;  4ETO A;  1NCX A;  5HL1 A;  1CNP A;  1CM4 A;  2JOJ A;  5JJG A;  2Y4Q A;  1JF2 A;  3QRX A;  1Z4H A;  2M9G A;  3O6B A;  1XYD A;  1ORG A;  1XFR A;  4XYN A;  1OMR A;  5HYD A;  3O4X A;  2P70 A;  1ODB A;  3B6X A;  2FCE A;  2D8N A;  1KFX L;  3I5F B;  2KFG A;  3I5F C;  3PAT A;  4HSZ A;  4QJ3 B;  4CFQ A;  1DJI A;  1KQM B;  2LCP A;  4PE7 A;  1DJX A;  2BNX A;  1SBJ A;  1Y1A A;  1XO5 A;  5CSN A;  1J1D A;  1ALW A;  1G8I A;  2BBN A;  4MRX A;  2O5G A;  3EG5 B;  5DIC A;  1BG1 A;  1C3Y A;  1GM0 A;  4MZL A;  1PAL A;  2LP3 A;  1Y1X A;  1QTX A;  2M8U A;  3ZWH A;  5TNC A;  1TCF A;  4C0K A;  3OBV A;  1DJG A;  4NDD A;  5HLO A;  1W7I B;  2M1U A;  4YRU A;  3S0A A;  2LAN A;  4USL A;  3BFB A;  4E68 A;  1IH0 A;  3UNW A;  2WC6 A;  2L98 A;  3K21 A;  1J7P A;  2MHH A;  4OVN F;  2BKI B;  3HX4 A;  4C0J A;  1A75 B;  1CLM A;  2JU0 A;  2WC5 A;  4MN0 A;  4P5O E;  1L2O C;  1SCM B;  3DVE A;  1TWO A;  3B88 A;  4PT1 A;  2KFH A;  3HCM A;  3PJI A;  3NSO A;  3SS5 A;  3R1P A;  4GAO A;  4MSP A;  1QS7 A;  1ZAC A;  1KQV A;  1D1O A;  2L0P A;  4Q04 A;  2JXL A;  1UUR A;  1YRU B;  1J7Q A;  1PUL A;  3D76 A;  2KGR A;  3FWB A;  3GK2 A;  5I2L A;  1KK8 B;  1YUS A;  4OV2 A;  2F2P A;  4YGE B;  1DEL A;  1SKT A;  1EG4 A;  1G33 A;  2NLN A;  5IBW A;  1IIO A;  2LVI A;  1IKU A;  3LLE A;  1SL9 A;  3BUM B;  1DEK A;  4PHJ A;  1F8H A;  3S0F A;  5HLV A;  1AUI B;  4U8D A;  1TTX A;  2LHI A;  3B86 A;  3L4L A;  2BCX A;  2M1K B;  3R72 A;  1L7Z A;  3CR2 A;  4YI8 A;  3CS1 A;  3CR4 X;  3OP0 A;  2KHN A;  1NPQ A;  5JOL A;  2ZFD A;  4P2Y B;  2QAC A;  1GGW A;  2L5Y A;  2I2R E;  1Y1U A;  3I5H B;  3N7H A;  1EL4 A;  3EK8 A;  4N5X A;  4PAL A;  2RGI A;  1K94 A;  1A03 A;  3OB1 B;  1OMD A;  3KHE A;  1A4P A;  1PSB A;  1U5I A;  2OPO A;  3D0Y A;  5AAN A;  1W9Z A;  4F7F A;  3EKJ A;  2MRD A;  2ZND A;  4BY5 A;  2MLF C;  3QME A;  3D73 A;  1IJ5 A;  1C7V A;  1RJV A;  2HET A;  2K61 A;  1QXP A;  2L2C A;  2JNX A;  5KSZ A;  2M0R A;  1S5G Y;  2I94 A;  1LKJ A;  3SG3 A;  4YGD B;  1WRL A;  2BCB A;  1XVJ A;  2ZRS A;  4GGN A;  3O78 A;  3VRP A;  1LA3 A;  2JXC A;  