2QDIA

Drosophila obp lush d118a mutation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENAAGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General odorant-binding protein lush
publication title Activation of pheromone-sensitive neurons is mediated by conformational activation of pheromone-binding protein.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qdiA00
1OW4A 2H8VA 3NGVA 2QEBA 1P28A 2KPHA 2P70A 1OOFA 3N7HA 3R1VA 2WCJA 2JPOA 3DYEA 5EL2A 3S0EA 2WC6A 3FE9A 3B7AA 2FJYA 2ERBA 3CZ0A 3BFHA 1C3YA 3S0AA 3V2LA 3B88A 3R72A 3FE6A 3D73A 3R1PA 3B87A 3S0DA 3CZ2A 3DZTA 1C3ZA 3R1OA 5DICA 3BFAA 2QEVA 2WC5A 3CYZA 3D74A 3D75A 3PJIA 4INWA 3QMEA 4OZDA 2WCKA 4F7FA 3B86A 2WCHA 2QEHA 1TUJA 4PT1A 3DXLA 1DQEA 2PQLA 1OOIX 2WCMA 3OGNA 3K1EA 1LS8A 3S0GA 3BFBA 3D78A 1QWVA 3D77A 3CABA 3L4LA 3D76A 4INXA 3L4AA 2WCLA 3B6XA 2P71A 1XFRA 4JD9A 2QDIA 3S0BA 3CDNA 1OOGA 3CZ1A 3Q8IA 2L2CA 1T14A 3NHIA 3NHTA 3L47A 3DY9A 3RZSA 3BJHA 1ORGA 3S0FA 4FQTA 3FE8A 1OOHA 3VB1A 1TWOA 1GM0A 2QEOA 2GTEA
chains in the Genus database with same CATH superfamily
2JC2A 1WLZA 2H61A 2KGRA 1KK7Y 3A8RA 3EVVA 4C0KA 2BNXA 2KPHA 2K7DA 3KEVA 2MJWB 1AUIB 4ZCVA 1KSMA 2KI4B 1JF2A 2JPOA 2L0PA 2WCJA 3NSIA 4YGEB 3UO9A 1B1GA 1FPWA 3RLZA 1G8IA 1KWOB 1J7RA 3C1VA 3IVTA 2KI4C 2LANA 1NCZA 2LLSA 1KWOC 4GGNA 4N1FA 1SSEB 1F70A 3I5FB 2WC8A 1J7OA 1Z2CB 1OMVA 2KBIA 2M0RA 5G08A 3K21A 2BKIB 2BECA 1NWDA 1SPYA 3I5FC 1QX7A 2JRFA 4I5NB 1BG1A 1XYDA 2PRUA 5GQQC 1IQ3A 1S5GZ 2LM5A 5IBWA 1C3YA 3R72A 3PLFB 3FE6A 1DJYA 1S6JA 5I2QA 1SCMB 1JUOA 5I2OA 3R1PA 1EG4A 3TZ1A 2K8MB 2O60A 3DZTA 3CR4X 1GGWA 1MF8B 1QX2A 1SCMC 2BL0B 3BFAA 2CNPA 3FWCA 1NX1A 3BUWB 1K9UA 2WC5A 1B8LA 1S3PA 2ZRTA 5F6TA 1W9ZA 4YGDB 2WOSA 4CLNA 1PSBA 1W7JB 1Z4HA 1WDCB 3WHTB 4OZDA 2PALA 1SR6B 3VRNA 4PE1A 1K2HA 1YX7A 3B86A 3GK2A 1S36A 1SR6C 4PT1A 1DVIA 3VGOA 1CMFA 2F3ZA 3EG5B 2ZN8A 2KI6C 1XK4A 1K95A 4I5LB 2V53A 4YI8A 2LV7A 1F54A 1H8BA 2BE6A 5D69A 1TTXA 2PMYA 1ZUZA 4WQ2A 3D78A 1SYMA 3CABA 1E8AA 1TNWA 3GK1A 1PRWA 3O4YA 1U5IB 4DS7A 1PSRA 1IGVA 2JULA 2YGUA 4JD9A 4OKHA 2FJUB 3WHUB 1ZOTB 1SW8A 1OOGA 2A4JA 2KAYA 2LMVA 2TN4A 4XJKB 4F0ZB 1CTRA 1OE9B 3PN7B 4P5OE 2JTTA 5JJGA 4OV2A 2EHBA 1QS7A 2K7OA 1BOCA 1HQVA 2L2CA 1T14A 1WRZA 3GOFA 3PN7C 2Y4QA 3TDUA 2KQYA 4AQIA 1S5GY 3D0YB 2L4IA 3E3RA 1QATA 1YRTB 1TRFA 4Q04A 5PALA 2HETA 4QJ5B 1RJVA 2K60A 1J1EA 3SS4A 2JWWA 4D1EA 4YRUA 4MRYA 2AAOA 3BUMB 1ORGA 5D7FA 