1S36A

Crystal structure of a ca2+-discharged photoprotein: implications for the mechanisms of the calcium trigger and the bioluminescence
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
185
Chain Sequence
VKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGFKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Crystal structure of a Ca2+-discharged photoprotein: implications for mechanisms of the calcium trigger and bioluminescence
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 71
structure length 185
sequence length 189
ec nomenclature
pdb deposition date 2004-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s36A00
2LLSA 2L2EA 4MEWA 3D10A 4AQIA 2HQ8A 1F55A 1MXLC 1YVHA 2AMIA 2HPSA 2KI4B 2LANA 4HSZA 1BF5A 4P2YB 4YBHB 4TNCA 2BCAA 1M63B 1U5IB 2JTTA 2LMTA 4DS7A 1SCVA 5I8NA 2Q4UA 4CFQA 1S3PA 3CWGA 3SG4A 3JTDB 1JUOA 1SPYA 3BOWB 2I2RE 2L51A 1AJ5A 4N1GA 2BCBA 2ZRTA 1ALVA 2NCPA 1YX8A 3TDZA 1EG4A 2ZN8A 2OTGC 1RWYA 1BODA 2BKHB 3E3RA 2P6BB 1IG5A 3O2PA 2WCFA 2BECA 1BU3A 1M31A 2O60A 4MRXA 2E6WA 2E30A 1NCYA 2F8PA 4N1FA 3IQQA 1CFCA 4XJKA 4NDCA 1PRWA 1Y1XA 2JRFA 4MVFA 1KFXL 3I5FC 4ORAB 3MSEB 1KQMB 2LVJA 2CBLA 1CLMA 1QLSA 3TDUA 2KQ6A 1K9KA 5FYXA 1QVIZ 1GGWA 3JVTB 1M46A 1TRFA 1Y6WA 2BBMA 1MQ1A 2NLNA 2FJUB 2JZIA 3PN7C 1CNPA 3TUYC 5HKWA 1QTXA 2KAVA 4PDZA 1NP8A 2M29A 2OTGB 1NIWA 1CFDA 3F45A 2D8NA 3I5HC 1ALWA 1YR5A 2K7DA 1BJFA 2M1UA 1BOCA 2BCXA 2LLUA 1B47A 1JFKA 2F33A 2KDHA 1W7IB 4HRGA 1EL4A 1XA5A 2BBNA 2DOQA 1YUSA 3BUNB 2LVVA 1YVLA 2KYFA 2ZFDA 1K94A 4OR9B 1A29A 1WRZA 2PMYA 2KAYA 1OMRA 1MHOA 4YGCB 1EJ3A 3LCPC 3NSIA 1IH0A 2K8MB 1K2HA 2GGZA 3DF0B 1KK8C 1EH2A 5AANA 2WOSA 2F3YA 3AKAA 1TOPA 1B7TZ 1RROA 1SRAA 1UHNA 3TUYB 3CR2A 1UUSA 2Y4QA 4PHJA 3PM8A 2LVIA 1U5IA 1NCZA 1NX3A 4YGDB 2KGBC 4A4BA 3FWCA 1EXRA 1ODBA 3BOWA 1CDNA 1PULA 4PHNA 5ER5A 1PSBA 4M2OA 1DJXA 4MSPA 1G8IA 4D1EA 3SG7A 4PE4A 1SL7A 1KK7Z 4I5NB 4MLWA 2Y1MA 1YUTA 2LP3A 1TNWA 2L98A 4N5XA 1UP5A 1K9UA 1PALA 3HCMA 1WLMA 5I2OA 1FI5A 1MUXA 1UHJA 2LC5A 3VGOA 1S6CA 2JT3A 2SCPA 5B8IB 3LK1A 5G08A 4PE1A 3WHUB 1DGVA 4YGEB 4GUKA 3ICBA 2COLB 4OCIA 2KI4C 3BUXB 2PSRA 3PLFB 4PE0A 5AEQA 1AUIB 2LP2A 5I2LA 1BG1A 1OMDA 1OMVA 1DGUA 1MR8A 1DJYA 1K9PA 1N0YA 2KQYA 4PHMA 1SL9A 1S5GY 1XFZO 4WQ2A 3EKHA 4JQ0D 2IS9A 1XFVO 5CPVA 3WHTB 3LK0A 1B8CA 3SIBA 1FF1A 2K7BA 3BXKA 4WQ3A 5BPJA 1Y0VH 3OX6A 1F54A 3LL8B 3KO0A 3C1VA 3VRRA 4QJ3B 2F2PA 1CLLA 5DKNA 5K89A 1JSAA 4ORCB 4YI8A 1SYMA 1IRJA 1PK0D 2MBXA 2I94A 3DF0A 2KHNA 5PALA 4XYNA 2JC2A 4YI9A 1LKJA 1QS7A 2JULA 2F3ZA 2M9GA 1V1GA 1CMGA 1KQMC 4AOMA 1SK6D 1SKTA 3ZNIA 1QV1A 1TIZA 2JOJA 3JVTC 4IL1A 5F6TA 2MA2A 2WCBA 2JPTA 2LUXA 3HX4A 1J7RA 1OSAA 1L2OB 1A75B 1QX2A 1F71A 4I5LB 3I5IB 5KSZA 5IBWA 1J7QA 3KEVA 3KPXA 3AAKA 3AAJA 1G33A 3RLZA 4OV2A 1NSHA 4GGFA 3DVEA 3M0WA 1K95A 5I2QA 1IQ5A 2PRUA 1SNLA 2BE6A 1UWOA 1QATA 2HF5A 2MRDA 4HRHA 2AUCA 3VRPA 1F8HA 1D1OA 2R2IA 4ZCVA 2M8UA 1SR6C 2QACA 4R1EA 4L9MA 1CFPA 1LINA 5KU1A 1GGZA 1JBAA 1F70A 2NCOA 1UHIA 3AKBA 4C0KA 2JNFA 2LVKA 1WLZA 5KTYA 2I7AA 2KFGA 4ZCUA 2ISDA 3CS1A 1UURA 5HKYA 1B8LA 3BUOB 1PSRA 1KFUS 2M1KB 1QJTA 1NX1A 2F2OA 4MBEA 3FWBA 3IQOA 4GGFC 1YRUB 1TCOB 1R2UA 3A4UB 1XFWO 2MLFC 2WORA 1B4CA 1SR6B 1SY9A 2M97A 1A2XA 2JQ6A 1DTLA 1KWOB 3TZ1A 1XFXO 2L5XB 4FTGA 3PFVA 2H2KA 1A4PA 3GOFA 5AERA 1YRTB 4A4CA 1UHHA 1NPQA 2ZRSA 1UHKA 3EVUA 4BY4A 5HLOA 2M3WA 5DKRA 1C7WA 4MZJA 5CSFA 1DT7B 2LNKA 3I5GB 2OPOA 2BE4A 2BKIB 2M49B 3OB1B 4M2QA 1QX5B 2ZNDA 1QV0A 1B9AA 3LLEA 2L4IA 1NCXA 1A75A 1Y1UA 2M0RA 3FS7A 1RTP1 1M39A 1WDCB 1DJZA 2V53A 2OS8B 2WC8A 3BQ3A 1V1FA 1WRKA 1S5GZ 2EGDA 1DF0B 2L0PA 1CMFA 1WY9A 3TS5C 2ZKMX 1S1EA 4MZKA 2K2AA 1F4OA 1Q80A 3VRQA 1N2DA 2KBIA 1FBVA 3NSLA 4DRWA 2G9BA 5ER4X 1CKKA 1TCFA 5AXIA 2MLEC 4BY5A 1GJYA 2JWWA 4U8DA 2AAOA 2KI6C 3OP0A 1IQ3A 1YUUA 3SJSA 5JJGA 1XFUO 1FW4A 1XYDA 1DJWA 1SBJA 4FQOA 1RK9A 4P5OE 1JF2A 2NZ0A 4YGAA 3TDIA 1CFFA 1NX0A 4NQGA 1RJVA 2LCPA 1C07A 1KSMA 1BR4B 1E8AA 3KHEA 4GNKB 5TNCA 1VRKA 4JWQA 3OHMB 3GK4X 2K2FA 3TS5B 1OZOA 3BUMB 1JC2A 3DVJA 1JWDA 1L2OC 1CDMA 2SASA 1DJIA 1S6IA 2CXJA 3RM1A 1B8RA 5DKQA 1JF0A 1AP4A 1F4QA 2LHLA 3I5IC 2MHHA 2Y1NA 4I5KA 2HETA 1YX7A 4F0ZB 1CTRA 2CTNA 3O78A 1X02A 5CSJA 2JU0A 5D69A 4YRUA 4PE7A 5D7FA 3EVRA 5GQQC 1XK4A 1SCMB 2A4JA 1TNXA 4GBAA 1XO5A 1BLQA 1QIVA 1ZACA 1BMOA 1CLBA 1IJ5A 1S26D 2B1UA 4ICBA 1WRLA 4UPGA 1H4BA 1AVSA 2K0JA 1Y1AA 1TTXA 2GGMA 1ZFSA 2KGRA 2KFFA 1LVCD 1DJGA 3K21A 2GV5A 3ZWHA 5J3XA 4ETOA 1W7JB 1R6PA 4OVNF 3D0YB 1ZOTB 1B1GA 3SG5A 3O6BA 1DF0A 3FIAA 3OB2B 2FCDA 3VROA 3EK8A 4MZLA 2JXCA 2KAXA 3PALA 4C0JA 1K96A 1CB1A 1S36A 4E68A 2H61A 3NSOA 2M7LA 2JTZA 4WRIA 2M7NA 3PATA 2CNPA 1ZUZA 1KFUL 1KWOC 1K93D 1XK4C 1K90D 1QXPA 3DD4A 4PALA 5AFPA 2LUCA 4HREE 1AK8A 2EC6B 1IJ6A 2RGIA 1SMGA 2KYCA 4YGBB 3EK4A 1NWDA 1ZMZA 1RFJA 1XFYO 3OX5A 1YTZC 1DJHA 2L50A 1C7VA 2NXQA 1J7OA 1LA0A 4GGNA 1KCYA 5JOLA 3I5GC 4OKHA 4DUQA 1DVIA 5CSNA 2MJWB 2VRGA 3CGAA 2ZN9A 3EKJA 3O4YA 3H4SE 1WDCC 2LM5A 2OS8C 2JT0A 2KBMA 1CM1A 2I18A 4C0LA 2FOTA 3EK7A 3VRNA 4CIDA 4USLA 2FCEA 1M45A 1MWNA 2L4HA 4NDBA 3BYAA 2MAZA 1KFXS 2H61C 1SW8A 3EVVA 3QRXA 1QLKA 2EHBA 1JFJA 2JT8A 1PVBA 2CCMA 4PHKA 1A03A 4MN0A 3PSRA 3NXAA 1OE9B 3DVKA 4GFTA 2WCEA 3I5FB 2G2BA 1PVAA 1QVIY 1HT9A 1LXFC 4Q04A 3GK1A 1NUBA 5HLVA 2LE9B 4CLNA 1FI6A 1NX2A 1CM4A 4QJ5B 1TNPA 1CDLA 1AHRA 1KSOA 1G4YR 2KOTA 3PN7B 1S6JA 3CLNA 3D0YA 1BR1B 4ORBB 4CFRA 5HKZA 3SG6A 1L7ZA 2K7OA 4GAOA 2O5GA 3I5HB 1NYAA 2HQWA 1MF8B 4I5JA 1CDPA 1N65A 3WXAA 4AQJA 1HQVA 2Q91A 1AJ4A 3SG2A 1RECA 2LLTA 2QPTA 1GQMA 1QX7A 4NDDA 1TNQA 3CZTX 1J1DA 1SCMC 1OZSA 1OQPA 3DVMA 1YURA 5HYDA 3CTNA 3WNXB 1IGVA 1K8UA 1KK8B 2KNEA 2WNDA 1B7TY 4XJKB 5CSIA 1DMOA 2BL0C 3SIAA 1J1EA 4JPZB 2PALA 4PCWA 1QASA 3SG3A 1BT6A 1EG3A 3GK2A 4M2PA 2LAPA 3NSKA 1OOJA 1IKUA 4MRYA 4DIRA 1LA3A 2KFHA 3IF7A 3CR5X 1MXEA 2JXLA 2KSPA 1J7PA 2PASA 2ZNEA 1XVJA 3CR4X 1KQVA 2JNXA 4CPVA 2LMUA 1J55A 1KK7Y 4GPLB 4QJ4B 1TN4A 3JTDC 2LHIA 1QIWA 2K61A 2PVBA 2TN4A 1SL8A 2CT9A 1IWQA 2LMVA 3KF9A 4DCKA 1H8BA 1FPWA 2BL0B 3A8RA 2Y5IA 2LV7A 2K7CA 2EC6C 3BUWB 2KI6D