1YUT A;  1QLK A;  1XFZ O;  2BAP A;  2LLT A;  3NSL A;  4M2O A;  4GBA A;  3SJS A;  1UHI A;  2OTG B;  2HQW A;  2BEC A;  1YTZ C;  1TIZ A;  1B8R A;  1JF0 A;  4MRY A;  3TUY C;  2K7B A;  3ICB A;  1K8U A;  2K60 A;  1B8L A;  3WHT B;  2KGB C;  1YX8 A;  2LVJ A;  3CTN A;  5D7F A;  3SIB A;  2KQY A;  2F3Z A;  3S0B A;  4QJ5 B;  4ORC B;  1NX2 A;  4PE0 A;  3DVJ A;  3AAJ A;  3DVM A;  3EK4 A;  2KNE A;  2WCJ A;  3AAK A;  3BUW B;  4YGC B;  2IS9 A;  1MR8 A;  2NCP A;  1K90 D;  3JVT C;  1NX0 A;  1CDM A;  1IRJ A;  2EC6 B;  4HRG A;  4DUQ A;  2SAS A;  1V1G A;  2EC6 C;  1K9K A;  3JTD B;  4JKT A;  3F45 A;  2LE9 B;  4A4C A;  1LXF C;  3CWG A;  2BCA A;  4NQG A;  2BE6 A;  1K9P A;  2LLU A;  1OE9 B;  3RLZ A;  1B7T Y;  3IF7 A;  3TDU A;  3NSI A;  2LMT A;  1K95 A;  1KSO A;  2GGZ A;  4HRH A;  4BY4 A;  2LHL A;  3TS5 B;  1TUJ A;  1HT9 A;  1WDC B;  5K89 A;  2HPS A;  1YUR A;  3D74 A;  4YGB B;  3CLN A;  2LUC A;  2QDI A;  2PSR A;  3OX5 A;  1B47 A;  3LCP C;  3PLF B;  3SG6 A;  5I8N A;  4JWQ A;  2MBX A;  1CLB A;  2E6W A;  1QIV A;  4TNC A;  5HKY A;  1MWN A;  5FYX A;  3BUN B;  1F54 A;  1RWY A;  1UHN A;  5I2O A;  1M45 A;  4N1G A;  3CDN A;  5GQQ C;  1KQM C;  2PQL A;  3CZ2 A;  1FBV A;  4ZCU A;  2QPT A;  2JT0 A;  4GGF C;  1BJF A;  1F4Q A;  1YX7 A;  4JQ0 D;  4M2Q A;  1QV1 A;  3BQ3 A;  2ZNE A;  4MZJ A;  2KLD A;  3FE9 A;  1UHH A;  3A8R A;  2HQ8 A;  1IQ3 A;  5DKR A;  2KI6 D;  2QEB A;  1RTP 1;  3NHI A;  3WNX B;  1FF1 A;  3B87 A;  3CR5 X;  3LK1 A;  2K2F A;  2KFF A;  1N2D A;  3DF0 A;  3EVR A;  3GK4 X;  3I5I B;  4PE4 A;  1XFX O;  2WCH A;  1KFU L;  1Y6W A;  1DF0 A;  2ERB A;  3TDZ A;  4AQI A;  4INX A;  1SCM C;  1J7O A;  4YI9 A;  1TCO B;  2WND A;  2LLS A;  4M2P A;  1M63 B;  5FI6 A;  4DS7 A;  2Y5I A;  4CFR A;  2M97 A;  2BL0 B;  2K8M B;  3DD4 A;  1K96 A;  3WHU B;  1OOG A;  1BMO A;  1N0Y A;  1AK8 A;  3RM1 A;  4PCW A;  1OOF A;  1W7J B;  3O4Y A;  1CMF A;  1SCV A;  1K2H A;  2K0J A;  5G08 A;  5I2Q A;  1XFU O;  1K9U A;  1KK8 C;  1NCY A;  2VRG A;  4NDC A;  5D69 A;  4WQ2 A;  2KYF A;  1ZFS A;  1CDN A;  2M29 A;  3SG4 A;  3LL8 B;  1F70 