3ZWHA 4PE4A 2FCDA 1RK9A 1A03A 1SMGA 2ZNEA 5AEQA 4FQTA 2LNKA 2OS8B 3FE8A 2MHHA 4PHMA 1BF5A 2JPTA 4ORCB 2LVIA 1BMOA 2GGZA 2WNDA 3LLEA 3OBVA 3SG4A 4AOMA 2KGBC 1ZACA 3ICBA 3EVRA 1KCYA 4OVNF 4P2YB 4M2OA 2LVJA 1SK6D 2K0JA 1J7QA 5K89A 1OW4A 2NCOA 3TS5B 3CTNA 1TCFA 2QEBA 3MSEB 1AP4A 2VRGA 4MVFA 4TNCA 3AAJA 3PM8A 1NIWA 2P70A 2F33A 1PVBA 4YGBB 3TS5C 2BBNA 3R1VA 3SG2A 1C07A 1DJIA 2KFHA 1IQ5A 1EL4A 1M46A 2KAVA 1WY9A 2NZ0A 1K8UA 1NCXA 4N1GA 1Y0VH 1M31A 4WRIA 1KQMB 2L51A 4BY5A 2JXCA 4OR9B 3H4SE 1WRKA 1TN4A 3HX4A 5HKYA 3FE9A 1F4QA 4AQJA 1KQMC 1Y1AA 2ISDA 4NDBA 1FF1A 4DRWA 1RECA 1KFUL 3A4UB 4UPGA 2ERBA 3CZ0A 1OZSA 5CSFA 2MBXA 4PE7A 3IF7A 1QLSA 3CR5X 2LUXA 4ETOA 1CMGA 2KQ6A 4YGCB 5HKZA 2LC5A 3LCPC 1A75B 1QLKA 1QV1A 3OHMB 3D73A 4MZJA 1FI6A 1ZMZA 1KFXL 2L5XB 1A4PA 2WORA 3CZ2A 5D3OA 1CDNA 1LXFC 4A4CA 1NP8A 3LK1A 1TOPA 1BR1B 2KFFA 2ZRSA 2PVBA 1Q80A 1DEKA 1W7IB 2I18A 2JNFA 2MLEC 3PJIA 4INWA 5KTYA 1YRUB 2WCKA 3SIAA 1JC2A 1A2XA 1YURA 2LVKA 2L2EA 3AKBA 4IL1A 1DGUA 3I5GB 3LK0A 1B7TZ 1TUJA 1U5IA 1K94A 3CZTX 3DXLA 1LKJA 1A29A 3BXKA 3I5GC 5DKRA 1QVIZ 4ORAB 4GGFC 1L2OB 2JT8A 1XFVO 1DF0B 1XFZO 3NXAA 3S0GA 4GUKA 3D77A 2LVVA 2WCBA 4INXA 1YUTA 1L2OC 1FI5A 3B6XA 1GGZA 1K96A 2LMTA 2K2AA 1SRAA 1PK0D 3M0WA 2QDIA 1RTP1 3QRXA 4MSPA 2BL0C 5B8IB 3I5IB 1NPQA 1CFDA 2F2PA 2JQ6A 2MRDA 3JTDB 4WQ3A 2D8NA 2M7LA 3CZ1A 3WXAA 1UP5A 3I5IC 2CT9A 3Q8IA 2KI6D 3DF0B 3JTDC 2L5YA 3KF9A 1KQVA 1WDCC 5CPVA 1MWNA 1B8RA 1EJ3A 3PFVA 4CIDA 1ALWA 1BU3A 1TUZA 4OCIA 3EK8A 1TNQA 4USLA 5ER5A 2JZIA 1SL7A 3DY9A 3EVUA 3RZSA 1KFUS 2I2RE 3O6BA 3PATA 1J1DA 2DOQA 5AXIA 3S0FA 2KHNA 1CDLA 1QASA 2BCXA 2M1UA 4FTGA 4PALA 2E30A 1UHKA 3OP0A 5BPJA 2JXLA 5JOLA 1UHHA 1CNPA 3UNWA 1N65A 1TNXA 2K7CA 2Y1NA 1QIWA 3BUNB 2H61C 4PCWA 4YI9A 4QJ4B 2Y5IA 1J7PA 2SASA 1B47A 5HLVA 1AVSA 3FWBA 4C0LA 2KDHA 1HT9A 5CSNA 3SG7A 4JPZB 3IQOA 1AJ5A 2BCBA 1TNPA 1B7TY 1LINA 1DC1A 1IWQA 4HSZA 3WNXB 3NGVA 2GGMA 2LLTA 4PHKA 2LHLA 1PULA 3F45A 1OOFA 1SL9A 3N7HA 4KYNA 2KFGA 1QVIY 4PDZA 1RWYA 1KK8B 3O78A 2M3WA 3EKHA 3BOWA 2Q91A 1YR5A 4BY4A 1CLBA 4U8DA 1J55A 4XYNA 1G4YR 1OMRA 2E6WA 1UWOA 1DJZA 2F8PA 1KK8C 1OMDA 1F8HA 1M63B 2B1UA 1WLMA 5DKQA 5EL2A 1CM1A 4MLWA 2M8UA 4N5XA 4ORBB 1IH0A 1IJ5A 2JT0A 2I7AA 1OQPA 2WC6A 1MQ1A 2OS8C 3EK4A 1MUXA 1Y1XA 2FJYA 2WCFA 4FQOA 1S6IA 3BFHA 1CDPA 4CFRA 2H2KA 3S0AA 3V2LA 4MBEA 2LLUA 1QX5B 1CB1A 4JQ0D 1R6PA 5AERA 1H4BA 3SS5A 1DGVA 1C3ZA 1EXRA 1IG5A 3R1OA 5DICA 2L4HA 