2QDIA

Drosophila obp lush d118a mutation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENAAGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords General odorant-binding protein lush
publication title Activation of pheromone-sensitive neurons is mediated by conformational activation of pheromone-binding protein.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qdiA00
3CYZA 1TWOA 5DICA 4INWA 4JD9A 1XFRA 2QEBA 3N7HA 2FJYA 3R72A 3BFHA 3FE6A 3CABA 3S0DA 2WCKA 3FE8A 3NHTA 3PJIA 3QMEA 3L4LA 3CZ0A 3R1OA 3OGNA 3B88A 1LS8A 1GM0A 3DYEA 3D73A 3B86A 3R1VA 1QWVA 1OW4A 3B7AA 3DXLA 2WCMA 3D75A 3VB1A 3K1EA 2WC5A 3S0BA 2PQLA 2GTEA 3BJHA 3D76A 3D78A 2WCJA 3CZ2A 4INXA 3DZTA 3BFBA 2JPOA 3L4AA 2P70A 1C3YA 3D77A 3S0AA 2WCHA 3S0EA 3L47A 1OOHA 3RZSA 2WCLA 1DQEA 2KPHA 4F7FA 1ORGA 5EL2A 1OOFA 1P28A 3Q8IA 2QEVA 2QEOA 2ERBA 3BFAA 4PT1A 3NHIA 2QDIA 2QEHA 1TUJA 1OOIX 3R1PA 3CDNA 4OZDA 3DY9A 1OOGA 1C3ZA 2WC6A 2L2CA 1T14A 3NGVA 2P71A 3CZ1A 2H8VA 3S0GA 3B6XA 3D74A 4FQTA 3B87A 3V2LA 3FE9A 3S0FA
chains in the Genus database with same CATH superfamily
1K8UA 2IS9A 2K7OA 2ZNEA 3IQQA 5DICA 4KYNA 3KPXA 1TNWA 1WLZA 3CWGA 5I94A 4PE7A 4PHNA 1BLQA 3DVMA 1S5GZ 1RJVA 2JWWA 2M49B 5CSJA 1JF2A 2OTGC 1LINA 3N7HA 2OS8C 4YRUA 1MR8A 2FJYA 3AAKA 3I5GC 1FI6A 1M63B 2BBMA 4YGAA 5KU1A 1B1GA 1FF1A 1PSRA 2P6BB 3CABA 2M7NA 3S0DA 2WCKA 2MRDA 3BQ3A 1ODBA 2H61C 2LLSA 1J1DA 3PJIA 3JTDB 3QMEA 1EXRA 2KFGA 3EK7A 2JXLA 3O78A 1SK6D 3EVVA 1SCVA 2JPTA 3LK0A 1NCXA 4HREE 4OVNF 2KDHA 2K8MB 1C7WA 1CFFA 4U8DA 4USLA 3F45A 1CLLA 4PHKA 1OW4A 4GPLB 1QVIZ 1JFJA 1W7JB 5JJGA 2F3YA 2WCMA 1JUOA 1JBAA 2LC5A 4M2PA 4M2OA 3S0BA 4UPGA 2PQLA 1QX2A 2K7BA 1MUXA 3BJHA 1JSAA 2LE9B 2L4IA 3D76A 3D78A 2KAYA 1KQMC 1Q80A 1R6PA 3I5GB 2D8NA 1CMGA 4INXA 1IQ5A 1DEKA 2M0RA 1AVSA 1B8LA 4TNCA 1UP5A 2KBIA 2PYQA 1D1OA 1SMGA 2LHLA 1XA5A 4JKTA 1C7VA 2LANA 3CR4X 2M1KB 2KOTA 1CLBA 4MRYA 1DVIA 3NSIA 1KFUS 2P70A 4R1EA 1FBVA 4MN0A 1L2OB 1WRLA 2KGBC 5ER5A 1CDNA 3I5HC 3NXAA 4GGFA 2OPOA 2BE4A 3FIAA 4AOMA 4CLNA 1A4PA 4HSZA 3PM2A 3TDZA 3LK1A 3SS5A 2O5GA 2Y1MA 3E3RA 2LP2A 2KSPA 2ZN9A 2KPHA 5EL2A 1UHJA 1AUIB 3RM1A 1OOFA 1P28A 1SR6B 1SPYA 1UHKA 1K94A 1CKKA 4PALA 3Q8IA 1KQMB 1NPQA 1KFXL 1OQPA 1W7IB 2L51A 2QEVA 4C0JA 1SCMC 2KAVA 1BG1A 1CLMA 3KO0A 2LNKA 1JF0A 1RTP1 1XFVO 2ERBA 1LKJA 2JRFA 2MLFC 3LLEA 4I5KA 1H8BA 1K90D 3I5IC 1M31A 3NHIA 1J7QA 1TUJA 3OBVA 5HKYA 1WRZA 1FW4A 3R1PA 1KK8C 1WDCC 