1S36A

Crystal structure of a ca2+-discharged photoprotein: implications for the mechanisms of the calcium trigger and the bioluminescence
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
185
Chain Sequence
VKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGFKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Obelin
publication title Crystal structure of a Ca2+-discharged photoprotein: implications for mechanisms of the calcium trigger and bioluminescence
pubmed doi rcsb
source organism Obelia longissima
total genus 71
structure length 185
sequence length 189
ec nomenclature
pdb deposition date 2004-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s36A00
1B9AA 1KFUS 1XFUO 1KK8C 2JNXA 1S1EA 2BKIB 2KYFA 3PALA 2LLUA 2LMTA 1KSMA 2JZIA 1G4YR 1K9UA 1JC2A 2ZN9A 3BOWB 2O60A 2EC6C 2LVIA 2KBIA 3I5IB 1DGUA 1IG5A 2Y1NA 2L98A 2LMUA 5DKNA 3M0WA 5DKQA 1E8AA 2NCOA 1UHHA 1AUIB 2D8NA 4ICBA 5GQQC 3GK4X 2BBNA 3SG2A 2F33A 3PN7B 4GAOA 2KOTA 1NP8A 2EHBA 3WHUB 4MZLA 2M29A 3SG7A 4C0KA 5KTYA 2CXJA 1UHKA 2WCFA 4YI8A 5J3XA 1C7WA 2OTGB 1BR4B 1BODA 1WRZA 1RROA 1A75B 1J7OA 4P2YB 3O78A 3I5GB 3TDUA 4WQ3A 5G08A 2L50A 3PM8A 1DGVA 4PDZA 1DJXA 1A03A 2V53A 3IF7A 1Q80A 1TRFA 4A4CA 5KSZA 2K7BA 4MRYA 1S6JA 2HQ8A 4C0LA 1MF8B 1K2HA 3O2PA 1CLMA 1SBJA 4CFQA 2M3WA 2MBXA 3MSEB 4AQJA 1B8LA 3I5HB 2F3YA 3D0YA 1EG4A 3VRQA 1DJYA 4I5LB 2PRUA 4ZCVA 2BCBA 1K95A 2Y5IA 3WHTB 4JWQA 1S3PA 4F0ZB 1NUBA 4XJKB 2JC2A 1OOJA 2LHIA 3JTDC 1BT6A 4XYNA 1LINA 5ER5A 1KK8B 1YUTA 2L51A 1CFPA 3BUXB 4YGBB 3DVMA 2NXQA 2FJUB 2EGDA 1FI6A 3BUMB 2EC6B 1RWYA 5AEQA 1QX2A 2H2KA 1DJWA 1YRUB 4PCWA 1CLLA 1SNLA 2LV7A 4PHNA 4N1GA 2CNPA 2K2AA 1KCYA 1YR5A 1CLBA 1M46A 1S26D 1ODBA 1A2XA 2F2OA 4ETOA 2LCPA 2M0RA 2PASA 2HETA 1SR6C 3GK1A 3LCPC 1J1DA 1NX1A 3IQOA 4YBHB 5HKZA 2LVKA 4YRUA 3OHMB 1GGZA 2SCPA 3BOWA 4TNCA 1NX2A 1JUOA 2RGIA 1MWNA 2L4HA 1CFCA 1DT7B 4MZKA 3SG5A 1TNQA 1NIWA 1Y1AA 3OX5A 1YUSA 2LM5A 1CM4A 1QLSA 1QX7A 5I2LA 2JXCA 1UURA 1SY9A 4D1EA 3KEVA 5HKYA 2K7CA 4CIDA 1A75A 2BKHB 4DCKA 2KFFA 1WRLA 1BLQA 1PVAA 1SCMC 2K7OA 3IQQA 3KHEA 4HREE 2MHHA 1JWDA 1TNPA 5D7FA 1K90D 3JTDB 2O5GA 4YGAA 1BMOA 1RK9A 2M7NA 1BOCA 2P6BB 1RJVA 1DTLA 4PHKA 2JNFA 2M8UA 1QIWA 2MLEC 5KU1A 1DF0A 2I94A 2M1KB 2MA2A 1XVJA 1V1GA 1BF5A 1K96A 1ZMZA 3OB2B 1DJHA 1J55A 1TTXA 3CS1A 2KHNA 3ZWHA 1MXLC 1CDMA 4NDDA 2GGZA 3LL8B 1FBVA 1QATA 1JSAA 3SJSA 2FOTA 4XJKA 1H4BA 3I5FC 2SASA 4YGEB 1SR6B 2KQYA 4M2PA 4M2OA 3FWCA 3O6BA 3O4YA 1KFUL 3FIAA 3SG4A 2R2IA 1YVHA 2M1UA 5TNCA 1X02A 1RTP1 3VRPA 1IH0A 1J7QA 2I7AA 2PMYA 1IRJA 1NCZA 3NSLA 2I18A 3KO0A 1YX7A 1NYAA 3AAKA 2BE6A 2KAYA 2BBMA 1OZSA 1QJTA 2LLSA 1EH2A 1WDCC 2MAZA 4USLA 2NCPA 3EKHA 1SCMB 1ZACA 2COLB 3OX6A 2FCEA 1OQPA 1H8BA 1PK0D 2VRGA 2ZRSA 1CFFA 1AJ4A 1L2OC 4BY5A 2L2EA 3LLEA 1ALVA 2PSRA 1MQ1A 2KFHA 2KQ6A 1RFJA 2LP3A 4I5JA 3RM1A 1Y1UA 2E6WA 1B8CA 4R1EA 2LUCA 2ZKMX 3NSKA 3PATA 1QV0A 1C07A 1XFWO 1WLZA 3CTNA 3NSIA 5B8IB 4OV2A 2A4JA 4BY4A 1B47A 1SMGA 4QJ4B 1LA0A 3AAJA 5AFPA 3I5FB 2LC5A 1KQMC 4HSZA 4DUQA 1GJYA 4MEWA 1DJIA 1CFDA 3PFVA 2ZFDA 2GV5A 2BL0C 1F4OA 2K8MB 1NCYA 1QV1A 1K9KA 1QS7A 2IS9A 2CTNA 2WC8A 4N1FA 1BR1B 2OS8C 4FQOA 2JTTA 1QASA 4NQGA 2JPTA 2JWWA 1AHRA 4HRHA 1BG1A 4JQ0D 2M7LA 4WQ2A 1F4QA 5PALA 4C0JA 2DOQA 3GK2A 1XK4C 1CNPA 3SIBA 1TCOB 1WDCB 5HLOA 3HX4A 2JT3A 2HF5A 4GGFA 1WY9A 3VRRA 4DS7A 1U5IB 1IJ5A 1FI5A 4PE0A 1TNXA 1AK8A 5ER4X 1KSOA 1L2OB 2K7DA 1UWOA 3DF0B 2H61C 1PULA 2AMIA 2LAPA 1A29A 2JULA 5CSFA 1NX3A 2KYCA 2LMVA 2M49B 4ORBB 2L5XB 1D1OA 1F54A 2M9GA 1JF0A 1SL8A 1MHOA 2BE4A 4MN0A 4I5NB 3GOFA 4Q04A 1R6PA 3E3RA 1KQMB 1OZOA 2ZNEA 5JOLA 5JJGA 1S6CA 2LVJA 1VRKA 2QPTA 1UP5A 2GGMA 1PVBA 2BL0B 2CCMA 2NLNA 2JT8A 2Q91A 2WORA 4NDBA 2OPOA 2OS8B 5K89A 4PE1A 1S5GZ 1FW4A 1QVIZ 1OMRA 1K8UA 5DKRA 1XFYO 1CMFA 1L7ZA 1IWQA 2LUXA 4AOMA 1N2DA 1B8RA 4ZCUA 1EL4A 4I5KA 1QLKA 1YUUA 2KI4C 3BUOB 4M2QA 1Y0VH 4UPGA 5CPVA 1B4CA 1DJGA 4OR9B 1ZOTB 4OKHA 1HT9A 2WCEA 2KGRA 2JTZA 4AQIA 1QTXA 3LK0A 1WRKA 1EG3A 4OVNF 2G2BA 1IJ6A 1UHJA 2KAVA 1Y6WA 1SCVA 2F3ZA 3H4SE 1GQMA 4ORCB 3TUYC 3D0YB 1OE9B 1FPWA 2HPSA 2FCDA 2JT0A 2ZRTA 4GGNA 4GFTA 2LANA 1B7TZ 2HQWA 5HKWA 3CR2A 3AKBA 3NSOA 1V1FA 1JF2A 1SKTA 1UUSA 1OSAA 2CBLA 4QJ3B 1J7PA 5CSJA 1NSHA 3CR4X 2CT9A 3C1VA 4CPVA 1U5IA 5IBWA 4CLNA 3PSRA 3CGAA 3DF0A 3EVRA 3DVKA 2KBMA 2L0PA 1CM1A 4QJ5B 1J1EA 1A4PA 1RECA 1OMDA 1FF1A 4FTGA 1F55A 4YGCB 3TZ1A 3TDIA 1S5GY 3VROA 1QVIY 1XA5A 5HLVA 1EJ3A 1F70A 2NZ0A 3OP0A 2KDHA 1NX0A 1BU3A 4JPZB 1ZUZA 2KI4B 5AXIA 3BYAA 4IL1A 1UHIA 4MBEA 2KGBC 2M97A 5CSIA 2KAXA 3PLFB 4OCIA 1PSBA 3A4UB 4A4BA 1M39A 2K61A 2LNKA 1IQ3A 1PSRA 1LA3A 1XFVO 1AVSA 1G8IA 2I2RE 2PALA 4MVFA 3BUWB 2BCAA 1BJFA 3EKJA 3OB1B 2BECA 1SL9A 4L9MA 3KPXA 3TUYB 1CMGA 3CLNA 4MLWA 1TOPA 3ZNIA 1TCFA 1B7TY 1TIZA 2MLFC 4MRXA 1B1GA 2KSPA 1XK4A 4N5XA 3F45A 3EK7A 4DIRA 1MR8A 5I2OA 3ICBA 1G33A 1DF0B 3VRNA 4PHJA 1KQVA 3K21A 3CWGA 2KNEA 1QXPA 2F2PA 4GUKA 1J7RA 1LXFC 2H61A 1R2UA 1YVLA 2LHLA 3DD4A 1XO5A 2K0JA 3TS5C 2WOSA 1NWDA 3D10A 1YTZC 1LKJA 3BQ3A 2KI6D 3NXAA 1DVIA 2LE9B 2MJWB 1SW8A 3HCMA 4DRWA 1SL7A 4PE7A 1JBAA 3FWBA 1TN4A 4PE4A 1N65A 3SG3A 1PRWA 2JU0A 1QIVA 3SIAA 1JFJA 1F71A 1KK7Z 1LVCD 5F6TA 2KI6C 3JVTC 1GGWA 3BUNB 1JFKA 1MUXA 1TNWA 3FS7A 1HQVA 1KWOC 1SRAA 3WXAA 5AERA 4GNKB 1YX8A 1ALWA 2LLTA 3DVJA 4MZJA 1YURA 5HYDA 2E30A 1QX5B 2LP2A 1CDLA 3EK8A 3KF9A 5CSNA 1ZFSA 4MSPA 4NDCA 4CFRA 1F8HA 4GGFC 1IGVA 1XFZO 2JOJA 2LVVA 3LK1A 3CR5X 1SPYA 5D69A 1K94A 1M63B 3I5IC 1OMVA 4ORAB 1CB1A 4HRGA 1N0YA 2TN4A 1XYDA 5I8NA 1AP4A 2AUCA 1CDNA 1CTRA 2BCXA 2Q4UA 4YGDB 2K2FA 1CDPA 2ISDA 1DMOA 3PN7C 1SK6D 2JQ6A 3RLZA 1Y1XA 3EVVA 4GPLB 3TS5B 1CKKA 2QACA 2AAOA 2JXLA 2KFGA 2OTGC 1IQ5A 1KFXL 2WCBA 3TDZA 5BPJA 1C7VA 1W7IB 3I5GC 3QRXA 1S36A 5I2QA 2PVBA 1KFXS 1XFXO 1K93D 4GBAA 3A8RA 1W7JB 1S6IA 4PHMA 4E68A 1KK7Y 1DJZA 3CZTX 2JRFA 1IKUA 1AJ5A 2G9BA 2WNDA 3EK4A 1UHNA 2ZN8A 3JVTB 5AANA 1PALA 1EXRA 4U8DA 1KWOB 2MRDA 1YRTB 1K9PA 4PALA 3VGOA 4P5OE 3BXKA 1NCXA 1WLMA 3AKAA 3I5HC 3DVEA 1SYMA 5FYXA 2B1UA 3EVUA 3SG6A 1M45A 2F8PA 2L4IA 1M31A 1MXEA 4YI9A 2ZNDA 4WRIA 2Y1MA 3WNXB 1NPQA 2Y4QA
