3FE6A

Crystal structure of a pheromone binding protein from apis mellifera with a serendipitous ligand at ph 5.5
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH induced domain-swapping favors pheromone release
rcsb
source organism Apis mellifera
total genus 45
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3fe6A00
2GTEA 3B88A 3CABA 3DYEA 1ORGA 5DICA 3FE9A 3D75A 2PQLA 2QEOA 2JPOA 3BFHA 3D78A 3S0GA 1OOHA 1TUJA 2WC5A 3D73A 3PJIA 2P71A 3L47A 3Q8IA 3CZ2A 1C3ZA 3R1PA 3FE6A 3B86A 1LS8A 4JD9A 3L4LA 3CZ1A 3V2LA 1T14A 1OOGA 3B6XA 3BFAA 2P70A 1OOIX 3CYZA 3D77A 3NGVA 2QDIA 2WCKA 3OGNA 3RZSA 4OZDA 3D74A 2QEVA 2L2CA 1P28A 3N7HA 2WCJA 3CDNA 3K1EA 3DXLA 3D76A 5EL2A 3S0AA 3FE8A 2WC6A 3L4AA 2FJYA 3R1VA 3NHTA 1QWVA 2H8VA 1TWOA 3R1OA 2QEHA 2ERBA 3VB1A 1OW4A 3BJHA 3S0BA 3DZTA 1GM0A 4INWA 3S0FA 3S0EA 3B7AA 3CZ0A 3DY9A 3BFBA 2KPHA 1DQEA 3R72A 2QEBA 4F7FA 2WCHA 4INXA 1XFRA 4PT1A 3B87A 1OOFA 3S0DA 3QMEA 2WCLA 4FQTA 2WCMA 1C3YA 3NHIA
chains in the Genus database with same CATH superfamily
3DVKA 3KF9A 4MRYA 1JFJA 2NCPA 2M1KB 4QJ5B 1CMFA 1E8AA 2KAVA 4YGBB 5AANA 2LP3A 1TCOB 2H61A 3GOFA 4M2PA 2F33A 3NSOA 1K9PA 2M8UA 2BNXA 3LCPC 4USLA 1B7TZ 3EK4A 1KWOB 3LK0A 2TN4A 4IJ7A 5CSIA 1ALVA 2JPOA 1YTZC 2H2KA 3PATA 1XYDA 1IJ5A 1B8LA 1QVIZ 1TUJA 2BBMA 1CM4A 1PSBA 2KAYA 1PK0D 1SR6B 2F2OA 1S1EA 2QPTA 3EKJA 3M0WA 4MBEA 1SKTA 1SRAA 2JC2A 2MAZA 2P71A 1PVAA 3K21A 3C1VA 1DJHA 1NX1A 3BYAA 3FE6A 5CSNA 3RM1A 4DS7A 3EK7A 1K9KA 2LLUA 2LUXA 2MA2A 4AQIA 2JT3A 2NCOA 2KFHA 2KGBC 1QLKA 4OR9B 4XYNA 3SS4A 2CBLA 5KU1A 2P70A 1OOIX 2GGMA 4MLWA 4QJ3B 1CDNA 2LVIA 3D77A 4M2QA 2QDIA 1CLBA 2L4IA 1H4BA 2KFFA 2B1UA 3CR4X 2L5XB 3RZSA 4OZDA 1CKKA 4AQJA 2I18A 3GK1A 4YI8A 5D7FA 1BT6A 1EH2A 2AAOA 2QEVA 1YX8A 2KYCA 1HQVA 1MXEA 3PN7B 2JT0A 5FYXA 3H4SE 1B4CA 2LP2A 3N7HA 3PSRA 1SBJA 3DXLA 3SIBA 3IQOA 2K61A 1K96A 2BBNA 4QJ4B 1DJGA 1SCMC 1H8BA 2KYFA 2WCFA 1KK7Y 3AKAA 1C07A 1EJ3A 2BCAA 1UWOA 2KI6C 2HQ8A 2COLB 1A75B 2KLEA 3D10A 3L4AA 4MZKA 1S3PA 2BCBA 3EG5B 1DJXA 1PRWA 2H8VA 1MXLC 1YURA 1KSMA 2ZRSA 1WLZA 3A4UB 3IQQA 5FI7A 3VB1A 1XFZO 1HT9A 1SK6D 1W7IB 1OOJA 2JULA 3BJHA 1F55A 1K93D 2AUCA 2EHBA 4HRHA 2JTZA 3DZTA 4D1EA 2G2BA 3S0FA 1OZSA 2BKHB 1WLMA 2PASA 4WQ3A 4I5KA 3CZ0A 1ODBA 3DY9A 5F6TA 3BFBA 1CM1A 3OB1B 3TS5B 4ORAB 3ZWHA 4HSZA 3EK8A 3I5HC 1TNPA 1KFUL 3WNXB 1D1OA 1BF5A 3DVJA 4P5OE 4F7FA 2WCHA 3UO9A 3PALA 2MRDA 1XFRA 4GFTA 4GGFA 4MRXA 