1KQVA 3OHMB 4PE4A 1CFDA 2KFHA 1SL9A 2I94A 4ORAB 2L2CA 5BPJA 1T14A 1EG3A 1BR1B 1AHRA 2FCEA 2L5XB 3BOWA 1F4OA 2SCPA 1YRTB 2M8UA 1L7ZA 4MSPA 3DD4A 4WRIA 4XYNA 1QIWA 5HL1A 2F2OA 1XFUO 1QTXA 2CNPA 1SCMB 1A75A 3PN7B 3VRPA 1J7PA 2KYCA 1XO5A 5HKWA 2K60A 3PATA 1NX1A 2KI4B 5CSNA 1CM1A 1MHOA 1IJ5A 5HLVA 5JOLA 3OX6A 4PE1A 3WHUB 2WCFA 1LA0A 2Q4UA 1EH2A 3LCPC 2ZN8A 4GBAA 1V1FA 5B8IB 2BL0C 1J7OA 2E30A 3KHEA 4PE0A 3R72A 1DC1A 3FE6A 3TUYB 1TCOB 1N65A 3BXKA 5D7FA 1IG5A 4FTGA 5AEQA 3JTDC 3O4XA 2EHBA 1A2XA 2PRUA 1PK0D 1RECA 1NYAA 3DVKA 3SG7A 1J7RA 3VROA 1DTLA 1UURA 3L4LA 4YI8A 2GGZA 2LHIA 3R1OA 2ISDA 1CM4A 1WLMA 1Y1UA 4XJKA 1IKUA 1DGUA 1LS8A 1Y1XA 1G8IA 2KFFA 4WQ3A 1C07A 1LA3A 2H2KA 1GJYA 3R1VA 5FI2A 1QWVA 2BKIB 3SG5A 5D3OA 4P5OE 3OB2B 1S26D 3DXLA 1F4QA 2PASA 1UUSA 3UNWA 2BBNA 1YRUB 2LCPA 1S5GY 1NWDA 4HRGA 1DT7B 3SJSA 2GTEA 2HETA 4I5JA 3D0YA 1F71A 4PDZA 1K93D 1KSOA 1NP8A 4CFRA 4DIRA 2Y1NA 2BL0B 5TNCA 3EG5B 1DJIA 1H4BA 3DVJA 3BOWB 1RWYA 4MZJA 2WOSA 1BOCA 3BFBA 4D1EA 5KSZA 3NSKA 1B47A 2JULA 2K2AA 1F8HA 1XK4C 2LP3A 1TOPA 2BECA 2I2RE 4OR9B 1CFPA 1VRKA 1QASA 3PALA 1L2OC 4DS7A 1NX2A 3S0AA 4GNKB 1SY9A 3A8RA 1CNPA 1A75B 2WCHA 4IL1A 1QVIY 1XFZO 3A4UB 5PALA 4PHJA 3S0EA 4BY5A 1QV1A 3VRNA 1IJ6A 5CSIA 5AANA 1G4YR 1XFXO 3ICBA 1ORGA 3CLNA 1E8AA 1SR6C 1J55A 5AXIA 2WORA 2CXJA 2LLUA 4QJ4B 1GQMA 1CFCA 2LUXA 2NCPA 3I5FB 2K2FA 2HPSA 2QEOA 2ZRTA 3OP0A 3EVUA 4MRXA 3BFAA 5CSFA 4L9MA 1J1EA 2L4HA 4QJ3B 1ZMZA 1KFXS 1QIVA 1KSMA 4PT1A 4ZCUA 4A4CA 1OMRA 1PRWA 1NSHA 1CDMA 1A29A 1QS7A 3AAJA 3CGAA 1DJHA 4YBHB 1DJYA 4XJKB 5GQQC 3DY9A 3FS7A 2WC6A 1C3ZA 4FQOA 2VRGA 5G08A 2LVJA 3EVRA 5I2QA 1Z2CB 2NLNA 3PSRA 5F6TA 1BF5A 1XFWO 2NZ0A 3S0GA 3SG3A 5CPVA 3B6XA 2PALA 1S3PA 1BT6A 1DJWA 2F3ZA 1KK7Z 1TN4A 2L98A 3D10A 1OE9B 3D0YB 2ZRSA 5I8NA 3B87A 1F55A 1Z4HA 1TUZA 1B7TY 3PN7C 3V2LA 1NUBA 4ETOA 3AKBA 4N1GA 2M1UA 4GFTA 2KHNA 2KI4C 4GUKA 2JXCA 1DF0A 2G9BA 3C1VA 2L2EA 1R2UA 1HT9A 3JVTB 2KNEA 1M39A 4JD9A 3UO9A 4GGFC 1XFRA 4F0ZB 2MAZA 2JTTA 2KLEA 2QEBA 3FWCA 3TUYC 1G33A 2G2BA 1RK9A 3KEVA 2M9GA 3PM8A 2HQ8A 1NIWA 5DKQA 1B4CA 3MSEB 4YGBB 1F54A 3CTNA 4NDBA 1M46A 1DGVA 1MF8B 2RGIA 1DJZA 4IJ7A 2O60A 3FE8A 3NHTA 1PALA 1WRKA 1SL7A 5HKZA 1EL4A 2CTNA 3EKJA 1NX0A 1S1EA 2ZNDA 3OGNA 4WQ2A 1SL8A 1UHNA 2LVIA 1MQ1A 2ZFDA 2BAPA 4YGDB 3D75A 1SBJA 2K7DA 4C0LA 3K1EA 2K7CA 2I7AA 4YGCB 2KQYA 3IVTA 2CBLA 2WCEA 5FI7A 4AQIA 2FCDA 1MWNA 1QATA 4M2QA 2BCXA 1TIZA 3QRXA 