3FE6A

Crystal structure of a pheromone binding protein from apis mellifera with a serendipitous ligand at ph 5.5
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH induced domain-swapping favors pheromone release
rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 45
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3fe6A00
3VB1A 1LS8A 3D78A 3BJHA 2QEHA 3NHTA 3DYEA 1OOHA 1GM0A 5DICA 3CDNA 3CZ0A 5EL2A 3BFHA 2H8VA 2JPOA 1OOGA 3R1OA 3B6XA 3L4LA 1C3ZA 1XFRA 3CYZA 2P70A 3S0DA 3V2LA 3B87A 3K1EA 2WCJA 2QEOA 3BFAA 3NGVA 1TWOA 1T14A 3S0GA 2WC5A 3DXLA 3CZ2A 4INXA 2P71A 3CABA 2GTEA 2WCHA 2QEVA 1P28A 3OGNA 3QMEA 2ERBA 1QWVA 4PT1A 2WCLA 3NHIA 4JD9A 3R72A 1ORGA 2PQLA 3N7HA 3CZ1A 3S0AA 3FE9A 1OOFA 1OW4A 3D75A 3RZSA 3S0BA 3Q8IA 3D73A 3B86A 3R1PA 3D76A 2L2CA 4INWA 3L4AA 3BFBA 3FE8A 3FE6A 2WC6A 2QEBA 3B7AA 4OZDA 2FJYA 3PJIA 3DZTA 3R1VA 1OOIX 3D77A 2WCKA 4F7FA 3S0FA 2QDIA 3L47A 1TUJA 1C3YA 3DY9A 3D74A 4FQTA 2KPHA 1DQEA 3B88A 3S0EA 2WCMA
chains in the Genus database with same CATH superfamily
2COLB 1LS8A 4ORCB 1JC2A 2JPTA 2PMYA 4U8DA 1K9PA 1QVIZ 2LLSA 2F3ZA 4PHJA 3PSRA 2DOQA 1RJVA 4I5LB 1ZOTB 3PM8A 3C1VA 1TNWA 3H4SE 1NUBA 4AQIA 2BBMA 1KWOC 1CDMA 1PULA 3CZ0A 1K9KA 4NDBA 1W9ZA 3BFHA 1YUUA 2K2AA 3M0WA 1GGWA 2L2EA 1F71A 1D1OA 2HQWA 5IBWA 1XFRA 2FCDA 4CLNA 1KK7Z 3I5FC 1IJ5A 1G33A 1M31A 4OKHA 2AAOA 1WLMA 1QX7A 5I94A 1SKTA 2MA2A 1J7OA 1H4BA 2NLNA 3S0DA 1Y6WA 1TIZA 2IS9A 1W7JB 2NZ0A 1CFDA 1KK8B 3CLNA 1ALWA 3I5GC 3PLFB 1MWNA 4MSPA 1XFWO 2M97A 1CFPA 1DJHA 1YR5A 3GK2A 4GUKA 4P5OE 1PSBA 4DUQA 3UO9A 5AANA 3BUWB 1FI6A 2F2PA 2BNXA 4MZLA 1UHKA 1J7RA 2MLFC 3SG2A 4I5JA 3BFAA 1CB1A 3CS1A 2BKIB 1KFUL 1ZFSA 1TTXA 2A4JA 4ETOA 2HPSA 2HETA 2SCPA 3A4UB 3S0GA 2JTZA 2E6WA 2GTEA 3PM2A 2WCHA 1XK4C 2QEVA 2WOSA 1P28A 2JT3A 1DF0A 1OOJA 3IF7A 1QASA 5FI7A 2P6BB 1ALVA 3DVEA 3QRXA 3SG3A 5KU1A 2WCLA 4DCKA 1WY9A 1NIWA 3WXAA 4C0LA 1KCYA 1Q80A 1JF2A 2K60A 1PRWA 1UWOA 1WDCB 1K90D 1KSMA 2L50A 4FQOA 4PHKA 1CLLA 1OOFA 5F6TA 4MLWA 5D7FA 2MBXA 1S36A 4MN0A 1C7VA 1FPWA 4IJ7A 1CLBA 3D75A 1SSEB 5DKQA 4YRUA 1NCZA 1DELA 3B86A 4XYNA 5HLOA 4CFRA 4QJ5B 3OB1B 1A2XA 4JWQA 2LANA 1OE9B 2L2CA 5CSNA 4C0KA 1SCMB 1EJ3A 3GOFA 1S6JA 2BL0B 1N2DA 2LVVA 4FTGA 1Y1AA 2I2RE 1GQMA 1UHIA 2F3YA 2TN4A 1Y0VH 3B7AA 3FE6A 1DVIA 1TUZA 2BCBA 1AJ4A 2KBIA 1AVSA 2MRDA 2QPTA 2WCBA 4IL1A 1BG1A 1J55A 1YUTA 2LVKA 1S3PA 2OPOA 3DF0B 2Y5IA 3D77A 1G8IA 3BYAA 3EK7A 