2QDIA

Drosophila obp lush d118a mutation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENAAGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General odorant-binding protein lush
publication title Activation of pheromone-sensitive neurons is mediated by conformational activation of pheromone-binding protein.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qdiA00
2JPOA 1OOGA 3RZSA 3OGNA 3QMEA 3K1EA 3S0BA 3S0DA 2WC5A 2ERBA 3B88A 2QEBA 2WCKA 3DZTA 1LS8A 3N7HA 3R72A 3V2LA 2WCMA 1DQEA 3NHTA 4JD9A 1TUJA 3CDNA 4F7FA 1TWOA 3S0FA 2WC6A 2WCHA 2WCJA 3B86A 2WCLA 1OOHA 3VB1A 2QEOA 3CZ1A 5EL2A 3R1OA 3D73A 3S0GA 3Q8IA 2QEHA 2FJYA 3DXLA 3S0AA 3FE6A 3B6XA 1OW4A 3NGVA 2PQLA 1C3YA 3BFAA 3R1PA 4FQTA 1GM0A 2GTEA 3BFBA 5DICA 2P70A 2QEVA 3DYEA 1T14A 3B7AA 3CZ2A 3L47A 3NHIA 1OOFA 2P71A 1C3ZA 3D76A 3L4AA 3FE8A 3CYZA 4OZDA 3DY9A 4INWA 2QDIA 3L4LA 3B87A 3D77A 3D75A 1XFRA 3D74A 3CZ0A 2L2CA 2KPHA 3CABA 2H8VA 3BFHA 1OOIX 1QWVA 3PJIA 1P28A 3D78A 3FE9A 3R1VA 4PT1A 1ORGA 3BJHA 4INXA 3S0EA
chains in the Genus database with same CATH superfamily
3WHUB 4ORBB 1OOGA 3KO0A 4MRYA 1ZFSA 2WCFA 3I5GC 4ORAB 1XA5A 2L2EA 3QMEA 3OX5A 2ZRTA 2ZRSA 3RM1A 1U5IB 2V53A 3K1EA 5I2LA 3SIAA 1CM1A 2VRGA 4MRXA 1B8LA 5GQQC 1SK6D 2EHBA 3I5FB 1CLBA 5FI7A 1WY9A 1K94A 5D3OA 1BLQA 1RROA 1Z4HA 2JTZA 3CGAA 2CT9A 1N0YA 2L51A 1NX1A 1DJYA 2KAXA 1SCVA 1S5GZ 3N7HA 2O5GA 1NSHA 1KSMA 2CTNA 1JFJA 2WNDA 1S6CA 1Y1UA 1YVHA 5FI2A 1L2OB 2CXJA 1KQMB 4PALA 2JWWA 2LVJA 3SG3A 2K61A 3JVTC 1FI5A 1YR5A 4MLWA 2G9BA 3VRNA 3SG4A 3VRQA 4AQJA 1FBVA 3NSIA 1XK4A 2MAZA 1TWOA 3QRXA 3AKAA 1ODBA 1OQPA 4PHKA 1DVIA 1N2DA 2QEOA 4MBEA 3CZ1A 4NDCA 1AJ5A 5EL2A 1CFPA 1SW8A 1B4CA 1S1EA 1EL4A 1DJHA 3D73A 1PULA 3CTNA 1QS7A 2KI4C 1CM4A 3Q8IA 4YRUA 3SJSA 2QEHA 2BNXA 1AK8A 2BBMA 2BBNA 2FJYA 3OB1B 3FS7A 3PATA 4CPVA 3H4SE 1IG5A 1KFXS 2K7BA 3CLNA 1W7JB 4GGNA 2KLEA 3BUMB 5AANA 1JWDA 5B8IB 4A4BA 5I8NA 2LP3A 2WOSA 2Y1NA 3D10A 3NGVA 2M3WA 2JC2A 3EK7A 4GNKB 1FI6A 3MSEB 3OB2B 5KTYA 4WQ3A 4C0LA 4DUQA 1C07A 1DT7B 1A75A 4ETOA 1LINA 1ZOTB 4E68A 1M45A 2L0PA 1T14A 3B7AA 1CFCA 1UHIA 3CZ2A 3AAKA 3L47A 4N1FA 1J7QA 1ZUZA 2LANA 1C3ZA 1KFUS 3D0YB 1R2UA 2LM5A 1DF0B 1NYAA 2PYQA 2Y4QA 2KHNA 2RGIA 3SG7A 1TCFA 2K7DA 4YBHB 5CPVA 2KFHA 3L4LA 1SCMB 4MN0A 1CDMA 4YI8A 1JF2A 1K9PA 1CB1A 4I5KA 3EVVA 5CSJA 1QASA 1XFXO 5HLOA 3WNXB 3NSOA 4I5JA 1BODA 3AAJA 1CTRA 2L98A 3D74A 2BKHB 3CR2A 1AUIB 2KDHA 2LVVA 