1UHIA 2HQWA 3VROA 1SCVA 3NSOA 1NX2A 4MRXA 1M45A 2BAPA 1DTLA 4GGFA 1DELA 2LCPA 2KOTA 5HLOA 1DMOA 3CYZA 1F71A 1PVAA 1L7ZA 1KSOA 4MEWA 4MZLA 1YTZC 3SG5A 2MLFC 1D1OA 1XO5A 3NSKA 3QMEA 3GK4X 2M1KB 4F7FA 4I5JA 2LP2A 1XK4C 1EH2A 2JNXA 1ALVA 1SY9A 1GJYA 1YUUA 2M7NA 2LP3A 3DVMA 3LL8B 3PSRA 1DQEA 2WCMA 2LAPA 2LUCA 2KYFA 3OX6A 2PSRA 1F4OA 1IRJA 1NX3A 3K1EA 4NDDA 4DCKA 2FOTA 2JU0A 3KPXA 2LHIA 3TDZA 1MR8A 4GPLB 4YBHB 1TCOB 1QWVA 2QPTA 3L4LA 1FBVA 2M29A 3L4AA 1UUSA 1BR4B 2SCPA 3DVEA 1VRKA 3BUOB 1CFCA 2JOJA 1UHJA 3FS7A 4PE0A 1AHRA 2L50A 5CSIA 3CDNA 1YX8A 1QV0A 5FYXA 1CLLA 1SL8A 2ZFDA 1BODA 1BT6A 3AKAA 1V1FA 1XVJA 4E68A 2FCEA 2AUCA 3RM1A 5CSJA 1PALA 1NYAA 3OB1B 1NSHA 2KSPA 1CLMA 3L47A 1JBAA 3SS3A 3D10A 1DT7B 3HCMA 5FI7A 2I94A 2O5GA 3BJHA 4XJKA 1S6CA 1XFYO 4MN0A 1Y1UA 3SG6A 5DKNA 1IKUA 1QIVA 1WRLA 2R2IA 2K2FA 3IQQA 1JF0A 1OOHA 1XA5A 3D0YA 2NCPA 3BQ3A 1DJWA 3CGAA 3KO0A 2BE4A 3VB1A 5HL1A 2OTGB 1TWOA 1GM0A 2K7BA 2QEOA 2GTEA 2QACA 1YVHA 4DUQA 4GAOA 1SBJA 2KBMA 1XFUO 2OTGC 4NQGA 5J3XA 3SIBA 1CKKA 2M9GA 3O2PA 3VRQA 2H8VA 2NLNA 1C7VA 1P28A 4R1EA 1JWDA 5I8NA 5FI2A 1G33A 1RFJA 1QJTA 2CCMA 1UURA 1BJFA 5TNCA 1S1EA 2COLB 2EC6B 3DYEA 1B4CA 4JKTA 1R2UA 3PALA 3S0EA 4GBAA 2KLDA 1S26D 4GNKB 2EC6C 1KFXS 1ODBA 3DD4A 4NDCA 1LVCD 3CS1A 3PM2A 3B7AA 1IIOA 1QXPA 4PHJA 1SNLA 1IJ6A 1B9AA 2Q4UA 3SJSA 4HRHA 2NXQA 1CFFA 1X02A 1B8CA 5AFPA 3FIAA 3B88A 2IS9A 4CFQA 1GQMA 3DVKA 4DIRA 1MHOA 1XFWO 2ZN9A 1EG3A 2KYCA 3B87A 4ICBA 3S0DA 3CR2A 2OPOA 1N0YA 1YVLA 1K90D 2CBLA 2QEVA 3ZNIA 2HQ8A 2MA2A 2HF5A 3D74A 3D75A 4C0JA 1N2DA 1A75A 2Y1MA 2EGDA 2CTNA 4M2PA 2P6BB 3BUXB 2WCEA 2WCHA 1BLQA 3VRPA 2QEHA 3EKJA 1KK7Z 2PQLA 1OOIX 4CPVA 4QJ3B 1ZFSA 3OGNA 1M39A 1LS8A 2KLEA 2G9BA 2LE9B 3I5HB 4HREE 3EK7A 3AAKA 1Y6WA 1MXLC 3TDIA 3BFBA 3OB2B 2GV5A 1CDMA 1NUBA 3D76A 1FW4A 3JVTB 2WCLA 2JTZA 3I5HC 2P71A 4I5KA 4PHNA 1TIZA 4ZCUA 5AANA 3SG3A 1NCYA 1XFRA 1OSAA 5HKWA 2HPSA 3S0BA 3JVTC 2KNEA 4IJ7A 2BCAA 2M97A 2PYQA 3KHEA 1DF0A 1CFPA 2K61A 3CLNA 2AMIA 1K93D 1K9KA 2JT3A 5KSZA 2G2BA 1DJXA 1C7WA 4M2QA 1OOJA 2L98A 4HRGA 3NHIA 2F3YA 1RROA 2KAXA 2MAZA 4YGAA 1K9PA 1UHNA 5I2LA 3NHTA 5ER4X 1DJGA 1CM4A 1OZOA 1JFJA 1XFXO 3O4XA 3BYAA 4A4BA 1NX0A 4MZKA 5I94A 3NSLA 2CXJA 3DF0A 1YUSA 3DVJA 1F55A 2PASA 2RGIA 1LA0A 3TUYB 1JFKA 1AK8A 1V1GA 2M49B 3OX5A 2LMUA 5HYDA 3VRRA 2ZKMX 1JSAA 3CWGA 2ZNDA 2BBMA 3TUYC 1QTXA 4L9MA 4GFTA 5FI6A 1DJHA 1MXEA 1AJ4A 3BOWB 1LA3A 4JWQA 1SKTA 5KU1A 2F2OA 2BKHB