3O6BA 1SL8A 2QDIA 3I5HB 1OMRA 5FI2A 1TUJA 1ODBA 2CXJA 2LUCA 3BOWB 1QV0A 4DIRA 1XFXO 5B8IB 2LNKA 2ZN8A 4JPZB 2FJUB 1HT9A 4MRYA 3GK4X 3SIBA 1K9UA 1RFJA 1DTLA 3EKHA 3JTDB 2BBNA 2WC8A 2JC2A 3B88A 1GGZA 4GGFA 2NXQA 2WCMA 1CM4A 1ZMZA 2E30A 3CR2A 3TUYC 4PE1A 1B47A 1IQ5A 1OMDA 3D78A 1DJXA 1LINA 1XFZO 1UURA 1YTZC 2QEHA 3DYEA 1OOHA 4GGNA 4ZCUA 3TDUA 1GM0A 1B8RA 5HKYA 5J3XA 2AUCA 1Z4HA 4NQGA 1EXRA 2EC6C 5HKWA 3EVVA 1MXLC 3OX5A 4GGFC 2L4IA 2KI4B 3I5IB 3R1OA 1KQMB 1WRZA 3B6XA 1DT7B 1HQVA 1WRLA 1BOCA 1C3ZA 3SS4A 3CYZA 3IQOA 4D1EA 1TN4A 2L5YA 1SYMA 4N1GA 1A4PA 1SBJA 5HLVA 1CLMA 5AERA 2CBLA 2KYFA 3TS5C 4GFTA 1QLKA 2ZN9A 5D69A 1XYDA 1KSOA 2JNFA 2G9BA 1KFXL 2I94A 3CR4X 3BQ3A 2RGIA 3TZ1A 1KWOB 2CCMA 2LE9B 1TRFA 3EG5B 4QJ4B 2LCPA 1B8LA 1CKKA 1AUIB 2OS8C 1NCYA 3OP0A 3PFVA 4ORBB 1IG5A 3EVRA 4PDZA 2LLTA 1K96A 5GQQC 1RROA 1M46A 2KFGA 4Q04A 2WORA 1PSRA 2K7CA 3ZWHA 3I5FB 3BXKA 1TWOA 1YRUB 4M2OA 1F55A 2FOTA 2WC5A 3CZ2A 2D8NA 2O5GA 3ZNIA 2M0RA 1PVAA 4I5KA 2PALA 2KQYA 1K94A 1K8UA 3I5GB 3AKAA 1IQ3A 2F8PA 3OHMB 1QWVA 4GPLB 1Z2CB 5KTYA 4PE0A 1F4OA 1NX3A 1UUSA 4ORAB 3NHIA 1B7TY 2Y1MA 1BR1B 2YGUA 4TNCA 4E68A 1QIWA 3R72A 1XK4A 1ORGA 1RK9A 3CZ1A 2CTNA 4PHNA 3SG4A 3S0AA 2GGZA 2QACA 1QTXA 4ZCVA 2ZRTA 1KFUS 3RZSA 2H61C 3S0BA 1A75A 3VROA 5D3OA 1UP5A 1XFVO 2PRUA 1SK6D 1V1FA 3JVTC 3DVJA 1C07A 3DVMA 4NDCA 3L4AA 1K2HA 1AP4A 2WC6A 1SR6B 1JFKA 2LV7A 4OR9B 1NCXA 4OZDA 2FJYA 3LCPC 5ER5A 1V1GA 3KEVA 1BODA 2L5XB 3NSLA 3DZTA 4GBAA 5CSIA 1A03A 2L4HA 2KAYA 3D10A 3LLEA 3SS5A 2JRFA 3EVUA 1DF0B 2LHLA 2LUXA 1NX1A 4JQ0D 4XJKA 1S6IA 1MXEA 3L47A 1C3YA 1BU3A 3DY9A 3DVKA 4GAOA 2KFHA 3PN7C 1JFJA 1YVHA 4YGEB 5G08A 1QXPA 1BF5A 1QS7A 3LL8B 1DQEA 1B4CA 5ER4X 1GJYA 2JQ6A 2KAVA 2H2KA 1F70A 3VB1A 3WHUB 3RM1A 1DJIA 1E8AA 3BJHA 2VRGA 3NHTA 2BE4A 5AEQA 1AK8A 2MAZA 2KI6D 2CNPA 1L2OC 3CDNA 4NDDA 3UNWA 3FWBA 3VRNA 3VRPA 2LVIA 2M3WA 5EL2A 4M2PA 1B7TZ 3ICBA 1TNXA 2KLDA 1OOGA 1NX0A 1YRTB 2BCAA 3AAKA 1XA5A 2Y4QA 1CMFA 1JF0A 4BY4A 1TCOB 2HQ8A 4MEWA 1LKJA 1EL4A 3VRRA 2BCXA 1XO5A 1TNPA 1J7QA 2BAPA 3TUYB 1DJYA 1XFUO 3KO0A 1IKUA 3SG5A 5HL1A 1SCMC 1J1EA 1LA0A 1UHJA 1LA3A 2EGDA 1NYAA 2OTGB 2Q91A 1MF8B 3V2LA 1SL9A 2L98A 2JU0A 3B87A 3EK8A 3K1EA 2PVBA 2EC6B 1MUXA 1XFYO 2LMUA 2LMVA 1DGVA 1X02A 4I5NB 4OV2A 4PHMA 1FI5A 2KBMA 2CT9A 2M7NA 2QEOA 3PATA 2M8UA 1PVBA 1RWYA 1A29A 4USLA 1QIVA 1B8CA 2GGMA 3MSEB 4CPVA 4P2YB 3I5HC 2PYQA 4YGAA 2I7AA 4L9MA 3HX4A 3SS3A 3O2PA 