3CZ0A 1DTLA 5CSFA 1F4OA 1ZMZA 3CABA 4ICBA 4ZCVA 3BFHA 2KBMA 1NIWA 2OPOA 2ZFDA 3TDZA 1NWDA 2HF5A 4U8DA 1CNPA 3TZ1A 2JU0A 3PFVA 4YGDB 1KQVA 1D1OA 1MR8A 4YGCB 1QIVA 1A03A 1CMFA 3FE9A 3TUYC 4PT1A 1RTP1 3OP0A 4JWQA 4PE4A 1LVCD 3BQ3A 2BKIB 2NXQA 3BXKA 3EKJA 1TOPA 2ISDA 1MQ1A 1YRTB 2IS9A 4XJKA 5HYDA 2M0RA 3IF7A 3VRPA 4OKHA 2I94A 1NCZA 3RZSA 4YGAA 1MXLC 1F55A 3GOFA 3OX6A 3FIAA 2LVKA 2ZNDA 2KAYA 3M0WA 4KYNA 4C0JA 2CNPA 4DRWA 1XVJA 2ZNEA 4IJ7A 4YI9A 3S0DA 3IVTA 4ORCB 3I5FC 3CR4X 4P2YB 1GJYA 1PSRA 5DKNA 3GK2A 4YGEB 1PSBA 2F2OA 3I5IC 2K8MB 3DZTA 1ZACA 2LLTA 1C7WA 4ZCUA 2M8UA 1TUZA 4PE1A 3EVUA 2JULA 3SG6A 2WCEA 2BL0C 1LA0A 1DELA 2NZ0A 4OCIA 2M7LA 3IQQA 1TNWA 1SL9A 1Y6WA 1G33A 2ZKMX 1E8AA 1H4BA 3JTDC 1OZSA 5BPJA 2FJUB 1WDCB 2F3ZA 1B8CA 1BR1B 2MA2A 4JD9A 1EXRA 1TUJA 4UPGA 3LK1A 2GGMA 4CLNA 3NSLA 2AUCA 1KCYA 3S0FA 2WCHA 3O6BA 3B86A 1S6JA 4PE7A 1AHRA 1OOHA 2E6WA 4HRGA 1DJXA 1YVLA 3DVKA 3SG2A 5I94A 3SIBA 4MZKA 3S0GA 5KU1A 1FF1A 1QIWA 4M2OA 3GK4X 4GUKA 2Q91A 1WRKA 4NQGA 1K96A 3WHTB 2KLDA 2LC5A 2MRDA 2BCAA 5HKZA 1OE9B 1TN4A 1SKTA 3B6XA 3KPXA 1W7IB 3NSKA 4WRIA 1DJWA 2AAOA 2LP2A 4GGFA 1A75B 3UO9A 3CS1A 1AVSA 5AEQA 2KGRA 1F71A 2GTEA 1N65A 2OTGB 1YX7A 1M39A 2LMUA 1KK8B 1IJ5A 2I18A 2PASA 2QEVA 3IQOA 3PM8A 3DYEA 1XO5A 3EKHA 4AQIA 3DVMA 3WXAA 3TS5B 5IBWA 1WLMA 2JT3A 4I5NB 2BE4A 4HRHA 1SRAA 1YRUB 2JXCA 2WCBA 1NP8A 1B8RA 2FCDA 1CLMA 1RWYA 1BF5A 3SS5A 1TNXA 1DJZA 3CYZA 2BECA 3DY9A 2QDIA 4OZDA 2QACA 1XFWO 3FWBA 5D7FA 1H8BA 1Y0VH 4F0ZB 1XFZO 1IH0A 3DF0B 1QATA 3B87A 1XYDA 4C0KA 2LLUA 4FQOA 1PVBA 3VROA 2E30A 2KI6C 2M9GA 2PALA 3PSRA 1MHOA 1DC1A 1SR6C 1U5IA 2M1KB 1UHJA 1KWOC 1Q80A 2LNKA 1CLLA 1OOIX 1CKKA 4OR9B 3I5HC 2P6BB 1M46A 2JPTA 3C1VA 1RFJA 5I2QA 3R1VA 4QJ4B 1PVAA 3O78A 5ER5A 1IJ6A 1LA3A 5HL1A 2KGBC 5AFPA 1YURA 3TS5C 2GV5A 1SMGA 4R1EA 1DGUA 4DS7A 1GGZA 1IKUA 3BOWB 2M1UA 1B7TY 4GGFC 2JT8A 4BY5A 2F33A 2L4IA 1L7ZA 3S0BA 3SS3A 2EC6C 1YTZC 5JJGA 1QX2A 1EG4A 1S26D 2JOJA 2OS8C 1OOJA 2A4JA 1J55A 2KI4B 3B88A 2MBXA 5DKQA 2JRFA 1BOCA 2QEBA 1TNPA 3PN7C 4N5XA 1QX7A 3AKBA 4HSZA 1K9KA 2I2RE 3V2LA 2LHLA 2WCMA 4MZLA 2PMYA 1M63B 1DQEA 1QV0A 1UP5A 5I2OA 2LLSA 3F45A 1GGWA 5TNCA 2KQYA 1TTXA 4JPZB 3DD4A 1WDCC 2LE9B 5DKRA 1FPWA 3BYAA 1NCYA 1UURA 2K0JA 4F7FA 2D8NA 4XYNA 2WCJA 3LLEA 2WCLA 5D69A 1B7TZ 3O4XA 2KFFA 2JT0A 2PVBA 1LKJA 5F6TA 3LCPC 1OMDA 4OV2A 3ZWHA 1HT9A 2FOTA 2WORA 3D0YA 1NX2A 1SPYA 3DXLA 3S0AA 2R2IA 5FI6A 2AMIA 2H61C 