chains in the Genus database with same CATH superfamily
2LLSA 2L2EA 4MEWA 3D10A 3EG5B 2HQ8A 4AQIA 1F55A 1MXLC 1YVHA 2AMIA 2HPSA 2KI4B 2LANA 4HSZA 1BF5A 4P2YB 4YBHB 4TNCA 2BCAA 1M63B 1U5IB 2JTTA 2LMTA 4DS7A 1SCVA 5I8NA 2Q4UA 4CFQA 1OOHA 1S3PA 3CWGA 3SG4A 1C3YA 3JTDB 1JUOA 1SPYA 3BOWB 2I2RE 2L51A 1AJ5A 4N1GA 2BCBA 1Z2CB 2ZRTA 1ALVA 2NCPA 1YX8A 3TDZA 1C3ZA 1EG4A 2ZN8A 2OTGC 1RWYA 1BODA 3D73A 2BKHB 3E3RA 2P6BB 1IG5A 3O2PA 2WCFA 2BECA 1BU3A 1M31A 2O60A 4MRXA 2E6WA 2E30A 1NCYA 2F8PA 4N1FA 3IQQA 5DICA 4XJKA 1CFCA 4NDCA 1PRWA 2QEOA 1Y1XA 2JRFA 4MVFA 1KFXL 3I5FC 4ORAB 3MSEB 1KQMB 2LVJA 2CBLA 1CLMA 1QLSA 3TDUA 2KQ6A 1K9KA 5FYXA 1QVIZ 1GGWA 3JVTB 1M46A 3R1OA 1TRFA 1Y6WA 2BBMA 1MQ1A 2NLNA 2FJUB 2JZIA 3CZ2A 3PN7C 4INXA 1CNPA 3TUYC 5HKWA 1QTXA 2KAVA 4PDZA 1NP8A 2M29A 2OTGB 1NIWA 1CFDA 3F45A 2D8NA 1T14A 3I5HC 1ALWA 1YR5A 2K7DA 1BJFA 2M1UA 1BOCA 2BCXA 2LLUA 3BFAA 4PT1A 1B47A 1JFKA 2F33A 3S0AA 2KDHA 3DXLA 1W7IB 4HRGA 1EL4A 1XA5A 1Z4HA 2BBNA 2DOQA 1YUSA 3BUNB 2LVVA 4JD9A 1YVLA 2KYFA 2ZFDA 1K94A 4OR9B 1A29A 1WRZA 2PMYA 2KAYA 1OMRA 1MHOA 4YGCB 1EJ3A 3LCPC 3NSIA 1IH0A 1XFRA 2K8MB 3Q8IA 3R1PA 1K2HA 2GGZA 3DF0B 1KK8C 1EH2A 2BNXA 5AANA 2WOSA 2F3YA 3AKAA 3S0BA 1TOPA 1B7TZ 1RROA 1SRAA 1UHNA 3TUYB 3CR2A 1UUSA 2Y4QA 4PHJA 3D78A 3PM8A 2LVIA 1U5IA 1NCZA 1NX3A 4YGDB 2KGBC 4A4BA 3FWCA 1EXRA 1ODBA 3BOWA 1CDNA 1PULA 4PHNA 5ER5A 1QWVA 1PSBA 2QDIA 1DJXA 4M2OA 4MSPA 1G8IA 3FE9A 4D1EA 3SG7A 4PE4A 1SL7A 1KK7Z 4I5NB 4MLWA 2Y1MA 1YUTA 2LP3A 1TNWA 2L98A 3D76A 4N5XA 1UP5A 1K9UA 1PALA 2GTEA 3FE8A 1OOIX 3HCMA 1WLMA 2KLEA 3L4LA 5I2OA 1MUXA 1FI5A 1UHJA 2KPHA 2LC5A 3VGOA 1S6CA 2JT3A 3NHIA 2SCPA 5B8IB 3LK1A 5G08A 3S0DA 4PE1A 3WHUB 1DGVA 4YGEB 4GUKA 3ICBA 2COLB 4OCIA 2KI4C 3BUXB 2PSRA 3PLFB 4IJ7A 4PE0A 1AUIB 2LP2A 5I2LA 5AEQA 3FE6A 1BG1A 1OMDA 1OMVA 1DGUA 1MR8A 1DJYA 1K9PA 1N0YA 2KQYA 4PHMA 1SL9A 1S5GY 2PYQA 1XFZO 4WQ2A 3EKHA 4JQ0D 2IS9A 1XFVO 5CPVA 3WHTB 3LK0A 1B8CA 3SIBA 1FF1A 3DYEA 2K7BA 3BXKA 4WQ3A 5BPJA 1Y0VH 2WCLA 3SS3A 3OX6A 1F54A 3LL8B 3KO0A 3C1VA 3VRRA 4QJ3B 3DY9A 2F2PA 1CLLA 5DKNA 4F7FA 5K89A 1JSAA 4ORCB 4YI8A 2WCJA 1SYMA 2WC6A 1IRJA 1PK0D 2MBXA 2I94A 3V2LA 3DF0A 2KHNA 3R1VA 5PALA 4XYNA 3UNWA 2JC2A 5HL1A 4YI9A 1LKJA 1QS7A 1DEKA 2JULA 2F3ZA 2KLDA 2M9GA 1V1GA 3BFHA 1CMGA 1KQMC 3CZ0A 1DELA 1SK6D 1SKTA 3ZNIA 4AOMA 1QV1A 1TIZA 2JOJA 3JVTC 4IL1A 5F6TA 2MA2A 2WCBA 2JPTA 2LUXA 3HX4A 1J7RA 1OSAA 1L2OB 1A75B 1QX2A 5FI2A 1F71A 1OW4A 2QEVA 4I5LB 3I5IB 3QMEA 5KSZA 5IBWA 1J7QA 3KEVA 3KPXA 3AAKA 3AAJA 1G33A 3RLZA 4OV2A 1NSHA 3BJHA 3DVEA 4GGFA 3M0WA 1K95A 5I2QA 1IQ5A 2PRUA 1SNLA 2BE6A 1UWOA 2JPOA 1QATA 2HF5A 2MRDA 4HRHA 2AUCA 3VRPA 3OBVA 3L47A 1F8HA 1D1OA 2R2IA 3D77A 4ZCVA 3RZSA 2M8UA 1SR6C 2QACA 4R1EA 4L9MA 1OOFA 1CFPA 1LINA 5KU1A 1GGZA 1JBAA 1F70A 2NCOA 1UHIA 3AKBA 4C0KA 2JNFA 2LVKA 1WLZA 1DQEA 5KTYA 2I7AA 1TUZA 2KFGA 4ZCUA 2ISDA 3CS1A 1UURA 5HKYA 1B8LA 3BUOB 1PSRA 1KFUS 3NGVA 2K60A 2M1KB 1QJTA 1NX1A 2F2OA 4MBEA 3FWBA 3IQOA 4GGFC 1YRUB 1TCOB 1R2UA 1TWOA 1XFWO 2MLFC 2WORA 3A4UB 1SR6B 1B4CA 3B7AA 1SY9A 2M97A 1A2XA 2JQ6A 1DTLA 1KWOB 3TZ1A 1XFXO 2L5XB 4FTGA 3PFVA 5FI7A 2H2KA 1A4PA 3GOFA 3BFBA 5AERA 1YRTB 4A4CA 1UHHA 1NPQA 2ZRSA 2P70A 1UHKA 3EVUA 4BY4A 5HLOA 2M3WA 5DKRA 1C7WA 4MZJA 5CSFA 1DT7B 2LNKA 3I5GB 2OPOA 2BE4A 2BKIB 2M49B 3OB1B 4M2QA 1QX5B 2ZNDA 1QV0A 3UO9A 1B9AA 3LLEA 2L4IA 1NCXA 1A75A 1Y1UA 2M0RA 3FS7A 3S0EA 1RTP1 1M39A 1WDCB 1DJZA 2V53A 2OS8B 2WC8A 3BQ3A 1V1FA 4INWA 1WRKA 1S5GZ 2EGDA 3VB1A 1DF0B 2L0PA 1CMFA 1GM0A 1TUJA 1WY9A 3TS5C 2ZKMX 1S1EA 4MZKA 2K2AA 1F4OA 1Q80A 3VRQA 1N2DA 2KBIA 1FBVA 3NSLA 4DRWA 2G9BA 5ER4X 3L4AA 1CKKA 2L2CA 1TCFA 5AXIA 2MLEC 4BY5A 1GJYA 2JWWA 4U8DA 2AAOA 2FJYA 2KI6C 3OP0A 1IQ3A 1YUUA 3SJSA 5JJGA 1XFUO 1FW4A 1XYDA 1DJWA 1SBJA 4FQOA 1RK9A 4P5OE 1JF2A 2NZ0A 4YGAA 3TDIA 1CFFA 1NX0A 4NQGA 1RJVA 2WC5A 2LCPA 1C07A 3D75A 1KSMA 1BR4B 1E8AA 1OOGA 3CYZA 3KHEA 4GNKB 5TNCA 1VRKA 4JWQA 3OHMB 3GK4X 2K2FA 4OZDA 1OZOA 3BUMB 3TS5B 3DVJA 1JC2A 1JWDA 1L2OC 1CDMA 2SASA 1DJIA 1S6IA 2CXJA 3RM1A 1B8RA 5DKQA 1JF0A 1AP4A 1F4QA 2LHLA 3I5IC 2MHHA 2Y1NA 4I5KA 2HETA 1YX7A 4F0ZB 1CTRA 2CTNA 3O78A 1X02A 5CSJA 2JU0A 5D69A 4YRUA 4PE7A 5D7FA 3CABA 3EVRA 5GQQC 1XK4A 1SCMB 1TNXA 2A4JA 4GBAA 1XO5A 1BLQA 1QIVA 1ZACA 1BMOA 1CLBA 1IJ5A 3OGNA 1S26D 2B1UA 4ICBA 1WRLA 4UPGA 1H4BA 1AVSA 2K0JA 1Y1AA 1TTXA 2GGMA 1ZFSA 2KGRA 2KFFA 1LVCD 1DJGA 3K21A 2GV5A 3ZWHA 5J3XA 4ETOA 1W7JB 1R6PA 4OVNF 3D0YB 1ZOTB 1B1GA 3SG5A 3O6BA 1DF0A 4FQTA 2L5YA 3FIAA 3OB2B 2FCDA 3VROA 4JKTA 3EK8A 4MZLA 2JXCA 2KAXA 3PALA 