2MJWB 1S1EA 1S5GY 3NGVA 1IRJA 2SASA 1LXFC 2LHIA 1IH0A 1F8HA 2WNDA 3CABA 1CDNA 1Y1XA 5PALA 2KFFA 2KSPA 2KYCA 3TS5B 1CDPA 4KYNA 3GK1A 1S6CA 2JULA 2KQ6A 3OBVA 4PT1A 2M1UA 1KFXS 1VRKA 3IQQA 1EH2A 2HF5A 2JWWA 1AHRA 2ZNDA 2OS8B 3EK4A 1XVJA 1FW4A 3NSIA 4OCIA 4MBEA 5CPVA 2K7DA 3VGOA 4JD9A 1NPQA 1YVLA 2JNXA 1DEKA 1B1GA 4WRIA 3IVTA 2WCFA 1DJWA 3SG7A 1NWDA 1OW4A 1DJGA 2F2OA 3Q8IA 1QJTA 3DD4A 1K95A 1YX7A 3R1PA 2NCOA 3BUXB 3LK0A 5I2LA 2K0JA 2ZFDA 3EKJA 1QX2A 3O78A 3PALA 4CIDA 4GNKB 2M7LA 1BT6A 1R6PA 3FE8A 5I8NA 1CNPA 4HRGA 2ZRSA 4PALA 2PSRA 2KAXA 3O4XA 2H61A 1JSAA 2JZIA 2NCPA 3PJIA 1FBVA 1JUOA 1OZOA 1SW8A 4UPGA 1OSAA 1UHNA 2KDHA 3BUMB 1SPYA 4ICBA 4YI9A 2G2BA 4F0ZB 3D74A 2M9GA 4MZKA 1AJ5A 4FQTA 2KPHA 1IGVA 3NSKA 1TOPA 1CMGA 3JVTB 4WQ2A 1S5GZ 1SL7A 1C7WA 2F33A 2JXLA 2KI6C 2JOJA 1QX5B 4JKTA 4A4BA 1DMOA 1PK0D 1CFCA 4R1EA 4OVNF 4M2QA 3CTNA 4WQ3A 3FS7A 1YURA 3HCMA 4QJ3B 1BMOA 2LAPA 1A75B 1KK8C 2FCEA 4MZJA 2EHBA 3CWGA 3SG6A 3SIAA 1UHHA 5DICA 4A4CA 2M1KB 4MRXA 3BUNB 2GV5A 1IWQA 1TNQA 3CZTX 4YI8A 2ISDA 5K89A 5I2OA 2H8VA 2JPOA 1WRKA 3L4LA 2KOTA 2LP3A 2MHHA 2M29A 3FIAA 3PN7B 3VRQA 2LC5A 2Y1NA 2P70A 2O60A 1DC1A 1S26D 1NSHA 2ZNEA 1RECA 3LK1A 1BR4B 2BE6A 4XJKB 1M39A 1H8BA 1IJ6A 5TNCA 1K93D 1G4YR 1SR6C 4PE7A 1MR8A 1WLZA 2WCJA 3OB2B 3OX6A 1MHOA 1L2OB 3KPXA 4YBHB 3K21A 5DKRA 2I18A 1FF1A 1YUSA 1M63B 5JJGA 3TDIA 5BPJA 4HREE 5KSZA 1WDCC 1BJFA 1R2UA 2V53A 2ZKMX 1SMGA 2KNEA 1J1DA 2KGRA 3SJSA 1N0YA 2K61A 1KQVA 1T14A 2BECA 2LLUA 3DXLA 2B1UA 4INXA 1DGUA 2BKHB 1SCVA 2P71A 5AXIA 1CFFA 3DF0A 2KHNA 1QVIY 3A8RA 4CFQA 3RLZA 1U5IA 1EG4A 1ZUZA 2R2IA 4HRHA 3D0YA 3OGNA 2BL0C 3QMEA 2ERBA 1BLQA 1L7ZA 4N1FA 1SY9A 4YGCB 3BOWA 3AKBA 2KGBC 1IIOA 3NXAA 3NSOA 2LVJA 5DKNA 2JT8A 4AOMA 3BUOB 1U5IB 3FWCA 1NX2A 1DJZA 2PQLA 5CSJA 3N7HA 3D0YB 1N65A 3WHTB 3FE9A 1KK7Y 1YX8A 2AMIA 2K2FA 1CM1A 2M49B 1MQ1A 2LM5A 5AFPA 1LVCD 4C0JA 4DS7A 1W7IB 1ZACA 2Q4UA 4YGDB 2PASA 2JTTA 3E3RA 3D73A 5HYDA 3AAJA 1NP8A 3CR5X 2JT0A 1TCFA 1EG3A 1OMVA 1SRAA 3D76A 1QV1A 3JTDC 4PE4A 4INWA 1OZSA 2K8MB 3BFBA 2OTGC 1JBAA 1RTP1 4MVFA 2JXCA 4BY5A 2QEBA 1QATA 1F54A 1JWDA 4HSZA 3F45A 5CSFA 3KF9A 2K7BA 1B9AA 1OOIX 3R1VA 2MLEC 2WCKA 4N5XA 4YGBB 5JOLA 1M45A 4PCWA 4F7FA 3S0FA 5FYXA 5HKZA 3TDZA 5FI6A 3KHEA 2KI4C 2L51A 2WCEA 1KQMC 1SNLA 3I5IC 3WNXB 3CGAA 4DRWA 1J7PA 4AQJA 2LMTA 2K7OA 5I2QA 3O4YA 1CDLA 1PALA 1CTRA 1F4QA 1OQPA 1QLSA 2KLEA 2L0PA 2LP2A 3S0EA 1Y1UA