3FE6A 1XFVO 1L2OC 1KQMC 3BFAA 1F54A 3R1PA 4CFRA 1K95A 1CFDA 1J1DA 2JQ6A 5CSIA 4A4CA 5DICA 1TNQA 1UUSA 1QLSA 1W9ZA 2P70A 5KSZA 1B1GA 2EGDA 1MXEA 1GQMA 1KK8C 2LMVA 4MSPA 5PALA 1V1GA 2WC8A 3TUYB 1PRWA 2HQWA 2KNEA 2K2AA 3KHEA 1IQ3A 2F8PA 2LCPA 1XFUO 3NHIA 1DEKA 1S3PA 4HREE 1OOFA 2P71A 3LK0A 3A4UB 1CDLA 1Y1XA 1JC2A 3D76A 1UHNA 1EH2A 1K2HA 3SS4A 1F4QA 3EG5B 4INWA 1MUXA 2KYFA 1BR4B 3UNWA 1YUSA 1A4PA 4JQ0D 1MF8B 3D77A 4YGBB 3CWGA 1K9UA 4I5LB 4D1EA 1QTXA 2K7OA 2KOTA 1QX5B 4N1GA 2YGUA 1KK7Y 2JXLA 3CR5X 2KPHA 4USLA 3PALA 2H8VA 4MZJA 3VRRA 1XFYO 1IIOA 2M97A 3I5IB 1VRKA 3RLZA 2G2BA 4PHNA 1Y1AA 1IRJA 1QWVA 1QXPA 2PSRA 3BUOB 2FCEA 1P28A 3OHMB 4L9MA 1J7OA 1SL8A 3ZNIA 1SL7A 1YUUA 2BL0B 4IL1A 3PLFB 1A2XA 3BUNB 1KSOA 4GBAA 4Q04A 3LL8B 3BUWB 3JTDB 2LUXA 1BU3A 5HLVA 4INXA 3S0EA 2JPOA 1BMOA 3I5GB 5CSNA 1YX8A 1SCMC 3OGNA 3SG5A 1M31A 1NPQA 1F8HA 1NUBA 1ALVA 3DVJA 1JF0A 2COLB 2F2PA 2JNFA 1UWOA 5ER4X 2CBLA 3HCMA 2WC5A 2GGZA 2KQ6A 2LUCA 2ERBA 1TCOB 1TRFA 1KK7Z 1RJVA 3FWCA 3K21A 4PCWA 5J3XA 1DMOA 1JBAA 2K60A 2K7CA 3TDIA 2WCKA 1QV1A 1ALWA 1LS8A 2JNXA 1WRLA 3R72A 3CZTX 1DJGA 4XJKB 1J7RA 4TNCA 3E3RA 2TN4A 5HKYA 2H61A 1EG3A 1K93D 3JVTB 1IGVA 1WLZA 2KYCA 1J1EA 3NHTA 1BG1A 1OMVA 2HPSA 5AXIA 5JOLA 4GAOA 1NX0A 2B1UA 2LVIA 3CDNA 4WQ2A 1QLKA 1B47A 2WC6A 4PHJA 1CDPA 3TDUA 1R6PA 4DIRA 3VB1A 2I7AA 3ICBA 5FYXA 1SSEB 2L5XB 1MWNA 1SBJA 2L5YA 3EVRA 1Z2CB 1QVIY 2JTTA 2K2FA 2M7NA 1CMGA 4PHMA 1SY9A 1C7VA 2HETA 3O4YA 3R1OA 5AERA 1J7PA 1IQ5A 2MLFC 2BCBA 2LV7A 1NCXA 2ZN8A 1A29A 3DVEA 1QJTA 1UHKA 4GFTA 2DOQA 2PRUA 1JFKA 3PM2A 1V1FA 2L4HA 4PE0A 2NCOA 2KSPA 1G8IA 4DCKA 1DGVA 2Y1MA 1OW4A 1X02A 2PQLA 3DF0A 1OMRA 1RECA 1B9AA 2L50A 1C3YA 2LHIA 1SR6B 1PALA 1XK4C 1PK0D 3KEVA 1KWOB 4P5OE 1AJ4A 4FQTA 1GM0A 2CCMA 1UHHA 3BFBA 3GK1A 4M2PA 3OBVA 3I5HB 1SNLA 1LXFC 2F3YA 1RK9A 3KF9A 3A8RA 1CFFA 1G4YR 2ZN9A 2BE6A 3EK8A 1S6IA 1TIZA 1WRZA 1QVIZ 2Q4UA 4NDBA 2MLEC 5K89A 2KBIA 4QJ3B 2KFGA 1KFXL 3L4AA 3FE8A 5G08A 1DJIA 1DF0A 1JUOA 4BY4A 1F70A 2SCPA 1BJFA 4JKTA 4PDZA 4GPLB 2H2KA 3NXAA 5HKWA 1JSAA 3D75A 2NCPA 1AP4A 1XFRA 3O2PA 2M49B 1IWQA 2EC6B 2SASA 3BOWA 2NLNA 2OS8B 2L2CA 4M2QA 1EJ3A 1FW4A 3VGOA 3BUXB 1S36A 1K8UA 2MJWB 4MVFA 4QJ5B 2KAVA 2JZIA 2OTGC 3EK4A 2BAPA 3PN7B 4MEWA 2M29A 1S5GY 4NDDA 1BT6A 2Y5IA 3PJIA 3D78A 1OSAA 4CIDA 4AOMA 2LMTA 4FTGA 2KI6D 1KFUL 1SYMA 2LAPA 2MHHA 1ORGA 4OVNF 1OZOA 1CDNA 3HX4A 3BJHA 4CFQA 2QPTA 2HQ8A 1YUTA 2O60A 1NX3A 1HQVA 2BCXA 1K90D