chains in the Genus database with same CATH topology
1OW4A 2H8VA 3NGVA 2QEBA 1P28A 2KPHA 2P70A 1OOFA 3N7HA 3R1VA 2WCJA 2JPOA 3DYEA 5EL2A 3S0EA 2WC6A 3FE9A 3B7AA 2FJYA 2ERBA 3CZ0A 3BFHA 1C3YA 3S0AA 3V2LA 3B88A 3R72A 3FE6A 3D73A 3R1PA 3B87A 3S0DA 3CZ2A 3DZTA 1C3ZA 3R1OA 5DICA 3BFAA 2QEVA 2WC5A 3CYZA 3D74A 3D75A 3PJIA 4INWA 3QMEA 4OZDA 2WCKA 4F7FA 3B86A 2WCHA 2QEHA 1TUJA 4PT1A 3DXLA 1DQEA 2PQLA 1OOIX 2WCMA 3OGNA 3K1EA 1LS8A 3S0GA 3BFBA 3D78A 1QWVA 3D77A 3CABA 3L4LA 3D76A 4INXA 3L4AA 2WCLA 3B6XA 2P71A 1XFRA 4JD9A 2QDIA 3S0BA 3CDNA 1OOGA 3CZ1A 3Q8IA 2L2CA 1T14A 3NHIA 3NHTA 3L47A 3DY9A 3RZSA 3BJHA 1ORGA 3S0FA 4FQTA 3FE8A 1OOHA 3VB1A 1TWOA 1GM0A 2QEOA 2GTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW4 A;  2H8V A;  3NGV A;  2QEB A;  1P28 A;  2KPH A;  2P70 A;  1OOF A;  3N7H A;  3R1V A;  2WCJ A;  2JPO A;  3DYE A;  5EL2 A;  3S0E A;  2WC6 A;  3FE9 A;  3B7A A;  2FJY A;  2ERB A;  3CZ0 A;  3BFH A;  1C3Y A;  3S0A A;  3V2L A;  3B88 A;  3R72 A;  3FE6 A;  3D73 A;  3R1P A;  3B87 A;  3S0D A;  3CZ2 A;  3DZT A;  1C3Z A;  3R1O A;  5DIC A;  3BFA A;  2QEV A;  2WC5 A;  3CYZ A;  3D74 A;  3D75 A;  3PJI A;  4INW A;  3QME A;  4OZD A;  2WCK A;  4F7F A;  3B86 A;  2WCH A;  2QEH A;  1TUJ A;  4PT1 A;  3DXL A;  1DQE A;  2PQL A;  1OOI X;  2WCM A;  3OGN A;  3K1E A;  1LS8 A;  3S0G A;  3BFB A;  3D78 A;  1QWV A;  3D77 A;  3CAB A;  3L4L A;  3D76 A;  4INX A;  3L4A A;  2WCL A;  3B6X A;  2P71 A;  1XFR A;  4JD9 A;  2QDI A;  3S0B A;  3CDN A;  1OOG A;  3CZ1 A;  3Q8I A;  2L2C A;  1T14 A;  3NHI A;  3NHT A;  3L47 A;  3DY9 A;  3RZS A;  3BJH A;  1ORG A;  3S0F A;  4FQT A;  3FE8 A;  1OOH A;  3VB1 A;  1TWO A;  1GM0 A;  2QEO A;  2GTE A; 
#chains in the Genus database with same CATH topology
 2JC2 A;  1WLZ A;  2H61 A;  2KGR A;  1KK7 Y;  3A8R A;  3EVV A;  4C0K A;  2BNX A;  2KPH A;  2K7D A;  3KEV A;  2MJW B;  1AUI B;  4ZCV A;  1KSM A;  2KI4 B;  1JF2 A;  2JPO A;  2L0P A;  2WCJ A;  3NSI A;  4YGE B;  3UO9 A;  1B1G A;  1FPW A;  3RLZ A;  1G8I A;  1KWO B;  1J7R A;  3C1V A;  3IVT A;  2KI4 C;  2LAN A;  1NCZ A;  2LLS A;  1KWO C;  4GGN A;  4N1F A;  1SSE B;  1F70 A;  3I5F B;  2WC8 A;  1J7O A;  1Z2C B;  1OMV A;  2KBI A;  2M0R A;  5G08 A;  3K21 A;  2BKI B;  2BEC A;  1NWD A;  1SPY A;  3I5F C;  1QX7 A;  2JRF A;  4I5N B;  1BG1 A;  1XYD A;  2PRU A;  5GQQ C;  1IQ3 A;  1S5G Z;  2LM5 A;  5IBW A;  1C3Y A;  3R72 A;  3PLF B;  3FE6 A;  