2OTGC 1QV0A 3WHUB 2O5GA 1SY9A 2ZN8A 2LNKA 3RLZA 2F2PA 4N5XA 1TCFA 2I7AA 2K60A 3I5HB 3PFVA 1DF0B 1YUUA 2HETA 2KNEA 1JBAA 2JPTA 3CGAA 3BUMB 5HYDA 5HKYA 1TNWA 1L2OC 4PHJA 4YGEB 3CR2A 1Q80A 2LLSA 4GPLB 1M45A 3DVMA 3PM8A 1PSRA 2GTEA 4GBAA 2KBMA 1CFDA 1QLSA 2K7DA 2MLFC 5ER4X 2KI4C 3DYEA 4C0LA 1TTXA 2Y5IA 4ORBB 2KI6D 4F0ZB 1LINA 1SYMA 4ICBA 1AJ4A 2Y1NA 2M7LA 1DJYA 2PQLA 5DKQA 4ZCUA 3BFHA 2MJWB 3FIAA 4AOMA 2WNDA 2WC5A 2Q4UA 1YVLA 3D73A 1SCVA 3ICBA 3PJIA 4TNCA 3L47A 1BR4B 2CXJA 4PALA 1RWYA 1NX0A 2R2IA 3SG2A 3CZ2A 5CSJA 3ZNIA 5AFPA 1C3ZA 2JT8A 2LC5A 1L7ZA 2KHNA 1J7RA 3SIAA 1LXFC 1MQ1A 3IVTA 3WHTB 4JD9A 1CDMA 1CMGA 1ZUZA 3L4LA 4NQGA 4C0KA 1FI5A 1PULA 4MEWA 3D0YB 3V2LA 5JJGA 2WCEA 2ZRTA 1T14A 1OOGA 1XFXO 2EC6B 3BUXB 3OB2B 1KK7Z 3CYZA 4CIDA 3VRNA 3SG5A 1BJFA 2LVJA 1BOCA 1A4PA 3CTNA 3DD4A 1EL4A 3A8RA 3FS7A 1YRTB 2L51A 2JRFA 2GGZA 4CFRA 2WC8A 2K7OA 2P6BB 3OX6A 2WCJA 1MUXA 2FCDA 1K2HA 3K1EA 2KAXA 1QX2A 5AEQA 1DGVA 1N65A 1IQ5A 3O2PA 1OE9B 1KCYA 5BPJA 3I5GC 1DJIA 1R2UA 2LVKA 2I94A 4PDZA 2JNFA 4PE1A 1A75A 1YX7A 5FI2A 5HKWA 2BL0C 1AHRA 1Z2CB 3CZTX 4ZCVA 1BU3A 1TUZA 2KQ6A 5FI6A 1IH0A 1SL8A 1WDCC 1DELA 2FJYA 3JTDC 4YGCB 1VRKA 2OS8C 3NHTA 1Y6WA 2JXLA 2M1UA 1TWOA 4OKHA 3R1OA 1RTP1 3I5FC 1IKUA 1BLQA 1C7WA 1FI6A 2KOTA 1MHOA 1V1FA 1CB1A 1ZMZA 1RJVA 2JOJA 3DF0A 2DOQA 2ZKMX 3TZ1A 2L50A 3S0BA 2NXQA 1SL7A 4N1GA 1DEKA 1XO5A 3VGOA 2BL0B 2K0JA 1ALWA 2LVVA 3B7AA 2EGDA 3JTDB 4OVNF 2OS8B 3KPXA 2BECA 2KPHA 1J1EA 1NCXA 2JXCA 1KFXS 1CDLA 3LL8B 5DKNA 3SG3A 2K8MB 2LHLA 1K94A 1S6IA 2SCPA 4INXA 4NDBA 4PT1A 5KSZA 2Y4QA 1B8CA 3CS1A 3B87A 1UURA 1SMGA 2KGRA 1NX2A 1DF0A 1GJYA 5B8IB 4YGDB 2E30A 1XK4C 2IS9A 1DVIA 1SCMB 2FOTA 3KO0A 1J1DA 3O78A 4KYNA 2M29A 4R1EA 1BG1A 3TDIA 3NHIA 1SSEB 3DF0B 1KQMC 4ETOA 1PVBA 1Y0VH 4UPGA 1QIVA 3TUYC 1CLMA 3GK2A 1OMRA 4WRIA 4CFQA 3CABA 1UUSA 2M9GA 2VRGA 4Q04A 1ORGA 3GK4X 2D8NA 1YRUB 2V53A 1F8HA 1XA5A 5PALA 3FE9A 4PHKA 4E68A 3D75A 2LAPA 2QEOA 4FTGA 3S0GA 1NIWA 2M0RA 1RK9A 2KSPA 3NSIA 1QV1A 1ZFSA 3SS3A 3O6BA 1J7QA 1F70A 2JU0A 1B8RA 1UHHA 1QS7A 2LM5A 1QXPA 1X02A 1WRZA 1EXRA 1YUSA 2HQWA 2ZNEA 4JQ0D 1BMOA 1G8IA 1PALA 2LE9B 2OTGB 2BAPA 4MZJA 1UHIA 5AXIA 2LHIA 4I5LB 2G9BA 3B86A 3D0YA 5I2LA 3TDUA 1N2DA 1DGUA 1F4OA 1KFUS 2ZN9A 4PCWA 3CZ1A 3SJSA 2PVBA 1XFVO 1GGWA 3UNWA 1UHNA 2Y1MA 3B6XA 3BFAA 3FWCA 5D69A 1MR8A 2YGUA 1KQVA 2RGIA 1NP8A 1L2OB 1Z4HA 2L0PA 2L4HA 4BY5A 3OGNA 1G33A 3AAKA 1W7JB 1NX3A 1WRLA 