chains in the Genus database with same CATH topology
2JPOA 1OOGA 3RZSA 3OGNA 3QMEA 3K1EA 3S0BA 3S0DA 2WC5A 2ERBA 3B88A 2QEBA 2WCKA 3DZTA 1LS8A 3N7HA 3R72A 3V2LA 2WCMA 1DQEA 3NHTA 4JD9A 1TUJA 3CDNA 4F7FA 1TWOA 3S0FA 2WC6A 2WCHA 2WCJA 3B86A 2WCLA 1OOHA 3VB1A 2QEOA 3CZ1A 5EL2A 3R1OA 3D73A 3S0GA 3Q8IA 2QEHA 2FJYA 3DXLA 3S0AA 3FE6A 3B6XA 1OW4A 3NGVA 2PQLA 1C3YA 3BFAA 3R1PA 4FQTA 1GM0A 2GTEA 3BFBA 5DICA 2P70A 2QEVA 3DYEA 1T14A 3B7AA 3CZ2A 3L47A 3NHIA 1OOFA 2P71A 1C3ZA 3D76A 3L4AA 3FE8A 3CYZA 4OZDA 3DY9A 4INWA 2QDIA 3L4LA 3B87A 3D77A 3D75A 1XFRA 3D74A 3CZ0A 2L2CA 2KPHA 3CABA 2H8VA 3BFHA 1OOIX 1QWVA 3PJIA 1P28A 3D78A 3FE9A 3R1VA 4PT1A 1ORGA 3BJHA 4INXA 3S0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPO A;  1OOG A;  3RZS A;  3OGN A;  3QME A;  3K1E A;  3S0B A;  3S0D A;  2WC5 A;  2ERB A;  3B88 A;  2QEB A;  2WCK A;  3DZT A;  1LS8 A;  3N7H A;  3R72 A;  3V2L A;  2WCM A;  1DQE A;  3NHT A;  4JD9 A;  1TUJ A;  3CDN A;  4F7F A;  1TWO A;  3S0F A;  2WC6 A;  2WCH A;  2WCJ A;  3B86 A;  2WCL A;  1OOH A;  3VB1 A;  2QEO A;  3CZ1 A;  5EL2 A;  3R1O A;  3D73 A;  3S0G A;  3Q8I A;  2QEH A;  2FJY A;  3DXL A;  3S0A A;  3FE6 A;  3B6X A;  1OW4 A;  3NGV A;  2PQL A;  1C3Y A;  3BFA A;  3R1P A;  4FQT A;  1GM0 A;  2GTE A;  3BFB A;  5DIC A;  2P70 A;  2QEV A;  3DYE A;  1T14 A;  3B7A A;  3CZ2 A;  3L47 A;  3NHI A;  1OOF A;  2P71 A;  1C3Z A;  3D76 A;  3L4A A;  3FE8 A;  3CYZ A;  4OZD A;  3DY9 A;  4INW A;  2QDI A;  3L4L A;  3B87 A;  3D77 A;  3D75 A;  1XFR A;  3D74 A;  3CZ0 A;  2L2C A;  2KPH A;  3CAB A;  2H8V A;  3BFH A;  1OOI X;  1QWV A;  3PJI A;  1P28 A;  3D78 A;  3FE9 A;  3R1V A;  4PT1 A;  1ORG A;  3BJH A;  4INX A;  3S0E A; 
#chains in the Genus database with same CATH topology
 3WHU B;  4ORB B;  1OOG A;  3KO0 A;  4MRY A;  1ZFS A;  2WCF A;  3I5G C;  4ORA B;  1XA5 A;  2L2E A;  3QME A;  3OX5 A;  2ZRT A;  2ZRS A;  3RM1 A;  1U5I B;  2V53 A;  3K1E A;  5I2L A;  3SIA A;  1CM1 A;  2VRG A;  4MRX A;  1B8L A;  5GQQ C;  1SK6 D;  2EHB A;  3I5F B;  1CLB A;  5FI7 A;  1WY9 A;  1K94 A;  5D3O A;  1BLQ A;  1RRO A;  1Z4H A;  2JTZ A;  3CGA A;  2CT9 A;  1N0Y A;  2L51 A;  1NX1 A;  1DJY A;  2KAX A;  1SCV A;  1S5G Z;  3N7H A;  2O5G A;  1NSH A;  1KSM A;  2CTN A;  1JFJ A;  2WND A;  1S6C A;  1Y1U A;  1YVH A;  5FI2 A;  1L2O B;  2CXJ A;  1KQM B;  4PAL A;  2JWW A;  2LVJ A;  3SG3 A;  2K61 A;  3JVT C;  1FI5 A;  1YR5 A;  4MLW A;  