chains in the Genus database with same CATH superfamily
2QEVA 1B9AA 1KFUS 1XFUO 1KK8C 2JNXA 1S1EA 2BKIB 2KYFA 3PALA 2LLUA 2LMTA 1KSMA 2JZIA 1G4YR 1K9UA 1JC2A 2ZN9A 3BOWB 2O60A 2EC6C 2LVIA 2KBIA 3CZ0A 1DGUA 3CZ1A 3I5IB 1IG5A 2Y1NA 2L98A 2LMUA 5DKNA 3M0WA 5DKQA 1E8AA 2NCOA 1UHHA 1AUIB 2D8NA 2PYQA 4ICBA 5GQQC 3GK4X 2BBNA 3SG2A 2F33A 3PN7B 1W9ZA 4GAOA 2KOTA 1NP8A 2EHBA 3WHUB 4MZLA 2M29A 3SG7A 4C0KA 2QEBA 3OBVA 5KTYA 2CXJA 4INWA 1UHKA 2WCFA 1OOGA 4YI8A 5J3XA 1C7WA 2OTGB 1BR4B 1BODA 1WRZA 1RROA 1A75B 3BJHA 4P2YB 3NGVA 1J7OA 3O78A 3I5GB 3TDUA 4WQ3A 5G08A 2L50A 3PM8A 1DGVA 4PDZA 1DJXA 5DICA 1A03A 2V53A 3IF7A 1Q80A 1TRFA 4A4CA 5KSZA 2K7BA 2YGUA 3BFHA 4MRYA 1S6JA 2HQ8A 4C0LA 1MF8B 1K2HA 3O2PA 1CLMA 1SBJA 3DXLA 4CFQA 2M3WA 5EL2A 2MBXA 3MSEB 4AQJA 1B8LA 3I5HB 2F3YA 3R72A 3D0YA 1EG4A 3VRQA 1DJYA 4I5LB 2PRUA 4ZCVA 2BCBA 1K95A 2Y5IA 3WHTB 4JWQA 1S3PA 4F0ZB 1NUBA 4XJKB 2JC2A 1OOJA 2LHIA 3JTDC 1BT6A 4XYNA 1LINA 5ER5A 1KK8B 1YUTA 2L51A 1CFPA 1OW4A 3BUXB 1DELA 3DVMA 4YGBB 2NXQA 2FJUB 5HL1A 2EGDA 1FI6A 3BUMB 2EC6B 1RWYA 5AEQA 1QX2A 2H2KA 1DJWA 3SS5A 1YRUB 4PCWA 1CLLA 1SNLA 2LV7A 4PHNA 3S0DA 4N1GA 2CNPA 2K2AA 1KCYA 1YR5A 1CLBA 1M46A 1S26D 1ODBA 5FI6A 3WNXB 1A2XA 2F2OA 4ETOA 2LCPA 2M0RA 2PASA 2HETA 1SR6C 3GK1A 3LCPC 1J1DA 3B6XA 1NX1A 3IQOA 4YBHB 3RZSA 5HKZA 2LVKA 2P71A 4YRUA 3OHMB 1GGZA 2SCPA 3BOWA 4TNCA 1NX2A 1XFRA 1JUOA 2RGIA 3Q8IA 1MWNA 2L4HA 3PM2A 1CFCA 1DT7B 4MZKA 3SG5A 1TNQA 1NIWA 1Y1AA 3OX5A 1Z2CB 1YUSA 2LM5A 1CM4A 1QLSA 1QX7A 2BNXA 1IIOA 5I2LA 2JXCA 1UURA 1SY9A 4D1EA 3KEVA 5HKYA 2JPOA 2K7CA 4CIDA 1A75A 2BKHB 4DCKA 2KFFA 1WRLA 1BLQA 1PVAA 1ORGA 1SCMC 2K7OA 3IQQA 3KHEA 4HREE 2MHHA 3SS4A 1JWDA 1TNPA 5D7FA 1K90D 3JTDB 2O5GA 4YGAA 1BMOA 1RK9A 2M7NA 1BOCA 2P6BB 1RJVA 1DTLA 4PHKA 2JNFA 2M8UA 1QIWA 2MLEC 4INXA 5KU1A 1DF0A 2I94A 2M1KB 2MA2A 1XVJA 3S0AA 1V1GA 1BF5A 1K96A 1ZMZA 3OB2B 1DJHA 1J55A 1TTXA 3CS1A 2KHNA 3ZWHA 1MXLC 1CDMA 4NDDA 2GGZA 3LL8B 1FBVA 1QATA 2KPHA 1JSAA 3SJSA 2FOTA 4XJKA 1H4BA 3I5FC 2SASA 4YGEB 1SR6B 2KQYA 4M2PA 4M2OA 3FWCA 3O6BA 3O4YA 3S0GA 2KLDA 1KFUL 3FIAA 3B7AA 3SG4A 2R2IA 1YVHA 2M1UA 1TWOA 5TNCA 1GM0A 1X02A 3S0FA 2WCLA 1RTP1 3VRPA 1IH0A 1J7QA 2I7AA 2PMYA 1IRJA 1SSEB 1NCZA 3QMEA 3NSLA 2I18A 3KO0A 1YX7A 1NYAA 3AAKA 3L47A 2BE6A 2KAYA 2BBMA 1OZSA 1QJTA 2LLSA 2L5YA 1EH2A 1WDCC 2MAZA 1DEKA 4USLA 2NCPA 3EKHA 1SCMB 1ZACA 2COLB 3OX6A 2FCEA 1OQPA 1H8BA 1PK0D 2VRGA 2ZRSA 1CFFA 1AJ4A 1L2OC 4BY5A 2P70A 2L2EA 3LLEA 1ALVA 2PSRA 1MQ1A 2KFHA 2KQ6A 1RFJA 2LP3A 4I5JA 3RM1A 1Y1UA 2E6WA 1B8CA 4R1EA 2LUCA 2ZKMX 3NSKA 3PATA 1QV0A 1C07A 1XFWO 1WLZA 3CTNA 3NSIA 5B8IB 4OV2A 2A4JA 4BY4A 1B47A 1SMGA 3D75A 1LA0A 4QJ4B 3AAJA 5AFPA 3I5FB 2LC5A 1KQMC 4HSZA 4DUQA 1GJYA 4MEWA 2KLEA 1DJIA 1CFDA 3PFVA 2ZFDA 2GV5A 2BL0C 1F4OA 2K8MB 1NCYA 2QEOA 1QV1A 1K9KA 1QS7A 2IS9A 2CTNA 3FE9A 2WC8A 4N1FA 1BR1B 2OS8C 4FQOA 2JTTA 1QASA 4NQGA 2WC5A 2JPTA 2JWWA 1AHRA 4HRHA 1BG1A 4JQ0D 2M7LA 4WQ2A 1F4QA 5PALA 4C0JA 2DOQA 3GK2A 1XK4C 3L4LA 1CNPA 3SIBA 1TCOB 1WDCB 3D73A 5HLOA 3DYEA 2GTEA 3HX4A 2JT3A 2HF5A 4GGFA 1WY9A 3VRRA 4DS7A 1U5IB 1IJ5A 1FI5A 4PE0A 4OZDA 1TNXA 1AK8A 5ER4X 1KSOA 1L2OB 2K7DA 1UWOA 3DF0B 2H61C 1PULA 1C3ZA 2AMIA 2LAPA 4FQTA 1A29A 2JULA 5CSFA 1NX3A 2KYCA 2LMVA 2M49B 4ORBB 2L5XB 3B86A 1D1OA 1F54A 2M9GA 1T14A 1JF0A 1SL8A 1MHOA 2BE4A 4MN0A 4I5NB 3L4AA 3GOFA 4Q04A 1R6PA 3E3RA 3V2LA 1KQMB 1LS8A 1OZOA 2ZNEA 5JOLA 5JJGA 1S6CA 2LVJA 1VRKA 3D78A 2QPTA 1UP5A 2GGMA 1PVBA 2BL0B 2CCMA 2NLNA 2JT8A 2Q91A 2WORA 3FE6A 2OPOA 3O4XA 4NDBA 2OS8B 5K89A 4PE1A 1S5GZ 1FW4A 1QVIZ 1OMRA 1K8UA 5DKRA 1XFYO 1CMFA 1L7ZA 1IWQA 2LUXA 4AOMA 1N2DA 1B8RA 4ZCUA 1EL4A 4I5KA 1QLKA 1YUUA 2KI4C 3CDNA 3BUOB 4M2QA 1Y0VH 4UPGA 1QWVA 5CPVA 1B4CA 1DJGA 4OR9B 5FI7A 2QEHA 1ZOTB 4OKHA 1HT9A 2WCEA 2KGRA 3NHTA 2JTZA 4AQIA 1QTXA 3LK0A 1WRKA 1EG3A 4OVNF 2G2BA 1IJ6A 1UHJA 2KAVA 3R1OA 1Y6WA 1SCVA 2F3ZA 3H4SE 1GQMA 4ORCB 3PJIA 3TUYC 3D0YB 1OE9B 4PT1A 1FPWA 2HPSA 2FCDA 2JT0A 2ZRTA 3IVTA 4GGNA 4GFTA 2LANA 1B7TZ 2HQWA 5HKWA 2K60A 3CR2A 3S0EA 3AKBA 3NSOA 1V1FA 2H8VA 1JF2A 1SKTA 1UUSA 1OSAA 2CBLA 1OOIX 4QJ3B 3S0BA 1J7PA 5CSJA 1TUJA 1NSHA 3CR4X 2QDIA 2CT9A 3C1VA 4CPVA 1U5IA 5IBWA 5I94A 1DC1A 4CLNA 3PSRA 3CGAA 3DF0A 2WCMA 3EVRA 3DZTA 3CABA 3DVKA 3SS3A 2KBMA 2L0PA 1CM1A 4QJ5B 1J1EA 1A4PA 1RECA 1OMDA 1FF1A 4FTGA 1F55A 4YGCB 3TZ1A 3TDIA 1S5GY 3VROA 1QVIY 1XA5A 5HLVA 1EJ3A 1F70A 2NZ0A 4F7FA 3OP0A 2KDHA 1NX0A 1BU3A 3FE8A 4JPZB 1ZUZA 2KI4B 5AXIA 3BYAA 3BFAA 4IL1A 1UHIA 4MBEA 5FI2A 2KGBC 2M97A 5CSIA 2KAXA 3PLFB 4OCIA 1PSBA 3A4UB 4A4BA 1M39A 2K61A 2LNKA 1IQ3A 1PSRA 1LA3A 1XFVO 1AVSA 1G8IA 2I2RE 2PALA 4MVFA 3BUWB 2BCAA 1BJFA 3EKJA 3OB1B 1SL9A 2BECA 4L9MA 3KPXA 5D3OA 3TUYB 1CMGA 3CLNA 4MLWA 1TOPA 3ZNIA 1TCFA 1B7TY 1TIZA 2MLFC 3UO9A 4MRXA 1B1GA 2KSPA 1XK4A 4N5XA 3F45A 