3AAJA 1TNXA 1YR5A 3CLNA 4GAOA 1S5GY 4DRWA 1AP4A 2KI4B 1TN4A 2L2CA 2LANA 3BXKA 4WQ2A 5HL1A 4JKTA 1IJ6A 1KK8C 1P28A 1OMVA 3AKBA 3SS5A 2ZFDA 2QACA 4NDCA 1NUBA 2I2RE 3VRPA 1DMOA 1RROA 2A4JA 2PYQA 3SG6A 1QASA 3D76A 5EL2A 2WORA 1G4YR 3KEVA 3FWBA 1XFYO 1CFFA 1GQMA 3FE8A 4IL1A 2WC6A 2M97A 1YUTA 1DJWA 1K95A 3BUNB 4PE4A 1Y1XA 1KK8B 2AMIA 4YGAA 2NZ0A 3SG7A 1NCZA 4HREE 3CWGA 1N0YA 1UP5A 1SPYA 5IBWA 4ORCB 1LA0A 4GUKA 2LMVA 4INWA 1TNQA 1B9AA 5TNCA 4YRUA 1GM0A 3MSEB 5HKZA 1A29A 2F3ZA 3S0EA 4JWQA 4MZLA 1SR6C 3BOWA 1QX7A 1K9UA 1NCYA 1TRFA 3OBVA 5D3OA 4DUQA 2F8PA 3R72A 2HPSA 2FJUB 3O4YA 2MBXA 5GQQC 2LUCA 4YBHB 3JVTC 1DTLA 1FW4A 2PMYA 5G08A 1QATA 2CCMA 2K7BA 3NSKA 2KDHA 2ISDA 1FBVA 1CNPA 2WCBA 3BUWB 2HF5A 2CTNA 2NLNA 1OOFA 1QX5B 1IIOA 4GNKB 3TDZA 3S0DA 1NPQA 2K2FA 3QMEA 4U8DA 3I5GB 1IGVA 2H61C 2WCLA 1MWNA 3JVTB 4MN0A 1V1GA 2WCMA 4FQTA 4CLNA 1XFWO 1SL9A 1C3YA 1F71A 3NXAA 1IRJA 1ZOTB 1WDCB 3QRXA 5HLVA 1JF0A 1M63B 1TIZA 3B88A 2JQ6A 4P2YB 5ER5A 1KFXL 1XK4A 2JWWA 1OQPA 1CDPA 3DVEA 3NSLA 1J7OA 2LMTA 3I5FB 2LMUA 3PN7C 2BKIB 3BOWB 1JFKA 2FCEA 3I5IC 5DICA 1WY9A 1FPWA 4A4CA 1XFUO 2CT9A 2E6WA 3D78A 1R6PA 1JSAA 1OOHA 3VRQA 2WOSA 2JZIA 1QIWA 2PALA 3KHEA 4M2OA 1RECA 1OMDA 1JWDA 1NWDA 5I2OA 1SW8A 1NYAA 1FF1A 2BE6A 2LLTA 3Q8IA 2M7NA 2PRUA 1W9ZA 3EKHA 3HX4A 1BR1B 2K2AA 3I5IB 1U5IA 3LLEA 4MSPA 3R1PA 1IG5A 1LKJA 1S5GZ 4I5JA 4FQOA 1B7TY 1DT7B 1LS8A 1Y1UA 1MF8B 1UHJA 1CTRA 2K7CA 1S6JA 3VROA 1XVJA 4BY4A 1QVIY 1OSAA 1RFJA 5CSFA 4XJKA 2L2EA 1M31A 2LCPA 3TS5C 5AERA 1LVCD 4DIRA 1CFCA 4JPZB 1EG3A 3NGVA 5CPVA 1LA3A 1K90D 4GGNA 1KQMB 2WCKA 3SG4A 4PHMA 3TUYB 4DCKA 1CLLA 1K8UA 4PE0A 5K89A 3PLFB 1IWQA 4YI9A 3D74A 1WRKA 1B1GA 4PHNA 2KQYA 3CDNA 1S6CA 2OPOA 4OCIA 1UHKA 2KFGA 3EVUA 3PM2A 1Y1AA 1NSHA 3EVVA 3F45A 1DC1A 1U5IB 1EG4A 3E3RA 4N1FA 2GV5A 4OV2A 3OP0A 3S0AA 4CPVA 3HCMA 5KTYA 4L9MA 1AJ5A 2SASA 1SNLA 1AUIB 1CFPA 1KSOA 3R1VA 2L5YA 1QWVA 4NDDA 4I5NB 1YVHA 2QEHA 2KBIA 4XJKB 2ERBA 1OW4A 1S26D 3OHMB 1OZOA 4HRGA 5HLOA 1JUOA 5J3XA 2L98A 2BE4A 2CNPA 2BCXA 3OX5A 1A2XA 3EVRA 5DKRA 1AVSA 2O60A 2Q91A 5JOLA 1BODA 4GGFC 5I8NA 4A4BA 1DJZA 1F4QA 1JC2A 1DQEA 4C0JA 1GGZA 2QEBA 1A03A 3BQ3A 4MVFA 4PE7A 1IQ3A 1QJTA 2F3YA 2PSRA 1J7PA 1ZACA 1QTXA 2KLDA 3LK1A 1M46A 2MLEC 3O4XA 3CR5X 2JTTA 2M49B 1F54A 1AK8A 3BUOB 1B47A 5I2QA 2LV7A 1TOPA 2EC6C 2ZNDA 5I94A 1JF2A 1KWOC 1M39A 2M3WA 3VRRA 2JNXA 1S36A 1J55A 1C7VA 2MHHA 3WXAA 3IF7A