1DJY A;  1S6J A;  5I2Q A;  1SCM B;  1JUO A;  5I2O A;  3R1P A;  1EG4 A;  3TZ1 A;  2K8M B;  2O60 A;  3DZT A;  3CR4 X;  1GGW A;  1MF8 B;  1QX2 A;  1SCM C;  2BL0 B;  3BFA A;  2CNP A;  3FWC A;  1NX1 A;  3BUW B;  1K9U A;  2WC5 A;  1B8L A;  1S3P A;  2ZRT A;  5F6T A;  1W9Z A;  4YGD B;  2WOS A;  4CLN A;  1PSB A;  1W7J B;  1Z4H A;  1WDC B;  3WHT B;  4OZD A;  2PAL A;  1SR6 B;  3VRN A;  4PE1 A;  1K2H A;  1YX7 A;  3B86 A;  3GK2 A;  1S36 A;  1SR6 C;  4PT1 A;  1DVI A;  3VGO A;  1CMF A;  2F3Z A;  3EG5 B;  2ZN8 A;  2KI6 C;  1XK4 A;  1K95 A;  4I5L B;  2V53 A;  4YI8 A;  2LV7 A;  1F54 A;  1H8B A;  2BE6 A;  5D69 A;  1TTX A;  2PMY A;  1ZUZ A;  4WQ2 A;  3D78 A;  1SYM A;  3CAB A;  1E8A A;  1TNW A;  3GK1 A;  1PRW A;  3O4Y A;  1U5I B;  4DS7 A;  1PSR A;  1IGV A;  2JUL A;  2YGU A;  4JD9 A;  4OKH A;  2FJU B;  3WHU B;  1ZOT B;  1SW8 A;  1OOG A;  2A4J A;  2KAY A;  2LMV A;  2TN4 A;  4XJK B;  4F0Z B;  1CTR A;  1OE9 B;  3PN7 B;  4P5O E;  2JTT A;  5JJG A;  4OV2 A;  2EHB A;  1QS7 A;  2K7O A;  1BOC A;  1HQV A;  2L2C A;  1T14 A;  1WRZ A;  3GOF A;  3PN7 C;  2Y4Q A;  3TDU A;  2KQY A;  4AQI A;  1S5G Y;  3D0Y B;  2L4I A;  3E3R A;  1QAT A;  1YRT B;  1TRF A;  4Q04 A;  5PAL A;  2HET A;  4QJ5 B;  1RJV A;  2K60 A;  1J1E A;  3SS4 A;  2JWW A;  4D1E A;  4YRU A;  4MRY A;  2AAO A;  3BUM B;  1ORG A;  5D7F A;  3ZWH A;  4PE4 A;  2FCD A;  1RK9 A;  1A03 A;  1SMG A;  2ZNE A;  5AEQ A;  4FQT A;  2LNK A;  2OS8 B;  3FE8 A;  2MHH A;  4PHM A;  1BF5 A;  2JPT A;  4ORC B;  2LVI A;  1BMO A;  2GGZ A;  2WND A;  3LLE A;  3OBV A;  3SG4 A;  4AOM A;  2KGB C;  1ZAC A;  3ICB A;  3EVR A;  1KCY A;  4OVN F;  4P2Y B;  4M2O A;  2LVJ A;  1SK6 D;  2K0J A;  1J7Q A;  5K89 A;  1OW4 A;  2NCO A;  3TS5 B;  3CTN A;  1TCF A;  2QEB A;  3MSE B;  1AP4 A;  2VRG A;  4MVF A;  4TNC A;  3AAJ A;  3PM8 A;  1NIW A;  2P70 A;  2F33 A;  1PVB A;  4YGB B;  3TS5 C;  2BBN A;  3R1V A;  3SG2 A;  1C07 A;  1DJI A;  2KFH A;  1IQ5 A;  1EL4 A;  1M46 A;  2KAV A;  1WY9 A;  2NZ0 A;  1K8U A;  1NCX A;  4N1G A;  1Y0V H;  1M31 A;  4WRI A;  1KQM B;  2L51 A;  4BY5 A;  2JXC A;  4OR9 B;  3H4S E;  1WRK A;  1TN4 A;  3HX4 A;  5HKY A;  3FE9 A;  1F4Q A;  4AQJ A;  1KQM C;  1Y1A A;  2ISD A;  4NDB A;  1FF1 A;  4DRW A;  1REC A;  1KFU L;  3A4U B;  4UPG A;  2ERB A;  3CZ0 A;  1OZS A;  5CSF A;  2MBX A;  4PE7 A;  3IF7 A;  1QLS A;  3CR5 X;  2LUX A;  4ETO A;  1CMG A;  2KQ6 A;  4YGC B;  5HKZ A;  2LC5 A;  3LCP C;  