chains in the Genus database with same CATH topology
3VB1A 1LS8A 3D78A 3BJHA 2QEHA 3NHTA 3DYEA 1OOHA 1GM0A 5DICA 3CDNA 3CZ0A 5EL2A 3BFHA 2H8VA 2JPOA 1OOGA 3R1OA 3B6XA 3L4LA 1C3ZA 1XFRA 3CYZA 2P70A 3S0DA 3V2LA 3B87A 3K1EA 2WCJA 2QEOA 3BFAA 3NGVA 1TWOA 1T14A 3S0GA 2WC5A 3DXLA 3CZ2A 4INXA 2P71A 3CABA 2GTEA 2WCHA 2QEVA 1P28A 3OGNA 3QMEA 2ERBA 1QWVA 4PT1A 2WCLA 3NHIA 4JD9A 3R72A 1ORGA 2PQLA 3N7HA 3CZ1A 3S0AA 3FE9A 1OOFA 1OW4A 3D75A 3RZSA 3S0BA 3Q8IA 3D73A 3B86A 3R1PA 3D76A 2L2CA 4INWA 3L4AA 3BFBA 3FE8A 3FE6A 2WC6A 2QEBA 3B7AA 4OZDA 2FJYA 3PJIA 3DZTA 3R1VA 1OOIX 3D77A 2WCKA 4F7FA 3S0FA 2QDIA 3L47A 1TUJA 1C3YA 3DY9A 3D74A 4FQTA 2KPHA 1DQEA 3B88A 3S0EA 2WCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VB1 A;  1LS8 A;  3D78 A;  3BJH A;  2QEH A;  3NHT A;  3DYE A;  1OOH A;  1GM0 A;  5DIC A;  3CDN A;  3CZ0 A;  5EL2 A;  3BFH A;  2H8V A;  2JPO A;  1OOG A;  3R1O A;  3B6X A;  3L4L A;  1C3Z A;  1XFR A;  3CYZ A;  2P70 A;  3S0D A;  3V2L A;  3B87 A;  3K1E A;  2WCJ A;  2QEO A;  3BFA A;  3NGV A;  1TWO A;  1T14 A;  3S0G A;  2WC5 A;  3DXL A;  3CZ2 A;  4INX A;  2P71 A;  3CAB A;  2GTE A;  2WCH A;  2QEV A;  1P28 A;  3OGN A;  3QME A;  2ERB A;  1QWV A;  4PT1 A;  2WCL A;  3NHI A;  4JD9 A;  3R72 A;  1ORG A;  2PQL A;  3N7H A;  3CZ1 A;  3S0A A;  3FE9 A;  1OOF A;  1OW4 A;  3D75 A;  3RZS A;  3S0B A;  3Q8I A;  3D73 A;  3B86 A;  3R1P A;  3D76 A;  2L2C A;  4INW A;  3L4A A;  3BFB A;  3FE8 A;  3FE6 A;  2WC6 A;  2QEB A;  3B7A A;  4OZD A;  2FJY A;  3PJI A;  3DZT A;  3R1V A;  1OOI X;  3D77 A;  2WCK A;  4F7F A;  3S0F A;  2QDI A;  3L47 A;  1TUJ A;  1C3Y A;  3DY9 A;  3D74 A;  4FQT A;  2KPH A;  1DQE A;  3B88 A;  3S0E A;  2WCM A; 
#chains in the Genus database with same CATH topology
 2COL B;  1LS8 A;  4ORC B;  1JC2 A;  2JPT A;  2PMY A;  4U8D A;  1K9P A;  1QVI Z;  2LLS A;  2F3Z A;  4PHJ A;  3PSR A;  2DOQ A;  1RJV A;  4I5L B;  1ZOT B;  3PM8 A;  3C1V A;  1TNW A;  3H4S E;  1NUB A;  4AQI A;  2BBM A;  1KWO C;  1CDM A;  1PUL A;  3CZ0 A;  1K9K A;  4NDB A;  1W9Z A;  3BFH A;  1YUU A;  2K2A A;  3M0W A;  1GGW A;  2L2E A;  1F71 A;  1D1O A;  2HQW A;  5IBW A;  1XFR A;  2FCD A;  4CLN A;  1KK7 Z;  3I5F C;  1IJ5 A;  1G33 A;  1M31 A;  4OKH A;  2AAO A;  1WLM A;  1QX7 A;  5I94 A;  1SKT A;  2MA2 A;  1J7O A;  1H4B A;  2NLN A;  3S0D A;  1Y6W A;  1TIZ A;  2IS9 A;  1W7J B;  2NZ0 A;  1CFD A;  1KK8 B;  3CLN A;  1ALW A;  3I5G C;  3PLF B;  1MWN A;  