A;  2FCD A;  3EK7 A;  1CFC A;  1OOJ A;  4I5N B;  1WLZ A;  1C7W A;  3D77 A;  2PRU A;  2WCE A;  1KK7 Z;  1J55 A;  5J3X A;  1Y0V H;  1SRA A;  1GQM A;  2B1U A;  3A4U B;  1QLS A;  1KFX S;  3R1V A;  4I5L B;  2NCO A;  2KI6 C;  3PN7 B;  1N65 A;  3KEV A;  1CDL A;  3I5H C;  4PDZ A;  1UHK A;  2CT9 A;  1WRZ A;  4MBE A;  2BE4 A;  5AFP A;  1LIN A;  1KWO B;  3FE6 A;  1WRK A;  4PHK A;  4IJ7 A;  1R6P A;  5BPJ A;  2JNF A;  3M0W A;  1B8C A;  2SCP A;  4FTG A;  3BFH A;  2KYC A;  2WCB A;  1TNW A;  2CXJ A;  1QVI Z;  3I5G B;  1TOP A;  2Y1M A;  3VRQ A;  2M3W A;  3CGA A;  1U5I B;  1NX3 A;  2TN4 A;  3D0Y B;  2WCK A;  1V1F A;  3OX6 A;  1C07 A;  4R1E A;  2KDH A;  4WQ3 A;  5CSJ A;  1EH2 A;  1ZUZ A;  2M49 B;  1KFU S;  4MVF A;  3NGV A;  4MZK A;  3VB1 A;  3PSR A;  1YUU A;  2OTG C;  3BXK A;  1CKK A;  1QAS A;  4FQO A;  5ER4 X;  2LMV A;  3MSE B;  4DCK A;  3Q8I A;  1J7R A;  3DY9 A;  4GNK B;  1CMG A;  2JQ6 A;  2PAL A;  5FI7 A;  5D3O A;  2KPH A;  1WY9 A;  1BT6 A;  3E3R A;  5FI2 A;  1OW4 A;  1OOH A;  1OZS A;  2JC2 A;  2MA2 A;  2V53 A;  4OCI A;  1XFW O;  3S0E A;  4IL1 A;  1FPW A;  2AAO A;  4CLN A;  1EJ3 A;  1NP8 A;  4YGA A;  1QV0 A;  1QJT A;  3GOF A;  1XK4 C;  5CPV A;  2KI4 B;  2OS8 B;  1TUZ A;  3FWC A;  3BOW A;  4PHN A;  1DMO A;  3IVT A;  3NSK A;  1REC A;  3OGN A;  4JPZ B;  2JT3 A;  3NHT A;  1C3Z A;  1DTL A;  3JTD C;  1IG5 A;  1A29 A;  1S5G Z;  2ZN9 A;  3DYE A;  4WRI A;  4DRW A;  2L51 A;  3TZ1 A;  4GUK A;  2M7N A;  2L5X B;  2PYQ A;  1CDP A;  3FS7 A;  1YVH A;  2NZ0 A;  2Q4U A;  1NYA A;  4UPG A;  1CFD A;  1OSA A;  3DXL A;  1NSH A;  1UP5 A;  4N1F A;  3TS5 C;  3H4S E;  1YVL A;  1NUB A;  2LM5 A;  3FE8 A;  5HKZ A;  5AEQ A;  3S0D A;  1WDC C;  4KYN A;  2ISD A;  3CAB A;  4OZD A;  1JC2 A;  1MF8 B;  1DJH A;  2KAV A;  3UO9 A;  2LMU A;  1KSM A;  2AUC A;  5DKQ A;  2GV5 A;  2LC5 A;  3LK0 A;  5KU1 A;  2AMI A;  1F71 A;  4XJK A;  1FI5 A;  2H61 A;  3VRN A;  1H4B A;  2WOR A;  1SR6 B;  5CSI A;  4DIR A;  1QIW A;  1LS8 A;  2JPO A;  1GJY A;  1CLL A;  4PHM A;  2P6B B;  2ZRT A;  1DJY A;  4GFT A;  1CM1 A;  1NWD A;  3IQQ A;  