3EK7A 3BFBA 4DIRA 1MR8A 5I2OA 2WCHA 3ICBA 1G33A 1DF0B 3VRNA 4PHJA 1KQVA 3K21A 3CWGA 2KNEA 1QXPA 3D74A 2F2PA 4GUKA 3CZ2A 1J7RA 1LXFC 2H61A 3K1EA 4IJ7A 1R2UA 1YVLA 2LHLA 3DD4A 1XO5A 2K0JA 3TS5C 2WOSA 1NWDA 3D10A 1P28A 1YTZC 1LKJA 1Z4HA 3BQ3A 2KI6D 3NXAA 1DVIA 2LE9B 2MJWB 3NHIA 1SW8A 3HCMA 4DRWA 1SL7A 4PE7A 1JBAA 3FWBA 1TN4A 1OOFA 4PE4A 3D77A 1N65A 3SG3A 1PRWA 2JU0A 1QIVA 3SIAA 3R1PA 1JFJA 1F71A 1KK7Z 1LVCD 5F6TA 2KI6C 3CYZA 3JVTC 1GGWA 3BUNB 1JFKA 1MUXA 1TNWA 3FS7A 1HQVA 1KWOC 1SRAA 3WXAA 5AERA 4GNKB 1YX8A 1ALWA 2LLTA 3DVJA 4MZJA 1YURA 5HYDA 2E30A 1QX5B 2LP2A 1CDLA 3EK8A 3KF9A 5CSNA 1ZFSA 4MSPA 4NDCA 4CFRA 1DQEA 2ERBA 1F8HA 4GGFC 1IGVA 1TUZA 2WCJA 3D76A 1XFZO 3OGNA 2JOJA 4KYNA 1OOHA 2LVVA 3LK1A 3CR5X 1C3YA 1SPYA 5D69A 1K94A 1M63B 3I5IC 1OMVA 4ORAB 2PQLA 3UNWA 4HRGA 1N0YA 1CB1A 2TN4A 1XYDA 3B88A 2L2CA 5I8NA 1AP4A 3B87A 2AUCA 1CDNA 1CTRA 2BCXA 2Q4UA 4YGDB 2K2FA 1CDPA 2ISDA 2BAPA 1DMOA 3PN7C 1SK6D 2WCKA 2JQ6A 3RLZA 1Y1XA 3EVVA 4GPLB 3TS5B 1CKKA 2QACA 2AAOA 2JXLA 4JKTA 2KFGA 2OTGC 3N7HA 1IQ5A 1KFXL 2WCBA 3TDZA 3VB1A 5BPJA 1C7VA 1W7IB 3I5GC 3DY9A 3QRXA 1S36A 4JD9A 2PVBA 5I2QA 1KFXS 1XFXO 1K93D 4GBAA 3A8RA 1W7JB 1S6IA 4PHMA 4E68A 1KK7Y 3R1VA 1DJZA 3CZTX 2WC6A 2JRFA 1IKUA 1AJ5A 2G9BA 2WNDA 3EK4A 1UHNA 2ZN8A 3JVTB 5AANA 1PALA 1EXRA 4U8DA 1KWOB 2MRDA 1YRTB 1K9PA 4PALA 3VGOA 4P5OE 3BXKA 1NCXA 1WLMA 3AKAA 3I5HC 3DVEA 1SYMA 5FYXA 2B1UA 3EVUA 3SG6A 1M45A 2F8PA 2L4IA 2FJYA 1M31A 1MXEA 4YI9A 2ZNDA 3EG5B 2Y1MA 4WRIA 1NPQA 2Y4QA
chains in the Genus database with same CATH topology
1B9AA 1KFUS 1XFUO 1KK8C 2JNXA 1S1EA 2BKIB 2KYFA 3PALA 2LLUA 2LMTA 1KSMA 2JZIA 1G4YR 1K9UA 1JC2A 2ZN9A 3BOWB 2O60A 2EC6C 2LVIA 2KBIA 3I5IB 1DGUA 1IG5A 2Y1NA 2L98A 2LMUA 5DKNA 3M0WA 5DKQA 1E8AA 2NCOA 1UHHA 1AUIB 2D8NA 4ICBA 5GQQC 3GK4X 2BBNA 3SG2A 2F33A 3PN7B 4GAOA 2KOTA 1NP8A 2EHBA 3WHUB 4MZLA 2M29A 3SG7A 4C0KA 5KTYA 2CXJA 1UHKA 2WCFA 4YI8A 5J3XA 1C7WA 2OTGB 1BR4B 1BODA 1WRZA 1RROA 1A75B 1J7OA 4P2YB 3O78A 3I5GB 3TDUA 4WQ3A 5G08A 2L50A 3PM8A 1DGVA 4PDZA 1DJXA 1A03A 2V53A 3IF7A 1Q80A 1TRFA 4A4CA 5KSZA 2K7BA 4MRYA 1S6JA 2HQ8A 4C0LA 1MF8B 1K2HA 3O2PA 1CLMA 1SBJA 4CFQA 2M3WA 2MBXA 3MSEB 4AQJA 1B8LA 3I5HB 2F3YA 3D0YA 1EG4A 3VRQA 1DJYA 4I5LB 2PRUA 4ZCVA 2BCBA 1K95A 2Y5IA 3WHTB 4JWQA 1S3PA 4F0ZB 1NUBA 4XJKB 2JC2A 1OOJA 2LHIA 3JTDC 1BT6A 4XYNA 1LINA 5ER5A 1KK8B 1YUTA 2L51A 1CFPA 3BUXB 4YGBB 3DVMA 2NXQA 2FJUB 2EGDA 1FI6A 3BUMB 2EC6B 1RWYA 5AEQA 1QX2A 2H2KA 1DJWA 1YRUB 4PCWA 1CLLA 1SNLA 2LV7A 4PHNA 4N1GA 2CNPA 2K2AA 1KCYA 1YR5A 1CLBA 1M46A 1S26D 1ODBA 1A2XA 2F2OA 4ETOA 2LCPA 2M0RA 2PASA 2HETA 1SR6C 3GK1A 3LCPC 1J1DA 1NX1A 3IQOA 4YBHB 5HKZA 2LVKA 4YRUA 3OHMB 1GGZA 2SCPA 3BOWA 4TNCA 1NX2A 1JUOA 2RGIA 1MWNA 2L4HA 1CFCA 1DT7B 4MZKA 3SG5A 1TNQA 1NIWA 1Y1AA 3OX5A 1YUSA 2LM5A 1CM4A 1QLSA 1QX7A 5I2LA 2JXCA 1UURA 1SY9A 4D1EA 3KEVA 5HKYA 2K7CA 4CIDA 1A75A 2BKHB 4DCKA 2KFFA 1WRLA 1BLQA 1PVAA 1SCMC 2K7OA 3IQQA 3KHEA 4HREE 2MHHA 1JWDA 1TNPA 5D7FA 1K90D 3JTDB 2O5GA 4YGAA 1BMOA 1RK9A 2M7NA 1BOCA 2P6BB 1RJVA 1DTLA 4PHKA 2JNFA 2M8UA 1QIWA 2MLEC 5KU1A 1DF0A 2I94A 2M1KB 2MA2A 1XVJA 1V1GA 1BF5A 1K96A 1ZMZA 3OB2B 1DJHA 1J55A 1TTXA 3CS1A 2KHNA 3ZWHA 1MXLC 1CDMA 4NDDA 2GGZA 3LL8B 1FBVA 1QATA 1JSAA 3SJSA 2FOTA 4XJKA 1H4BA 3I5FC 2SASA 4YGEB 1SR6B 2KQYA 4M2PA 4M2OA 3FWCA 3O6BA 3O4YA 1KFUL 3FIAA 3SG4A 2R2IA 1YVHA 2M1UA 5TNCA 1X02A 1RTP1 3VRPA 1IH0A 1J7QA 2I7AA 2PMYA 1IRJA 1NCZA 3NSLA 2I18A 3KO0A 1YX7A 1NYAA 3AAKA 2BE6A 2KAYA 2BBMA 1OZSA 1QJTA 2LLSA 1EH2A 1WDCC 2MAZA 4USLA 2NCPA 3EKHA 1SCMB 1ZACA 2COLB 3OX6A 2FCEA 1OQPA 1H8BA 1PK0D 2VRGA 2ZRSA 1CFFA 1AJ4A 1L2OC 4BY5A 2L2EA 3LLEA 1ALVA 2PSRA 1MQ1A 2KFHA 2KQ6A 1RFJA 2LP3A 4I5JA 3RM1A 1Y1UA 2E6WA 1B8CA 4R1EA 2LUCA 2ZKMX 3NSKA 3PATA 1QV0A 1C07A 1XFWO 1WLZA 3CTNA 3NSIA 5B8IB 4OV2A 2A4JA 4BY4A 1B47A 1SMGA 4QJ4B 1LA0A 3AAJA 5AFPA 3I5FB 2LC5A 1KQMC 4HSZA 4DUQA 1GJYA 4MEWA 1DJIA 1CFDA 3PFVA 2ZFDA 2GV5A 2BL0C 1F4OA 2K8MB 1NCYA 1QV1A 1K9KA 1QS7A 2IS9A 2CTNA 2WC8A 4N1FA 1BR1B 2OS8C 4FQOA 2JTTA 1QASA 4NQGA 2JPTA 2JWWA 1AHRA 4HRHA 1BG1A 4JQ0D 2M7LA 4WQ2A 1F4QA 5PALA 4C0JA 2DOQA 3GK2A 1XK4C 1CNPA 3SIBA 1TCOB 1WDCB 5HLOA 3HX4A 2JT3A 2HF5A 4GGFA 1WY9A 3VRRA 4DS7A 1U5IB 1IJ5A 1FI5A 4PE0A 1TNXA 1AK8A 5ER4X 1KSOA 1L2OB 2K7DA 1UWOA 3DF0B 2H61C 1PULA 2AMIA 2LAPA 1A29A 2JULA 5CSFA 1NX3A 2KYCA 2LMVA 2M49B 4ORBB 2L5XB 1D1OA 1F54A 2M9GA 1JF0A 1SL8A 1MHOA 2BE4A 4MN0A 4I5NB 3GOFA 4Q04A 1R6PA 3E3RA 1KQMB 1OZOA 2ZNEA 5JOLA 5JJGA 1S6CA 2LVJA 1VRKA 2QPTA 1UP5A 2GGMA 1PVBA 2BL0B 2CCMA 2NLNA 2JT8A 2Q91A 2WORA 4NDBA 2OPOA 2OS8B 5K89A 4PE1A 1S5GZ 1FW4A 1QVIZ 1OMRA 1K8UA 5DKRA 1XFYO 1CMFA 1L7ZA 1IWQA 2LUXA 4AOMA 1N2DA 1B8RA 4ZCUA 1EL4A 4I5KA 1QLKA 1YUUA 2KI4C 3BUOB 4M2QA 1Y0VH 4UPGA 5CPVA 1B4CA 1DJGA 4OR9B 1ZOTB 4OKHA 1HT9A 2WCEA 2KGRA 2JTZA 4AQIA 1QTXA 3LK0A 1WRKA 1EG3A 4OVNF 2G2BA 1IJ6A 1UHJA 2KAVA 1Y6WA 1SCVA 2F3ZA 3H4SE 1GQMA 4ORCB 3TUYC 3D0YB 1OE9B 1FPWA 2HPSA 2FCDA 2JT0A 2ZRTA 4GGNA 4GFTA 2LANA 1B7TZ 2HQWA 5HKWA 3CR2A 3AKBA 3NSOA 1V1FA 1JF2A 1SKTA 1UUSA 1OSAA 2CBLA 4QJ3B 1J7PA 5CSJA 1NSHA 3CR4X 2CT9A 3C1VA 4CPVA 1U5IA 5IBWA 4CLNA 3PSRA 3CGAA 3DF0A 3EVRA 3DVKA 2KBMA 2L0PA 1CM1A 4QJ5B 1J1EA 1A4PA 1RECA 1OMDA 1FF1A 4FTGA 1F55A 4YGCB 3TZ1A 3TDIA 1S5GY 3VROA 1QVIY 1XA5A 5HLVA 1EJ3A 1F70A 2NZ0A 3OP0A 2KDHA 1NX0A 1BU3A 4JPZB 1ZUZA 2KI4B 5AXIA 3BYAA 4IL1A 1UHIA 4MBEA 2KGBC 2M97A 5CSIA 2KAXA 3PLFB 4OCIA 1PSBA 3A4UB 4A4BA 1M39A 2K61A 