3WHTB 1TRFA 3DZTA 4CFQA 1IH0A 1OZSA 2JTZA 4DCKA 2JQ6A 2PSRA 4PCWA 3VRQA 1F70A 1NCYA 2JNFA 1RFJA 1SYMA 2LLTA 2JT0A 1OSAA 2JZIA 1C3YA 2L5YA 1GGWA 2WCBA 1YURA 3NSOA 2CT9A 4NQGA 1KCYA 3L47A 2GGMA 1K96A 4NDCA 1QLSA 3TDUA 5J3XA 1OOHA 2V53A 2PVBA 2B1UA 3RZSA 1DF0B 1M45A 4N1FA 4E68A 2KI6D 4F7FA 1BU3A 1N0YA 1K9PA 2H61A 2M97A 3BUMB 1YUUA 3I5FC 2JT8A 3CS1A 1TCFA 3SG6A 1PULA 3GK1A 1QXPA 1AK8A 2AUCA 1YTZC 3TS5B 2QPTA 3BUXB 3HCMA 1PSBA 4YI9A 4CPVA 4GGNA 2WC8A 4MZKA 5FYXA 2QEHA 1SW8A 2QDIA 2MBXA 2Q91A 4DRWA 4CIDA 1EJ3A 1OOIX 1ZOTB 3BYAA 1V1GA 1YX7A 2L50A 3CDNA 1DJGA 2GV5A 1AJ5A 1QV0A 1UHHA 3K21A 4OCIA 4OZDA 3NSLA 1OOGA 2JT3A 1YUSA 2M3WA 3EK4A 3RLZA 2JC2A 4JQ0D 3SS4A 2LM5A 3IF7A 1CDLA 1KWOB 1SRAA 1YR5A 1X02A 3PLFB 1Y0VH 3OB1B 2JNXA 1AJ4A 1IRJA 4HRHA 1IWQA 1Y1AA 1U5IA 2F2PA 4PHMA 1TTXA 1AP4A 4I5LB 1TNQA 2TN4A 2KGRA 2LVVA 2EGDA 3FE9A 3ZWHA 1K9UA 2F33A 1OZOA 2HQWA 3GK4X 1TNXA 2JU0A 1K95A 1FPWA 3CYZA 1TWOA 1DJXA 3JVTC 3TDIA 4INWA 3FWBA 2KBMA 2LUCA 5DKRA 2SASA 3BUNB 1MXLC 1FI5A 2KYFA 1DMOA 2OTGB 3VGOA 1N2DA 1WY9A 2LAPA 3BFHA 4ORBB 2NXQA 2OS8B 2JOJA 2YGUA 2Y4QA 2L0PA 3SIBA 3SG2A 1KK7Y 1YVHA 1S6CA 2BKHB 1CMFA 4GAOA 5KTYA 2KI6C 2PMYA 3SIAA 3CZ0A 3WNXB 5HYDA 2BE6A 4MLWA 2BCBA 3B88A 2LVKA 3CR2A 4QJ5B 1GM0A 3DYEA 1W9ZA 3D73A 1XYDA 3B86A 4ZCVA 4NDDA 1QX7A 4MBEA 1QJTA 3B7AA 2AAOA 2WNDA 3TZ1A 2LMTA 1JFKA 3VB1A 2WC5A 1UHIA 4BY4A 5FI6A 1IIOA 1TNPA 2MA2A 4MVFA 1B8CA 3DF0A 1DELA 4OKHA 4DUQA 1OMDA 1JWDA 2R2IA 1OOJA 2F8PA 1MXEA 2EC6C 2MJWB 2WCJA 2HF5A 3CZ2A 3H4SE 4N5XA 5IBWA 3CR5X 5ER4X 2FJUB 5HLOA 4OV2A 1OMVA 2I18A 5AERA 1B7TZ 1XFYO 5D69A 3EKHA 2BCAA 3O6BA 1KFUL 2JPOA 1U5IB 1CTRA 1XVJA 4MZLA 4A4BA 3L4AA 3M0WA 3VRRA 3O2PA 3D77A 4JWQA 3GOFA 1JC2A 1YVLA 3IQOA 1NCZA 1RROA 3I5HB 1BODA 1YX8A 2DOQA 2ZKMX 1ZACA 5DKNA 1ALWA 1BR4B 2AMIA 2WCLA 1DQEA 3KF9A 1K2HA 1CB1A 2E6WA 2NCOA 3OX5A 2K0JA 2A4JA 5K89A 3EK8A 4YGEB 1B9AA 4Q04A 2EC6B 3TS5C 2Y5IA 4JPZB 1IQ3A 1SSEB 1ALVA 1ZFSA 4I5NB 5I2LA 2FOTA 1QX5B 4C0KA 1ZUZA 2KQ6A 4P2YB 2MLEC 2LMUA 1PVBA 1GGZA 5I2OA 4ICBA 3ZNIA 4ORCB 1YUTA 3I5IB 3PFVA 1UWOA 2CCMA 3HX4A 3WXAA 1SNLA 1KK8B 2LV7A 1QLKA 1WDCB 3BUOB 1K9KA 1HQVA 3NGVA 1KWOC 1EG4A 2P71A 3GK2A 3AKAA 3BUWB 3CZ1A 2H8VA 1SKTA 2M7LA 2KAXA 2QACA 3O4YA 2K61A 2COLB 1B8RA 1Y6WA 1LVCD 1PVAA 3LL8B 2MHHA 1BJFA 1IGVA 1CDPA 4MEWA 1XK4A 3DF0B 3DVEA 3D74A 1BMOA 3CZTX 4FQTA 1S36A 3SS3A 3SG4A 5AFPA 1LXFC 1S6IA 2BNXA 1NX3A 4AQJA 2LMVA 1A03A 1S6JA 2KLDA 2M29A 3S0FA