3KF9 A;  1OMV A;  2CTN A;  1B9A A;  1UWO A;  2MJW B;  2I18 A;  2CNP A;  1J1E A;  1YR5 A;  4ORB B;  3CZ0 A;  2R2I A;  3EVV A;  3VGO A;  2KAY A;  4AOM A;  1TNP A;  1CFF A;  1B7T Z;  1F4O A;  1X02 A;  2FJU B;  1A2X A;  3R1O A;  1R2U A;  3PM8 A;  1AJ4 A;  1QX2 A;  4JD9 A;  1GGZ A;  3OB2 B;  2F33 A;  2FOT A;  3I5I C;  4GGF A;  2E30 A;  4OKH A;  2KOT A;  1XA5 A;  1JWD A;  4MLW A;  1RRO A;  3SS4 A;  1K93 D;  1IJ6 A;  1Z2C B;  4PE1 A;  1MUX A;  3D78 A;  4CID A;  1TNX A;  1QX5 B;  1DT7 B;  1OZO A;  1EXR A;  2PAS A;  3WXA A;  1HQV A;  1B4C A;  3DF0 B;  2WCM A;  1CTR A;  2H2K A;  2PMY A;  1QX7 A;  1S6C A;  1IWQ A;  2YGU A;  4QJ4 B;  2JWW A;  2BL0 C;  2L4H A;  5AXI A;  3SIA A;  4I5J A;  2ZN8 A;  1DF0 B;  3DZT A;  5EL2 A;  3AKB A;  2WCL A;  1M46 A;  1XFV O;  1PSR A;  2K2A A;  1A75 A;  1DGU A;  1KK7 Y;  2A4J A;  1NIW A;  3NXA A;  4GPL B;  3KO0 A;  1S36 A;  4C0L A;  2BKH B;  1DC1 A;  1F55 A;  1MHO A;  1XFY O;  3BUO B;  1BOD A;  3GK1 A;  1JUO A;  1SL7 A;  1E8A A;  1RK9 A;  1YRT B;  3KPX A;  2Y1N A;  1DVI A;  4L9M A;  1UUS A;  1L2O B;  4YBH B;  5HKW A;  3IQO A;  3BJH A;  3VRR A;  2DOQ A;  4MEW A;  1S26 D;  1PVB A;  5I94 A;  2JPT A;  1M31 A;  1DJZ A;  5CSF A;  1ZOT B;  3L47 A;  4INW A;  5AER A;  1BLQ A;  3ZNI A;  3BUX B;  1DQE A;  1IQ5 A;  2K7D A;  3PN7 C;  1QVI Y;  3RZS A;  4D1E A;  2K7C A;  3SG5 A;  2M7L A;  1KWO C;  3PFV A;  3PM2 A;  1NX1 A;  2GGM A;  5PAL A;  2L2E A;  2LV7 A;  1SPY A;  1AJ5 A;  4CPV A;  1JSA A;  2KBM A;  1CFP A;  1BF5 A;  3I5G C;  3SG2 A;  1UHJ A;  4FQT A;  1PK0 D;  3OHM B;  2KAX A;  4ZCV A;  2CCM A;  1CB1 A;  1S6I A;  1PVA A;  3CZ1 A;  1TN4 A;  2BBM A;  4NDB A;  3O2P A;  2I7A A;  1M39 A;  2MAZ A;  1QWV A;  1QAT A;  3BFA A;  1AP4 A;  1Q80 A;  3B7A A;  1FI6 A;  2KSP A;  1B1G A;  1KCY A;  1S1E A;  2GTE A;  5DKN A;  1SMG A;  1ALV A;  1SW8 A;  3SS3 A;  1BOC A;  1AHR A;  2L50 A;  1S6J A;  1G4Y R;  2H8V A;  1JFJ A;  2QEH A;  1TNQ A;  2LVK A;  3TDI A;  1OQP A;  3L4A A;  1FW4 A;  2KI4 C;  2FJY A;  1SL8 A;  1MXE A;  2OS8 C;  3AKA A;  3D75 A;  1OOI X;  3CYZ A;  1BU3 A;  1MQ1 A;  1VRK A;  3TUY B;  1PRW A;  2G9B A;  1SY9 A;  3DVK A;  2F8P A;  2NXQ A;  1T14 A;  2O60 A;  3BOW B;  1XK4 A;  2JTZ A;  2Q91 A;  2LP2 A;  2CBL A;  2JUL A;  1WLM A;  3D10 A;  5ER5 A;  4ICB A;  4HRE E;  2HF5 A;  4AQJ A; 