chains in the Genus database with same CATH topology
2GTEA 3B88A 3CABA 3DYEA 1ORGA 5DICA 3FE9A 3D75A 2PQLA 2QEOA 2JPOA 3BFHA 3D78A 3S0GA 1OOHA 1TUJA 2WC5A 3D73A 3PJIA 2P71A 3L47A 3Q8IA 3CZ2A 1C3ZA 3R1PA 3FE6A 3B86A 1LS8A 4JD9A 3L4LA 3CZ1A 3V2LA 1T14A 1OOGA 3B6XA 3BFAA 2P70A 1OOIX 3CYZA 3D77A 3NGVA 2QDIA 2WCKA 3OGNA 3RZSA 4OZDA 3D74A 2QEVA 2L2CA 1P28A 3N7HA 2WCJA 3CDNA 3K1EA 3DXLA 3D76A 5EL2A 3S0AA 3FE8A 2WC6A 3L4AA 2FJYA 3R1VA 3NHTA 1QWVA 2H8VA 1TWOA 3R1OA 2QEHA 2ERBA 3VB1A 1OW4A 3BJHA 3S0BA 3DZTA 1GM0A 4INWA 3S0FA 3S0EA 3B7AA 3CZ0A 3DY9A 3BFBA 2KPHA 1DQEA 3R72A 2QEBA 4F7FA 2WCHA 4INXA 1XFRA 4PT1A 3B87A 1OOFA 3S0DA 3QMEA 2WCLA 4FQTA 2WCMA 1C3YA 3NHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTE A;  3B88 A;  3CAB A;  3DYE A;  1ORG A;  5DIC A;  3FE9 A;  3D75 A;  2PQL A;  2QEO A;  2JPO A;  3BFH A;  3D78 A;  3S0G A;  1OOH A;  1TUJ A;  2WC5 A;  3D73 A;  3PJI A;  2P71 A;  3L47 A;  3Q8I A;  3CZ2 A;  1C3Z A;  3R1P A;  3FE6 A;  3B86 A;  1LS8 A;  4JD9 A;  3L4L A;  3CZ1 A;  3V2L A;  1T14 A;  1OOG A;  3B6X A;  3BFA A;  2P70 A;  1OOI X;  3CYZ A;  3D77 A;  3NGV A;  2QDI A;  2WCK A;  3OGN A;  3RZS A;  4OZD A;  3D74 A;  2QEV A;  2L2C A;  1P28 A;  3N7H A;  2WCJ A;  3CDN A;  3K1E A;  3DXL A;  3D76 A;  5EL2 A;  3S0A A;  3FE8 A;  2WC6 A;  3L4A A;  2FJY A;  3R1V A;  3NHT A;  1QWV A;  2H8V A;  1TWO A;  3R1O A;  2QEH A;  2ERB A;  3VB1 A;  1OW4 A;  3BJH A;  3S0B A;  3DZT A;  1GM0 A;  4INW A;  3S0F A;  3S0E A;  3B7A A;  3CZ0 A;  3DY9 A;  3BFB A;  2KPH A;  1DQE A;  3R72 A;  2QEB A;  4F7F A;  2WCH A;  4INX A;  1XFR A;  4PT1 A;  3B87 A;  1OOF A;  3S0D A;  3QME A;  2WCL A;  4FQT A;  2WCM A;  1C3Y A;  3NHI A; 
#chains in the Genus database with same CATH topology
 3DVK A;  3KF9 A;  4MRY A;  1JFJ A;  2NCP A;  2M1K B;  4QJ5 B;  1CMF A;  1E8A A;  2KAV A;  4YGB B;  5AAN A;  2LP3 A;  1TCO B;  2H61 A;  3GOF A;  4M2P A;  2F33 A;  3NSO A;  1K9P A;  2M8U A;  2BNX A;  3LCP C;  4USL A;  1B7T Z;  3EK4 A;  1KWO B;  3LK0 A;  2TN4 A;  4IJ7 A;  5CSI A;  1ALV A;  2JPO A;  1YTZ C;  2H2K A;  3PAT A;  1XYD A;  1IJ5 A;  1B8L A;  1QVI Z;  1TUJ A;  2BBM A;  1CM4 A;  1PSB A;  2KAY A;  1PK0 D;  1SR6 B;  2F2O A;  1S1E A;  2QPT A;  3EKJ A;  3M0W A;  4MBE A;  1SKT A;  1SRA A;  2JC2 A;  2MAZ A;  2P71 A;  1PVA A;  3K21 A;  3C1V A;  1DJH A;  1NX1 A;  3BYA A;  3FE6 A;  5CSN A;  3RM1 A;  4DS7 A;  3EK7 A;  1K9K A;  2LLU A;  2LUX A;  2MA2 