2G9B A;  3VRN A;  3SG4 A;  3VRQ A;  4AQJ A;  1FBV A;  3NSI A;  1XK4 A;  2MAZ A;  1TWO A;  3QRX A;  3AKA A;  1ODB A;  1OQP A;  4PHK A;  1DVI A;  1N2D A;  2QEO A;  4MBE A;  3CZ1 A;  4NDC A;  1AJ5 A;  5EL2 A;  1CFP A;  1SW8 A;  1B4C A;  1S1E A;  1EL4 A;  1DJH A;  3D73 A;  1PUL A;  3CTN A;  1QS7 A;  2KI4 C;  1CM4 A;  3Q8I A;  4YRU A;  3SJS A;  2QEH A;  2BNX A;  1AK8 A;  2BBM A;  2BBN A;  2FJY A;  3OB1 B;  3FS7 A;  3PAT A;  4CPV A;  3H4S E;  1IG5 A;  1KFX S;  2K7B A;  3CLN A;  1W7J B;  4GGN A;  2KLE A;  3BUM B;  5AAN A;  1JWD A;  5B8I B;  4A4B A;  5I8N A;  2LP3 A;  2WOS A;  2Y1N A;  3D10 A;  3NGV A;  2M3W A;  2JC2 A;  3EK7 A;  4GNK B;  1FI6 A;  3MSE B;  3OB2 B;  5KTY A;  4WQ3 A;  4C0L A;  4DUQ A;  1C07 A;  1DT7 B;  1A75 A;  4ETO A;  1LIN A;  1ZOT B;  4E68 A;  1M45 A;  2L0P A;  1T14 A;  3B7A A;  1CFC A;  1UHI A;  3CZ2 A;  3AAK A;  3L47 A;  4N1F A;  1J7Q A;  1ZUZ A;  2LAN A;  1C3Z A;  1KFU S;  3D0Y B;  1R2U A;  2LM5 A;  1DF0 B;  1NYA A;  2PYQ A;  2Y4Q A;  2KHN A;  2RGI A;  3SG7 A;  1TCF A;  2K7D A;  4YBH B;  5CPV A;  2KFH A;  3L4L A;  1SCM B;  4MN0 A;  1CDM A;  4YI8 A;  1JF2 A;  1K9P A;  1CB1 A;  4I5K A;  3EVV A;  5CSJ A;  1QAS A;  1XFX O;  5HLO A;  3WNX B;  3NSO A;  4I5J A;  1BOD A;  3AAJ A;  1CTR A;  2L98 A;  3D74 A;  2BKH B;  3CR2 A;  1AUI B;  2KDH A;  2LVV A;  3CZ0 A;  1DTL A;  5CSF A;  1F4O A;  1ZMZ A;  3CAB A;  4ICB A;  4ZCV A;  3BFH A;  2KBM A;  1NIW A;  2OPO A;  2ZFD A;  3TDZ A;  1NWD A;  2HF5 A;  4U8D A;  1CNP A;  3TZ1 A;  2JU0 A;  3PFV A;  4YGD B;  1KQV A;  1D1O A;  1MR8 A;  4YGC B;  1QIV A;  1A03 A;  1CMF A;  3FE9 A;  3TUY C;  4PT1 A;  1RTP 1;  3OP0 A;  4JWQ A;  4PE4 A;  1LVC D;  3BQ3 A;  2BKI B;  2NXQ A;  3BXK A;  3EKJ A;  1TOP A;  2ISD A;  1MQ1 A;  1YRT B;  2IS9 A;  4XJK A;  5HYD A;  2M0R A;  3IF7 A;  3VRP A;  4OKH A;  2I94 A;  1NCZ A;  3RZS A;  4YGA A;  1MXL C;  1F55 A;  3GOF A;  3OX6 A;  3FIA A;  2LVK A;  2ZND A;  2KAY A;  3M0W A;  4KYN A;  4C0J A;  2CNP A;  4DRW A;  1XVJ A;  2ZNE A;  4IJ7 A;  4YI9 A;  3S0D A;  3IVT A;  4ORC B;  3I5F C;  3CR4 X;  4P2Y B;  1GJY A;  1PSR A;  5DKN A;  3GK2 A;  4YGE B;  1PSB A;  2F2O A;  3I5I C;  2K8M B;  3DZT A;  1ZAC A;  2LLT A;  1C7W A;  4ZCU A;  2M8U A;  1TUZ A;  4PE1 A;  3EVU A;  2JUL A;  3SG6 A;  2WCE A;  2BL0 C;  1LA0 A;  1DEL A;  2NZ0 A;  4OCI A;  2M7L A;  3IQQ A;  1TNW A;  1SL9 A;  1Y6W A;  1G33 A;  2ZKM X;  1E8A A;  1H4B A;  