#chains in the Genus database with same CATH homology
 1S3P A;  2F3Y A;  3FIA A;  3VRO A;  5KTY A;  1ZMZ A;  1EG3 A;  1LVC D;  1MXL C;  2JT8 A;  2PVB A;  3C1V A;  2F2O A;  3EVU A;  3JVT B;  3PAL A;  1BR4 B;  4F0Z B;  1JFK A;  3BYA A;  2WCF A;  2KBI A;  1RFJ A;  2LVV A;  3SG7 A;  2EHB A;  5B8I B;  2LAP A;  1H8B A;  2G2B A;  1SNL A;  4A4B A;  2LNK A;  1DGV A;  1AVS A;  3EKH A;  3CZT X;  1DJW A;  1SR6 C;  2JZI A;  2MLE C;  1JBA A;  1BR1 B;  4OR9 B;  1TRF A;  2JTT A;  2WOS A;  2ZKM X;  2EGD A;  2KQ6 A;  4XJK B;  2JRF A;  2L4I A;  2K7O A;  1LA0 A;  2H61 C;  1SK6 D;  4ORA B;  5F6T A;  1SYM A;  1IGV A;  2COL B;  1NCZ A;  2LUX A;  2WC8 A;  4I5K A;  4ETO A;  1NCX A;  1CNP A;  1CM4 A;  2JOJ A;  5JJG A;  2Y4Q A;  1JF2 A;  3QRX A;  3O6B A;  2M9G A;  1XYD A;  4XYN A;  1OMR A;  5HYD A;  1ODB A;  3I5F B;  2FCE A;  2D8N A;  1KFX L;  3I5F C;  2KFG A;  3PAT A;  4HSZ A;  4QJ3 B;  4CFQ A;  1DJI A;  1KQM B;  2LCP A;  4PE7 A;  1DJX A;  1SBJ A;  1Y1A A;  1XO5 A;  5CSN A;  1J1D A;  1ALW A;  1G8I A;  2BBN A;  4MRX A;  2O5G A;  1BG1 A;  4MZL A;  1PAL A;  2LP3 A;  1Y1X A;  1QTX A;  2M8U A;  3ZWH A;  5TNC A;  1TCF A;  4C0K A;  1DJG A;  4NDD A;  5HLO A;  1W7I B;  2M1U A;  4YRU A;  2LAN A;  4USL A;  4E68 A;  1IH0 A;  3K21 A;  2L98 A;  1J7P A;  2MHH A;  4OVN F;  2BKI B;  3HX4 A;  4C0J A;  1A75 B;  1CLM A;  2JU0 A;  4MN0 A;  4P5O E;  1L2O C;  1SCM B;  3DVE A;  1CLB A;  2KFH A;  3HCM A;  3NSO A;  4GAO A;  4MSP A;  1QS7 A;  1ZAC A;  1KQV A;  1D1O A;  2L0P A;  4Q04 A;  2JXL A;  1UUR A;  1YRU B;  1J7Q A;  1PUL A;  2KGR A;  3FWB A;  3GK2 A;  5I2L A;  1KK8 B;  1YUS A;  4OV2 A;  2F2P A;  4YGE B;  1SKT A;  1EG4 A;  1G33 A;  2NLN A;  5IBW A;  2LVI A;  1IKU A;  3LLE A;  1SL9 A;  3BUM B;  4PHJ A;  1F8H A;  5HLV A;  1AUI B;  4U8D A;  1TTX A;  2LHI A;  2BCX A;  2M1K B;  4YI8 A;  