A;  4AQI A;  2JT3 A;  2NCO A;  2KFH A;  2KGB C;  1QLK A;  4OR9 B;  4XYN A;  3SS4 A;  2CBL A;  5KU1 A;  2P70 A;  1OOI X;  2GGM A;  4MLW A;  4QJ3 B;  1CDN A;  2LVI A;  3D77 A;  4M2Q A;  2QDI A;  1CLB A;  2L4I A;  1H4B A;  2KFF A;  2B1U A;  3CR4 X;  2L5X B;  3RZS A;  4OZD A;  1CKK A;  4AQJ A;  2I18 A;  3GK1 A;  4YI8 A;  5D7F A;  1BT6 A;  1EH2 A;  2AAO A;  2QEV A;  1YX8 A;  2KYC A;  1HQV A;  1MXE A;  3PN7 B;  2JT0 A;  5FYX A;  3H4S E;  1B4C A;  2LP2 A;  3N7H A;  3PSR A;  1SBJ A;  3DXL A;  3SIB A;  3IQO A;  2K61 A;  1K96 A;  2BBN A;  4QJ4 B;  1DJG A;  1SCM C;  1H8B A;  2KYF A;  2WCF A;  1KK7 Y;  3AKA A;  1C07 A;  1EJ3 A;  2BCA A;  1UWO A;  2KI6 C;  2HQ8 A;  2COL B;  1A75 B;  2KLE A;  3D10 A;  3L4A A;  4MZK A;  1S3P A;  2BCB A;  3EG5 B;  1DJX A;  1PRW A;  2H8V A;  1MXL C;  1YUR A;  1KSM A;  2ZRS A;  1WLZ A;  3A4U B;  3IQQ A;  5FI7 A;  3VB1 A;  1XFZ O;  1HT9 A;  1SK6 D;  1W7I B;  1OOJ A;  2JUL A;  3BJH A;  1F55 A;  1K93 D;  2AUC A;  2EHB A;  4HRH A;  2JTZ A;  3DZT A;  4D1E A;  2G2B A;  3S0F A;  1OZS A;  2BKH B;  1WLM A;  2PAS A;  4WQ3 A;  4I5K A;  3CZ0 A;  1ODB A;  3DY9 A;  5F6T A;  3BFB A;  1CM1 A;  3OB1 B;  3TS5 B;  4ORA B;  3ZWH A;  4HSZ A;  3EK8 A;  3I5H C;  1TNP A;  1KFU L;  3WNX B;  1D1O A;  1BF5 A;  3DVJ A;  4P5O E;  4F7F A;  2WCH A;  3UO9 A;  3PAL A;  2MRD A;  1XFR A;  4GFT A;  4GGF A;  4MRX A;  2OTG C;  1QV0 A;  3WHU B;  2O5G A;  1SY9 A;  2ZN8 A;  2LNK A;  3RLZ A;  2F2P A;  4N5X A;  1TCF A;  2I7A A;  2K60 A;  3I5H B;  3PFV A;  1DF0 B;  1YUU A;  2HET A;  2KNE A;  1JBA A;  2JPT A;  3CGA A;  3BUM B;  5HYD A;  5HKY A;  1TNW A;  1L2O C;  4PHJ A;  4YGE B;  3CR2 A;  1Q80 A;  2LLS A;  4GPL B;  1M45 A;  3DVM A;  3PM8 A;  1PSR A;  2GTE A;  4GBA A;  2KBM A;  1CFD A;  1QLS A;  2K7D A;  2MLF C;  5ER4 X;  2KI4 C;  3DYE A;  4C0L A;  1TTX A;  2Y5I A;  4ORB B;  2KI6 D;  4F0Z B;  1LIN A;  1SYM A;  4ICB A;  1AJ4 A;  2Y1N A;  2M7L A;  1DJY A;  2PQL A;  5DKQ A;  4ZCU A;  3BFH A;  2MJW B;  3FIA A;  4AOM A;  2WND A;  2WC5 A;  2Q4U A;  1YVL A;  3D73 A;  1SCV A;  3ICB A;  3PJI A;  4TNC A;  3L47 A;  1BR4 B;  2CXJ A;  4PAL A;  1RWY A;  1NX0 A;  2R2I A;  3SG2 A;  3CZ2 A;  5CSJ A;  3ZNI A;  5AFP A;  1C3Z A;  2JT8 A;  2LC5 A;  1L7Z A;  2KHN A;  1J7R A;  3SIA A;  1LXF C;  1MQ1 A;  3IVT A;  3WHT B;  4JD9 A;  1CDM A;  1CMG A;  1ZUZ A;  3L4L A;  4NQG A;  4C0K A;  1FI5 A;  1PUL A;  4MEW A;  3D0Y B;  