3JTD C;  1OZS A;  5BPJ A;  2FJU B;  1WDC B;  2F3Z A;  1B8C A;  1BR1 B;  2MA2 A;  4JD9 A;  1EXR A;  1TUJ A;  4UPG A;  3LK1 A;  2GGM A;  4CLN A;  3NSL A;  2AUC A;  1KCY A;  3S0F A;  2WCH A;  3O6B A;  3B86 A;  1S6J A;  4PE7 A;  1AHR A;  1OOH A;  2E6W A;  4HRG A;  1DJX A;  1YVL A;  3DVK A;  3SG2 A;  5I94 A;  3SIB A;  4MZK A;  3S0G A;  5KU1 A;  1FF1 A;  1QIW A;  4M2O A;  3GK4 X;  4GUK A;  2Q91 A;  1WRK A;  4NQG A;  1K96 A;  3WHT B;  2KLD A;  2LC5 A;  2MRD A;  2BCA A;  5HKZ A;  1OE9 B;  1TN4 A;  1SKT A;  3B6X A;  3KPX A;  1W7I B;  3NSK A;  4WRI A;  1DJW A;  2AAO A;  2LP2 A;  4GGF A;  1A75 B;  3UO9 A;  3CS1 A;  1AVS A;  5AEQ A;  2KGR A;  1F71 A;  2GTE A;  1N65 A;  2OTG B;  1YX7 A;  1M39 A;  2LMU A;  1KK8 B;  1IJ5 A;  2I18 A;  2PAS A;  2QEV A;  3IQO A;  3PM8 A;  3DYE A;  1XO5 A;  3EKH A;  4AQI A;  3DVM A;  3WXA A;  3TS5 B;  5IBW A;  1WLM A;  2JT3 A;  4I5N B;  2BE4 A;  4HRH A;  1SRA A;  1YRU B;  2JXC A;  2WCB A;  1NP8 A;  1B8R A;  2FCD A;  1CLM A;  1RWY A;  1BF5 A;  3SS5 A;  1TNX A;  1DJZ A;  3CYZ A;  2BEC A;  3DY9 A;  2QDI A;  4OZD A;  2QAC A;  1XFW O;  3FWB A;  5D7F A;  1H8B A;  1Y0V H;  4F0Z B;  1XFZ O;  1IH0 A;  3DF0 B;  1QAT A;  3B87 A;  1XYD A;  4C0K A;  2LLU A;  4FQO A;  1PVB A;  3VRO A;  2E30 A;  2KI6 C;  2M9G A;  2PAL A;  3PSR A;  1MHO A;  1DC1 A;  1SR6 C;  1U5I A;  2M1K B;  1UHJ A;  1KWO C;  1Q80 A;  2LNK A;  1CLL A;  1OOI X;  1CKK A;  4OR9 B;  3I5H C;  2P6B B;  1M46 A;  2JPT A;  3C1V A;  1RFJ A;  5I2Q A;  3R1V A;  4QJ4 B;  1PVA A;  3O78 A;  5ER5 A;  1IJ6 A;  1LA3 A;  5HL1 A;  2KGB C;  5AFP A;  1YUR A;  3TS5 C;  2GV5 A;  1SMG A;  4R1E A;  1DGU A;  4DS7 A;  1GGZ A;  1IKU A;  3BOW B;  2M1U A;  1B7T Y;  4GGF C;  2JT8 A;  4BY5 A;  2F33 A;  2L4I A;  1L7Z A;  3S0B A;  3SS3 A;  2EC6 C;  1YTZ C;  5JJG A;  1QX2 A;  1EG4 A;  1S26 D;  2JOJ A;  2OS8 C;  1OOJ A;  2A4J A;  1J55 A;  2KI4 B;  3B88 A;  2MBX A;  5DKQ A;  2JRF A;  1BOC A;  2QEB A;  1TNP A;  3PN7 C;  4N5X A;  1QX7 A;  3AKB A;  4HSZ A;  1K9K A;  2I2R E;  3V2L A;  2LHL A;  2WCM A;  4MZL A;  2PMY A;  1M63 B;  1DQE A;  1QV0 A;  1UP5 A;  5I2O A;  2LLS A;  3F45 A;  1GGW A;  5TNC A;  2KQY A;  1TTX A;  4JPZ B;  3DD4 A;  1WDC C;  2LE9 B;  5DKR A;  1FPW A;  3BYA A;  1NCY A;  1UUR A;  2K0J A;  4F7F A;  2D8N A;  4XYN A;  2WCJ A;  3LLE A;  2WCL A;  5D69 A;  1B7T Z;  3O4X A;  2KFF A;  2JT0 A;  2PVB A;  1LKJ A;  5F6T A;  3LCP C;  1OMD A;  4OV2 