chains in the Genus database with same CATH topology
3CYZA 1TWOA 5DICA 4INWA 4JD9A 1XFRA 2QEBA 3N7HA 2FJYA 3R72A 3BFHA 3FE6A 3CABA 3S0DA 2WCKA 3FE8A 3NHTA 3PJIA 3QMEA 3L4LA 3CZ0A 3R1OA 3OGNA 3B88A 1LS8A 1GM0A 3DYEA 3D73A 3B86A 3R1VA 1QWVA 1OW4A 3B7AA 3DXLA 2WCMA 3D75A 3VB1A 3K1EA 2WC5A 3S0BA 2PQLA 2GTEA 3BJHA 3D76A 3D78A 2WCJA 3CZ2A 4INXA 3DZTA 3BFBA 2JPOA 3L4AA 2P70A 1C3YA 3D77A 3S0AA 2WCHA 3S0EA 3L47A 1OOHA 3RZSA 2WCLA 1DQEA 2KPHA 4F7FA 1ORGA 5EL2A 1OOFA 1P28A 3Q8IA 2QEVA 2QEOA 2ERBA 3BFAA 4PT1A 3NHIA 2QDIA 2QEHA 1TUJA 1OOIX 3R1PA 3CDNA 4OZDA 3DY9A 1OOGA 1C3ZA 2WC6A 2L2CA 1T14A 3NGVA 2P71A 3CZ1A 2H8VA 3S0GA 3B6XA 3D74A 4FQTA 3B87A 3V2LA 3FE9A 3S0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYZ A;  1TWO A;  5DIC A;  4INW A;  4JD9 A;  1XFR A;  2QEB A;  3N7H A;  2FJY A;  3R72 A;  3BFH A;  3FE6 A;  3CAB A;  3S0D A;  2WCK A;  3FE8 A;  3NHT A;  3PJI A;  3QME A;  3L4L A;  3CZ0 A;  3R1O A;  3OGN A;  3B88 A;  1LS8 A;  1GM0 A;  3DYE A;  3D73 A;  3B86 A;  3R1V A;  1QWV A;  1OW4 A;  3B7A A;  3DXL A;  2WCM A;  3D75 A;  3VB1 A;  3K1E A;  2WC5 A;  3S0B A;  2PQL A;  2GTE A;  3BJH A;  3D76 A;  3D78 A;  2WCJ A;  3CZ2 A;  4INX A;  3DZT A;  3BFB A;  2JPO A;  3L4A A;  2P70 A;  1C3Y A;  3D77 A;  3S0A A;  2WCH A;  3S0E A;  3L47 A;  1OOH A;  3RZS A;  2WCL A;  1DQE A;  2KPH A;  4F7F A;  1ORG A;  5EL2 A;  1OOF A;  1P28 A;  3Q8I A;  2QEV A;  2QEO A;  2ERB A;  3BFA A;  4PT1 A;  3NHI A;  2QDI A;  2QEH A;  1TUJ A;  1OOI X;  3R1P A;  3CDN A;  4OZD A;  3DY9 A;  1OOG A;  1C3Z A;  2WC6 A;  2L2C A;  1T14 A;  3NGV A;  2P71 A;  3CZ1 A;  2H8V A;  3S0G A;  3B6X A;  3D74 A;  4FQT A;  3B87 A;  3V2L A;  3FE9 A;  3S0F A; 
#chains in the Genus database with same CATH topology
 1K8U A;  2IS9 A;  2K7O A;  2ZNE A;  3IQQ A;  5DIC A;  4KYN A;  3KPX A;  1TNW A;  1WLZ A;  3CWG A;  5I94 A;  4PE7 A;  4PHN A;  1BLQ A;  3DVM A;  1S5G Z;  1RJV A;  2JWW A;  2M49 B;  5CSJ A;  1JF2 A;  2OTG C;  1LIN A;  3N7H A;  2OS8 C;  4YRU A;  1MR8 A;  2FJY A;  3AAK A;  3I5G C;  1FI6 A;  1M63 B;  2BBM A;  4YGA A;  5KU1 A;  1B1G A;  1FF1 A;  1PSR A;  2P6B B;  3CAB A;  2M7N A;  3S0D A;  2WCK A;  2MRD A;  3BQ3 A;  1ODB A;  2H61 C;  2LLS A;  1J1D A;  3PJI A;  3JTD B;  3QME A;  1EXR A;  2KFG A;  3EK7 A;  2JXL A;  3O78 A;  1SK6 D;  3EVV A;  1SCV A;  2JPT A;  3LK0 A;  1NCX A;  4HRE E;  4OVN F;  2KDH A;  2K8M B;  1C7W A;  1CFF