4C0JA 1K96A 1CB1A 1S36A 3O4XA 4E68A 2H61A 3NSOA 2M7LA 2PQLA 2JTZA 4WRIA 2M7NA 3PATA 2CNPA 1ZUZA 3PM2A 1KFUL 1KWOC 1K93D 1XK4C 1K90D 1QXPA 3DD4A 4PALA 5AFPA 2LUCA 4HREE 1AK8A 2EC6B 1IJ6A 2RGIA 1SMGA 2KYCA 3K1EA 3EK4A 4YGBB 1NWDA 1ZMZA 1RFJA 1XFYO 3B88A 3OX5A 5I94A 1YTZC 1DJHA 2L50A 1C7VA 2NXQA 1J7OA 1LA0A 4GGNA 1KCYA 5JOLA 3I5GC 4OKHA 4DUQA 1DVIA 5CSNA 2MJWB 2VRGA 3CGAA 2ZN9A 3EKJA 3O4YA 3H4SE 1WDCC 2LM5A 2OS8C 2JT0A 2KBMA 1CM1A 2I18A 4C0LA 3B6XA 2FOTA 3EK7A 3VRNA 4CIDA 4USLA 2FCEA 1M45A 1MWNA 2L4HA 4NDBA 2WCMA 3BYAA 2MAZA 1KFXS 2H61C 1SW8A 4KYNA 3EVVA 3QRXA 1QLKA 2EHBA 1P28A 1JFJA 2JT8A 3R72A 1PVBA 2CCMA 4PHKA 5D3OA 4MN0A 3PSRA 3NXAA 1A03A 1OE9B 2ERBA 2QEBA 3DVKA 1ORGA 4GFTA 2WCEA 3I5FB 2G2BA 1PVAA 1QVIY 1HT9A 2WCKA 1LXFC 1LS8A 4Q04A 3GK1A 1NUBA 5HLVA 2LE9B 4CLNA 1FI6A 1NX2A 1CM4A 4QJ5B 1TNPA 3D74A 1CDLA 1AHRA 1KSOA 1G4YR 2KOTA 3B86A 1S6JA 3CLNA 3PN7B 2BAPA 3D0YA 1BR1B 4ORBB 4CFRA 5HKZA 3SG6A 1L7ZA 2K7OA 4GAOA 2O5GA 3I5HB 1NYAA 2HQWA 1MF8B 4I5JA 1CDPA 1N65A 3WXAA 1SSEB 4AQJA 1HQVA 2Q91A 1AJ4A 3SG2A 1RECA 3B87A 2LLTA 2QPTA 3CZ1A 1GQMA 3DZTA 2WCHA 1QX7A 4NDDA 1TNQA 3CZTX 2P71A 1J1DA 1SCMC 3SS5A 1OZSA 1OQPA 3DVMA 1YURA 5HYDA 3CTNA 3WNXB 1IGVA 1K8UA 1KK8B 2KNEA 2WNDA 1B7TY 4XJKB 5CSIA 3S0GA 3SS4A 1DMOA 2BL0C 3SIAA 1J1EA 3PJIA 4JPZB 2PALA 4PCWA 1W9ZA 1QASA 1BT6A 3SG3A 2H8VA 1EG3A 3GK2A 4M2PA 2LAPA 3IVTA 3NSKA 1OOJA 1IKUA 4MRYA 3NHTA 4DIRA 1LA3A 3CDNA 2KFHA 3IF7A 3CR5X 1MXEA 2JXLA 2KSPA 2YGUA 1J7PA 2PASA 2ZNEA 1XVJA 3CR4X 1KQVA 2JNXA 4CPVA 1DC1A 2LMUA 3N7HA 1J55A 1KK7Y 4GPLB 4QJ4B 1TN4A 3JTDC 2LHIA 1QIWA 5FI6A 2K61A 2PVBA 2TN4A 2QEHA 1SL8A 2CT9A 1IIOA 1IWQA 2LMVA 3KF9A 4DCKA 1H8BA 1FPWA 2BL0B 3A8RA 3S0FA 2Y5IA 5EL2A 2LV7A 2K7CA 2EC6C 3BUWB 2KI6D
chains in the Genus database with same CATH topology
2LLSA 2L2EA 4MEWA 3D10A 4AQIA 2HQ8A 1F55A 1MXLC 1YVHA 2AMIA 2HPSA 2KI4B 2LANA 4HSZA 1BF5A 4P2YB 4YBHB 4TNCA 2BCAA 1M63B 1U5IB 2JTTA 2LMTA 4DS7A 1SCVA 5I8NA 2Q4UA 4CFQA 1S3PA 3CWGA 3SG4A 3JTDB 1JUOA 1SPYA 3BOWB 2I2RE 2L51A 1AJ5A 4N1GA 2BCBA 2ZRTA 1ALVA 2NCPA 1YX8A 3TDZA 1EG4A 2ZN8A 2OTGC 1RWYA 1BODA 2BKHB 3E3RA 2P6BB 1IG5A 3O2PA 2WCFA 2BECA 1BU3A 1M31A 2O60A 4MRXA 2E6WA 2E30A 1NCYA 2F8PA 4N1FA 3IQQA 1CFCA 4XJKA 4NDCA 1PRWA 1Y1XA 2JRFA 4MVFA 1KFXL 3I5FC 4ORAB 3MSEB 1KQMB 2LVJA 2CBLA 1CLMA 1QLSA 3TDUA 2KQ6A 1K9KA 5FYXA 1QVIZ 1GGWA 3JVTB 1M46A 1TRFA 1Y6WA 2BBMA 1MQ1A 2NLNA 2FJUB 2JZIA 3PN7C 1CNPA 3TUYC 5HKWA 1QTXA 2KAVA 4PDZA 1NP8A 2M29A 2OTGB 1NIWA 1CFDA 3F45A 2D8NA 3I5HC 1ALWA 1YR5A 2K7DA 1BJFA 2M1UA 1BOCA 2BCXA 2LLUA 1B47A 1JFKA 2F33A 2KDHA 1W7IB 4HRGA 1EL4A 1XA5A 2BBNA 2DOQA 1YUSA 3BUNB 2LVVA 1YVLA 2KYFA 2ZFDA 1K94A 4OR9B 1A29A 1WRZA 2PMYA 2KAYA 1OMRA 1MHOA 4YGCB 1EJ3A 3LCPC 3NSIA 1IH0A 2K8MB 1K2HA 2GGZA 3DF0B 1KK8C 1EH2A 5AANA 2WOSA 2F3YA 3AKAA 1TOPA 1B7TZ 1RROA 1SRAA 1UHNA 3TUYB 3CR2A 1UUSA 2Y4QA 4PHJA 3PM8A 2LVIA 1U5IA 1NCZA 1NX3A 4YGDB 2KGBC 4A4BA 3FWCA 1EXRA 1ODBA 3BOWA 1CDNA 1PULA 4PHNA 5ER5A 1PSBA 4M2OA 1DJXA 4MSPA 1G8IA 4D1EA 3SG7A 4PE4A 1SL7A 1KK7Z 4I5NB 4MLWA 2Y1MA 1YUTA 2LP3A 1TNWA 2L98A 4N5XA 1UP5A 1K9UA 1PALA 3HCMA 1WLMA 5I2OA 1FI5A 1MUXA 1UHJA 2LC5A 3VGOA 1S6CA 2JT3A 2SCPA 5B8IB 3LK1A 5G08A 4PE1A 3WHUB 1DGVA 4YGEB 4GUKA 3ICBA 2COLB 4OCIA 2KI4C 3BUXB 2PSRA 3PLFB 4PE0A 5AEQA 1AUIB 2LP2A 5I2LA 1BG1A 1OMDA 1OMVA 1DGUA 1MR8A 1DJYA 1K9PA 1N0YA 2KQYA 4PHMA 1SL9A 1S5GY 1XFZO 4WQ2A 3EKHA 4JQ0D 2IS9A 1XFVO 5CPVA 3WHTB 3LK0A 1B8CA 3SIBA 1FF1A 2K7BA 3BXKA 4WQ3A 5BPJA 1Y0VH 3OX6A 1F54A 3LL8B 3KO0A 3C1VA 3VRRA 4QJ3B 2F2PA 1CLLA 5DKNA 5K89A 1JSAA 4ORCB 4YI8A 1SYMA 1IRJA 1PK0D 2MBXA 2I94A 3DF0A 2KHNA 5PALA 4XYNA 2JC2A 4YI9A 1LKJA 1QS7A 2JULA 2F3ZA 2M9GA 1V1GA 1CMGA 1KQMC 4AOMA 1SK6D 1SKTA 3ZNIA 1QV1A 1TIZA 2JOJA 3JVTC 4IL1A 5F6TA 2MA2A 2WCBA 2JPTA 2LUXA 3HX4A 1J7RA 1OSAA 1L2OB 1A75B 1QX2A 1F71A 4I5LB 3I5IB 5KSZA 5IBWA 1J7QA 3KEVA 3KPXA 3AAKA 3AAJA 1G33A 3RLZA 4OV2A 1NSHA 4GGFA 3DVEA 3M0WA 1K95A 5I2QA 1IQ5A 2PRUA 1SNLA 2BE6A 1UWOA 1QATA 2HF5A 2MRDA 4HRHA 2AUCA 3VRPA 1F8HA 1D1OA 2R2IA 4ZCVA 2M8UA 1SR6C 2QACA 4R1EA 4L9MA 1CFPA 1LINA 5KU1A 1GGZA 1JBAA 1F70A 2NCOA 1UHIA 3AKBA 4C0KA 2JNFA 2LVKA 1WLZA 5KTYA 2I7AA 2KFGA 4ZCUA 2ISDA 3CS1A 1UURA 5HKYA 1B8LA 3BUOB 1PSRA 1KFUS 2M1KB 1QJTA 1NX1A 2F2OA 4MBEA 3FWBA 3IQOA 4GGFC 1YRUB 1TCOB 1R2UA 3A4UB 1XFWO 2MLFC 2WORA 1B4CA 1SR6B 1SY9A 2M97A 1A2XA 2JQ6A 1DTLA 1KWOB 3TZ1A 1XFXO 2L5XB 4FTGA 3PFVA 2H2KA 1A4PA 3GOFA 5AERA 1YRTB 4A4CA 1UHHA 1NPQA 2ZRSA 1UHKA 3EVUA 4BY4A 5HLOA 2M3WA 5DKRA 1C7WA 4MZJA 5CSFA 1DT7B 2LNKA 3I5GB 2OPOA 2BE4A 2BKIB 2M49B 3OB1B 4M2QA 1QX5B 2ZNDA 1QV0A 1B9AA 3LLEA 2L4IA 1NCXA 1A75A 1Y1UA 2M0RA 3FS7A 1RTP1 1M39A 1WDCB 1DJZA 2V53A 2OS8B 2WC8A 3BQ3A 1V1FA 1WRKA 1S5GZ 2EGDA 1DF0B 2L0PA 1CMFA 1WY9A 3TS5C 2ZKMX 1S1EA 4MZKA 2K2AA 1F4OA 1Q80A 3VRQA 1N2DA 2KBIA 1FBVA 3NSLA 4DRWA 2G9BA 5ER4X 1CKKA 1TCFA 5AXIA 2MLEC 4BY5A 1GJYA 2JWWA 4U8DA 2AAOA 2KI6C 3OP0A 1IQ3A 1YUUA 3SJSA 5JJGA 1XFUO 1FW4A 1XYDA 1DJWA 1SBJA 4FQOA 1RK9A 4P5OE 1JF2A 2NZ0A 4YGAA 3TDIA 1CFFA 1NX0A 4NQGA 1RJVA 2LCPA 1C07A 1KSMA 1BR4B 1E8AA 3KHEA 4GNKB 5TNCA 1VRKA 4JWQA 3OHMB 3GK4X 2K2FA 3TS5B 1OZOA 3BUMB 1JC2A 3DVJA 1JWDA 1L2OC 1CDMA 2SASA 1DJIA 1S6IA 2CXJA 3RM1A 1B8RA 5DKQA 1JF0A 1AP4A 1F4QA 2LHLA 3I5IC 2MHHA 2Y1NA 4I5KA 2HETA 1YX7A 