1L7Z A;  3CR2 A;  3CS1 A;  3CR4 X;  3OP0 A;  2KHN A;  1NPQ A;  5JOL A;  2ZFD A;  4P2Y B;  2QAC A;  1GGW A;  4PAL A;  2I2R E;  1Y1U A;  3I5H B;  4N5X A;  1EL4 A;  3EK8 A;  1A03 A;  2RGI A;  1K94 A;  3OB1 B;  1OMD A;  3KHE A;  1A4P A;  1PSB A;  1U5I A;  2OPO A;  3D0Y A;  5AAN A;  3EKJ A;  2MRD A;  2ZND A;  4BY5 A;  2MLF C;  1C7V A;  1IJ5 A;  1RJV A;  2HET A;  2K61 A;  1QXP A;  2JNX A;  5KSZ A;  2M0R A;  1S5G Y;  2I94 A;  1LKJ A;  3SG3 A;  4YGD B;  1WRL A;  2BCB A;  1XVJ A;  2ZRS A;  4GGN A;  3O78 A;  3VRP A;  1LA3 A;  2JXC A;  1YUT A;  1QLK A;  1XFZ O;  2LLT A;  3NSL A;  4M2O A;  4GBA A;  3SJS A;  1UHI A;  2OTG B;  2HQW A;  2BEC A;  1YTZ C;  1TIZ A;  1B8R A;  1JF0 A;  4MRY A;  3TUY C;  2K7B A;  3ICB A;  1K8U A;  1B8L A;  3WHT B;  2KGB C;  1YX8 A;  2LVJ A;  3CTN A;  5D7F A;  3SIB A;  2KQY A;  2F3Z A;  4QJ5 B;  4ORC B;  1NX2 A;  4PE0 A;  3DVJ A;  3AAJ A;  3DVM A;  3EK4 A;  2KNE A;  3AAK A;  3BUW B;  4YGC B;  2IS9 A;  1MR8 A;  2NCP A;  1K90 D;  3JVT C;  1NX0 A;  1CDM A;  1IRJ A;  2EC6 B;  4HRG A;  4DUQ A;  2SAS A;  1V1G A;  2EC6 C;  1K9K A;  3JTD B;  3F45 A;  2LE9 B;  4A4C A;  1LXF C;  3CWG A;  2BCA A;  4NQG A;  2BE6 A;  1K9P A;  2LLU A;  1OE9 B;  3RLZ A;  1B7T Y;  3IF7 A;  3TDU A;  3NSI A;  2LMT A;  1K95 A;  1KSO A;  2GGZ A;  4HRH A;  4BY4 A;  2LHL A;  3TS5 B;  1HT9 A;  1WDC B;  5K89 A;  2HPS A;  1YUR A;  4YGB B;  3CLN A;  2LUC A;  3OX5 A;  2PSR A;  3SG6 A;  1B47 A;  3LCP C;  3PLF B;  5I8N A;  4JWQ A;  2MBX A;  2E6W A;  1QIV A;  4TNC A;  5HKY A;  1MWN A;  5FYX A;  3BUN B;  1F54 A;  1RWY A;  1UHN A;  5I2O A;  1M45 A;  4N1G A;  5GQQ C;  1KQM C;  1FBV A;  4ZCU A;  2QPT A;  2JT0 A;  4GGF C;  1BJF A;  1F4Q A;  1YX7 A;  4JQ0 D;  4M2Q A;  1QV1 A;  3BQ3 A;  2ZNE A;  4MZJ A;  1UHH A;  3A8R A;  2HQ8 A;  1IQ3 A;  5DKR A;  2KI6 D;  1RTP 1;  3WNX B;  1FF1 A;  3CR5 X;  3LK1 A;  2K2F A;  2KFF A;  1N2D A;  3DF0 A;  3EVR A;  3GK4 X;  3I5I B;  4PE4 A;  1XFX O;  1KFU L;  1Y6W A;  1DF0 A;  3TDZ A;  4AQI A;  1SCM C;  1J7O A;  4YI9 A;  1TCO B;  2WND A;  2LLS A;  4M2P A;  1M63 B;  4DS7 