A;  4U8D A;  4USL A;  3F45 A;  1CLL A;  4PHK A;  1OW4 A;  4GPL B;  1QVI Z;  1JFJ A;  1W7J B;  5JJG A;  2F3Y A;  2WCM A;  1JUO A;  1JBA A;  2LC5 A;  4M2P A;  4M2O A;  3S0B A;  4UPG A;  2PQL A;  1QX2 A;  2K7B A;  1MUX A;  3BJH A;  1JSA A;  2LE9 B;  2L4I A;  3D76 A;  3D78 A;  2KAY A;  1KQM C;  1Q80 A;  1R6P A;  3I5G B;  2D8N A;  1CMG A;  4INX A;  1IQ5 A;  1DEK A;  2M0R A;  1AVS A;  1B8L A;  4TNC A;  1UP5 A;  2KBI A;  2PYQ A;  1D1O A;  1SMG A;  2LHL A;  1XA5 A;  4JKT A;  1C7V A;  2LAN A;  3CR4 X;  2M1K B;  2KOT A;  1CLB A;  4MRY A;  1DVI A;  3NSI A;  1KFU S;  2P70 A;  4R1E A;  1FBV A;  4MN0 A;  1L2O B;  1WRL A;  2KGB C;  5ER5 A;  1CDN A;  3I5H C;  3NXA A;  4GGF A;  2OPO A;  2BE4 A;  3FIA A;  4AOM A;  4CLN A;  1A4P A;  4HSZ A;  3PM2 A;  3TDZ A;  3LK1 A;  3SS5 A;  2O5G A;  2Y1M A;  3E3R A;  2LP2 A;  2KSP A;  2ZN9 A;  2KPH A;  5EL2 A;  1UHJ A;  1AUI B;  3RM1 A;  1OOF A;  1P28 A;  1SR6 B;  1SPY A;  1UHK A;  1K94 A;  1CKK A;  4PAL A;  3Q8I A;  1KQM B;  1NPQ A;  1KFX L;  1OQP A;  1W7I B;  2L51 A;  2QEV A;  4C0J A;  1SCM C;  2KAV A;  1BG1 A;  1CLM A;  3KO0 A;  2LNK A;  1JF0 A;  1RTP 1;  1XFV O;  2ERB A;  1LKJ A;  2JRF A;  2MLF C;  3LLE A;  4I5K A;  1H8B A;  1K90 D;  3I5I C;  1M31 A;  3NHI A;  1J7Q A;  1TUJ A;  3OBV A;  5HKY A;  1WRZ A;  1FW4 A;  3R1P A;  1KK8 C;  1WDC C;  1KQV A;  3OHM B;  4PE4 A;  1CFD A;  2KFH A;  1SL9 A;  2I94 A;  4ORA B;  2L2C A;  5BPJ A;  1T14 A;  1EG3 A;  1BR1 B;  1AHR A;  2FCE A;  2L5X B;  3BOW A;  1F4O A;  2SCP A;  1YRT B;  2M8U A;  1L7Z A;  4MSP A;  3DD4 A;  4WRI A;  4XYN A;  1QIW A;  5HL1 A;  2F2O A;  1XFU O;  1QTX A;  2CNP A;  1SCM B;  1A75 A;  3PN7 B;  3VRP A;  1J7P A;  2KYC A;  1XO5 A;  5HKW A;  2K60 A;  3PAT A;  1NX1 A;  2KI4 B;  5CSN A;  1CM1 A;  1MHO A;  1IJ5 A;  5HLV A;  5JOL A;  3OX6 A;  4PE1 A;  3WHU B;  2WCF A;  1LA0 A;  2Q4U A;  1EH2 A;  3LCP C;  2ZN8 A;  4GBA A;  1V1F A;  5B8I B;  2BL0 C;  1J7O A;  2E30 A;  3KHE A;  4PE0 A;  3R72 A;  1DC1 A;  3FE6 A;  3TUY B;  1TCO B;  1N65 A;  3BXK A;  5D7F A;  1IG5 A;  4FTG A;  5AEQ A;  3JTD C;  3O4X A;  2EHB A;  1A2X A;  2PRU A;  1PK0 D;  1REC A;  1NYA A;  3DVK A;  3SG7 A;  1J7R A;  3VRO A;  1DTL A;  1UUR A;  3L4L A;  4YI8 A;  2GGZ A;  2LHI A;  3R1O A;  2ISD A;  1CM4 A;  1WLM A;  1Y1U A;  4XJK A;  1IKU A;  1DGU A;  1LS8 A;  1Y1X A;  1G8I A;  2KFF A;  4WQ3 A;  1C07 A;  1LA3 A;  2H2K A;  1GJY A;  3R1V A;  5FI2 A;  