4F0ZB 1CTRA 2CTNA 3O78A 1X02A 5CSJA 2JU0A 5D69A 4YRUA 4PE7A 5D7FA 3EVRA 5GQQC 1XK4A 1SCMB 2A4JA 1TNXA 4GBAA 1XO5A 1BLQA 1QIVA 1ZACA 1BMOA 1CLBA 1IJ5A 1S26D 2B1UA 4ICBA 1WRLA 4UPGA 1H4BA 1AVSA 2K0JA 1Y1AA 1TTXA 2GGMA 1ZFSA 2KGRA 2KFFA 1LVCD 1DJGA 3K21A 2GV5A 3ZWHA 5J3XA 4ETOA 1W7JB 1R6PA 4OVNF 3D0YB 1ZOTB 1B1GA 3SG5A 3O6BA 1DF0A 3FIAA 3OB2B 2FCDA 3VROA 3EK8A 4MZLA 2JXCA 2KAXA 3PALA 4C0JA 1K96A 1CB1A 1S36A 4E68A 2H61A 3NSOA 2M7LA 2JTZA 4WRIA 2M7NA 3PATA 2CNPA 1ZUZA 1KFUL 1KWOC 1K93D 1XK4C 1K90D 1QXPA 3DD4A 4PALA 5AFPA 2LUCA 4HREE 1AK8A 2EC6B 1IJ6A 2RGIA 1SMGA 2KYCA 4YGBB 3EK4A 1NWDA 1ZMZA 1RFJA 1XFYO 3OX5A 1YTZC 1DJHA 2L50A 1C7VA 2NXQA 1J7OA 1LA0A 4GGNA 1KCYA 5JOLA 3I5GC 4OKHA 4DUQA 1DVIA 5CSNA 2MJWB 2VRGA 3CGAA 2ZN9A 3EKJA 3O4YA 3H4SE 1WDCC 2LM5A 2OS8C 2JT0A 2KBMA 1CM1A 2I18A 4C0LA 2FOTA 3EK7A 3VRNA 4CIDA 4USLA 2FCEA 1M45A 1MWNA 2L4HA 4NDBA 3BYAA 2MAZA 1KFXS 2H61C 1SW8A 3EVVA 3QRXA 1QLKA 2EHBA 1JFJA 2JT8A 1PVBA 2CCMA 4PHKA 1A03A 4MN0A 3PSRA 3NXAA 1OE9B 3DVKA 4GFTA 2WCEA 3I5FB 2G2BA 1PVAA 1QVIY 1HT9A 1LXFC 4Q04A 3GK1A 1NUBA 5HLVA 2LE9B 4CLNA 1FI6A 1NX2A 1CM4A 4QJ5B 1TNPA 1CDLA 1AHRA 1KSOA 1G4YR 2KOTA 3PN7B 1S6JA 3CLNA 3D0YA 1BR1B 4ORBB 4CFRA 5HKZA 3SG6A 1L7ZA 2K7OA 4GAOA 2O5GA 3I5HB 1NYAA 2HQWA 1MF8B 4I5JA 1CDPA 1N65A 3WXAA 4AQJA 1HQVA 2Q91A 1AJ4A 3SG2A 1RECA 2LLTA 2QPTA 1GQMA 1QX7A 4NDDA 1TNQA 3CZTX 1J1DA 1SCMC 1OZSA 1OQPA 3DVMA 1YURA 5HYDA 3CTNA 3WNXB 1IGVA 1K8UA 1KK8B 2KNEA 2WNDA 1B7TY 4XJKB 5CSIA 1DMOA 2BL0C 3SIAA 1J1EA 4JPZB 2PALA 4PCWA 1QASA 3SG3A 1BT6A 1EG3A 3GK2A 4M2PA 2LAPA 3NSKA 1OOJA 1IKUA 4MRYA 4DIRA 1LA3A 2KFHA 3IF7A 3CR5X 1MXEA 2JXLA 2KSPA 1J7PA 2PASA 2ZNEA 1XVJA 3CR4X 1KQVA 2JNXA 4CPVA 2LMUA 1J55A 1KK7Y 4GPLB 4QJ4B 1TN4A 3JTDC 2LHIA 1QIWA 2K61A 2PVBA 2TN4A 1SL8A 2CT9A 1IWQA 2LMVA 3KF9A 4DCKA 1H8BA 1FPWA 2BL0B 3A8RA 2Y5IA 2LV7A 2K7CA 2EC6C 3BUWB 2KI6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLS A;  2L2E A;  4MEW A;  3D10 A;  4AQI A;  2HQ8 A;  1F55 A;  1MXL C;  1YVH A;  2AMI A;  2HPS A;  2KI4 B;  2LAN A;  4HSZ A;  1BF5 A;  4P2Y B;  4YBH B;  4TNC A;  2BCA A;  1M63 B;  1U5I B;  2JTT A;  2LMT A;  4DS7 A;  1SCV A;  5I8N A;  2Q4U A;  4CFQ A;  1S3P A;  3CWG A;  3SG4 A;  3JTD B;  1JUO A;  1SPY A;  3BOW B;  2I2R E;  2L51 A;  1AJ5 A;  4N1G A;  2BCB A;  2ZRT A;  1ALV A;  2NCP A;  1YX8 A;  3TDZ A;  1EG4 A;  2ZN8 A;  2OTG C;  1RWY A;  1BOD A;  2BKH B;  3E3R A;  2P6B B;  1IG5 A;  3O2P A;  2WCF A;  2BEC A;  1BU3 A;  1M31 A;  2O60 A;  4MRX A;  2E6W A;  2E30 A;  1NCY A;  2F8P A;  4N1F A;  3IQQ A;  1CFC A;  4XJK A;  4NDC A;  1PRW A;  1Y1X A;  2JRF A;  4MVF A;  1KFX L;  3I5F C;  4ORA B;  3MSE B;  1KQM B;  2LVJ A;  2CBL A;  1CLM A;  1QLS A;  3TDU A;  2KQ6 A;  1K9K A;  5FYX A;  1QVI Z;  1GGW A;  3JVT B;  1M46 A;  1TRF A;  1Y6W A;  2BBM A;  1MQ1 A;  2NLN A;  2FJU B;  2JZI A;  3PN7 C;  1CNP A;  3TUY C;  5HKW A;  1QTX A;  2KAV A;  4PDZ A;  1NP8 A;  2M29 A;  2OTG B;  1NIW A;  1CFD A;  3F45 A;  2D8N A;  3I5H C;  1ALW A;  1YR5 A;  2K7D A;  1BJF A;  2M1U A;  1BOC A;  2BCX A;  2LLU A;  1B47 A;  1JFK A;  2F33 A;  2KDH A;  1W7I B;  4HRG A;  1EL4 A;  1XA5 A;  2BBN A;  2DOQ A;  1YUS A;  3BUN B;  2LVV A;  1YVL A;  2KYF A;  2ZFD A;  1K94 A;  4OR9 B;  1A29 A;  1WRZ A;  2PMY A;  2KAY A;  1OMR A;  1MHO A;  4YGC B;  1EJ3 A;  3LCP C;  3NSI A;  1IH0 A;  2K8M B;  1K2H A;  2GGZ A;  3DF0 B;  1KK8 C;  1EH2 A;  5AAN A;  2WOS A;  2F3Y A;  3AKA A;  1TOP A;  1B7T Z;  1RRO A;  1SRA A;  1UHN A;  3TUY B;  3CR2 A;  1UUS A;  2Y4Q A;  4PHJ A;  3PM8 A;  2LVI A;  1U5I A;  1NCZ A;  1NX3 A;  4YGD B;  2KGB C;  4A4B A;  3FWC A;  1EXR A;  1ODB A;  3BOW A;  1CDN A;  1PUL A;  4PHN A;  5ER5 A;  1PSB A;  4M2O A;  1DJX A;  4MSP A;  1G8I A;  4D1E A;  3SG7 A;  4PE4 A;  1SL7 A;  1KK7 Z;  4I5N B;  4MLW A;  2Y1M A;  1YUT A;  2LP3 A;  1TNW A;  2L98 A;  4N5X A;  1UP5 A;  1K9U A;  1PAL A;  3HCM A;  1WLM A;  5I2O A;  1FI5 A;  1MUX A;  1UHJ A;  2LC5 A;  3VGO A;  1S6C A;  2JT3 A;  2SCP A;  5B8I B;  3LK1 A;  5G08 A;  4PE1 A;  3WHU B;  1DGV A;  4YGE B;  4GUK A;  3ICB A;  2COL B;  4OCI A;  2KI4 C;  3BUX B;  2PSR A;  3PLF B;  4PE0 A;  5AEQ A;  1AUI B;  2LP2 A;  5I2L A;  1BG1 A;  1OMD A;  1OMV A;  1DGU A;  1MR8 A;  1DJY A;  1K9P A;  1N0Y A;  2KQY A;  4PHM A;  1SL9 A;  1S5G Y;  1XFZ O;  4WQ2 A;  3EKH A;  4JQ0 D;  2IS9 A;  1XFV O;  5CPV A;  3WHT B;  3LK0 A;  1B8C A;  3SIB A;  1FF1 A;  2K7B A;  3BXK A;  4WQ3 A;  5BPJ A;  1Y0V H;  3OX6 A;  1F54 A;  3LL8 B;  3KO0 A;  3C1V A;  3VRR A;  4QJ3 B;  2F2P A;  1CLL A;  5DKN A;  5K89 A;  1JSA A;  4ORC B;  4YI8 A;  1SYM A;  1IRJ A;  1PK0 D;  2MBX A;  2I94 A;  3DF0 A;  2KHN A;  5PAL A;  4XYN A;  2JC2 A;  4YI9 A;  1LKJ A;  1QS7 A;  2JUL A;  2F3Z A;  2M9G A;  1V1G A;  1CMG A;  1KQM C;  4AOM A;  1SK6 D;  1SKT A;  3ZNI A;  1QV1 A;  1TIZ A;  2JOJ A;  3JVT C;  4IL1 A;  5F6T A;  2MA2 A;  2WCB A;  2JPT A;  2LUX A;  3HX4 A;  1J7R A;  1OSA A;  1L2O B;  1A75 B;  1QX2 A;  1F71 A;  4I5L B;  3I5I B;  5KSZ A;  5IBW A;  1J7Q A;  3KEV A;  3KPX A;  3AAK A;  3AAJ A;  1G33 A;  3RLZ A;  4OV2 A;  1NSH A;  4GGF A;  3DVE A;  3M0W A;  1K95 A;  5I2Q A;  1IQ5 A;  2PRU A;  1SNL A;  2BE6 A;  1UWO A;  1QAT A;  2HF5 A;  2MRD A;  4HRH A;  2AUC A;  3VRP A;  1F8H A;  1D1O A;  2R2I A;  4ZCV