A;  2Y5I A;  4CFR A;  2M97 A;  2BL0 B;  2K8M B;  3DD4 A;  1K96 A;  3WHU B;  1BMO A;  1N0Y A;  1AK8 A;  3RM1 A;  4PCW A;  1W7J B;  3O4Y A;  1CMF A;  1SCV A;  1K2H A;  2K0J A;  5G08 A;  5I2Q A;  1XFU O;  1K9U A;  1KK8 C;  1NCY A;  2VRG A;  4NDC A;  5D69 A;  4WQ2 A;  2KYF A;  1ZFS A;  1CDN A;  2M29 A;  3SG4 A;  3LL8 B;  1F70 A;  2FCD A;  3EK7 A;  1CFC A;  1OOJ A;  4I5N B;  1WLZ A;  1C7W A;  2PRU A;  2WCE A;  1KK7 Z;  1J55 A;  5J3X A;  1Y0V H;  1SRA A;  1GQM A;  2B1U A;  3A4U B;  1QLS A;  1KFX S;  4I5L B;  2NCO A;  2KI6 C;  3PN7 B;  1N65 A;  3KEV A;  1CDL A;  3I5H C;  4PDZ A;  1UHK A;  2CT9 A;  1WRZ A;  4MBE A;  2BE4 A;  5AFP A;  1LIN A;  1KWO B;  1WRK A;  4PHK A;  1R6P A;  5BPJ A;  2JNF A;  3M0W A;  1B8C A;  2SCP A;  4FTG A;  2KYC A;  2WCB A;  1TNW A;  2CXJ A;  1QVI Z;  3I5G B;  1TOP A;  2Y1M A;  3VRQ A;  2M3W A;  3CGA A;  1U5I B;  1NX3 A;  2TN4 A;  3D0Y B;  1V1F A;  3OX6 A;  1C07 A;  4R1E A;  2KDH A;  4WQ3 A;  5CSJ A;  1EH2 A;  1ZUZ A;  2M49 B;  1KFU S;  4MVF A;  4MZK A;  3PSR A;  1YUU A;  2OTG C;  3BXK A;  1CKK A;  1QAS A;  4FQO A;  5ER4 X;  2LMV A;  3MSE B;  4DCK A;  1J7R A;  4GNK B;  1CMG A;  2JQ6 A;  2PAL A;  1WY9 A;  1BT6 A;  3E3R A;  2JC2 A;  1OZS A;  2MA2 A;  2V53 A;  4OCI A;  1FPW A;  1XFW O;  4IL1 A;  2AAO A;  4CLN A;  1EJ3 A;  1NP8 A;  4YGA A;  1QV0 A;  1QJT A;  3GOF A;  1XK4 C;  5CPV A;  2KI4 B;  2OS8 B;  1DMO A;  3FWC A;  3BOW A;  4PHN A;  3NSK A;  1REC A;  4JPZ B;  2JT3 A;  1DTL A;  3JTD C;  1IG5 A;  1A29 A;  1S5G Z;  2ZN9 A;  4DRW A;  4WRI A;  2L51 A;  3TZ1 A;  4GUK A;  2M7N A;  2L5X B;  1CDP A;  3FS7 A;  1YVH A;  2NZ0 A;  2Q4U A;  1NYA A;  4UPG A;  1CFD A;  1OSA A;  1NSH A;  1UP5 A;  4N1F A;  3TS5 C;  3H4S E;  1YVL A;  1NUB A;  2LM5 A;  5HKZ A;  5AEQ A;  1JC2 A;  1WDC C;  2ISD A;  1MF8 B;  1DJH A;  2KAV A;  2LMU A;  1KSM A;  2AUC A;  5DKQ A;  2GV5 A;  2LC5 A;  3LK0 A;  5KU1 A;  2AMI A;  1F71 A;  4XJK A;  1FI5 A;  2H61 A;  3VRN A;  1H4B A;  2WOR A;  1SR6 B;  5CSI A;  4DIR A;  1QIW A;  1GJY A;  1CLL A;  4PHM A;  2P6B B;  2ZRT A;  1DJY A;  4GFT A;  