1A75 B;  1QLK A;  1QV1 A;  3OHM B;  3D73 A;  4MZJ A;  1FI6 A;  1ZMZ A;  1KFX L;  2L5X B;  1A4P A;  2WOR A;  3CZ2 A;  5D3O A;  1CDN A;  1LXF C;  4A4C A;  1NP8 A;  3LK1 A;  1TOP A;  1BR1 B;  2KFF A;  2ZRS A;  2PVB A;  1Q80 A;  1DEK A;  1W7I B;  2I18 A;  2JNF A;  2MLE C;  3PJI A;  4INW A;  5KTY A;  1YRU B;  2WCK A;  3SIA A;  1JC2 A;  1A2X A;  1YUR A;  2LVK A;  2L2E A;  3AKB A;  4IL1 A;  1DGU A;  3I5G B;  3LK0 A;  1B7T Z;  1TUJ A;  1U5I A;  1K94 A;  3CZT X;  3DXL A;  1LKJ A;  1A29 A;  3BXK A;  3I5G C;  5DKR A;  1QVI Z;  4ORA B;  4GGF C;  1L2O B;  2JT8 A;  1XFV O;  1DF0 B;  1XFZ O;  3NXA A;  3S0G A;  4GUK A;  3D77 A;  2LVV A;  2WCB A;  4INX A;  1YUT A;  1L2O C;  1FI5 A;  3B6X A;  1GGZ A;  1K96 A;  2LMT A;  2K2A A;  1SRA A;  1PK0 D;  3M0W A;  2QDI A;  1RTP 1;  3QRX A;  4MSP A;  2BL0 C;  5B8I B;  3I5I B;  1NPQ A;  1CFD A;  2F2P A;  2JQ6 A;  2MRD A;  3JTD B;  4WQ3 A;  2D8N A;  2M7L A;  3CZ1 A;  3WXA A;  1UP5 A;  3I5I C;  2CT9 A;  3Q8I A;  2KI6 D;  3DF0 B;  3JTD C;  2L5Y A;  3KF9 A;  1KQV A;  1WDC C;  5CPV A;  1MWN A;  1B8R A;  1EJ3 A;  3PFV A;  4CID A;  1ALW A;  1BU3 A;  1TUZ A;  4OCI A;  3EK8 A;  1TNQ A;  4USL A;  5ER5 A;  2JZI A;  1SL7 A;  3DY9 A;  3EVU A;  3RZS A;  1KFU S;  2I2R E;  3O6B A;  3PAT A;  1J1D A;  2DOQ A;  5AXI A;  3S0F A;  2KHN A;  1CDL A;  1QAS A;  2BCX A;  2M1U A;  4FTG A;  4PAL A;  2E30 A;  1UHK A;  3OP0 A;  5BPJ A;  2JXL A;  5JOL A;  1UHH A;  1CNP A;  3UNW A;  1N65 A;  1TNX A;  2K7C A;  2Y1N A;  1QIW A;  3BUN B;  2H61 C;  4PCW A;  4YI9 A;  4QJ4 B;  2Y5I A;  1J7P A;  2SAS A;  1B47 A;  5HLV A;  1AVS A;  3FWB A;  4C0L A;  2KDH A;  1HT9 A;  5CSN A;  3SG7 A;  4JPZ B;  3IQO A;  1AJ5 A;  2BCB A;  1TNP A;  1B7T Y;  1LIN A;  1DC1 A;  1IWQ A;  4HSZ A;  3WNX B;  3NGV A;  2GGM A;  2LLT A;  4PHK A;  2LHL A;  1PUL A;  3F45 A;  1OOF A;  1SL9 A;  3N7H A;  4KYN A;  2KFG A;  1QVI Y;  4PDZ A;  1RWY A;  1KK8 B;  3O78 A;  2M3W A;  3EKH A;  3BOW A;  2Q91 A;  1YR5 A;  4BY4 A;  1CLB A;  4U8D A;  1J55 A;  4XYN A;  1G4Y R;  1OMR A;  2E6W A;  1UWO A;  1DJZ A;  2F8P A;  1KK8 C;  1OMD A;  1F8H A;  1M63 B;  2B1U A;  1WLM A;  5DKQ A;  5EL2 A;  1CM1 A;  4MLW A;  2M8U A;  4N5X A;  4ORB B;  1IH0 A;  1IJ5 A;  2JT0 A;  2I7A A;  1OQP A;  2WC6 A;  1MQ1 A;  2OS8 C;  3EK4 A;  1MUX A;  1Y1X A;  2FJY A;  2WCF A;  4FQO A;  1S6I A;  3BFH A;  1CDP A;  4CFR A;  2H2K A;  3S0A A;  3V2L A;  4MBE A;  2LLU A;  1QX5 