1QWV A;  2BKI B;  3SG5 A;  5D3O A;  4P5O E;  3OB2 B;  1S26 D;  3DXL A;  1F4Q A;  2PAS A;  1UUS A;  3UNW A;  2BBN A;  1YRU B;  2LCP A;  1S5G Y;  1NWD A;  4HRG A;  1DT7 B;  3SJS A;  2GTE A;  2HET A;  4I5J A;  3D0Y A;  1F71 A;  4PDZ A;  1K93 D;  1KSO A;  1NP8 A;  4CFR A;  4DIR A;  2Y1N A;  2BL0 B;  5TNC A;  3EG5 B;  1DJI A;  1H4B A;  3DVJ A;  3BOW B;  1RWY A;  4MZJ A;  2WOS A;  1BOC A;  3BFB A;  4D1E A;  5KSZ A;  3NSK A;  1B47 A;  2JUL A;  2K2A A;  1F8H A;  1XK4 C;  2LP3 A;  1TOP A;  2BEC A;  2I2R E;  4OR9 B;  1CFP A;  1VRK A;  1QAS A;  3PAL A;  1L2O C;  4DS7 A;  1NX2 A;  3S0A A;  4GNK B;  1SY9 A;  3A8R A;  1CNP A;  1A75 B;  2WCH A;  4IL1 A;  1QVI Y;  1XFZ O;  3A4U B;  5PAL A;  4PHJ A;  3S0E A;  4BY5 A;  1QV1 A;  3VRN A;  1IJ6 A;  5CSI A;  5AAN A;  1G4Y R;  1XFX O;  3ICB A;  1ORG A;  3CLN A;  1E8A A;  1SR6 C;  1J55 A;  5AXI A;  2WOR A;  2CXJ A;  2LLU A;  4QJ4 B;  1GQM A;  1CFC A;  2LUX A;  2NCP A;  3I5F B;  2K2F A;  2HPS A;  2QEO A;  2ZRT A;  3OP0 A;  3EVU A;  4MRX A;  3BFA A;  5CSF A;  4L9M A;  1J1E A;  2L4H A;  4QJ3 B;  1ZMZ A;  1KFX S;  1QIV A;  1KSM A;  4PT1 A;  4ZCU A;  4A4C A;  1OMR A;  1PRW A;  1NSH A;  1CDM A;  1A29 A;  1QS7 A;  3AAJ A;  3CGA A;  1DJH A;  4YBH B;  1DJY A;  4XJK B;  5GQQ C;  3DY9 A;  3FS7 A;  2WC6 A;  1C3Z A;  4FQO A;  2VRG A;  5G08 A;  2LVJ A;  3EVR A;  5I2Q A;  1Z2C B;  2NLN A;  3PSR A;  5F6T A;  1BF5 A;  1XFW O;  2NZ0 A;  3S0G A;  3SG3 A;  5CPV A;  3B6X A;  2PAL A;  1S3P A;  1BT6 A;  1DJW A;  2F3Z A;  1KK7 Z;  1TN4 A;  2L98 A;  3D10 A;  1OE9 B;  3D0Y B;  2ZRS A;  5I8N A;  3B87 A;  1F55 A;  1Z4H A;  1TUZ A;  1B7T Y;  3PN7 C;  3V2L A;  1NUB A;  4ETO A;  3AKB A;  4N1G A;  2M1U A;  4GFT A;  2KHN A;  2KI4 C;  4GUK A;  2JXC A;  1DF0 A;  2G9B A;  3C1V A;  2L2E A;  1R2U A;  1HT9 A;  3JVT B;  2KNE A;  1M39 A;  4JD9 A;  3UO9 A;  4GGF C;  1XFR A;  4F0Z B;  2MAZ A;  2JTT A;  2KLE A;  2QEB A;  3FWC A;  3TUY C;  1G33 A;  2G2B A;  1RK9 A;  3KEV A;  2M9G A;  3PM8 A;  2HQ8 A;  1NIW A;  5DKQ A;  1B4C A;  3MSE B;  4YGB B;  1F54 A;  3CTN A;  4NDB A;  1M46 A;  1DGV A;  1MF8 B;  2RGI A;  1DJZ A;  4IJ7 A;  2O60 A;  3FE8 A;  3NHT A;  1PAL A;  1WRK A;  1SL7 A;  5HKZ A;  1EL4 A;  2CTN A;  3EKJ A;  1NX0 A;  1S1E A;  2ZND A;  3OGN A;  4WQ2 A;  1SL8 A;  1UHN A;  2LVI A;  1MQ1 A;  2ZFD A;  2BAP A;  4YGD B;  3D75 A;  1SBJ A;  2K7D A;  4C0L A;  3K1E A;  2K7C A;  2I7A A;  4YGC B;  