4MSP A;  1XFW O;  2M97 A;  1CFP A;  1DJH A;  1YR5 A;  3GK2 A;  4GUK A;  4P5O E;  1PSB A;  4DUQ A;  3UO9 A;  5AAN A;  3BUW B;  1FI6 A;  2F2P A;  2BNX A;  4MZL A;  1UHK A;  1J7R A;  2MLF C;  3SG2 A;  4I5J A;  3BFA A;  1CB1 A;  3CS1 A;  2BKI B;  1KFU L;  1ZFS A;  1TTX A;  2A4J A;  4ETO A;  2HPS A;  2HET A;  2SCP A;  3A4U B;  3S0G A;  2JTZ A;  2E6W A;  2GTE A;  3PM2 A;  2WCH A;  1XK4 C;  2QEV A;  2WOS A;  1P28 A;  2JT3 A;  1DF0 A;  1OOJ A;  3IF7 A;  1QAS A;  5FI7 A;  2P6B B;  1ALV A;  3DVE A;  3QRX A;  3SG3 A;  5KU1 A;  2WCL A;  4DCK A;  1WY9 A;  1NIW A;  3WXA A;  4C0L A;  1KCY A;  1Q80 A;  1JF2 A;  2K60 A;  1PRW A;  1UWO A;  1WDC B;  1K90 D;  1KSM A;  2L50 A;  4FQO A;  4PHK A;  1CLL A;  1OOF A;  5F6T A;  4MLW A;  5D7F A;  2MBX A;  1S36 A;  4MN0 A;  1C7V A;  1FPW A;  4IJ7 A;  1CLB A;  3D75 A;  1SSE B;  5DKQ A;  4YRU A;  1NCZ A;  1DEL A;  3B86 A;  4XYN A;  5HLO A;  4CFR A;  4QJ5 B;  3OB1 B;  1A2X A;  4JWQ A;  2LAN A;  1OE9 B;  2L2C A;  5CSN A;  4C0K A;  1SCM B;  1EJ3 A;  3GOF A;  1S6J A;  2BL0 B;  1N2D A;  2LVV A;  4FTG A;  1Y1A A;  2I2R E;  1GQM A;  1UHI A;  2F3Y A;  2TN4 A;  1Y0V H;  3B7A A;  3FE6 A;  1DVI A;  1TUZ A;  2BCB A;  1AJ4 A;  2KBI A;  1AVS A;  2MRD A;  2QPT A;  2WCB A;  4IL1 A;  1BG1 A;  1J55 A;  1YUT A;  2LVK A;  1S3P A;  2OPO A;  3DF0 B;  2Y5I A;  3D77 A;  1G8I A;  3BYA A;  3EK7 A;  3O6B A;  1SL8 A;  2QDI A;  3I5H B;  1OMR A;  5FI2 A;  1TUJ A;  1ODB A;  2CXJ A;  2LUC A;  3BOW B;  1QV0 A;  4DIR A;  1XFX O;  5B8I B;  2LNK A;  2ZN8 A;  4JPZ B;  2FJU B;  1HT9 A;  4MRY A;  3GK4 X;  3SIB A;  1K9U A;  1RFJ A;  1DTL A;  3EKH A;  3JTD B;  2BBN A;  2WC8 A;  2JC2 A;  3B88 A;  1GGZ A;  4GGF A;  2NXQ A;  2WCM A;  1CM4 A;  1ZMZ A;  2E30 A;  3CR2 A;  3TUY C;  4PE1 A;  1B47 A;  1IQ5 A;  1OMD A;  3D78 A;  1DJX A;  1LIN A;  1XFZ O;  1UUR A;  1YTZ C;  2QEH A;  3DYE A;  1OOH A;  4GGN A;  4ZCU A;  3TDU A;  1GM0 A;  1B8R A;  5HKY A;  5J3X A;  2AUC A;  1Z4H A;  4NQG A;  1EXR A;  2EC6 C;  5HKW A;  3EVV A;  1MXL C;  3OX5 A;  4GGF C;  2L4I A;  2KI4 B;  3I5I B;  3R1O A;  1KQM B;  1WRZ A;  3B6X A;  1DT7 B;  1HQV A;  1WRL A;  1BOC A;  1C3Z A;  3SS4 A;  3CYZ A;  3IQO A;  4D1E A;  1TN4 A;  2L5Y A;  1SYM A;  4N1G A;  1A4P A;  1SBJ A;  5HLV A;  1CLM A;  5AER A;  2CBL A;  2KYF A;  3TS5 C;  4GFT A;  1QLK A;  2ZN9 A;  5D69 A;  1XYD A;  1KSO A;  2JNF A;  2G9B A;  1KFX L;  2I94 A;  3CR4 X;  3BQ3 A;  