3V2L A;  5JJG A;  2WCE A;  2ZRT A;  1T14 A;  1OOG A;  1XFX O;  2EC6 B;  3BUX B;  3OB2 B;  1KK7 Z;  3CYZ A;  4CID A;  3VRN A;  3SG5 A;  1BJF A;  2LVJ A;  1BOC A;  1A4P A;  3CTN A;  3DD4 A;  1EL4 A;  3A8R A;  3FS7 A;  1YRT B;  2L51 A;  2JRF A;  2GGZ A;  4CFR A;  2WC8 A;  2K7O A;  2P6B B;  3OX6 A;  2WCJ A;  1MUX A;  2FCD A;  1K2H A;  3K1E A;  2KAX A;  1QX2 A;  5AEQ A;  1DGV A;  1N65 A;  1IQ5 A;  3O2P A;  1OE9 B;  1KCY A;  5BPJ A;  3I5G C;  1DJI A;  1R2U A;  2LVK A;  2I94 A;  4PDZ A;  2JNF A;  4PE1 A;  1A75 A;  1YX7 A;  5FI2 A;  5HKW A;  2BL0 C;  1AHR A;  1Z2C B;  3CZT X;  4ZCV A;  1BU3 A;  1TUZ A;  2KQ6 A;  5FI6 A;  1IH0 A;  1SL8 A;  1WDC C;  1DEL A;  2FJY A;  3JTD C;  4YGC B;  1VRK A;  2OS8 C;  3NHT A;  1Y6W A;  2JXL A;  2M1U A;  1TWO A;  4OKH A;  3R1O A;  1RTP 1;  3I5F C;  1IKU A;  1BLQ A;  1C7W A;  1FI6 A;  2KOT A;  1MHO A;  1V1F A;  1CB1 A;  1ZMZ A;  1RJV A;  2JOJ A;  3DF0 A;  2DOQ A;  2ZKM X;  3TZ1 A;  2L50 A;  3S0B A;  2NXQ A;  1SL7 A;  4N1G A;  1DEK A;  1XO5 A;  3VGO A;  2BL0 B;  2K0J A;  1ALW A;  2LVV A;  3B7A A;  2EGD A;  3JTD B;  4OVN F;  2OS8 B;  3KPX A;  2BEC A;  2KPH A;  1J1E A;  1NCX A;  2JXC A;  1KFX S;  1CDL A;  3LL8 B;  5DKN A;  3SG3 A;  2K8M B;  2LHL A;  1K94 A;  1S6I A;  2SCP A;  4INX A;  4NDB A;  4PT1 A;  5KSZ A;  2Y4Q A;  1B8C A;  3CS1 A;  3B87 A;  1UUR A;  1SMG A;  2KGR A;  1NX2 A;  1DF0 A;  1GJY A;  5B8I B;  4YGD B;  2E30 A;  1XK4 C;  2IS9 A;  1DVI A;  1SCM B;  2FOT A;  3KO0 A;  1J1D A;  3O78 A;  4KYN A;  2M29 A;  4R1E A;  1BG1 A;  3TDI A;  3NHI A;  1SSE B;  3DF0 B;  1KQM C;  4ETO A;  1PVB A;  1Y0V H;  4UPG A;  1QIV A;  3TUY C;  1CLM A;  3GK2 A;  1OMR A;  4WRI A;  4CFQ A;  3CAB A;  1UUS A;  2M9G A;  2VRG A;  4Q04 A;  1ORG A;  3GK4 X;  2D8N A;  1YRU B;  2V53 A;  1F8H A;  1XA5 A;  5PAL A;  3FE9 A;  4PHK A;  4E68 A;  3D75 A;  2LAP A;  2QEO A;  4FTG A;  3S0G A;  1NIW A;  2M0R A;  1RK9 A;  2KSP A;  3NSI A;  1QV1 A;  1ZFS A;  3SS3 A;  3O6B A;  1J7Q A;  1F70 A;  2JU0 A;  1B8R A;  1UHH A;  1QS7 A;  2LM5 A;  1QXP A;  1X02 A;  1WRZ A;  1EXR A;  1YUS A;  2HQW A;  2ZNE A;  4JQ0 D;  1BMO A;  1G8I A;  1PAL A;  2LE9 B;  2OTG B;  2BAP A;  4MZJ A;  1UHI A;  5AXI A;  2LHI A;  4I5L B;  2G9B A;  3B86 A;  3D0Y A;  5I2L A;  3TDU A;  1N2D A;  1DGU A;  1F4O A;  1KFU S;  2ZN9 A;  4PCW A;  3CZ1 A;  3SJS A;  2PVB A;  1XFV O;  1GGW A;  3UNW A;  1UHN A;  2Y1M A;  3B6X A;  3BFA