2KQY A;  3IVT A;  2CBL A;  2WCE A;  5FI7 A;  4AQI A;  2FCD A;  1MWN A;  1QAT A;  4M2Q A;  2BCX A;  1TIZ A;  3QRX A;  3WHT B;  1TRF A;  3DZT A;  4CFQ A;  1IH0 A;  1OZS A;  2JTZ A;  4DCK A;  2JQ6 A;  2PSR A;  4PCW A;  3VRQ A;  1F70 A;  1NCY A;  2JNF A;  1RFJ A;  1SYM A;  2LLT A;  2JT0 A;  1OSA A;  2JZI A;  1C3Y A;  2L5Y A;  1GGW A;  2WCB A;  1YUR A;  3NSO A;  2CT9 A;  4NQG A;  1KCY A;  3L47 A;  2GGM A;  1K96 A;  4NDC A;  1QLS A;  3TDU A;  5J3X A;  1OOH A;  2V53 A;  2PVB A;  2B1U A;  3RZS A;  1DF0 B;  1M45 A;  4N1F A;  4E68 A;  2KI6 D;  4F7F A;  1BU3 A;  1N0Y A;  1K9P A;  2H61 A;  2M97 A;  3BUM B;  1YUU A;  3I5F C;  2JT8 A;  3CS1 A;  1TCF A;  3SG6 A;  1PUL A;  3GK1 A;  1QXP A;  1AK8 A;  2AUC A;  1YTZ C;  3TS5 B;  2QPT A;  3BUX B;  3HCM A;  1PSB A;  4YI9 A;  4CPV A;  4GGN A;  2WC8 A;  4MZK A;  5FYX A;  2QEH A;  1SW8 A;  2QDI A;  2MBX A;  2Q91 A;  4DRW A;  4CID A;  1EJ3 A;  1OOI X;  1ZOT B;  3BYA A;  1V1G A;  1YX7 A;  2L50 A;  3CDN A;  1DJG A;  2GV5 A;  1AJ5 A;  1QV0 A;  1UHH A;  3K21 A;  4OCI A;  4OZD A;  3NSL A;  1OOG A;  2JT3 A;  1YUS A;  2M3W A;  3EK4 A;  3RLZ A;  2JC2 A;  4JQ0 D;  3SS4 A;  2LM5 A;  3IF7 A;  1CDL A;  1KWO B;  1SRA A;  1YR5 A;  1X02 A;  3PLF B;  1Y0V H;  3OB1 B;  2JNX A;  1AJ4 A;  1IRJ A;  4HRH A;  1IWQ A;  1Y1A A;  1U5I A;  2F2P A;  4PHM A;  1TTX A;  1AP4 A;  4I5L B;  1TNQ A;  2TN4 A;  2KGR A;  2LVV A;  2EGD A;  3FE9 A;  3ZWH A;  1K9U A;  2F33 A;  1OZO A;  2HQW A;  3GK4 X;  1TNX A;  2JU0 A;  1K95 A;  1FPW A;  3CYZ A;  1TWO A;  1DJX A;  3JVT C;  3TDI A;  4INW A;  3FWB A;  2KBM A;  2LUC A;  5DKR A;  2SAS A;  3BUN B;  1MXL C;  1FI5 A;  2KYF A;  1DMO A;  2OTG B;  3VGO A;  1N2D A;  1WY9 A;  2LAP A;  3BFH A;  4ORB B;  2NXQ A;  2OS8 B;  2JOJ A;  2YGU A;  2Y4Q A;  2L0P A;  3SIB A;  3SG2 A;  1KK7 Y;  1YVH A;  1S6C A;  2BKH B;  1CMF A;  4GAO A;  5KTY A;  2KI6 C;  2PMY A;  3SIA A;  3CZ0 A;  3WNX B;  5HYD A;  2BE6 A;  4MLW A;  2BCB A;  3B88 A;  2LVK A;  3CR2 A;  4QJ5 B;  1GM0 A;  3DYE A;  1W9Z A;  3D73 A;  1XYD A;  3B86 A;  4ZCV A;  4NDD A;  1QX7 A;  4MBE A;  1QJT A;  3B7A A;  2AAO A;  2WND A;  3TZ1 A;  2LMT A;  1JFK A;  3VB1 A;  2WC5 A;  1UHI A;  4BY4 A;  5FI6 A;  1IIO A;  1TNP A;  2MA2 A;  4MVF A;  1B8C A;  3DF0 A;  1DEL A;  4OKH A;  4DUQ A;  1OMD A;  1JWD A;  2R2I A;  1OOJ A;  2F8P A;  1MXE A;  2EC6 C;  2MJW B;  2WCJ A;  2HF5 A;  3CZ2 A;  3H4S E;  4N5X A;  5IBW A;  3CR5 