2LNKA 1IQ3A 1PSRA 1LA3A 1XFVO 1AVSA 1G8IA 2I2RE 2PALA 4MVFA 3BUWB 2BCAA 1BJFA 3EKJA 3OB1B 2BECA 1SL9A 4L9MA 3KPXA 3TUYB 1CMGA 3CLNA 4MLWA 1TOPA 3ZNIA 1TCFA 1B7TY 1TIZA 2MLFC 4MRXA 1B1GA 2KSPA 1XK4A 4N5XA 3F45A 3EK7A 4DIRA 1MR8A 5I2OA 3ICBA 1G33A 1DF0B 3VRNA 4PHJA 1KQVA 3K21A 3CWGA 2KNEA 1QXPA 2F2PA 4GUKA 1J7RA 1LXFC 2H61A 1R2UA 1YVLA 2LHLA 3DD4A 1XO5A 2K0JA 3TS5C 2WOSA 1NWDA 3D10A 1YTZC 1LKJA 3BQ3A 2KI6D 3NXAA 1DVIA 2LE9B 2MJWB 1SW8A 3HCMA 4DRWA 1SL7A 4PE7A 1JBAA 3FWBA 1TN4A 4PE4A 1N65A 3SG3A 1PRWA 2JU0A 1QIVA 3SIAA 1JFJA 1F71A 1KK7Z 1LVCD 5F6TA 2KI6C 3JVTC 1GGWA 3BUNB 1JFKA 1MUXA 1TNWA 3FS7A 1HQVA 1KWOC 1SRAA 3WXAA 5AERA 4GNKB 1YX8A 1ALWA 2LLTA 3DVJA 4MZJA 1YURA 5HYDA 2E30A 1QX5B 2LP2A 1CDLA 3EK8A 3KF9A 5CSNA 1ZFSA 4MSPA 4NDCA 4CFRA 1F8HA 4GGFC 1IGVA 1XFZO 2JOJA 2LVVA 3LK1A 3CR5X 1SPYA 5D69A 1K94A 1M63B 3I5IC 1OMVA 4ORAB 1CB1A 4HRGA 1N0YA 2TN4A 1XYDA 5I8NA 1AP4A 2AUCA 1CDNA 1CTRA 2BCXA 2Q4UA 4YGDB 2K2FA 1CDPA 2ISDA 1DMOA 3PN7C 1SK6D 2JQ6A 3RLZA 1Y1XA 3EVVA 4GPLB 3TS5B 1CKKA 2QACA 2AAOA 2JXLA 2KFGA 2OTGC 1IQ5A 1KFXL 2WCBA 3TDZA 5BPJA 1C7VA 1W7IB 3I5GC 3QRXA 1S36A 5I2QA 2PVBA 1KFXS 1XFXO 1K93D 4GBAA 3A8RA 1W7JB 1S6IA 4PHMA 4E68A 1KK7Y 1DJZA 3CZTX 2JRFA 1IKUA 1AJ5A 2G9BA 2WNDA 3EK4A 1UHNA 2ZN8A 3JVTB 5AANA 1PALA 1EXRA 4U8DA 1KWOB 2MRDA 1YRTB 1K9PA 4PALA 3VGOA 4P5OE 3BXKA 1NCXA 1WLMA 3AKAA 3I5HC 3DVEA 1SYMA 5FYXA 2B1UA 3EVUA 3SG6A 1M45A 2F8PA 2L4IA 1M31A 1MXEA 4YI9A 2ZNDA 4WRIA 2Y1MA 3WNXB 1NPQA 2Y4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9A A;  1KFU S;  1XFU O;  1KK8 C;  2JNX A;  1S1E A;  2BKI B;  2KYF A;  3PAL A;  2LLU A;  2LMT A;  1KSM A;  2JZI A;  1G4Y R;  1K9U A;  1JC2 A;  2ZN9 A;  3BOW B;  2O60 A;  2EC6 C;  2LVI A;  2KBI A;  3I5I B;  1DGU A;  1IG5 A;  2Y1N A;  2L98 A;  2LMU A;  5DKN A;  3M0W A;  5DKQ A;  1E8A A;  2NCO A;  1UHH A;  1AUI B;  2D8N A;  4ICB A;  5GQQ C;  3GK4 X;  2BBN A;  3SG2 A;  2F33 A;  3PN7 B;  4GAO A;  2KOT A;  1NP8 A;  2EHB A;  3WHU B;  4MZL A;  2M29 A;  3SG7 A;  4C0K A;  5KTY A;  2CXJ A;  1UHK A;  2WCF A;  4YI8 A;  5J3X A;  1C7W A;  2OTG B;  1BR4 B;  1BOD A;  1WRZ A;  1RRO A;  1A75 B;  1J7O A;  4P2Y B;  3O78 A;  3I5G B;  3TDU A;  4WQ3 A;  5G08 A;  2L50 A;  3PM8 A;  1DGV A;  4PDZ A;  1DJX A;  1A03 A;  2V53 A;  3IF7 A;  1Q80 A;  1TRF A;  4A4C A;  5KSZ A;  2K7B A;  4MRY A;  1S6J A;  2HQ8 A;  4C0L A;  1MF8 B;  1K2H A;  3O2P A;  1CLM A;  1SBJ A;  4CFQ A;  2M3W A;  2MBX A;  3MSE B;  4AQJ A;  1B8L A;  3I5H B;  2F3Y A;  3D0Y A;  1EG4 A;  3VRQ A;  1DJY A;  4I5L B;  2PRU A;  4ZCV A;  2BCB A;  1K95 A;  2Y5I A;  3WHT B;  4JWQ A;  1S3P A;  4F0Z B;  1NUB A;  4XJK B;  2JC2 A;  1OOJ A;  2LHI A;  3JTD C;  1BT6 A;  4XYN A;  1LIN A;  5ER5 A;  1KK8 B;  1YUT A;  2L51 A;  1CFP A;  3BUX B;  4YGB B;  3DVM A;  2NXQ A;  2FJU B;  2EGD A;  1FI6 A;  3BUM B;  2EC6 B;  1RWY A;  5AEQ A;  1QX2 A;  2H2K A;  1DJW A;  1YRU B;  4PCW A;  1CLL A;  1SNL A;  2LV7 A;  4PHN A;  4N1G A;  2CNP A;  2K2A A;  1KCY A;  1YR5 A;  1CLB A;  1M46 A;  1S26 D;  1ODB A;  1A2X A;  2F2O A;  4ETO A;  2LCP A;  2M0R A;  2PAS A;  2HET A;  1SR6 C;  3GK1 A;  3LCP C;  1J1D A;  1NX1 A;  3IQO A;  4YBH B;  5HKZ A;  2LVK A;  4YRU A;  3OHM B;  1GGZ A;  2SCP A;  3BOW A;  4TNC A;  1NX2 A;  1JUO A;  2RGI A;  1MWN A;  2L4H A;  1CFC A;  1DT7 B;  4MZK A;  3SG5 A;  1TNQ A;  1NIW A;  1Y1A A;  3OX5 A;  1YUS A;  2LM5 A;  1CM4 A;  1QLS A;  1QX7 A;  5I2L A;  2JXC A;  1UUR A;  1SY9 A;  4D1E A;  3KEV A;  5HKY A;  2K7C A;  4CID A;  1A75 A;  2BKH B;  4DCK A;  2KFF A;  1WRL A;  1BLQ A;  1PVA A;  1SCM C;  2K7O A;  3IQQ A;  3KHE A;  4HRE E;  2MHH A;  1JWD A;  1TNP A;  5D7F A;  1K90 D;  3JTD B;  2O5G A;  4YGA A;  1BMO A;  1RK9 A;  2M7N A;  1BOC A;  2P6B B;  1RJV A;  1DTL A;  4PHK A;  2JNF A;  2M8U A;  1QIW A;  2MLE C;  5KU1 A;  1DF0 A;  2I94 A;  2M1K B;  2MA2 A;  1XVJ A;  1V1G A;  1BF5 A;  1K96 A;  1ZMZ A;  3OB2 B;  1DJH A;  1J55 A;  1TTX A;  3CS1 A;  2KHN A;  3ZWH A;  1MXL C;  1CDM A;  4NDD A;  2GGZ A;  3LL8 B;  1FBV A;  1QAT A;  1JSA A;  3SJS A;  2FOT A;  4XJK A;  1H4B A;  3I5F C;  2SAS A;  4YGE B;  1SR6 B;  2KQY A;  4M2P A;  4M2O A;  3FWC A;  3O6B A;  3O4Y A;  1KFU L;  3FIA A;  3SG4 A;  2R2I A;  1YVH A;  2M1U A;  5TNC A;  1X02 A;  1RTP 1;  3VRP A;  1IH0 A;  1J7Q A;  2I7A A;  2PMY A;  1IRJ A;  1NCZ A;  3NSL A;  2I18 A;  3KO0 A;  1YX7 A;  1NYA A;  3AAK A;  2BE6 A;  2KAY A;  2BBM A;  1OZS A;  1QJT A;  2LLS A;  1EH2 A;  1WDC C;  2MAZ A;  4USL A;  2NCP A;  3EKH A;  1SCM B;  1ZAC A;  2COL B;  3OX6 A;  2FCE A;  1OQP A;  1H8B A;  1PK0 D;  2VRG A;  2ZRS A;  1CFF A;  1AJ4 A;  1L2O C;  4BY5 A;  2L2E A;  3LLE A;  1ALV A;  2PSR A;  1MQ1 A;  2KFH A;  2KQ6 A;  1RFJ A;  2LP3 A;  4I5J A;  3RM1 A;  1Y1U A;  2E6W A;  1B8C A;  4R1E A;  2LUC A;  2ZKM X;  3NSK A;  3PAT A;  1QV0 A;  1C07 A;  1XFW O;  1WLZ A;  3CTN A;  3NSI A;  5B8I B;  4OV2 A;  2A4J A;  4BY4 A;  1B47 A;  1SMG A;  4QJ4 B;  1LA0 A;  3AAJ A;  5AFP A;  3I5F B;  2LC5 A;  1KQM C;  4HSZ A;  4DUQ A;  1GJY A;  4MEW A;  1DJI A;  1CFD A;  3PFV A;  2ZFD A;  2GV5 A;  2BL0 C;  1F4O A;  2K8M B;  1NCY A;  1QV1 A;  1K9K A;  1QS7 A;  2IS9 A;  2CTN A;  2WC8 A;  4N1F A;  1BR1 B;  2OS8 C;  4FQO A;  2JTT A;  1QAS A;  4NQG A;  2JPT A;  2JWW A;  1AHR A;  4HRH A;  1BG1 A;  4JQ0 D;  2M7L A;  4WQ2 A;  1F4Q A;  5PAL A;  4C0J A;  2DOQ A;  3GK2 A;  1XK4 C;  1CNP A;  3SIB A;  1TCO B;  1WDC B;  5HLO