A;  2M8U A;  1SR6 C;  2QAC A;  4R1E A;  4L9M A;  1CFP A;  1LIN A;  5KU1 A;  1GGZ A;  1JBA A;  1F70 A;  2NCO A;  1UHI A;  3AKB A;  4C0K A;  2JNF A;  2LVK A;  1WLZ A;  5KTY A;  2I7A A;  2KFG A;  4ZCU A;  2ISD A;  3CS1 A;  1UUR A;  5HKY A;  1B8L A;  3BUO B;  1PSR A;  1KFU S;  2M1K B;  1QJT A;  1NX1 A;  2F2O A;  4MBE A;  3FWB A;  3IQO A;  4GGF C;  1YRU B;  1TCO B;  1R2U A;  3A4U B;  1XFW O;  2MLF C;  2WOR A;  1B4C A;  1SR6 B;  1SY9 A;  2M97 A;  1A2X A;  2JQ6 A;  1DTL A;  1KWO B;  3TZ1 A;  1XFX O;  2L5X B;  4FTG A;  3PFV A;  2H2K A;  1A4P A;  3GOF A;  5AER A;  1YRT B;  4A4C A;  1UHH A;  1NPQ A;  2ZRS A;  1UHK A;  3EVU A;  4BY4 A;  5HLO A;  2M3W A;  5DKR A;  1C7W A;  4MZJ A;  5CSF A;  1DT7 B;  2LNK A;  3I5G B;  2OPO A;  2BE4 A;  2BKI B;  2M49 B;  3OB1 B;  4M2Q A;  1QX5 B;  2ZND A;  1QV0 A;  1B9A A;  3LLE A;  2L4I A;  1NCX A;  1A75 A;  1Y1U A;  2M0R A;  3FS7 A;  1RTP 1;  1M39 A;  1WDC B;  1DJZ A;  2V53 A;  2OS8 B;  2WC8 A;  3BQ3 A;  1V1F A;  1WRK A;  1S5G Z;  2EGD A;  1DF0 B;  2L0P A;  1CMF A;  1WY9 A;  3TS5 C;  2ZKM X;  1S1E A;  4MZK A;  2K2A A;  1F4O A;  1Q80 A;  3VRQ A;  1N2D A;  2KBI A;  1FBV A;  3NSL A;  4DRW A;  2G9B A;  5ER4 X;  1CKK A;  1TCF A;  5AXI A;  2MLE C;  4BY5 A;  1GJY A;  2JWW A;  4U8D A;  2AAO A;  2KI6 C;  3OP0 A;  1IQ3 A;  1YUU A;  3SJS A;  5JJG A;  1XFU O;  1FW4 A;  1XYD A;  1DJW A;  1SBJ A;  4FQO A;  1RK9 A;  4P5O E;  1JF2 A;  2NZ0 A;  4YGA A;  3TDI A;  1CFF A;  1NX0 A;  4NQG A;  1RJV A;  2LCP A;  1C07 A;  1KSM A;  1BR4 B;  1E8A A;  3KHE A;  4GNK B;  5TNC A;  1VRK A;  4JWQ A;  3OHM B;  3GK4 X;  2K2F A;  3TS5 B;  1OZO A;  3BUM B;  1JC2 A;  3DVJ A;  1JWD A;  1L2O C;  1CDM A;  2SAS A;  1DJI A;  1S6I A;  2CXJ A;  3RM1 A;  1B8R A;  5DKQ A;  1JF0 A;  1AP4 A;  1F4Q A;  2LHL A;  3I5I C;  2MHH A;  2Y1N A;  4I5K A;  2HET A;  1YX7 A;  4F0Z B;  1CTR A;  2CTN A;  3O78 A;  1X02 A;  5CSJ A;  2JU0 A;  5D69 A;  4YRU A;  4PE7 A;  5D7F A;  3EVR A;  5GQQ C;  1XK4 A;  1SCM B;  2A4J A;  1TNX A;  4GBA A;  1XO5 A;  1BLQ A;  1QIV A;  1ZAC A;  1BMO A;  1CLB A;  1IJ5 A;  1S26 D;  2B1U A;  4ICB A;  1WRL A;  4UPG A;  1H4B A;  1AVS A;  2K0J A;  1Y1A A;  1TTX A;  2GGM A;  1ZFS A;  2KGR A;  2KFF A;  1LVC D;  1DJG A;  3K21 A;  2GV5 A;  3ZWH A;  5J3X A;  4ETO A;  1W7J B;  1R6P A;  4OVN F;  3D0Y B;  1ZOT B;  1B1G A;  3SG5 A;  3O6B A;  1DF0 A;  3FIA A;  3OB2 B;  2FCD A;  3VRO A;  3EK8 A;  4MZL A;  2JXC A;  2KAX A;  3PAL A;  4C0J A;  1K96 A;  1CB1 A;  1S36 A;  4E68 A;  2H61 A;  3NSO A;  2M7L A;  2JTZ A;  4WRI A;  2M7N A;  3PAT A;  2CNP A;  1ZUZ A;  1KFU L;  1KWO C;  1K93 D;  1XK4 C;  1K90 D;  1QXP A;  3DD4 A;  4PAL A;  5AFP A;  2LUC A;  4HRE E;  1AK8 A;  2EC6 B;  1IJ6 A;  2RGI A;  1SMG A;  2KYC A;  4YGB B;  3EK4 A;  1NWD A;  1ZMZ A;  1RFJ A;  1XFY O;  3OX5 A;  1YTZ C;  1DJH A;  2L50 A;  1C7V A;  2NXQ A;  1J7O A;  1LA0 A;  4GGN A;  1KCY A;  5JOL A;  3I5G C;  4OKH A;  4DUQ A;  1DVI A;  5CSN A;  2MJW B;  2VRG A;  3CGA A;  2ZN9 A;  3EKJ A;  3O4Y A;  3H4S E;  1WDC C;  2LM5 A;  2OS8 C;  2JT0 A;  2KBM A;  1CM1 A;  2I18 A;  4C0L A;  2FOT A;  3EK7 A;  3VRN A;  4CID A;  4USL A;  2FCE A;  1M45 A;  1MWN A;  2L4H A;  4NDB A;  3BYA A;  2MAZ A;  1KFX S;  2H61 C;  1SW8 A;  3EVV A;  3QRX A;  1QLK A;  2EHB A;  1JFJ A;  2JT8 A;  1PVB A;  2CCM A;  4PHK A;  1A03 A;  4MN0 A;  3PSR A;  3NXA A;  1OE9 B;  3DVK A;  4GFT A;  2WCE A;  3I5F B;  2G2B A;  1PVA A;  1QVI Y;  1HT9 A;  1LXF C;  4Q04 A;  3GK1 A;  1NUB A;  5HLV A;  2LE9 B;  4CLN A;  1FI6 A;  1NX2 A;  1CM4 A;  4QJ5 B;  1TNP A;  1CDL A;  1AHR A;  1KSO A;  1G4Y R;  2KOT A;  3PN7 B;  1S6J A;  3CLN A;  3D0Y A;  1BR1 B;  4ORB B;  4CFR A;  5HKZ A;  3SG6 A;  1L7Z A;  2K7O A;  4GAO A;  2O5G A;  3I5H B;  1NYA A;  2HQW A;  1MF8 B;  4I5J A;  1CDP A;  1N65 A;  3WXA A;  4AQJ A;  1HQV A;  2Q91 A;  1AJ4 A;  3SG2 A;  1REC A;  2LLT A;  2QPT A;  1GQM A;  1QX7 A;  4NDD A;  1TNQ A;  3CZT X;  1J1D A;  1SCM C;  1OZS A;  1OQP A;  3DVM A;  1YUR A;  5HYD A;  3CTN A;  3WNX B;  1IGV A;  1K8U A;  1KK8 B;  2KNE A;  2WND A;  1B7T Y;  4XJK B;  5CSI A;  1DMO A;  2BL0 C;  3SIA A;  1J1E A;  4JPZ B;  2PAL A;  4PCW A;  1QAS A;  3SG3 A;  1BT6 A;  1EG3 A;  3GK2 A;  4M2P A;  2LAP A;  3NSK A;  1OOJ A;  1IKU A;  4MRY A;  4DIR A;  1LA3 A;  2KFH A;  3IF7 A;  3CR5 X;  1MXE A;  2JXL A;  2KSP A;  1J7P A;  2PAS A;  2ZNE A;  1XVJ A;  3CR4 X;  1KQV A;  2JNX A;  4CPV A;  2LMU A;  1J55 A;  1KK7 Y;  4GPL B;  4QJ4 B;  1TN4 A;  3JTD C;  2LHI A;  1QIW A;  2K61 A;  2PVB A;  2TN4 A;  1SL8 A;  2CT9 A;  1IWQ A;  2LMV A;  3KF9 A;  4DCK A;  1H8B A;  1FPW A;  2BL0 B;  3A8R A;  2Y5I A;  2LV7 A;  2K7C A;  2EC6 C;  3BUW B;  2KI6 D; 
#chains in the Genus database with same CATH topology