2RGI A;  3TZ1 A;  1KWO B;  2CCM A;  2LE9 B;  1TRF A;  3EG5 B;  4QJ4 B;  2LCP A;  1B8L A;  1CKK A;  1AUI B;  2OS8 C;  1NCY A;  3OP0 A;  3PFV A;  4ORB B;  1IG5 A;  3EVR A;  4PDZ A;  2LLT A;  1K96 A;  5GQQ C;  1RRO A;  1M46 A;  2KFG A;  4Q04 A;  2WOR A;  1PSR A;  2K7C A;  3ZWH A;  3I5F B;  3BXK A;  1TWO A;  1YRU B;  4M2O A;  1F55 A;  2FOT A;  2WC5 A;  3CZ2 A;  2D8N A;  2O5G A;  3ZNI A;  2M0R A;  1PVA A;  4I5K A;  2PAL A;  2KQY A;  1K94 A;  1K8U A;  3I5G B;  3AKA A;  1IQ3 A;  2F8P A;  3OHM B;  1QWV A;  4GPL B;  1Z2C B;  5KTY A;  4PE0 A;  1F4O A;  1NX3 A;  1UUS A;  4ORA B;  3NHI A;  1B7T Y;  2Y1M A;  1BR1 B;  2YGU A;  4TNC A;  4E68 A;  1QIW A;  3R72 A;  1XK4 A;  1ORG A;  1RK9 A;  3CZ1 A;  2CTN A;  4PHN A;  3SG4 A;  3S0A A;  2GGZ A;  2QAC A;  1QTX A;  4ZCV A;  2ZRT A;  1KFU S;  3RZS A;  2H61 C;  3S0B A;  1A75 A;  3VRO A;  5D3O A;  1UP5 A;  1XFV O;  2PRU A;  1SK6 D;  1V1F A;  3JVT C;  3DVJ A;  1C07 A;  3DVM A;  4NDC A;  3L4A A;  1K2H A;  1AP4 A;  2WC6 A;  1SR6 B;  1JFK A;  2LV7 A;  4OR9 B;  1NCX A;  4OZD A;  2FJY A;  3LCP C;  5ER5 A;  1V1G A;  3KEV A;  1BOD A;  2L5X B;  3NSL A;  3DZT A;  4GBA A;  5CSI A;  1A03 A;  2L4H A;  2KAY A;  3D10 A;  3LLE A;  3SS5 A;  2JRF A;  3EVU A;  1DF0 B;  2LHL A;  2LUX A;  1NX1 A;  4JQ0 D;  4XJK A;  1S6I A;  1MXE A;  3L47 A;  1C3Y A;  1BU3 A;  3DY9 A;  3DVK A;  4GAO A;  2KFH A;  3PN7 C;  1JFJ A;  1YVH A;  4YGE B;  5G08 A;  1QXP A;  1BF5 A;  1QS7 A;  3LL8 B;  1DQE A;  1B4C A;  5ER4 X;  1GJY A;  2JQ6 A;  2KAV A;  2H2K A;  1F70 A;  3VB1 A;  3WHU B;  3RM1 A;  1DJI A;  1E8A A;  3BJH A;  2VRG A;  3NHT A;  2BE4 A;  5AEQ A;  1AK8 A;  2MAZ A;  2KI6 D;  2CNP A;  1L2O C;  3CDN A;  4NDD A;  3UNW A;  3FWB A;  3VRN A;  3VRP A;  2LVI A;  2M3W A;  5EL2 A;  4M2P A;  1B7T Z;  3ICB A;  1TNX A;  2KLD A;  1OOG A;  1NX0 A;  1YRT B;  2BCA A;  3AAK A;  1XA5 A;  2Y4Q A;  1CMF A;  1JF0 A;  4BY4 A;  1TCO B;  2HQ8 A;  4MEW A;  1LKJ A;  1EL4 A;  3VRR A;  2BCX A;  1XO5 A;  1TNP A;  1J7Q A;  2BAP A;  3TUY B;  1DJY A;  1XFU O;  3KO0 A;  1IKU A;  3SG5 A;  5HL1 A;  1SCM C;  1J1E A;  1LA0 A;  1UHJ A;  1LA3 A;  2EGD A;  1NYA A;  2OTG B;  2Q91 A;  1MF8 B;  3V2L A;  1SL9 A;  2L98 A;  2JU0 A;  3B87 A;  3EK8 A;  3K1E A;  2PVB A;  2EC6 B;  1MUX A;  1XFY O;  2LMU A;  2LMV A;  1DGV A;  1X02 A;  4I5N B;  4OV2 A;  4PHM A;  1FI5 A;  2KBM A;  2CT9 A;  2M7N A;  2QEO A;  3PAT A;  2M8U A;  1PVB