A;  3HX4 A;  2JT3 A;  2HF5 A;  4GGF A;  1WY9 A;  3VRR A;  4DS7 A;  1U5I B;  1IJ5 A;  1FI5 A;  4PE0 A;  1TNX A;  1AK8 A;  5ER4 X;  1KSO A;  1L2O B;  2K7D A;  1UWO A;  3DF0 B;  2H61 C;  1PUL A;  2AMI A;  2LAP A;  1A29 A;  2JUL A;  5CSF A;  1NX3 A;  2KYC A;  2LMV A;  2M49 B;  4ORB B;  2L5X B;  1D1O A;  1F54 A;  2M9G A;  1JF0 A;  1SL8 A;  1MHO A;  2BE4 A;  4MN0 A;  4I5N B;  3GOF A;  4Q04 A;  1R6P A;  3E3R A;  1KQM B;  1OZO A;  2ZNE A;  5JOL A;  5JJG A;  1S6C A;  2LVJ A;  1VRK A;  2QPT A;  1UP5 A;  2GGM A;  1PVB A;  2BL0 B;  2CCM A;  2NLN A;  2JT8 A;  2Q91 A;  2WOR A;  4NDB A;  2OPO A;  2OS8 B;  5K89 A;  4PE1 A;  1S5G Z;  1FW4 A;  1QVI Z;  1OMR A;  1K8U A;  5DKR A;  1XFY O;  1CMF A;  1L7Z A;  1IWQ A;  2LUX A;  4AOM A;  1N2D A;  1B8R A;  4ZCU A;  1EL4 A;  4I5K A;  1QLK A;  1YUU A;  2KI4 C;  3BUO B;  4M2Q A;  1Y0V H;  4UPG A;  5CPV A;  1B4C A;  1DJG A;  4OR9 B;  1ZOT B;  4OKH A;  1HT9 A;  2WCE A;  2KGR A;  2JTZ A;  4AQI A;  1QTX A;  3LK0 A;  1WRK A;  1EG3 A;  4OVN F;  2G2B A;  1IJ6 A;  1UHJ A;  2KAV A;  1Y6W A;  1SCV A;  2F3Z A;  3H4S E;  1GQM A;  4ORC B;  3TUY C;  3D0Y B;  1OE9 B;  1FPW A;  2HPS A;  2FCD A;  2JT0 A;  2ZRT A;  4GGN A;  4GFT A;  2LAN A;  1B7T Z;  2HQW A;  5HKW A;  3CR2 A;  3AKB A;  3NSO A;  1V1F A;  1JF2 A;  1SKT A;  1UUS A;  1OSA A;  2CBL A;  4QJ3 B;  1J7P A;  5CSJ A;  1NSH A;  3CR4 X;  2CT9 A;  3C1V A;  4CPV A;  1U5I A;  5IBW A;  4CLN A;  3PSR A;  3CGA A;  3DF0 A;  3EVR A;  3DVK A;  2KBM A;  2L0P A;  1CM1 A;  4QJ5 B;  1J1E A;  1A4P A;  1REC A;  1OMD A;  1FF1 A;  4FTG A;  1F55 A;  4YGC B;  3TZ1 A;  3TDI A;  1S5G Y;  3VRO A;  1QVI Y;  1XA5 A;  5HLV A;  1EJ3 A;  1F70 A;  2NZ0 A;  3OP0 A;  2KDH A;  1NX0 A;  1BU3 A;  4JPZ B;  1ZUZ A;  2KI4 B;  5AXI A;  3BYA A;  4IL1 A;  1UHI A;  4MBE A;  2KGB C;  2M97 A;  5CSI A;  2KAX A;  3PLF B;  4OCI A;  1PSB A;  3A4U B;  4A4B A;  1M39 A;  2K61 A;  2LNK A;  1IQ3 A;  1PSR A;  1LA3 A;  1XFV O;  1AVS A;  1G8I A;  2I2R E;  2PAL A;  4MVF A;  3BUW B;  2BCA A;  1BJF A;  3EKJ A;  3OB1 B;  2BEC A;  1SL9 A;  4L9M A;  3KPX A;  3TUY B;  1CMG A;  3CLN A;  4MLW A;  1TOP A;  3ZNI A;  1TCF A;  1B7T Y;  1TIZ A;  2MLF C;  4MRX A;  1B1G A;  2KSP A;  1XK4 A;  4N5X A;  3F45 A;  3EK7 A;  4DIR A;  1MR8 A;  5I2O A;  3ICB A;  1G33 A;  1DF0 B;  3VRN A;  4PHJ A;  1KQV A;  3K21 A;  3CWG A;  2KNE A;  1QXP A;  2F2P A;  4GUK A;  1J7R A;  1LXF C;  2H61 A;  1R2U A;  1YVL A;  2LHL A;  3DD4 A;  1XO5 A;  2K0J A;  3TS5 C;  2WOS A;  1NWD A;  3D10 A;  1YTZ C;  1LKJ A;  3BQ3 A;  2KI6 D;  3NXA A;  1DVI A;  2LE9 B;  2MJW B;  1SW8 A;  3HCM A;  4DRW A;  1SL7 A;  4PE7 A;  1JBA A;  3FWB A;  1TN4 A;  4PE4 A;  1N65 A;  3SG3 A;  1PRW A;  2JU0 A;  1QIV A;  3SIA A;  1JFJ A;  1F71 A;  1KK7 Z;  1LVC D;  5F6T A;  2KI6 C;  3JVT C;  1GGW A;  3BUN B;  1JFK A;  1MUX A;  1TNW A;  3FS7 A;  1HQV A;  1KWO C;  1SRA A;  3WXA A;  5AER A;  4GNK B;  1YX8 A;  1ALW A;  2LLT A;  3DVJ A;  4MZJ A;  1YUR A;  5HYD A;  2E30 A;  1QX5 B;  2LP2 A;  1CDL A;  3EK8 A;  3KF9 A;  5CSN A;  1ZFS A;  4MSP A;  4NDC A;  4CFR A;  1F8H A;  4GGF C;  1IGV A;  1XFZ O;  2JOJ A;  2LVV A;  3LK1 A;  3CR5 X;  1SPY A;  5D69 A;  1K94 A;  1M63 B;  3I5I C;  1OMV A;  4ORA B;  1CB1 A;  4HRG A;  1N0Y A;  2TN4 A;  1XYD A;  5I8N A;  1AP4 A;  2AUC A;  1CDN A;  1CTR A;  2BCX A;  2Q4U A;  4YGD B;  2K2F A;  1CDP A;  2ISD A;  1DMO A;  3PN7 C;  1SK6 D;  2JQ6 A;  3RLZ A;  1Y1X A;  3EVV A;  4GPL B;  3TS5 B;  1CKK A;  2QAC A;  2AAO A;  2JXL A;  2KFG A;  2OTG C;  1IQ5 A;  1KFX L;  2WCB A;  3TDZ A;  5BPJ A;  1C7V A;  1W7I B;  3I5G C;  3QRX A;  1S36 A;  5I2Q A;  2PVB A;  1KFX S;  1XFX O;  1K93 D;  4GBA A;  3A8R A;  1W7J B;  1S6I A;  4PHM A;  4E68 A;  1KK7 Y;  1DJZ A;  3CZT X;  2JRF A;  1IKU A;  1AJ5 A;  2G9B A;  2WND A;  3EK4 A;  1UHN A;  2ZN8 A;  3JVT B;  5AAN A;  1PAL A;  1EXR A;  4U8D A;  1KWO B;  2MRD A;  1YRT B;  1K9P A;  4PAL A;  3VGO A;  4P5O E;  3BXK A;  1NCX A;  1WLM A;  3AKA A;  3I5H C;  3DVE A;  1SYM A;  5FYX A;  2B1U A;  3EVU A;  3SG6 A;  1M45 A;  2F8P A;  2L4I A;  1M31 A;  1MXE A;  4YI9 A;  2ZND A;  4WRI A;  2Y1M A;  3WNX B;  1NPQ A;  2Y4Q A; 
#chains in the Genus database with same CATH topology
 2QEV A;  1B9A A;  1KFU S;  1XFU O;  1KK8 C;  2JNX A;  1S1E A;  2BKI B;  2KYF A;  3PAL A;  2LLU A;  2LMT A;  1KSM A;  2JZI A;  1G4Y R;  1K9U A;  1JC2 A;  2ZN9 A;  3BOW B;  2O60 A;  2EC6 C;  2LVI A;  2KBI A;  3CZ0 A;  1DGU A;  3CZ1 A;  3I5I B;  1IG5 A;  2Y1N A;  2L98 A;  2LMU A;  5DKN A;  3M0W A;  5DKQ A;  1E8A A;  2NCO A;  1UHH A;  1AUI B;  2D8N A;  2PYQ A;  4ICB A;  5GQQ C;  3GK4 X;  2BBN A;  3SG2 A;  2F33 A;  3PN7 B;  1W9Z A;  4GAO A;  2KOT A;  1NP8 A;  2EHB A;  3WHU B;  4MZL A;  2M29 A;  3SG7 A;  4C0K A;  2QEB A;  3OBV A;  5KTY A;  2CXJ A;  4INW A;  1UHK A;  2WCF A;  1OOG A;  4YI8 A;  5J3X A;  1C7W A;  2OTG B;  1BR4 B;  1BOD A;  1WRZ A;  1RRO A;  1A75 B;  3BJH A;  4P2Y B;  3NGV A;  1J7O A;  3O78 A;  3I5G B;  3TDU A;  4WQ3 A;  5G08 A;  2L50 A;  3PM8 A;  1DGV A;  4PDZ A;  1DJX A;  5DIC A;  1A03 A;  2V53 A;  3IF7 A;  1Q80 A;  1TRF A;  4A4C A;  5KSZ A;  2K7B A;  2YGU A;  3BFH A;  4MRY A;  1S6J A;  2HQ8 A;  4C0L A;  1MF8 B;  1K2H A;  3O2P A;  1CLM A;  1SBJ A;  3DXL A;  4CFQ A;  2M3W A;  5EL2 A;  2MBX A;  3MSE B;  4AQJ A;  1B8L A;  3I5H B;  2F3Y A;  3R72 A;  3D0Y A;  1EG4 A;  3VRQ A;  1DJY A;  4I5L B;  2PRU A;  4ZCV A;  2BCB A;  1K95 