 2LLS A;  2L2E A;  4MEW A;  3D10 A;  3EG5 B;  2HQ8 A;  4AQI A;  1F55 A;  1MXL C;  1YVH A;  2AMI A;  2HPS A;  2KI4 B;  2LAN A;  4HSZ A;  1BF5 A;  4P2Y B;  4YBH B;  4TNC A;  2BCA A;  1M63 B;  1U5I B;  2JTT A;  2LMT A;  4DS7 A;  1SCV A;  5I8N A;  2Q4U A;  4CFQ A;  1OOH A;  1S3P A;  3CWG A;  3SG4 A;  1C3Y A;  3JTD B;  1JUO A;  1SPY A;  3BOW B;  2I2R E;  2L51 A;  1AJ5 A;  4N1G A;  2BCB A;  1Z2C B;  2ZRT A;  1ALV A;  2NCP A;  1YX8 A;  3TDZ A;  1C3Z A;  1EG4 A;  2ZN8 A;  2OTG C;  1RWY A;  1BOD A;  3D73 A;  2BKH B;  3E3R A;  2P6B B;  1IG5 A;  3O2P A;  2WCF A;  2BEC A;  1BU3 A;  1M31 A;  2O60 A;  4MRX A;  2E6W A;  2E30 A;  1NCY A;  2F8P A;  4N1F A;  3IQQ A;  5DIC A;  4XJK A;  1CFC A;  4NDC A;  1PRW A;  2QEO A;  1Y1X A;  2JRF A;  4MVF A;  1KFX L;  3I5F C;  4ORA B;  3MSE B;  1KQM B;  2LVJ A;  2CBL A;  1CLM A;  1QLS A;  3TDU A;  2KQ6 A;  1K9K A;  5FYX A;  1QVI Z;  1GGW A;  3JVT B;  1M46 A;  3R1O A;  1TRF A;  1Y6W A;  2BBM A;  1MQ1 A;  2NLN A;  2FJU B;  2JZI A;  3CZ2 A;  3PN7 C;  4INX A;  1CNP A;  3TUY C;  5HKW A;  1QTX A;  2KAV A;  4PDZ A;  1NP8 A;  2M29 A;  2OTG B;  1NIW A;  1CFD A;  3F45 A;  2D8N A;  1T14 A;  3I5H C;  1ALW A;  1YR5 A;  2K7D A;  1BJF A;  2M1U A;  1BOC A;  2BCX A;  2LLU A;  3BFA A;  4PT1 A;  1B47 A;  1JFK A;  2F33 A;  3S0A A;  2KDH A;  3DXL A;  1W7I B;  4HRG A;  1EL4 A;  1XA5 A;  1Z4H A;  2BBN A;  2DOQ A;  1YUS A;  3BUN B;  2LVV A;  4JD9 A;  1YVL A;  2KYF A;  2ZFD A;  1K94 A;  4OR9 B;  1A29 A;  1WRZ A;  2PMY A;  2KAY A;  1OMR A;  1MHO A;  4YGC B;  1EJ3 A;  3LCP C;  3NSI A;  1IH0 A;  1XFR A;  2K8M B;  3Q8I A;  3R1P A;  1K2H A;  2GGZ A;  3DF0 B;  1KK8 C;  1EH2 A;  2BNX A;  5AAN A;  2WOS A;  2F3Y A;  3AKA A;  3S0B A;  1TOP A;  1B7T Z;  1RRO A;  1SRA A;  1UHN A;  3TUY B;  3CR2 A;  1UUS A;  2Y4Q A;  4PHJ A;  3D78 A;  3PM8 A;  2LVI A;  1U5I A;  1NCZ A;  1NX3 A;  4YGD B;  2KGB C;  4A4B A;  3FWC A;  1EXR A;  1ODB A;  3BOW A;  1CDN A;  1PUL A;  4PHN A;  5ER5 A;  1QWV A;  1PSB A;  2QDI A;  1DJX A;  4M2O A;  4MSP A;  1G8I A;  3FE9 A;  4D1E A;  3SG7 A;  4PE4 A;  1SL7 A;  1KK7 Z;  4I5N B;  4MLW A;  2Y1M A;  1YUT A;  2LP3 A;  1TNW A;  2L98 A;  3D76 A;  4N5X A;  1UP5 A;  1K9U A;  1PAL A;  2GTE A;  3FE8 A;  1OOI X;  3HCM A;  1WLM A;  2KLE A;  3L4L A;  5I2O A;  1MUX A;  1FI5 A;  1UHJ A;  2KPH A;  2LC5 A;  3VGO A;  1S6C A;  2JT3 A;  3NHI A;  2SCP A;  5B8I B;  3LK1 A;  5G08 A;  3S0D A;  4PE1 A;  3WHU B;  1DGV A;  4YGE B;  4GUK A;  3ICB A;  2COL B;  4OCI A;  2KI4 C;  3BUX B;  2PSR A;  3PLF B;  4IJ7 A;  4PE0 A;  1AUI B;  2LP2 A;  5I2L A;  5AEQ A;  3FE6 A;  1BG1 A;  1OMD A;  1OMV A;  1DGU A;  1MR8 A;  1DJY A;  1K9P A;  1N0Y A;  2KQY A;  4PHM A;  1SL9 A;  1S5G Y;  2PYQ A;  1XFZ O;  4WQ2 A;  3EKH A;  4JQ0 D;  2IS9 A;  1XFV O;  5CPV A;  3WHT B;  3LK0 A;  1B8C A;  3SIB A;  1FF1 A;  3DYE A;  2K7B A;  3BXK A;  4WQ3 A;  5BPJ A;  1Y0V H;  2WCL A;  3SS3 A;  3OX6 A;  1F54 A;  3LL8 B;  3KO0 A;  3C1V A;  3VRR A;  4QJ3 B;  3DY9 A;  2F2P A;  1CLL A;  5DKN A;  4F7F A;  5K89 A;  1JSA A;  4ORC B;  4YI8 A;  2WCJ A;  1SYM A;  2WC6 A;  1IRJ A;  1PK0 D;  2MBX A;  2I94 A;  3V2L A;  3DF0 A;  2KHN A;  3R1V A;  5PAL A;  4XYN A;  3UNW A;  2JC2 A;  5HL1 A;  4YI9 A;  1LKJ A;  1QS7 A;  1DEK A;  2JUL A;  2F3Z A;  2KLD A;  2M9G A;  1V1G A;  3BFH A;  1CMG A;  1KQM C;  3CZ0 A;  1DEL A;  1SK6 D;  1SKT A;  3ZNI A;  4AOM A;  1QV1 A;  1TIZ A;  2JOJ A;  3JVT C;  4IL1 A;  5F6T A;  2MA2 A;  2WCB A;  2JPT A;  2LUX A;  3HX4 A;  1J7R A;  1OSA A;  1L2O B;  1A75 B;  1QX2 A;  5FI2 A;  1F71 A;  1OW4 A;  2QEV A;  4I5L B;  3I5I B;  3QME A;  5KSZ A;  5IBW A;  1J7Q A;  3KEV A;  3KPX A;  3AAK A;  3AAJ A;  1G33 A;  3RLZ A;  4OV2 A;  1NSH A;  3BJH A;  3DVE A;  4GGF A;  3M0W A;  1K95 A;  5I2Q A;  1IQ5 A;  2PRU A;  1SNL A;  2BE6 A;  1UWO A;  2JPO A;  1QAT A;  2HF5 A;  2MRD A;  4HRH A;  2AUC A;  3VRP A;  3OBV A;  3L47 A;  1F8H A;  1D1O A;  2R2I A;  3D77 A;  4ZCV A;  3RZS A;  2M8U A;  1SR6 C;  2QAC A;  4R1E A;  4L9M A;  1OOF A;  1CFP A;  1LIN A;  5KU1 A;  1GGZ A;  1JBA A;  1F70 A;  2NCO A;  1UHI A;  3AKB A;  4C0K A;  2JNF A;  2LVK A;  1WLZ A;  1DQE A;  5KTY A;  2I7A A;  1TUZ A;  2KFG A;  4ZCU A;  2ISD A;  3CS1 A;  1UUR A;  5HKY A;  1B8L A;  3BUO B;  1PSR A;  1KFU S;  3NGV A;  2K60 A;  2M1K B;  1QJT A;  1NX1 A;  2F2O A;  4MBE A;  3FWB A;  3IQO A;  4GGF C;  1YRU B;  1TCO B;  1R2U A;  1TWO A;  1XFW O;  2MLF C;  2WOR A;  3A4U B;  1SR6 B;  1B4C A;  3B7A A;  1SY9 A;  2M97 A;  1A2X A;  2JQ6 A;  1DTL A;  1KWO B;  3TZ1 A;  1XFX O;  2L5X B;  4FTG A;  3PFV A;  5FI7 A;  2H2K A;  1A4P A;  3GOF A;  3BFB A;  5AER A;  1YRT B;  4A4C A;  1UHH A;  1NPQ A;  2ZRS A;  2P70 A;  1UHK A;  3EVU A;  4BY4 A;  5HLO A;  2M3W A;  5DKR A;  1C7W A;  4MZJ A;  5CSF A;  1DT7 B;  2LNK A;  3I5G B;  2OPO A;  2BE4 A;  2BKI B;  2M49 B;  3OB1 B;  4M2Q A;  1QX5 B;  2ZND A;  1QV0 A;  3UO9 A;  1B9A A;  3LLE A;  2L4I A;  1NCX A;  1A75 A;  1Y1U A;  2M0R A;  3FS7 A;  3S0E A;  1RTP 1;  1M39 A;  1WDC B;  1DJZ A;  2V53 A;  2OS8 B;  2WC8 A;  3BQ3 A;  1V1F A;  4INW A;  1WRK A;  1S5G Z;  2EGD A;  3VB1 A;  1DF0 B;  2L0P A;  1CMF A;  1GM0 A;  1TUJ A;  1WY9 A;  3TS5 C;  2ZKM X;  1S1E A;  4MZK A;  2K2A A;  1F4O A;  1Q80 A;  3VRQ A;  1N2D A;  2KBI A;  1FBV A;  3NSL A;  4DRW A;  2G9B A;  5ER4 X;  3L4A A;  1CKK A;  2L2C A;  1TCF A;  5AXI A;  2MLE C;  4BY5 A;  1GJY A;  2JWW A;  4U8D A;  2AAO A;  2FJY A;  2KI6 C;  3OP0 A;  1IQ3 A;  1YUU A;  3SJS A;  5JJG A;  1XFU O;  1FW4 A;  1XYD A;  1DJW A;  1SBJ A;  4FQO A;  1RK9 A;  4P5O E;  1JF2 A;  2NZ0 A;  4YGA A;  3TDI A;  1CFF A;  1NX0 A;  4NQG A;  1RJV A;  2WC5 A;  2LCP A;  1C07 A;  3D75 A;  1KSM A;  1BR4 B;  1E8A A;  1OOG A;  3CYZ A;  3KHE A;  4GNK B;  5TNC A;  1VRK A;  4JWQ A;  3OHM B;  3GK4 X;  2K2F A;  4OZD A;  1OZO