1CM1 A;  1NWD A;  3IQQ A;  3KF9 A;  1OMV A;  2CTN A;  1B9A A;  1UWO A;  2MJW B;  2I18 A;  2CNP A;  1J1E A;  1YR5 A;  4ORB B;  2R2I A;  3EVV A;  3VGO A;  2KAY A;  4AOM A;  1TNP A;  1CFF A;  1B7T Z;  1F4O A;  1X02 A;  2FJU B;  1A2X A;  1R2U A;  3PM8 A;  1AJ4 A;  1QX2 A;  1GGZ A;  3OB2 B;  2F33 A;  2FOT A;  3I5I C;  4GGF A;  2E30 A;  4OKH A;  2KOT A;  1XA5 A;  1JWD A;  4MLW A;  1RRO A;  1K93 D;  1IJ6 A;  4PE1 A;  1MUX A;  4CID A;  1TNX A;  1QX5 B;  1DT7 B;  1OZO A;  1EXR A;  2PAS A;  3WXA A;  1HQV A;  1B4C A;  3DF0 B;  1CTR A;  2H2K A;  2PMY A;  1QX7 A;  1S6C A;  1IWQ A;  4QJ4 B;  2JWW A;  2BL0 C;  2L4H A;  5AXI A;  3SIA A;  4I5J A;  2ZN8 A;  1DF0 B;  3AKB A;  1M46 A;  1XFV O;  1PSR A;  2K2A A;  1A75 A;  1DGU A;  1KK7 Y;  2A4J A;  1NIW A;  3NXA A;  4GPL B;  3KO0 A;  1S36 A;  4C0L A;  2BKH B;  1F55 A;  1MHO A;  1XFY O;  3BUO B;  1BOD A;  3GK1 A;  1JUO A;  1SL7 A;  1E8A A;  1RK9 A;  1YRT B;  3KPX A;  2Y1N A;  1DVI A;  4L9M A;  1UUS A;  1L2O B;  4YBH B;  5HKW A;  3IQO A;  3VRR A;  2DOQ A;  4MEW A;  1S26 D;  1PVB A;  2JPT A;  1M31 A;  1DJZ A;  5CSF A;  1ZOT B;  5AER A;  1BLQ A;  3ZNI A;  3BUX B;  2K7D A;  1IQ5 A;  3PN7 C;  1QVI Y;  4D1E A;  2K7C A;  3SG5 A;  2M7L A;  1KWO C;  3PFV A;  1NX1 A;  2GGM A;  5PAL A;  2L2E A;  2LV7 A;  1SPY A;  1AJ5 A;  4CPV A;  1JSA A;  2KBM A;  1CFP A;  1BF5 A;  3I5G C;  3SG2 A;  1UHJ A;  1PK0 D;  3OHM B;  2KAX A;  4ZCV A;  2CCM A;  1CB1 A;  1S6I A;  1PVA A;  1TN4 A;  2BBM A;  4NDB A;  3O2P A;  2I7A A;  1M39 A;  2MAZ A;  1QAT A;  1AP4 A;  1FI6 A;  1Q80 A;  2KSP A;  1B1G A;  1KCY A;  1S1E A;  5DKN A;  1SMG A;  1ALV A;  1SW8 A;  1BOC A;  1AHR A;  2L50 A;  1S6J A;  1G4Y R;  1JFJ A;  1TNQ A;  2LVK A;  3TDI A;  1OQP A;  1FW4 A;  2KI4 C;  2OS8 C;  1SL8 A;  1MXE A;  3AKA A;  1BU3 A;  1MQ1 A;  1VRK A;  3TUY B;  1PRW A;  2G9B A;  1SY9 A;  3DVK A;  2F8P A;  2NXQ A;  3BOW B;  2O60 A;  1XK4 A;  2JTZ A;  2Q91 A;  2LP2 A;  2CBL A;  2JUL A;  1WLM A;  3D10 A;  5ER5 A;  4ICB A;  4HRE E;  2HF5 A;  4AQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...