A;  2Y5I A;  3WHT B;  4JWQ A;  1S3P A;  4F0Z B;  1NUB A;  4XJK B;  2JC2 A;  1OOJ A;  2LHI A;  3JTD C;  1BT6 A;  4XYN A;  1LIN A;  5ER5 A;  1KK8 B;  1YUT A;  2L51 A;  1CFP A;  1OW4 A;  3BUX B;  1DEL A;  3DVM A;  4YGB B;  2NXQ A;  2FJU B;  5HL1 A;  2EGD A;  1FI6 A;  3BUM B;  2EC6 B;  1RWY A;  5AEQ A;  1QX2 A;  2H2K A;  1DJW A;  3SS5 A;  1YRU B;  4PCW A;  1CLL A;  1SNL A;  2LV7 A;  4PHN A;  3S0D A;  4N1G A;  2CNP A;  2K2A A;  1KCY A;  1YR5 A;  1CLB A;  1M46 A;  1S26 D;  1ODB A;  5FI6 A;  3WNX B;  1A2X A;  2F2O A;  4ETO A;  2LCP A;  2M0R A;  2PAS A;  2HET A;  1SR6 C;  3GK1 A;  3LCP C;  1J1D A;  3B6X A;  1NX1 A;  3IQO A;  4YBH B;  3RZS A;  5HKZ A;  2LVK A;  2P71 A;  4YRU A;  3OHM B;  1GGZ A;  2SCP A;  3BOW A;  4TNC A;  1NX2 A;  1XFR A;  1JUO A;  2RGI A;  3Q8I A;  1MWN A;  2L4H A;  3PM2 A;  1CFC A;  1DT7 B;  4MZK A;  3SG5 A;  1TNQ A;  1NIW A;  1Y1A A;  3OX5 A;  1Z2C B;  1YUS A;  2LM5 A;  1CM4 A;  1QLS A;  1QX7 A;  2BNX A;  1IIO A;  5I2L A;  2JXC A;  1UUR A;  1SY9 A;  4D1E A;  3KEV A;  5HKY A;  2JPO A;  2K7C A;  4CID A;  1A75 A;  2BKH B;  4DCK A;  2KFF A;  1WRL A;  1BLQ A;  1PVA A;  1ORG A;  1SCM C;  2K7O A;  3IQQ A;  3KHE A;  4HRE E;  2MHH A;  3SS4 A;  1JWD A;  1TNP A;  5D7F A;  1K90 D;  3JTD B;  2O5G A;  4YGA A;  1BMO A;  1RK9 A;  2M7N A;  1BOC A;  2P6B B;  1RJV A;  1DTL A;  4PHK A;  2JNF A;  2M8U A;  1QIW A;  2MLE C;  4INX A;  5KU1 A;  1DF0 A;  2I94 A;  2M1K B;  2MA2 A;  1XVJ A;  3S0A A;  1V1G A;  1BF5 A;  1K96 A;  1ZMZ A;  3OB2 B;  1DJH A;  1J55 A;  1TTX A;  3CS1 A;  2KHN A;  3ZWH A;  1MXL C;  1CDM A;  4NDD A;  2GGZ A;  3LL8 B;  1FBV A;  1QAT A;  2KPH A;  1JSA A;  3SJS A;  2FOT A;  4XJK A;  1H4B A;  3I5F C;  2SAS A;  4YGE B;  1SR6 B;  2KQY A;  4M2P A;  4M2O A;  3FWC A;  3O6B A;  3O4Y A;  3S0G A;  2KLD A;  1KFU L;  3FIA A;  3B7A A;  3SG4 A;  2R2I A;  1YVH A;  2M1U A;  1TWO A;  5TNC A;  1GM0 A;  1X02 A;  3S0F A;  2WCL A;  1RTP 1;  3VRP A;  1IH0 A;  1J7Q A;  2I7A A;  2PMY A;  1IRJ A;  1SSE B;  1NCZ A;  3QME A;  3NSL A;  2I18 A;  3KO0 A;  1YX7 A;  1NYA A;  3AAK A;  3L47 A;  2BE6 A;  2KAY A;  2BBM A;  1OZS A;  1QJT A;  2LLS A;  2L5Y A;  1EH2 A;  1WDC C;  2MAZ A;  1DEK A;  4USL A;  2NCP A;  3EKH A;  1SCM B;  1ZAC A;  2COL B;  3OX6 A;  2FCE A;  1OQP A;  1H8B A;  1PK0 D;  2VRG A;  2ZRS A;  1CFF A;  1AJ4 A;  1L2O C;  4BY5 A;  2P70 A;  2L2E A;  3LLE A;  1ALV A;  2PSR A;  1MQ1 A;  2KFH A;  2KQ6 A;  1RFJ A;  2LP3 A;  4I5J A;  3RM1 A;  1Y1U A;  2E6W A;  1B8C A;  4R1E A;  2LUC A;  2ZKM X;  3NSK A;  3PAT A;  1QV0 A;  1C07 A;  1XFW O;  1WLZ A;  3CTN A;  3NSI A;  5B8I B;  4OV2 A;  2A4J A;  4BY4 A;  1B47 A;  1SMG A;  3D75 A;  1LA0 A;  4QJ4 B;  3AAJ A;  5AFP A;  3I5F B;  2LC5 A;  1KQM C;  4HSZ A;  4DUQ A;  1GJY A;  4MEW A;  2KLE A;  1DJI A;  1CFD A;  3PFV A;  2ZFD A;  2GV5 A;  2BL0 C;  1F4O A;  2K8M B;  1NCY A;  2QEO A;  1QV1 A;  1K9K A;  1QS7 A;  2IS9 A;  2CTN A;  3FE9 A;  2WC8 A;  4N1F A;  1BR1 B;  2OS8 C;  4FQO A;  2JTT A;  1QAS A;  4NQG A;  2WC5 A;  2JPT A;  2JWW A;  1AHR A;  4HRH A;  1BG1 A;  4JQ0 D;  2M7L A;  4WQ2 A;  1F4Q A;  5PAL A;  4C0J A;  2DOQ A;  3GK2 A;  1XK4 C;  3L4L A;  1CNP A;  3SIB A;  1TCO B;  1WDC B;  3D73 A;  5HLO A;  3DYE A;  2GTE A;  3HX4 A;  2JT3 A;  2HF5 A;  4GGF A;  1WY9 A;  3VRR A;  4DS7 A;  1U5I B;  1IJ5 A;  1FI5 A;  4PE0 A;  4OZD A;  1TNX A;  1AK8 A;  5ER4 X;  1KSO A;  1L2O B;  2K7D A;  1UWO A;  3DF0 B;  2H61 C;  1PUL A;  1C3Z A;  2AMI A;  2LAP A;  4FQT A;  1A29 A;  2JUL A;  5CSF A;  1NX3 A;  2KYC A;  2LMV A;  2M49 B;  4ORB B;  2L5X B;  3B86 A;  1D1O A;  1F54 A;  2M9G A;  1T14 A;  1JF0 A;  1SL8 A;  1MHO A;  2BE4 A;  4MN0 A;  4I5N B;  3L4A A;  3GOF A;  4Q04 A;  1R6P A;  3E3R A;  3V2L A;  1KQM B;  1LS8 A;  1OZO A;  2ZNE A;  5JOL A;  5JJG A;  1S6C A;  2LVJ A;  1VRK A;  3D78 A;  2QPT A;  1UP5 A;  2GGM A;  1PVB A;  2BL0 B;  2CCM A;  2NLN A;  2JT8 A;  2Q91 A;  2WOR A;  3FE6 A;  2OPO A;  3O4X A;  4NDB A;  2OS8 B;  5K89 A;  4PE1 A;  1S5G Z;  1FW4 A;  1QVI Z;  1OMR A;  1K8U A;  5DKR A;  1XFY O;  1CMF A;  1L7Z A;  1IWQ A;  2LUX A;  4AOM A;  1N2D A;  1B8R A;  4ZCU A;  1EL4 A;  4I5K A;  1QLK A;  1YUU A;  2KI4 C;  3CDN A;  3BUO B;  4M2Q A;  1Y0V H;  4UPG A;  1QWV A;  5CPV A;  1B4C A;  1DJG A;  4OR9 B;  5FI7 A;  2QEH A;  1ZOT B;  4OKH A;  1HT9 A;  2WCE A;  2KGR A;  3NHT A;  2JTZ A;  4AQI A;  1QTX A;  3LK0 A;  1WRK A;  1EG3 A;  4OVN F;  2G2B A;  1IJ6 A;  1UHJ A;  2KAV A;  3R1O A;  1Y6W A;  1SCV A;  2F3Z A;  3H4S E;  1GQM A;  4ORC B;  3PJI A;  3TUY C;  3D0Y B;  1OE9 B;  4PT1 A;  1FPW A;  2HPS A;  2FCD A;  2JT0 A;  2ZRT A;  3IVT A;  4GGN A;  4GFT A;  2LAN A;  1B7T Z;  2HQW A;  5HKW A;  2K60 A;  3CR2 A;  3S0E A;  3AKB A;  3NSO A;  1V1F A;  2H8V A;  1JF2 A;  1SKT A;  1UUS A;  1OSA A;  2CBL A;  1OOI X;  4QJ3 B;  3S0B A;  1J7P A;  5CSJ A;  1TUJ A;  1NSH A;  3CR4 X;  2QDI A;  2CT9 A;  3C1V A;  4CPV A;  1U5I A;  5IBW A;  5I94 A;  1DC1 A;  4CLN A;  3PSR A;  3CGA A;  3DF0 A;  2WCM A;  3EVR A;  3DZT A;  3CAB A;  3DVK A;  3SS3 A;  2KBM A;  2L0P A;  1CM1 A;  4QJ5 B;  1J1E A;  1A4P A;  1REC A;  1OMD A;  1FF1 A;  4FTG A;  1F55 A;  4YGC B;  3TZ1 A;  3TDI A;  1S5G Y;  3VRO A;  1QVI Y;  1XA5 A;  5HLV A;  1EJ3 A;  1F70 A;  2NZ0 A;  4F7F A;  3OP0 A;  2KDH A;  1NX0 A;  1BU3 A;  3FE8 A;  4JPZ B;  1ZUZ A;  2KI4 B;  5AXI A;  3BYA A;  3BFA A;  4IL1 A;  1UHI A;  4MBE A;  5FI2 A;  2KGB C;  2M97 