A;  1RWY A;  1A29 A;  4USL A;  1QIV A;  1B8C A;  2GGM A;  3MSE B;  4CPV A;  4P2Y B;  3I5H C;  2PYQ A;  4YGA A;  2I7A A;  4L9M A;  3HX4 A;  3SS3 A;  3O2P A;  2MJW B;  1S1E A;  1S5G Y;  3NGV A;  1IRJ A;  2SAS A;  1LXF C;  2LHI A;  1IH0 A;  1F8H A;  2WND A;  3CAB A;  1CDN A;  1Y1X A;  5PAL A;  2KFF A;  2KSP A;  2KYC A;  3TS5 B;  1CDP A;  4KYN A;  3GK1 A;  1S6C A;  2JUL A;  2KQ6 A;  3OBV A;  4PT1 A;  2M1U A;  1KFX S;  1VRK A;  3IQQ A;  1EH2 A;  2HF5 A;  2JWW A;  1AHR A;  2ZND A;  2OS8 B;  3EK4 A;  1XVJ A;  1FW4 A;  3NSI A;  4OCI A;  4MBE A;  5CPV A;  2K7D A;  3VGO A;  4JD9 A;  1NPQ A;  1YVL A;  2JNX A;  1DEK A;  1B1G A;  4WRI A;  3IVT A;  2WCF A;  1DJW A;  3SG7 A;  1NWD A;  1OW4 A;  1DJG A;  2F2O A;  3Q8I A;  1QJT A;  3DD4 A;  1K95 A;  1YX7 A;  3R1P A;  2NCO A;  3BUX B;  3LK0 A;  5I2L A;  2K0J A;  2ZFD A;  3EKJ A;  1QX2 A;  3O78 A;  3PAL A;  4CID A;  4GNK B;  2M7L A;  1BT6 A;  1R6P A;  3FE8 A;  5I8N A;  1CNP A;  4HRG A;  2ZRS A;  4PAL A;  2PSR A;  2KAX A;  3O4X A;  2H61 A;  1JSA A;  2JZI A;  2NCP A;  3PJI A;  1FBV A;  1JUO A;  1OZO A;  1SW8 A;  4UPG A;  1OSA A;  1UHN A;  2KDH A;  3BUM B;  1SPY A;  4ICB A;  4YI9 A;  2G2B A;  4F0Z B;  3D74 A;  2M9G A;  4MZK A;  1AJ5 A;  4FQT A;  2KPH A;  1IGV A;  3NSK A;  1TOP A;  1CMG A;  3JVT B;  4WQ2 A;  1S5G Z;  1SL7 A;  1C7W A;  2F33 A;  2JXL A;  2KI6 C;  2JOJ A;  1QX5 B;  4JKT A;  4A4B A;  1DMO A;  1PK0 D;  1CFC A;  4R1E A;  4OVN F;  4M2Q A;  3CTN A;  4WQ3 A;  3FS7 A;  1YUR A;  3HCM A;  4QJ3 B;  1BMO A;  2LAP A;  1A75 B;  1KK8 C;  2FCE A;  4MZJ A;  2EHB A;  3CWG A;  3SG6 A;  3SIA A;  1UHH A;  5DIC A;  4A4C A;  2M1K B;  4MRX A;  3BUN B;  2GV5 A;  1IWQ A;  1TNQ A;  3CZT X;  4YI8 A;  2ISD A;  5K89 A;  5I2O A;  2H8V A;  2JPO A;  1WRK A;  3L4L A;  2KOT A;  2LP3 A;  2MHH A;  2M29 A;  3FIA A;  3PN7 B;  3VRQ A;  2LC5 A;  2Y1N A;  2P70 A;  2O60 A;  1DC1 A;  1S26 D;  1NSH A;  2ZNE A;  1REC A;  3LK1 A;  1BR4 B;  2BE6 A;  4XJK B;  1M39 A;  1H8B A;  1IJ6 A;  5TNC A;  1K93 D;  1G4Y R;  1SR6 C;  4PE7 A;  1MR8 A;  1WLZ A;  2WCJ A;  3OB2 B;  3OX6 A;  1MHO A;  1L2O B;  3KPX A;  4YBH B;  3K21 A;  5DKR A;  2I18 A;  1FF1 A;  1YUS A;  1M63 B;  5JJG A;  3TDI A;  5BPJ A;  4HRE E;  5KSZ A;  1WDC C;  1BJF A;  1R2U A;  2V53 A;  2ZKM X;  1SMG A;  2KNE A;  1J1D A;  2KGR A;  3SJS A;  1N0Y A;  2K61 A;  1KQV A;  1T14 A;  2BEC A;  2LLU A;  3DXL A;  2B1U A;  4INX A;  