A;  3ZWH A;  1HT9 A;  2FOT A;  2WOR A;  3D0Y A;  1NX2 A;  1SPY A;  3DXL A;  3S0A A;  2R2I A;  5FI6 A;  2AMI A;  2H61 C;  3FE6 A;  1XFV O;  1L2O C;  1KQM C;  3BFA A;  1F54 A;  3R1P A;  4CFR A;  1K95 A;  1CFD A;  1J1D A;  2JQ6 A;  5CSI A;  4A4C A;  5DIC A;  1TNQ A;  1UUS A;  1QLS A;  1W9Z A;  2P70 A;  5KSZ A;  1B1G A;  2EGD A;  1MXE A;  1GQM A;  1KK8 C;  2LMV A;  4MSP A;  5PAL A;  1V1G A;  2WC8 A;  3TUY B;  1PRW A;  2HQW A;  2KNE A;  2K2A A;  3KHE A;  1IQ3 A;  2F8P A;  2LCP A;  1XFU O;  3NHI A;  1DEK A;  1S3P A;  4HRE E;  1OOF A;  2P71 A;  3LK0 A;  3A4U B;  1CDL A;  1Y1X A;  1JC2 A;  3D76 A;  1UHN A;  1EH2 A;  1K2H A;  3SS4 A;  1F4Q A;  3EG5 B;  4INW A;  1MUX A;  2KYF A;  1BR4 B;  3UNW A;  1YUS A;  1A4P A;  4JQ0 D;  1MF8 B;  3D77 A;  4YGB B;  3CWG A;  1K9U A;  4I5L B;  4D1E A;  1QTX A;  2K7O A;  2KOT A;  1QX5 B;  4N1G A;  2YGU A;  1KK7 Y;  2JXL A;  3CR5 X;  2KPH A;  4USL A;  3PAL A;  2H8V A;  4MZJ A;  3VRR A;  1XFY O;  1IIO A;  2M97 A;  3I5I B;  1VRK A;  3RLZ A;  2G2B A;  4PHN A;  1Y1A A;  1IRJ A;  1QWV A;  1QXP A;  2PSR A;  3BUO B;  2FCE A;  1P28 A;  3OHM B;  4L9M A;  1J7O A;  1SL8 A;  3ZNI A;  1SL7 A;  1YUU A;  2BL0 B;  4IL1 A;  3PLF B;  1A2X A;  3BUN B;  1KSO A;  4GBA A;  4Q04 A;  3LL8 B;  3BUW B;  3JTD B;  2LUX A;  1BU3 A;  5HLV A;  4INX A;  3S0E A;  2JPO A;  1BMO A;  3I5G B;  5CSN A;  1YX8 A;  1SCM C;  3OGN A;  3SG5 A;  1M31 A;  1NPQ A;  1F8H A;  1NUB A;  1ALV A;  3DVJ A;  1JF0 A;  2COL B;  2F2P A;  2JNF A;  1UWO A;  5ER4 X;  2CBL A;  3HCM A;  2WC5 A;  2GGZ A;  2KQ6 A;  2LUC A;  2ERB A;  1TCO B;  1TRF A;  1KK7 Z;  1RJV A;  3FWC A;  3K21 A;  4PCW A;  5J3X A;  1DMO A;  1JBA A;  2K60 A;  2K7C A;  3TDI A;  2WCK A;  1QV1 A;  1ALW A;  1LS8 A;  2JNX A;  1WRL A;  3R72 A;  3CZT X;  1DJG A;  4XJK B;  1J7R A;  4TNC A;  3E3R A;  2TN4 A;  5HKY A;  2H61 A;  1EG3 A;  1K93 D;  3JVT B;  1IGV A;  1WLZ A;  2KYC A;  1J1E A;  3NHT A;  1BG1 A;  1OMV A;  2HPS A;  5AXI A;  5JOL A;  4GAO A;  1NX0 A;  2B1U A;  2LVI A;  3CDN A;  4WQ2 A;  1QLK A;  1B47 A;  2WC6 A;  4PHJ A;  1CDP A;  3TDU A;  1R6P A;  4DIR A;  3VB1 A;  2I7A A;  3ICB A;  5FYX A;  1SSE B;  2L5X B;  1MWN A;  1SBJ A;  2L5Y A;  3EVR A;  1Z2C B;  1QVI Y;  2JTT A;  2K2F A;  2M7N A;  1CMG A;  4PHM A;  1SY9 A;  1C7V A;  2HET A;  3O4Y A;  3R1O A;  5AER A;  1J7P A;  1IQ5 A;  2MLF C;  2BCB A;  2LV7 A;  1NCX A;  2ZN8 A;  1A29 A;  3DVE A;  1QJT