B;  1CB1 A;  4JQ0 D;  1R6P A;  5AER A;  1H4B A;  3SS5 A;  1DGV A;  1C3Z A;  1EXR A;  1IG5 A;  3R1O A;  5DIC A;  2L4H A;  1UHI A;  2HQW A;  3VRO A;  1SCV A;  3NSO A;  1NX2 A;  4MRX A;  1M45 A;  2BAP A;  1DTL A;  4GGF A;  1DEL A;  2LCP A;  2KOT A;  5HLO A;  1DMO A;  3CYZ A;  1F71 A;  1PVA A;  1L7Z A;  1KSO A;  4MEW A;  4MZL A;  1YTZ C;  3SG5 A;  2MLF C;  1D1O A;  1XO5 A;  3NSK A;  3QME A;  3GK4 X;  2M1K B;  4F7F A;  4I5J A;  2LP2 A;  1XK4 C;  1EH2 A;  2JNX A;  1ALV A;  1SY9 A;  1GJY A;  1YUU A;  2M7N A;  2LP3 A;  3DVM A;  3LL8 B;  3PSR A;  1DQE A;  2WCM A;  2LAP A;  2LUC A;  2KYF A;  3OX6 A;  2PSR A;  1F4O A;  1IRJ A;  1NX3 A;  3K1E A;  4NDD A;  4DCK A;  2FOT A;  2JU0 A;  3KPX A;  2LHI A;  3TDZ A;  1MR8 A;  4GPL B;  4YBH B;  1TCO B;  1QWV A;  2QPT A;  3L4L A;  1FBV A;  2M29 A;  3L4A A;  1UUS A;  1BR4 B;  2SCP A;  3DVE A;  1VRK A;  3BUO B;  1CFC A;  2JOJ A;  1UHJ A;  3FS7 A;  4PE0 A;  1AHR A;  2L50 A;  5CSI A;  3CDN A;  1YX8 A;  1QV0 A;  5FYX A;  1CLL A;  1SL8 A;  2ZFD A;  1BOD A;  1BT6 A;  3AKA A;  1V1F A;  1XVJ A;  4E68 A;  2FCE A;  2AUC A;  3RM1 A;  5CSJ A;  1PAL A;  1NYA A;  3OB1 B;  1NSH A;  2KSP A;  1CLM A;  3L47 A;  1JBA A;  3SS3 A;  3D10 A;  1DT7 B;  3HCM A;  5FI7 A;  2I94 A;  2O5G A;  3BJH A;  4XJK A;  1S6C A;  1XFY O;  4MN0 A;  1Y1U A;  3SG6 A;  5DKN A;  1IKU A;  1QIV A;  1WRL A;  2R2I A;  2K2F A;  3IQQ A;  1JF0 A;  1OOH A;  1XA5 A;  3D0Y A;  2NCP A;  3BQ3 A;  1DJW A;  3CGA A;  3KO0 A;  2BE4 A;  3VB1 A;  5HL1 A;  2OTG B;  1TWO A;  1GM0 A;  2K7B A;  2QEO A;  2GTE A;  2QAC A;  1YVH A;  4DUQ A;  4GAO A;  1SBJ A;  2KBM A;  1XFU O;  2OTG C;  4NQG A;  5J3X A;  3SIB A;  1CKK A;  2M9G A;  3O2P A;  3VRQ A;  2H8V A;  2NLN A;  1C7V A;  1P28 A;  4R1E A;  1JWD A;  5I8N A;  5FI2 A;  1G33 A;  1RFJ A;  1QJT A;  2CCM A;  1UUR A;  1BJF A;  5TNC A;  1S1E A;  2COL B;  2EC6 B;  3DYE A;  1B4C A;  4JKT A;  1R2U A;  3PAL A;  3S0E A;  4GBA A;  2KLD A;  1S26 D;  4GNK B;  2EC6 C;  1KFX S;  1ODB A;  3DD4 A;  4NDC A;  1LVC D;  3CS1 A;  3PM2 A;  3B7A A;  1IIO A;  1QXP A;  4PHJ A;  1SNL A;  1IJ6 A;  1B9A A;  2Q4U A;  3SJS A;  4HRH A;  2NXQ A;  1CFF A;  1X02 A;  1B8C A;  5AFP A;  3FIA A;  3B88 A;  2IS9 A;  4CFQ A;  1GQM A;  3DVK A;  4DIR A;  1MHO A;  1XFW O;  2ZN9 A;  1EG3 A;  2KYC A;  3B87 A;  4ICB A;  3S0D A;  3CR2 A;  2OPO A;  1N0Y A;  1YVL A;  1K90 D;  2CBL A;  2QEV A;  3ZNI A;  2HQ8 A;  2MA2 