1DGU A;  2BKH B;  1SCV A;  2P71 A;  5AXI A;  1CFF A;  3DF0 A;  2KHN A;  1QVI Y;  3A8R A;  4CFQ A;  3RLZ A;  1U5I A;  1EG4 A;  1ZUZ A;  2R2I A;  4HRH A;  3D0Y A;  3OGN A;  2BL0 C;  3QME A;  2ERB A;  1BLQ A;  1L7Z A;  4N1F A;  1SY9 A;  4YGC B;  3BOW A;  3AKB A;  2KGB C;  1IIO A;  3NXA A;  3NSO A;  2LVJ A;  5DKN A;  2JT8 A;  4AOM A;  3BUO B;  1U5I B;  3FWC A;  1NX2 A;  1DJZ A;  2PQL A;  5CSJ A;  3N7H A;  3D0Y B;  1N65 A;  3WHT B;  3FE9 A;  1KK7 Y;  1YX8 A;  2AMI A;  2K2F A;  1CM1 A;  2M49 B;  1MQ1 A;  2LM5 A;  5AFP A;  1LVC D;  4C0J A;  4DS7 A;  1W7I B;  1ZAC A;  2Q4U A;  4YGD B;  2PAS A;  2JTT A;  3E3R A;  3D73 A;  5HYD A;  3AAJ A;  1NP8 A;  3CR5 X;  2JT0 A;  1TCF A;  1EG3 A;  1OMV A;  1SRA A;  3D76 A;  1QV1 A;  3JTD C;  4PE4 A;  4INW A;  1OZS A;  2K8M B;  3BFB A;  2OTG C;  1JBA A;  1RTP 1;  4MVF A;  2JXC A;  4BY5 A;  2QEB A;  1QAT A;  1F54 A;  1JWD A;  4HSZ A;  3F45 A;  5CSF A;  3KF9 A;  2K7B A;  1B9A A;  1OOI X;  3R1V A;  2MLE C;  2WCK A;  4N5X A;  4YGB B;  5JOL A;  1M45 A;  4PCW A;  4F7F A;  3S0F A;  5FYX A;  5HKZ A;  3TDZ A;  5FI6 A;  3KHE A;  2KI4 C;  2L51 A;  2WCE A;  1KQM C;  1SNL A;  3I5I C;  3WNX B;  3CGA A;  4DRW A;  1J7P A;  4AQJ A;  2LMT A;  2K7O A;  5I2Q A;  3O4Y A;  1CDL A;  1PAL A;  1CTR A;  1F4Q A;  1OQP A;  1QLS A;  2KLE A;  2L0P A;  2LP2 A;  3S0E A;  1Y1U A; 
#chains in the Genus database with same CATH homology
 3VB1 A;  1LS8 A;  3D78 A;  3BJH A;  2QEH A;  3NHT A;  3DYE A;  1OOH A;  1GM0 A;  5DIC A;  3CDN A;  3CZ0 A;  5EL2 A;  3BFH A;  2H8V A;  2JPO A;  1OOG A;  3R1O A;  3B6X A;  3L4L A;  1C3Z A;  1XFR A;  3CYZ A;  2P70 A;  3S0D A;  3V2L A;  3B87 A;  3K1E A;  2WCJ A;  2QEO A;  3BFA A;  3NGV A;  1TWO A;  1T14 A;  3S0G A;  2WC5 A;  3DXL A;  3CZ2 A;  4INX A;  2P71 A;  3CAB A;  2GTE A;  2WCH A;  2QEV A;  1P28 A;  3OGN A;  3QME A;  2ERB A;  1QWV A;  4PT1 A;  2WCL A;  3NHI A;  4JD9 A;  3R72 A;  1ORG A;  2PQL A;  3N7H A;  3CZ1 A;  3S0A A;  3FE9 A;  1OOF A;  1OW4 A;  3D75 A;  3RZS A;  3S0B A;  3Q8I A;  3D73 A;  3B86 A;  3R1P A;  3D76 A;  2L2C A;  4INW A;  3L4A A;  3BFB A;  3FE8 A;  3FE6 A;  2WC6 A;  2QEB A;  3B7A A;  4OZD A;  2FJY A;  3PJI A;  3DZT A;  3R1V A;  1OOI X;  3D77 A;  2WCK A;  4F7F A;  3S0F A;  2QDI A;  3L47 A;  1TUJ A;  1C3Y A;  3DY9 A;  3D74 A;  4FQT A;  2KPH A;  1DQE A;  3B88 A;  3S0E A;  2WCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...