A;  5CSI A;  2KAX A;  3PLF B;  4OCI A;  1PSB A;  3A4U B;  4A4B A;  1M39 A;  2K61 A;  2LNK A;  1IQ3 A;  1PSR A;  1LA3 A;  1XFV O;  1AVS A;  1G8I A;  2I2R E;  2PAL A;  4MVF A;  3BUW B;  2BCA A;  1BJF A;  3EKJ A;  3OB1 B;  1SL9 A;  2BEC A;  4L9M A;  3KPX A;  5D3O A;  3TUY B;  1CMG A;  3CLN A;  4MLW A;  1TOP A;  3ZNI A;  1TCF A;  1B7T Y;  1TIZ A;  2MLF C;  3UO9 A;  4MRX A;  1B1G A;  2KSP A;  1XK4 A;  4N5X A;  3F45 A;  3EK7 A;  3BFB A;  4DIR A;  1MR8 A;  5I2O A;  2WCH A;  3ICB A;  1G33 A;  1DF0 B;  3VRN A;  4PHJ A;  1KQV A;  3K21 A;  3CWG A;  2KNE A;  1QXP A;  3D74 A;  2F2P A;  4GUK A;  3CZ2 A;  1J7R A;  1LXF C;  2H61 A;  3K1E A;  4IJ7 A;  1R2U A;  1YVL A;  2LHL A;  3DD4 A;  1XO5 A;  2K0J A;  3TS5 C;  2WOS A;  1NWD A;  3D10 A;  1P28 A;  1YTZ C;  1LKJ A;  1Z4H A;  3BQ3 A;  2KI6 D;  3NXA A;  1DVI A;  2LE9 B;  2MJW B;  3NHI A;  1SW8 A;  3HCM A;  4DRW A;  1SL7 A;  4PE7 A;  1JBA A;  3FWB A;  1TN4 A;  1OOF A;  4PE4 A;  3D77 A;  1N65 A;  3SG3 A;  1PRW A;  2JU0 A;  1QIV A;  3SIA A;  3R1P A;  1JFJ A;  1F71 A;  1KK7 Z;  1LVC D;  5F6T A;  2KI6 C;  3CYZ A;  3JVT C;  1GGW A;  3BUN B;  1JFK A;  1MUX A;  1TNW A;  3FS7 A;  1HQV A;  1KWO C;  1SRA A;  3WXA A;  5AER A;  4GNK B;  1YX8 A;  1ALW A;  2LLT A;  3DVJ A;  4MZJ A;  1YUR A;  5HYD A;  2E30 A;  1QX5 B;  2LP2 A;  1CDL A;  3EK8 A;  3KF9 A;  5CSN A;  1ZFS A;  4MSP A;  4NDC A;  4CFR A;  1DQE A;  2ERB A;  1F8H A;  4GGF C;  1IGV A;  1TUZ A;  2WCJ A;  3D76 A;  1XFZ O;  3OGN A;  2JOJ A;  4KYN A;  1OOH A;  2LVV A;  3LK1 A;  3CR5 X;  1C3Y A;  1SPY A;  5D69 A;  1K94 A;  1M63 B;  3I5I C;  1OMV A;  4ORA B;  2PQL A;  3UNW A;  4HRG A;  1N0Y A;  1CB1 A;  2TN4 A;  1XYD A;  3B88 A;  2L2C A;  5I8N A;  1AP4 A;  3B87 A;  2AUC A;  1CDN A;  1CTR A;  2BCX A;  2Q4U A;  4YGD B;  2K2F A;  1CDP A;  2ISD A;  2BAP A;  1DMO A;  3PN7 C;  1SK6 D;  2WCK A;  2JQ6 A;  3RLZ A;  1Y1X A;  3EVV A;  4GPL B;  3TS5 B;  1CKK A;  2QAC A;  2AAO A;  2JXL A;  4JKT A;  2KFG A;  2OTG C;  3N7H A;  1IQ5 A;  1KFX L;  2WCB A;  3TDZ A;  3VB1 A;  5BPJ A;  1C7V A;  1W7I B;  3I5G C;  3DY9 A;  3QRX A;  1S36 A;  4JD9 A;  2PVB A;  5I2Q A;  1KFX S;  1XFX O;  1K93 D;  4GBA A;  3A8R A;  1W7J B;  1S6I A;  4PHM A;  4E68 A;  1KK7 Y;  3R1V A;  1DJZ A;  3CZT X;  2WC6 A;  2JRF A;  1IKU A;  1AJ5 A;  2G9B A;  2WND A;  3EK4 A;  1UHN A;  2ZN8 A;  3JVT B;  5AAN A;  1PAL A;  1EXR A;  4U8D A;  1KWO B;  2MRD A;  1YRT B;  1K9P A;  4PAL A;  3VGO A;  4P5O E;  3BXK A;  1NCX A;  1WLM A;  3AKA A;  3I5H C;  3DVE A;  1SYM A;  5FYX A;  2B1U A;  3EVU A;  3SG6 A;  1M45 A;  2F8P A;  2L4I A;  2FJY A;  1M31 A;  1MXE A;  4YI9 A;  2ZND A;  3EG5 B;  2Y1M A;  4WRI A;  1NPQ A;  2Y4Q A; 
#chains in the Genus database with same CATH homology
 1B9A A;  1KFU S;  1XFU O;  1KK8 C;  2JNX A;  1S1E A;  2BKI B;  2KYF A;  3PAL A;  2LLU A;  2LMT A;  1KSM A;  2JZI A;  1G4Y R;  1K9U A;  1JC2 A;  2ZN9 A;  3BOW B;  2O60 A;  2EC6 C;  2LVI A;  2KBI A;  3I5I B;  1DGU A;  1IG5 A;  2Y1N A;  2L98 A;  2LMU A;  5DKN A;  3M0W A;  5DKQ A;  1E8A A;  2NCO A;  1UHH A;  1AUI B;  2D8N A;  4ICB A;  5GQQ C;  3GK4 X;  2BBN A;  3SG2 A;  2F33 A;  3PN7 B;  4GAO A;  2KOT A;  1NP8 A;  2EHB A;  3WHU B;  4MZL A;  2M29 A;  3SG7 A;  4C0K A;  5KTY A;  2CXJ A;  1UHK A;  2WCF A;  4YI8 A;  5J3X A;  1C7W A;  2OTG B;  1BR4 B;  1BOD A;  1WRZ A;  1RRO A;  1A75 B;  1J7O A;  4P2Y B;  3O78 A;  3I5G B;  3TDU A;  4WQ3 A;  5G08 A;  2L50 A;  3PM8 A;  1DGV A;  4PDZ A;  1DJX A;  1A03 A;  2V53 A;  3IF7 A;  1Q80 A;  1TRF A;  4A4C A;  5KSZ A;  2K7B A;  4MRY A;  1S6J A;  2HQ8 A;  4C0L A;  1MF8 B;  1K2H A;  3O2P A;  1CLM A;  1SBJ A;  4CFQ A;  2M3W A;  2MBX A;  3MSE B;  4AQJ A;  1B8L A;  3I5H B;  2F3Y A;  3D0Y A;  1EG4 A;  3VRQ A;  1DJY A;  4I5L B;  2PRU A;  4ZCV A;  2BCB A;  1K95 A;  2Y5I A;  3WHT B;  4JWQ A;  1S3P A;  4F0Z B;  1NUB A;  4XJK B;  2JC2 A;  1OOJ A;  2LHI A;  3JTD C;  1BT6 A;  4XYN A;  1LIN A;  5ER5 A;  1KK8 B;  1YUT A;  2L51 A;  1CFP A;  3BUX B;  4YGB B;  3DVM A;  2NXQ A;  2FJU B;  2EGD A;  1FI6 A;  3BUM B;  2EC6 B;  1RWY A;  5AEQ A;  1QX2 A;  2H2K A;  1DJW A;  1YRU B;  4PCW A;  1CLL A;  1SNL A;  2LV7 A;  4PHN A;  4N1G A;  2CNP A;  2K2A A;  1KCY A;  1YR5 A;  1CLB A;  1M46 A;  1S26 D;  1ODB A;  1A2X A;  2F2O A;  4ETO A;  2LCP A;  2M0R A;  2PAS A;  2HET A;  1SR6 C;  3GK1 A;  3LCP C;  1J1D A;  1NX1 A;  3IQO A;  4YBH B;  5HKZ A;  2LVK A;  4YRU A;  3OHM B;  1GGZ A;  2SCP A;  3BOW A;  4TNC A;  1NX2 A;  1JUO A;  2RGI A;  1MWN A;  2L4H A;  1CFC A;  1DT7 B;  4MZK A;  3SG5 A;  1TNQ A;  1NIW A;  1Y1A A;  3OX5 A;  1YUS A;  2LM5 A;  1CM4 A;  1QLS A;  1QX7 A;  5I2L A;  2JXC A;  1UUR A;  1SY9 A;  4D1E A;  3KEV A;  5HKY A;  2K7C A;  4CID A;  1A75 A;  2BKH B;  4DCK A;  2KFF A;  1WRL A;  1BLQ A;  1PVA A;  1SCM C;  2K7O A;  3IQQ A;  3KHE A;  4HRE E;  2MHH A;  1JWD A;  1TNP A;  5D7F A;  1K90 D;  3JTD B;  2O5G A;  4YGA A;  1BMO A;  1RK9 A;  2M7N A;  1BOC A;  2P6B B;  1RJV A;  1DTL A;  4PHK A;  2JNF A;  2M8U A;  1QIW A;  2MLE C;  5KU1 A;  1DF0 A;  2I94 A;  2M1K B;  2MA2 A;  1XVJ A;  1V1G A;  1BF5 A;  1K96 A;  1ZMZ A;  3OB2 B;  1DJH A;  1J55 A;  1TTX A;  3CS1 A;  2KHN A;  3ZWH A;  1MXL C;  1CDM A;  4NDD A;  2GGZ A;  3LL8 B;  1FBV A;  1QAT A;  1JSA A;  3SJS A;  2FOT A;  4XJK A;  1H4B A;  3I5F C;  2SAS A;  4YGE B;  1SR6 B;  2KQY A;  4M2P A;  4M2O A;  3FWC A;  3O6B A;  3O4Y A;  1KFU L;  3FIA A;  3SG4 