A;  2HF5 A;  3D74 A;  3D75 A;  4C0J A;  1N2D A;  1A75 A;  2Y1M A;  2EGD A;  2CTN A;  4M2P A;  2P6B B;  3BUX B;  2WCE A;  2WCH A;  1BLQ A;  3VRP A;  2QEH A;  3EKJ A;  1KK7 Z;  2PQL A;  1OOI X;  4CPV A;  4QJ3 B;  1ZFS A;  3OGN A;  1M39 A;  1LS8 A;  2KLE A;  2G9B A;  2LE9 B;  3I5H B;  4HRE E;  3EK7 A;  3AAK A;  1Y6W A;  1MXL C;  3TDI A;  3BFB A;  3OB2 B;  2GV5 A;  1CDM A;  1NUB A;  3D76 A;  1FW4 A;  3JVT B;  2WCL A;  2JTZ A;  3I5H C;  2P71 A;  4I5K A;  4PHN A;  1TIZ A;  4ZCU A;  5AAN A;  3SG3 A;  1NCY A;  1XFR A;  1OSA A;  5HKW A;  2HPS A;  3S0B A;  3JVT C;  2KNE A;  4IJ7 A;  2BCA A;  2M97 A;  2PYQ A;  3KHE A;  1DF0 A;  1CFP A;  2K61 A;  3CLN A;  2AMI A;  1K93 D;  1K9K A;  2JT3 A;  5KSZ A;  2G2B A;  1DJX A;  1C7W A;  4M2Q A;  1OOJ A;  2L98 A;  4HRG A;  3NHI A;  2F3Y A;  1RRO A;  2KAX A;  2MAZ A;  4YGA A;  1K9P A;  1UHN A;  5I2L A;  3NHT A;  5ER4 X;  1DJG A;  1CM4 A;  1OZO A;  1JFJ A;  1XFX O;  3O4X A;  3BYA A;  4A4B A;  1NX0 A;  4MZK A;  5I94 A;  3NSL A;  2CXJ A;  3DF0 A;  1YUS A;  3DVJ A;  1F55 A;  2PAS A;  2RGI A;  1LA0 A;  3TUY B;  1JFK A;  1AK8 A;  1V1G A;  2M49 B;  3OX5 A;  2LMU A;  5HYD A;  3VRR A;  2ZKM X;  1JSA A;  3CWG A;  2ZND A;  2BBM A;  3TUY C;  1QTX A;  4L9M A;  4GFT A;  5FI6 A;  1DJH A;  1MXE A;  1AJ4 A;  3BOW B;  1LA3 A;  4JWQ A;  1SKT A;  5KU1 A;  2F2O A;  2BKH B; 
#chains in the Genus database with same CATH homology
 1OW4 A;  2H8V A;  3NGV A;  2QEB A;  1P28 A;  2KPH A;  2P70 A;  1OOF A;  3N7H A;  3R1V A;  2WCJ A;  2JPO A;  3DYE A;  5EL2 A;  3S0E A;  2WC6 A;  3FE9 A;  3B7A A;  2FJY A;  2ERB A;  3CZ0 A;  3BFH A;  1C3Y A;  3S0A A;  3V2L A;  3B88 A;  3R72 A;  3FE6 A;  3D73 A;  3R1P A;  3B87 A;  3S0D A;  3CZ2 A;  3DZT A;  1C3Z A;  3R1O A;  5DIC A;  3BFA A;  2QEV A;  2WC5 A;  3CYZ A;  3D74 A;  3D75 A;  3PJI A;  4INW A;  3QME A;  4OZD A;  2WCK A;  4F7F A;  3B86 A;  2WCH A;  2QEH A;  1TUJ A;  4PT1 A;  3DXL A;  1DQE A;  2PQL A;  1OOI X;  2WCM A;  3OGN A;  3K1E A;  1LS8 A;  3S0G A;  3BFB A;  3D78 A;  1QWV A;  3D77 A;  3CAB A;  3L4L A;  3D76 A;  4INX A;  3L4A A;  2WCL A;  3B6X A;  2P71 A;  1XFR A;  4JD9 A;  2QDI A;  3S0B A;  3CDN A;  1OOG A;  3CZ1 A;  3Q8I A;  2L2C A;  1T14 A;  3NHI A;  3NHT A;  3L47 A;  3DY9 A;  3RZS A;  3BJH A;  1ORG A;  3S0F A;  4FQT A;  3FE8 A;  1OOH A;  3VB1 A;  1TWO A;  1GM0 A;  2QEO A;  2GTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...