X;  5ER4 X;  2FJU B;  5HLO A;  4OV2 A;  1OMV A;  2I18 A;  5AER A;  1B7T Z;  1XFY O;  5D69 A;  3EKH A;  2BCA A;  3O6B A;  1KFU L;  2JPO A;  1U5I B;  1CTR A;  1XVJ A;  4MZL A;  4A4B A;  3L4A A;  3M0W A;  3VRR A;  3O2P A;  3D77 A;  4JWQ A;  3GOF A;  1JC2 A;  1YVL A;  3IQO A;  1NCZ A;  1RRO A;  3I5H B;  1BOD A;  1YX8 A;  2DOQ A;  2ZKM X;  1ZAC A;  5DKN A;  1ALW A;  1BR4 B;  2AMI A;  2WCL A;  1DQE A;  3KF9 A;  1K2H A;  1CB1 A;  2E6W A;  2NCO A;  3OX5 A;  2K0J A;  2A4J A;  5K89 A;  3EK8 A;  4YGE B;  1B9A A;  4Q04 A;  2EC6 B;  3TS5 C;  2Y5I A;  4JPZ B;  1IQ3 A;  1SSE B;  1ALV A;  1ZFS A;  4I5N B;  5I2L A;  2FOT A;  1QX5 B;  4C0K A;  1ZUZ A;  2KQ6 A;  4P2Y B;  2MLE C;  2LMU A;  1PVB A;  1GGZ A;  5I2O A;  4ICB A;  3ZNI A;  4ORC B;  1YUT A;  3I5I B;  3PFV A;  1UWO A;  2CCM A;  3HX4 A;  3WXA A;  1SNL A;  1KK8 B;  2LV7 A;  1QLK A;  1WDC B;  3BUO B;  1K9K A;  1HQV A;  3NGV A;  1KWO C;  1EG4 A;  2P71 A;  3GK2 A;  3AKA A;  3BUW B;  3CZ1 A;  2H8V A;  1SKT A;  2M7L A;  2KAX A;  2QAC A;  3O4Y A;  2K61 A;  2COL B;  1B8R A;  1Y6W A;  1LVC D;  1PVA A;  3LL8 B;  2MHH A;  1BJF A;  1IGV A;  1CDP A;  4MEW A;  1XK4 A;  3DF0 B;  3DVE A;  3D74 A;  1BMO A;  3CZT X;  4FQT A;  1S36 A;  3SS3 A;  3SG4 A;  5AFP A;  1LXF C;  1S6I A;  2BNX A;  1NX3 A;  4AQJ A;  2LMV A;  1A03 A;  1S6J A;  2KLD A;  2M29 A;  3S0F A; 
#chains in the Genus database with same CATH homology
 3CYZ A;  1TWO A;  5DIC A;  4INW A;  4JD9 A;  1XFR A;  2QEB A;  3N7H A;  2FJY A;  3R72 A;  3BFH A;  3FE6 A;  3CAB A;  3S0D A;  2WCK A;  3FE8 A;  3NHT A;  3PJI A;  3QME A;  3L4L A;  3CZ0 A;  3R1O A;  3OGN A;  3B88 A;  1LS8 A;  1GM0 A;  3DYE A;  3D73 A;  3B86 A;  3R1V A;  1QWV A;  1OW4 A;  3B7A A;  3DXL A;  2WCM A;  3D75 A;  3VB1 A;  3K1E A;  2WC5 A;  3S0B A;  2PQL A;  2GTE A;  3BJH A;  3D76 A;  3D78 A;  2WCJ A;  3CZ2 A;  4INX A;  3DZT A;  3BFB A;  2JPO A;  3L4A A;  2P70 A;  1C3Y A;  3D77 A;  3S0A A;  2WCH A;  3S0E A;  3L47 A;  1OOH A;  3RZS A;  2WCL A;  1DQE A;  2KPH A;  4F7F A;  1ORG A;  5EL2 A;  1OOF A;  1P28 A;  3Q8I A;  2QEV A;  2QEO A;  2ERB A;  3BFA A;  4PT1 A;  3NHI A;  2QDI A;  2QEH A;  1TUJ A;  1OOI X;  3R1P A;  3CDN A;  4OZD A;  3DY9 A;  1OOG A;  1C3Z A;  2WC6 A;  2L2C A;  1T14 A;  3NGV A;  2P71 A;  3CZ1 A;  2H8V A;  3S0G A;  3B6X A;  3D74 A;  4FQT A;  3B87 A;  3V2L A;  3FE9 A;  3S0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...