A;  3BUM B;  3TS5 B;  3DVJ A;  1JC2 A;  1JWD A;  1L2O C;  1CDM A;  2SAS A;  1DJI A;  1S6I A;  2CXJ A;  3RM1 A;  1B8R A;  5DKQ A;  1JF0 A;  1AP4 A;  1F4Q A;  2LHL A;  3I5I C;  2MHH A;  2Y1N A;  4I5K A;  2HET A;  1YX7 A;  4F0Z B;  1CTR A;  2CTN A;  3O78 A;  1X02 A;  5CSJ A;  2JU0 A;  5D69 A;  4YRU A;  4PE7 A;  5D7F A;  3CAB A;  3EVR A;  5GQQ C;  1XK4 A;  1SCM B;  1TNX A;  2A4J A;  4GBA A;  1XO5 A;  1BLQ A;  1QIV A;  1ZAC A;  1BMO A;  1CLB A;  1IJ5 A;  3OGN A;  1S26 D;  2B1U A;  4ICB A;  1WRL A;  4UPG A;  1H4B A;  1AVS A;  2K0J A;  1Y1A A;  1TTX A;  2GGM A;  1ZFS A;  2KGR A;  2KFF A;  1LVC D;  1DJG A;  3K21 A;  2GV5 A;  3ZWH A;  5J3X A;  4ETO A;  1W7J B;  1R6P A;  4OVN F;  3D0Y B;  1ZOT B;  1B1G A;  3SG5 A;  3O6B A;  1DF0 A;  4FQT A;  2L5Y A;  3FIA A;  3OB2 B;  2FCD A;  3VRO A;  4JKT A;  3EK8 A;  4MZL A;  2JXC A;  2KAX A;  3PAL A;  4C0J A;  1K96 A;  1CB1 A;  1S36 A;  3O4X A;  4E68 A;  2H61 A;  3NSO A;  2M7L A;  2PQL A;  2JTZ A;  4WRI A;  2M7N A;  3PAT A;  2CNP A;  1ZUZ A;  3PM2 A;  1KFU L;  1KWO C;  1K93 D;  1XK4 C;  1K90 D;  1QXP A;  3DD4 A;  4PAL A;  5AFP A;  2LUC A;  4HRE E;  1AK8 A;  2EC6 B;  1IJ6 A;  2RGI A;  1SMG A;  2KYC A;  3K1E A;  3EK4 A;  4YGB B;  1NWD A;  1ZMZ A;  1RFJ A;  1XFY O;  3B88 A;  3OX5 A;  5I94 A;  1YTZ C;  1DJH A;  2L50 A;  1C7V A;  2NXQ A;  1J7O A;  1LA0 A;  4GGN A;  1KCY A;  5JOL A;  3I5G C;  4OKH A;  4DUQ A;  1DVI A;  5CSN A;  2MJW B;  2VRG A;  3CGA A;  2ZN9 A;  3EKJ A;  3O4Y A;  3H4S E;  1WDC C;  2LM5 A;  2OS8 C;  2JT0 A;  2KBM A;  1CM1 A;  2I18 A;  4C0L A;  3B6X A;  2FOT A;  3EK7 A;  3VRN A;  4CID A;  4USL A;  2FCE A;  1M45 A;  1MWN A;  2L4H A;  4NDB A;  2WCM A;  3BYA A;  2MAZ A;  1KFX S;  2H61 C;  1SW8 A;  4KYN A;  3EVV A;  3QRX A;  1QLK A;  2EHB A;  1P28 A;  1JFJ A;  2JT8 A;  3R72 A;  1PVB A;  2CCM A;  4PHK A;  5D3O A;  4MN0 A;  3PSR A;  3NXA A;  1A03 A;  1OE9 B;  2ERB A;  2QEB A;  3DVK A;  1ORG A;  4GFT A;  2WCE A;  3I5F B;  2G2B A;  1PVA A;  1QVI Y;  1HT9 A;  2WCK A;  1LXF C;  1LS8 A;  4Q04 A;  3GK1 A;  1NUB A;  5HLV A;  2LE9 B;  4CLN A;  1FI6 A;  1NX2 A;  1CM4 A;  4QJ5 B;  1TNP A;  3D74 A;  1CDL A;  1AHR A;  1KSO A;  1G4Y R;  2KOT A;  3B86 A;  1S6J A;  3CLN A;  3PN7 B;  2BAP A;  3D0Y A;  1BR1 B;  4ORB B;  4CFR A;  5HKZ A;  3SG6 A;  1L7Z A;  2K7O A;  4GAO A;  2O5G A;  3I5H B;  1NYA A;  2HQW A;  1MF8 B;  4I5J A;  1CDP A;  1N65 A;  3WXA A;  1SSE B;  4AQJ A;  1HQV A;  2Q91 A;  1AJ4 A;  3SG2 A;  1REC A;  3B87 A;  2LLT A;  2QPT A;  3CZ1 A;  1GQM A;  3DZT A;  2WCH A;  1QX7 A;  4NDD A;  1TNQ A;  3CZT X;  2P71 A;  1J1D A;  1SCM C;  3SS5 A;  1OZS A;  1OQP A;  3DVM A;  1YUR A;  5HYD A;  3CTN A;  3WNX B;  1IGV A;  1K8U A;  1KK8 B;  2KNE A;  2WND A;  1B7T Y;  4XJK B;  5CSI A;  3S0G A;  3SS4 A;  1DMO A;  2BL0 C;  3SIA A;  1J1E A;  3PJI A;  4JPZ B;  2PAL A;  4PCW A;  1W9Z A;  1QAS A;  1BT6 A;  3SG3 A;  2H8V A;  1EG3 A;  3GK2 A;  4M2P A;  2LAP A;  3IVT A;  3NSK A;  1OOJ A;  1IKU A;  4MRY A;  3NHT A;  4DIR A;  1LA3 A;  3CDN A;  2KFH A;  3IF7 A;  3CR5 X;  1MXE A;  2JXL A;  2KSP A;  2YGU A;  1J7P A;  2PAS A;  2ZNE A;  1XVJ A;  3CR4 X;  1KQV A;  2JNX A;  4CPV A;  1DC1 A;  2LMU A;  3N7H A;  1J55 A;  1KK7 Y;  4GPL B;  4QJ4 B;  1TN4 A;  3JTD C;  2LHI A;  1QIW A;  5FI6 A;  2K61 A;  2PVB A;  2TN4 A;  2QEH A;  1SL8 A;  2CT9 A;  1IIO A;  1IWQ A;  2LMV A;  3KF9 A;  4DCK A;  1H8B A;  1FPW A;  2BL0 B;  3A8R A;  3S0F A;  2Y5I A;  5EL2 A;  2LV7 A;  2K7C A;  2EC6 C;  3BUW B;  2KI6 D; 
#chains in the Genus database with same CATH homology
 2LLS A;  2L2E A;  4MEW A;  3D10 A;  4AQI A;  2HQ8 A;  1F55 A;  1MXL C;  1YVH A;  2AMI A;  2HPS A;  2KI4 B;  2LAN A;  4HSZ A;  1BF5 A;  4P2Y B;  4YBH B;  4TNC A;  2BCA A;  1M63 B;  1U5I B;  2JTT A;  2LMT A;  4DS7 A;  1SCV A;  5I8N A;  2Q4U A;  4CFQ A;  1S3P A;  3CWG A;  3SG4 A;  3JTD B;  1JUO A;  1SPY A;  3BOW B;  2I2R E;  2L51 A;  1AJ5 A;  4N1G A;  2BCB A;  2ZRT A;  1ALV A;  2NCP A;  1YX8 A;  3TDZ A;  1EG4 A;  2ZN8 A;  2OTG C;  1RWY A;  1BOD A;  2BKH B;  3E3R A;  2P6B B;  1IG5 A;  3O2P A;  2WCF A;  2BEC A;  1BU3 A;  1M31 A;  2O60 A;  4MRX A;  2E6W A;  2E30 A;  1NCY A;  2F8P A;  4N1F A;  3IQQ A;  1CFC A;  4XJK A;  4NDC A;  1PRW A;  1Y1X A;  2JRF A;  4MVF A;  1KFX L;  3I5F C;  4ORA B;  3MSE B;  1KQM B;  2LVJ A;  2CBL A;  1CLM A;  1QLS A;  3TDU A;  2KQ6 A;  1K9K A;  5FYX A;  1QVI Z;  1GGW A;  3JVT B;  1M46 A;  1TRF A;  1Y6W A;  2BBM A;  1MQ1 A;  2NLN A;  2FJU B;  2JZI A;  3PN7 C;  1CNP A;  3TUY C;  5HKW A;  1QTX A;  2KAV A;  4PDZ A;  1NP8 A;  2M29 A;  2OTG B;  1NIW A;  1CFD A;  3F45 A;  2D8N A;  3I5H C;  1ALW A;  1YR5 A;  2K7D A;  1BJF A;  2M1U A;  1BOC A;  2BCX A;  2LLU A;  1B47 A;  1JFK A;  2F33 A;  2KDH A;  1W7I B;  4HRG A;  1EL4 A;  1XA5 A;  2BBN A;  2DOQ A;  1YUS A;  3BUN B;  2LVV A;  1YVL A;  2KYF A;  2ZFD A;  1K94 A;  4OR9 B;  1A29 A;  1WRZ A;  2PMY A;  2KAY A;  1OMR A;  1MHO A;  4YGC B;  1EJ3 A;  3LCP C;  3NSI A;  1IH0 A;  2K8M B;  1K2H A;  2GGZ A;  3DF0 B;  1KK8 C;  1EH2 A;  5AAN A;  2WOS A;  2F3Y A;  3AKA A;  1TOP A;  1B7T Z;  1RRO A;  1SRA A;  1UHN A;  3TUY B;  3CR2 A;  1UUS A;  2Y4Q A;  4PHJ A;  3PM8 A;  2LVI A;  1U5I A;  1NCZ A;  1NX3 A;  4YGD B;  2KGB C;  4A4B A;  3FWC A;  1EXR A;  