A;  3FWC A;  5D69 A;  1MR8 A;  2YGU A;  1KQV A;  2RGI A;  1NP8 A;  1L2O B;  1Z4H A;  2L0P A;  2L4H A;  4BY5 A;  3OGN A;  1G33 A;  3AAK A;  1W7J B;  1NX3 A;  1WRL A;  3AAJ A;  1TNX A;  1YR5 A;  3CLN A;  4GAO A;  1S5G Y;  4DRW A;  1AP4 A;  2KI4 B;  1TN4 A;  2L2C A;  2LAN A;  3BXK A;  4WQ2 A;  5HL1 A;  4JKT A;  1IJ6 A;  1KK8 C;  1P28 A;  1OMV A;  3AKB A;  3SS5 A;  2ZFD A;  2QAC A;  4NDC A;  1NUB A;  2I2R E;  3VRP A;  1DMO A;  1RRO A;  2A4J A;  2PYQ A;  3SG6 A;  1QAS A;  3D76 A;  5EL2 A;  2WOR A;  1G4Y R;  3KEV A;  3FWB A;  1XFY O;  1CFF A;  1GQM A;  3FE8 A;  4IL1 A;  2WC6 A;  2M97 A;  1YUT A;  1DJW A;  1K95 A;  3BUN B;  4PE4 A;  1Y1X A;  1KK8 B;  2AMI A;  4YGA A;  2NZ0 A;  3SG7 A;  1NCZ A;  4HRE E;  3CWG A;  1N0Y A;  1UP5 A;  1SPY A;  5IBW A;  4ORC B;  1LA0 A;  4GUK A;  2LMV A;  4INW A;  1TNQ A;  1B9A A;  5TNC A;  4YRU A;  1GM0 A;  3MSE B;  5HKZ A;  1A29 A;  2F3Z A;  3S0E A;  4JWQ A;  4MZL A;  1SR6 C;  3BOW A;  1QX7 A;  1K9U A;  1NCY A;  1TRF A;  3OBV A;  5D3O A;  4DUQ A;  2F8P A;  3R72 A;  2HPS A;  2FJU B;  3O4Y A;  2MBX A;  5GQQ C;  2LUC A;  4YBH B;  3JVT C;  1DTL A;  1FW4 A;  2PMY A;  5G08 A;  1QAT A;  2CCM A;  2K7B A;  3NSK A;  2KDH A;  2ISD A;  1FBV A;  1CNP A;  2WCB A;  3BUW B;  2HF5 A;  2CTN A;  2NLN A;  1OOF A;  1QX5 B;  1IIO A;  4GNK B;  3TDZ A;  3S0D A;  1NPQ A;  2K2F A;  3QME A;  4U8D A;  3I5G B;  1IGV A;  2H61 C;  2WCL A;  1MWN A;  3JVT B;  4MN0 A;  1V1G A;  2WCM A;  4FQT A;  4CLN A;  1XFW O;  1SL9 A;  1C3Y A;  1F71 A;  3NXA A;  1IRJ A;  1ZOT B;  1WDC B;  3QRX A;  5HLV A;  1JF0 A;  1M63 B;  1TIZ A;  3B88 A;  2JQ6 A;  4P2Y B;  5ER5 A;  1KFX L;  1XK4 A;  2JWW A;  1OQP A;  1CDP A;  3DVE A;  3NSL A;  1J7O A;  2LMT A;  3I5F B;  2LMU A;  3PN7 C;  2BKI B;  3BOW B;  1JFK A;  2FCE A;  3I5I C;  5DIC A;  1WY9 A;  1FPW A;  4A4C A;  1XFU O;  2CT9 A;  2E6W A;  3D78 A;  1R6P A;  1JSA A;  1OOH A;  3VRQ A;  2WOS A;  2JZI A;  1QIW A;  2PAL A;  3KHE A;  4M2O A;  1REC A;  1OMD A;  1JWD A;  1NWD A;  5I2O A;  1SW8 A;  1NYA A;  1FF1 A;  2BE6 A;  2LLT A;  3Q8I A;  2M7N A;  2PRU A;  1W9Z A;  3EKH A;  3HX4 A;  1BR1 B;  2K2A A;  3I5I B;  1U5I A;  3LLE A;  4MSP A;  3R1P A;  1IG5 A;  1LKJ A;  1S5G Z;  4I5J A;  4FQO A;  1B7T Y;  1DT7 B;  1LS8 A;  1Y1U A;  1MF8 B;  1UHJ A;  1CTR A;  2K7C A;  1S6J A;  3VRO A;  1XVJ A;  4BY4 A;  1QVI Y;  1OSA A;  1RFJ A;  5CSF A;  4XJK A;  2L2E A;  1M31 A;  