A;  1UHK A;  4GFT A;  2DOQ A;  2PRU A;  1JFK A;  3PM2 A;  1V1F A;  2L4H A;  4PE0 A;  2NCO A;  2KSP A;  1G8I A;  4DCK A;  1DGV A;  2Y1M A;  1OW4 A;  1X02 A;  2PQL A;  3DF0 A;  1OMR A;  1REC A;  1B9A A;  2L50 A;  1C3Y A;  2LHI A;  1SR6 B;  1PAL A;  1XK4 C;  1PK0 D;  3KEV A;  1KWO B;  4P5O E;  1AJ4 A;  4FQT A;  1GM0 A;  2CCM A;  1UHH A;  3BFB A;  3GK1 A;  4M2P A;  3OBV A;  3I5H B;  1SNL A;  1LXF C;  2F3Y A;  1RK9 A;  3KF9 A;  3A8R A;  1CFF A;  1G4Y R;  2ZN9 A;  2BE6 A;  3EK8 A;  1S6I A;  1TIZ A;  1WRZ A;  1QVI Z;  2Q4U A;  4NDB A;  2MLE C;  5K89 A;  2KBI A;  4QJ3 B;  2KFG A;  1KFX L;  3L4A A;  3FE8 A;  5G08 A;  1DJI A;  1DF0 A;  1JUO A;  4BY4 A;  1F70 A;  2SCP A;  1BJF A;  4JKT A;  4PDZ A;  4GPL B;  2H2K A;  3NXA A;  5HKW A;  1JSA A;  3D75 A;  2NCP A;  1AP4 A;  1XFR A;  3O2P A;  2M49 B;  1IWQ A;  2EC6 B;  2SAS A;  3BOW A;  2NLN A;  2OS8 B;  2L2C A;  4M2Q A;  1EJ3 A;  1FW4 A;  3VGO A;  3BUX B;  1S36 A;  1K8U A;  2MJW B;  4MVF A;  4QJ5 B;  2KAV A;  2JZI A;  2OTG C;  3EK4 A;  2BAP A;  3PN7 B;  4MEW A;  2M29 A;  1S5G Y;  4NDD A;  1BT6 A;  2Y5I A;  3PJI A;  3D78 A;  1OSA A;  4CID A;  4AOM A;  2LMT A;  4FTG A;  2KI6 D;  1KFU L;  1SYM A;  2LAP A;  2MHH A;  1ORG A;  4OVN F;  1OZO A;  1CDN A;  3HX4 A;  3BJH A;  4CFQ A;  2QPT A;  2HQ8 A;  1YUT A;  2O60 A;  1NX3 A;  1HQV A;  2BCX A;  1K90 D; 
#chains in the Genus database with same CATH homology
 2JPO A;  1OOG A;  3RZS A;  3OGN A;  3QME A;  3K1E A;  3S0B A;  3S0D A;  2WC5 A;  2ERB A;  3B88 A;  2QEB A;  2WCK A;  3DZT A;  1LS8 A;  3N7H A;  3R72 A;  3V2L A;  2WCM A;  1DQE A;  3NHT A;  4JD9 A;  1TUJ A;  3CDN A;  4F7F A;  1TWO A;  3S0F A;  2WC6 A;  2WCH A;  2WCJ A;  3B86 A;  2WCL A;  1OOH A;  3VB1 A;  2QEO A;  3CZ1 A;  5EL2 A;  3R1O A;  3D73 A;  3S0G A;  3Q8I A;  2QEH A;  2FJY A;  3DXL A;  3S0A A;  3FE6 A;  3B6X A;  1OW4 A;  3NGV A;  2PQL A;  1C3Y A;  3BFA A;  3R1P A;  4FQT A;  1GM0 A;  2GTE A;  3BFB A;  5DIC A;  2P70 A;  2QEV A;  3DYE A;  1T14 A;  3B7A A;  3CZ2 A;  3L47 A;  3NHI A;  1OOF A;  2P71 A;  1C3Z A;  3D76 A;  3L4A A;  3FE8 A;  3CYZ A;  4OZD A;  3DY9 A;  4INW A;  2QDI A;  3L4L A;  3B87 A;  3D77 A;  3D75 A;  1XFR A;  3D74 A;  3CZ0 A;  2L2C A;  2KPH A;  3CAB A;  2H8V A;  3BFH A;  1OOI X;  1QWV A;  3PJI A;  1P28 A;  3D78 A;  3FE9 A;  3R1V A;  4PT1 A;  1ORG A;  3BJH A;  4INX A;  3S0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...