A;  2R2I A;  1YVH A;  2M1U A;  5TNC A;  1X02 A;  1RTP 1;  3VRP A;  1IH0 A;  1J7Q A;  2I7A A;  2PMY A;  1IRJ A;  1NCZ A;  3NSL A;  2I18 A;  3KO0 A;  1YX7 A;  1NYA A;  3AAK A;  2BE6 A;  2KAY A;  2BBM A;  1OZS A;  1QJT A;  2LLS A;  1EH2 A;  1WDC C;  2MAZ A;  4USL A;  2NCP A;  3EKH A;  1SCM B;  1ZAC A;  2COL B;  3OX6 A;  2FCE A;  1OQP A;  1H8B A;  1PK0 D;  2VRG A;  2ZRS A;  1CFF A;  1AJ4 A;  1L2O C;  4BY5 A;  2L2E A;  3LLE A;  1ALV A;  2PSR A;  1MQ1 A;  2KFH A;  2KQ6 A;  1RFJ A;  2LP3 A;  4I5J A;  3RM1 A;  1Y1U A;  2E6W A;  1B8C A;  4R1E A;  2LUC A;  2ZKM X;  3NSK A;  3PAT A;  1QV0 A;  1C07 A;  1XFW O;  1WLZ A;  3CTN A;  3NSI A;  5B8I B;  4OV2 A;  2A4J A;  4BY4 A;  1B47 A;  1SMG A;  4QJ4 B;  1LA0 A;  3AAJ A;  5AFP A;  3I5F B;  2LC5 A;  1KQM C;  4HSZ A;  4DUQ A;  1GJY A;  4MEW A;  1DJI A;  1CFD A;  3PFV A;  2ZFD A;  2GV5 A;  2BL0 C;  1F4O A;  2K8M B;  1NCY A;  1QV1 A;  1K9K A;  1QS7 A;  2IS9 A;  2CTN A;  2WC8 A;  4N1F A;  1BR1 B;  2OS8 C;  4FQO A;  2JTT A;  1QAS A;  4NQG A;  2JPT A;  2JWW A;  1AHR A;  4HRH A;  1BG1 A;  4JQ0 D;  2M7L A;  4WQ2 A;  1F4Q A;  5PAL A;  4C0J A;  2DOQ A;  3GK2 A;  1XK4 C;  1CNP A;  3SIB A;  1TCO B;  1WDC B;  5HLO A;  3HX4 A;  2JT3 A;  2HF5 A;  4GGF A;  1WY9 A;  3VRR A;  4DS7 A;  1U5I B;  1IJ5 A;  1FI5 A;  4PE0 A;  1TNX A;  1AK8 A;  5ER4 X;  1KSO A;  1L2O B;  2K7D A;  1UWO A;  3DF0 B;  2H61 C;  1PUL A;  2AMI A;  2LAP A;  1A29 A;  2JUL A;  5CSF A;  1NX3 A;  2KYC A;  2LMV A;  2M49 B;  4ORB B;  2L5X B;  1D1O A;  1F54 A;  2M9G A;  1JF0 A;  1SL8 A;  1MHO A;  2BE4 A;  4MN0 A;  4I5N B;  3GOF A;  4Q04 A;  1R6P A;  3E3R A;  1KQM B;  1OZO A;  2ZNE A;  5JOL A;  5JJG A;  1S6C A;  2LVJ A;  1VRK A;  2QPT A;  1UP5 A;  2GGM A;  1PVB A;  2BL0 B;  2CCM A;  2NLN A;  2JT8 A;  2Q91 A;  2WOR A;  4NDB A;  2OPO A;  2OS8 B;  5K89 A;  4PE1 A;  1S5G Z;  1FW4 A;  1QVI Z;  1OMR A;  1K8U A;  5DKR A;  1XFY O;  1CMF A;  1L7Z A;  1IWQ A;  2LUX A;  4AOM A;  1N2D A;  1B8R A;  4ZCU A;  1EL4 A;  4I5K A;  1QLK A;  1YUU A;  2KI4 C;  3BUO B;  4M2Q A;  1Y0V H;  4UPG A;  5CPV A;  1B4C A;  1DJG A;  4OR9 B;  1ZOT B;  4OKH A;  1HT9 A;  2WCE A;  2KGR A;  2JTZ A;  4AQI A;  1QTX A;  3LK0 A;  1WRK A;  1EG3 A;  4OVN F;  2G2B A;  1IJ6 A;  1UHJ A;  2KAV A;  1Y6W A;  1SCV A;  2F3Z A;  3H4S E;  1GQM A;  4ORC B;  3TUY C;  3D0Y B;  1OE9 B;  1FPW A;  2HPS A;  2FCD A;  2JT0 A;  2ZRT A;  4GGN A;  4GFT A;  2LAN A;  1B7T Z;  2HQW A;  5HKW A;  3CR2 A;  3AKB A;  3NSO A;  1V1F A;  1JF2 A;  1SKT A;  1UUS A;  1OSA A;  2CBL A;  4QJ3 B;  1J7P A;  5CSJ A;  1NSH A;  3CR4 X;  2CT9 A;  3C1V A;  4CPV A;  1U5I A;  5IBW A;  4CLN A;  3PSR A;  3CGA A;  3DF0 A;  3EVR A;  3DVK A;  2KBM A;  2L0P A;  1CM1 A;  4QJ5 B;  1J1E A;  1A4P A;  1REC A;  1OMD A;  1FF1 A;  4FTG A;  1F55 A;  4YGC B;  3TZ1 A;  3TDI A;  1S5G Y;  3VRO A;  1QVI Y;  1XA5 A;  5HLV A;  1EJ3 A;  1F70 A;  2NZ0 A;  3OP0 A;  2KDH A;  1NX0 A;  1BU3 A;  4JPZ B;  1ZUZ A;  2KI4 B;  5AXI A;  3BYA A;  4IL1 A;  1UHI A;  4MBE A;  2KGB C;  2M97 A;  5CSI A;  2KAX A;  3PLF B;  4OCI A;  1PSB A;  3A4U B;  4A4B A;  1M39 A;  2K61 A;  2LNK A;  1IQ3 A;  1PSR A;  1LA3 A;  1XFV O;  1AVS A;  1G8I A;  2I2R E;  2PAL A;  4MVF A;  3BUW B;  2BCA A;  1BJF A;  3EKJ A;  3OB1 B;  2BEC A;  1SL9 A;  4L9M A;  3KPX A;  3TUY B;  1CMG A;  3CLN A;  4MLW A;  1TOP A;  3ZNI A;  1TCF A;  1B7T Y;  1TIZ A;  2MLF C;  4MRX A;  1B1G A;  2KSP A;  1XK4 A;  4N5X A;  3F45 A;  3EK7 A;  4DIR A;  1MR8 A;  5I2O A;  3ICB A;  1G33 A;  1DF0 B;  3VRN A;  4PHJ A;  1KQV A;  3K21 A;  3CWG A;  2KNE A;  1QXP A;  2F2P A;  4GUK A;  1J7R A;  1LXF C;  2H61 A;  1R2U A;  1YVL A;  2LHL A;  3DD4 A;  1XO5 A;  2K0J A;  3TS5 C;  2WOS A;  1NWD A;  3D10 A;  1YTZ C;  1LKJ A;  3BQ3 A;  2KI6 D;  3NXA A;  1DVI A;  2LE9 B;  2MJW B;  1SW8 A;  3HCM A;  4DRW A;  1SL7 A;  4PE7 A;  1JBA A;  3FWB A;  1TN4 A;  4PE4 A;  1N65 A;  3SG3 A;  1PRW A;  2JU0 A;  1QIV A;  3SIA A;  1JFJ A;  1F71 A;  1KK7 Z;  1LVC D;  5F6T A;  2KI6 C;  3JVT C;  1GGW A;  3BUN B;  1JFK A;  1MUX A;  1TNW A;  3FS7 A;  1HQV A;  1KWO C;  1SRA A;  3WXA A;  5AER A;  4GNK B;  1YX8 A;  1ALW A;  2LLT A;  3DVJ A;  4MZJ A;  1YUR A;  5HYD A;  2E30 A;  1QX5 B;  2LP2 A;  1CDL A;  3EK8 A;  3KF9 A;  5CSN A;  1ZFS A;  4MSP A;  4NDC A;  4CFR A;  1F8H A;  4GGF C;  1IGV A;  1XFZ O;  2JOJ A;  2LVV A;  3LK1 A;  3CR5 X;  1SPY A;  5D69 A;  1K94 A;  1M63 B;  3I5I C;  1OMV A;  4ORA B;  1CB1 A;  4HRG A;  1N0Y A;  2TN4 A;  1XYD A;  5I8N A;  1AP4 A;  2AUC A;  1CDN A;  1CTR A;  2BCX A;  2Q4U A;  4YGD B;  2K2F A;  1CDP A;  2ISD A;  1DMO A;  3PN7 C;  1SK6 D;  2JQ6 A;  3RLZ A;  1Y1X A;  3EVV A;  4GPL B;  3TS5 B;  1CKK A;  2QAC A;  2AAO A;  2JXL A;  2KFG A;  2OTG C;  1IQ5 A;  1KFX L;  2WCB A;  3TDZ A;  5BPJ A;  1C7V A;  1W7I B;  3I5G C;  3QRX A;  1S36 A;  5I2Q A;  2PVB A;  1KFX S;  1XFX O;  1K93 D;  4GBA A;  3A8R A;  1W7J B;  1S6I A;  4PHM A;  4E68 A;  1KK7 Y;  1DJZ A;  3CZT X;  2JRF A;  1IKU A;  1AJ5 A;  2G9B A;  2WND A;  3EK4 A;  1UHN A;  2ZN8 A;  3JVT B;  5AAN A;  1PAL A;  1EXR A;  4U8D A;  1KWO B;  2MRD A;  1YRT B;  1K9P A;  4PAL A;  3VGO A;  4P5O E;  3BXK A;  1NCX A;  1WLM A;  3AKA A;  3I5H C;  3DVE A;  1SYM A;  5FYX A;  2B1U A;  3EVU A;  3SG6 A;  1M45 A;  2F8P A;  2L4I A;  1M31 A;  1MXE A;  4YI9 A;  2ZND A;  4WRI A;  2Y1M A;  3WNX B;  1NPQ A;  2Y4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...