2LCP A;  3TS5 C;  5AER A;  1LVC D;  4DIR A;  1CFC A;  4JPZ B;  1EG3 A;  3NGV A;  5CPV A;  1LA3 A;  1K90 D;  4GGN A;  1KQM B;  2WCK A;  3SG4 A;  4PHM A;  3TUY B;  4DCK A;  1CLL A;  1K8U A;  4PE0 A;  5K89 A;  3PLF B;  1IWQ A;  4YI9 A;  3D74 A;  1WRK A;  1B1G A;  4PHN A;  2KQY A;  3CDN A;  1S6C A;  2OPO A;  4OCI A;  1UHK A;  2KFG A;  3EVU A;  3PM2 A;  1Y1A A;  1NSH A;  3EVV A;  3F45 A;  1DC1 A;  1U5I B;  1EG4 A;  3E3R A;  4N1F A;  2GV5 A;  4OV2 A;  3OP0 A;  3S0A A;  4CPV A;  3HCM A;  5KTY A;  4L9M A;  1AJ5 A;  2SAS A;  1SNL A;  1AUI B;  1CFP A;  1KSO A;  3R1V A;  2L5Y A;  1QWV A;  4NDD A;  4I5N B;  1YVH A;  2QEH A;  2KBI A;  4XJK B;  2ERB A;  1OW4 A;  1S26 D;  3OHM B;  1OZO A;  4HRG A;  5HLO A;  1JUO A;  5J3X A;  2L98 A;  2BE4 A;  2CNP A;  2BCX A;  3OX5 A;  1A2X A;  3EVR A;  5DKR A;  1AVS A;  2O60 A;  2Q91 A;  5JOL A;  1BOD A;  4GGF C;  5I8N A;  4A4B A;  1DJZ A;  1F4Q A;  1JC2 A;  1DQE A;  4C0J A;  1GGZ A;  2QEB A;  1A03 A;  3BQ3 A;  4MVF A;  4PE7 A;  1IQ3 A;  1QJT A;  2F3Y A;  2PSR A;  1J7P A;  1ZAC A;  1QTX A;  2KLD A;  3LK1 A;  1M46 A;  2MLE C;  3O4X A;  3CR5 X;  2JTT A;  2M49 B;  1F54 A;  1AK8 A;  3BUO B;  1B47 A;  5I2Q A;  2LV7 A;  1TOP A;  2EC6 C;  2ZND A;  5I94 A;  1JF2 A;  1KWO C;  1M39 A;  2M3W A;  3VRR A;  2JNX A;  1S36 A;  1J55 A;  1C7V A;  2MHH A;  3WXA A;  3IF7 A; 
#chains in the Genus database with same CATH homology
 2GTE A;  3B88 A;  3CAB A;  3DYE A;  1ORG A;  5DIC A;  3FE9 A;  3D75 A;  2PQL A;  2QEO A;  2JPO A;  3BFH A;  3D78 A;  3S0G A;  1OOH A;  1TUJ A;  2WC5 A;  3D73 A;  3PJI A;  2P71 A;  3L47 A;  3Q8I A;  3CZ2 A;  1C3Z A;  3R1P A;  3FE6 A;  3B86 A;  1LS8 A;  4JD9 A;  3L4L A;  3CZ1 A;  3V2L A;  1T14 A;  1OOG A;  3B6X A;  3BFA A;  2P70 A;  1OOI X;  3CYZ A;  3D77 A;  3NGV A;  2QDI A;  2WCK A;  3OGN A;  3RZS A;  4OZD A;  3D74 A;  2QEV A;  2L2C A;  1P28 A;  3N7H A;  2WCJ A;  3CDN A;  3K1E A;  3DXL A;  3D76 A;  5EL2 A;  3S0A A;  3FE8 A;  2WC6 A;  3L4A A;  2FJY A;  3R1V A;  3NHT A;  1QWV A;  2H8V A;  1TWO A;  3R1O A;  2QEH A;  2ERB A;  3VB1 A;  1OW4 A;  3BJH A;  3S0B A;  3DZT A;  1GM0 A;  4INW A;  3S0F A;  3S0E A;  3B7A A;  3CZ0 A;  3DY9 A;  3BFB A;  2KPH A;  1DQE A;  3R72 A;  2QEB A;  4F7F A;  2WCH A;  4INX A;  1XFR A;  4PT1 A;  3B87 A;  1OOF A;  3S0D A;  3QME A;  2WCL A;  4FQT A;  2WCM A;  1C3Y A;  3NHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...