1ODB A;  3BOW A;  1CDN A;  1PUL A;  4PHN A;  5ER5 A;  1PSB A;  4M2O A;  1DJX A;  4MSP A;  1G8I A;  4D1E A;  3SG7 A;  4PE4 A;  1SL7 A;  1KK7 Z;  4I5N B;  4MLW A;  2Y1M A;  1YUT A;  2LP3 A;  1TNW A;  2L98 A;  4N5X A;  1UP5 A;  1K9U A;  1PAL A;  3HCM A;  1WLM A;  5I2O A;  1FI5 A;  1MUX A;  1UHJ A;  2LC5 A;  3VGO A;  1S6C A;  2JT3 A;  2SCP A;  5B8I B;  3LK1 A;  5G08 A;  4PE1 A;  3WHU B;  1DGV A;  4YGE B;  4GUK A;  3ICB A;  2COL B;  4OCI A;  2KI4 C;  3BUX B;  2PSR A;  3PLF B;  4PE0 A;  5AEQ A;  1AUI B;  2LP2 A;  5I2L A;  1BG1 A;  1OMD A;  1OMV A;  1DGU A;  1MR8 A;  1DJY A;  1K9P A;  1N0Y A;  2KQY A;  4PHM A;  1SL9 A;  1S5G Y;  1XFZ O;  4WQ2 A;  3EKH A;  4JQ0 D;  2IS9 A;  1XFV O;  5CPV A;  3WHT B;  3LK0 A;  1B8C A;  3SIB A;  1FF1 A;  2K7B A;  3BXK A;  4WQ3 A;  5BPJ A;  1Y0V H;  3OX6 A;  1F54 A;  3LL8 B;  3KO0 A;  3C1V A;  3VRR A;  4QJ3 B;  2F2P A;  1CLL A;  5DKN A;  5K89 A;  1JSA A;  4ORC B;  4YI8 A;  1SYM A;  1IRJ A;  1PK0 D;  2MBX A;  2I94 A;  3DF0 A;  2KHN A;  5PAL A;  4XYN A;  2JC2 A;  4YI9 A;  1LKJ A;  1QS7 A;  2JUL A;  2F3Z A;  2M9G A;  1V1G A;  1CMG A;  1KQM C;  4AOM A;  1SK6 D;  1SKT A;  3ZNI A;  1QV1 A;  1TIZ A;  2JOJ A;  3JVT C;  4IL1 A;  5F6T A;  2MA2 A;  2WCB A;  2JPT A;  2LUX A;  3HX4 A;  1J7R A;  1OSA A;  1L2O B;  1A75 B;  1QX2 A;  1F71 A;  4I5L B;  3I5I B;  5KSZ A;  5IBW A;  1J7Q A;  3KEV A;  3KPX A;  3AAK A;  3AAJ A;  1G33 A;  3RLZ A;  4OV2 A;  1NSH A;  4GGF A;  3DVE A;  3M0W A;  1K95 A;  5I2Q A;  1IQ5 A;  2PRU A;  1SNL A;  2BE6 A;  1UWO A;  1QAT A;  2HF5 A;  2MRD A;  4HRH A;  2AUC A;  3VRP A;  1F8H A;  1D1O A;  2R2I A;  4ZCV A;  2M8U A;  1SR6 C;  2QAC A;  4R1E A;  4L9M A;  1CFP A;  1LIN A;  5KU1 A;  1GGZ A;  1JBA A;  1F70 A;  2NCO A;  1UHI A;  3AKB A;  4C0K A;  2JNF A;  2LVK A;  1WLZ A;  5KTY A;  2I7A A;  2KFG A;  4ZCU A;  2ISD A;  3CS1 A;  1UUR A;  5HKY A;  1B8L A;  3BUO B;  1PSR A;  1KFU S;  2M1K B;  1QJT A;  1NX1 A;  2F2O A;  4MBE A;  3FWB A;  3IQO A;  4GGF C;  1YRU B;  1TCO B;  1R2U A;  3A4U B;  1XFW O;  2MLF C;  2WOR A;  1B4C A;  1SR6 B;  1SY9 A;  2M97 A;  1A2X A;  2JQ6 A;  1DTL A;  1KWO B;  3TZ1 A;  1XFX O;  2L5X B;  4FTG A;  3PFV A;  2H2K A;  1A4P A;  3GOF A;  5AER A;  1YRT B;  4A4C A;  1UHH A;  1NPQ A;  2ZRS A;  1UHK A;  3EVU A;  4BY4 A;  5HLO A;  2M3W A;  5DKR A;  1C7W A;  4MZJ A;  5CSF A;  1DT7 B;  2LNK A;  3I5G B;  2OPO A;  2BE4 A;  2BKI B;  2M49 B;  3OB1 B;  4M2Q A;  1QX5 B;  2ZND A;  1QV0 A;  1B9A A;  3LLE A;  2L4I A;  1NCX A;  1A75 A;  1Y1U A;  2M0R A;  3FS7 A;  1RTP 1;  1M39 A;  1WDC B;  1DJZ A;  2V53 A;  2OS8 B;  2WC8 A;  3BQ3 A;  1V1F A;  1WRK A;  1S5G Z;  2EGD A;  1DF0 B;  2L0P A;  1CMF A;  1WY9 A;  3TS5 C;  2ZKM X;  1S1E A;  4MZK A;  2K2A A;  1F4O A;  1Q80 A;  3VRQ A;  1N2D A;  2KBI A;  1FBV A;  3NSL A;  4DRW A;  2G9B A;  5ER4 X;  1CKK A;  1TCF A;  5AXI A;  2MLE C;  4BY5 A;  1GJY A;  2JWW A;  4U8D A;  2AAO A;  2KI6 C;  3OP0 A;  1IQ3 A;  1YUU A;  3SJS A;  5JJG A;  1XFU O;  1FW4 A;  1XYD A;  1DJW A;  1SBJ A;  4FQO A;  1RK9 A;  4P5O E;  1JF2 A;  2NZ0 A;  4YGA A;  3TDI A;  1CFF A;  1NX0 A;  4NQG A;  1RJV A;  2LCP A;  1C07 A;  1KSM A;  1BR4 B;  1E8A A;  3KHE A;  4GNK B;  5TNC A;  1VRK A;  4JWQ A;  3OHM B;  3GK4 X;  2K2F A;  3TS5 B;  1OZO A;  3BUM B;  1JC2 A;  3DVJ A;  1JWD A;  1L2O C;  1CDM A;  2SAS A;  1DJI A;  1S6I A;  2CXJ A;  3RM1 A;  1B8R A;  5DKQ A;  1JF0 A;  1AP4 A;  1F4Q A;  2LHL A;  3I5I C;  2MHH A;  2Y1N A;  4I5K A;  2HET A;  1YX7 A;  4F0Z B;  1CTR A;  2CTN A;  3O78 A;  1X02 A;  5CSJ A;  2JU0 A;  5D69 A;  4YRU A;  4PE7 A;  5D7F A;  3EVR A;  5GQQ C;  1XK4 A;  1SCM B;  2A4J A;  1TNX A;  4GBA A;  1XO5 A;  1BLQ A;  1QIV A;  1ZAC A;  1BMO A;  1CLB A;  1IJ5 A;  1S26 D;  2B1U A;  4ICB A;  1WRL A;  4UPG A;  1H4B A;  1AVS A;  2K0J A;  1Y1A A;  1TTX A;  2GGM A;  1ZFS A;  2KGR A;  2KFF A;  1LVC D;  1DJG A;  3K21 A;  2GV5 A;  3ZWH A;  5J3X A;  4ETO A;  1W7J B;  1R6P A;  4OVN F;  3D0Y B;  1ZOT B;  1B1G A;  3SG5 A;  3O6B A;  1DF0 A;  3FIA A;  3OB2 B;  2FCD A;  3VRO A;  3EK8 A;  4MZL A;  2JXC A;  2KAX A;  3PAL A;  4C0J A;  1K96 A;  1CB1 A;  1S36 A;  4E68 A;  2H61 A;  3NSO A;  2M7L A;  2JTZ A;  4WRI A;  2M7N A;  3PAT A;  2CNP A;  1ZUZ A;  1KFU L;  1KWO C;  1K93 D;  1XK4 C;  1K90 D;  1QXP A;  3DD4 A;  4PAL A;  5AFP A;  2LUC A;  4HRE E;  1AK8 A;  2EC6 B;  1IJ6 A;  2RGI A;  1SMG A;  2KYC A;  4YGB B;  3EK4 A;  1NWD A;  1ZMZ A;  1RFJ A;  1XFY O;  3OX5 A;  1YTZ C;  1DJH A;  2L50 A;  1C7V A;  2NXQ A;  1J7O A;  1LA0 A;  4GGN A;  1KCY A;  5JOL A;  3I5G C;  4OKH A;  4DUQ A;  1DVI A;  5CSN A;  2MJW B;  2VRG A;  3CGA A;  2ZN9 A;  3EKJ A;  3O4Y A;  3H4S E;  1WDC C;  2LM5 A;  2OS8 C;  2JT0 A;  2KBM A;  1CM1 A;  2I18 A;  4C0L A;  2FOT A;  3EK7 A;  3VRN A;  4CID A;  4USL A;  2FCE A;  1M45 A;  1MWN A;  2L4H A;  4NDB A;  3BYA A;  2MAZ A;  1KFX S;  2H61 C;  1SW8 A;  3EVV A;  3QRX A;  1QLK A;  2EHB A;  1JFJ A;  2JT8 A;  1PVB A;  2CCM A;  4PHK A;  1A03 A;  4MN0 A;  3PSR A;  3NXA A;  1OE9 B;  3DVK A;  4GFT A;  2WCE A;  3I5F B;  2G2B A;  1PVA A;  1QVI Y;  1HT9 A;  1LXF C;  4Q04 A;  3GK1 A;  1NUB A;  5HLV A;  2LE9 B;  4CLN A;  1FI6 A;  1NX2 A;  1CM4 A;  4QJ5 B;  1TNP A;  1CDL A;  1AHR A;  1KSO A;  1G4Y R;  2KOT A;  3PN7 B;  1S6J A;  3CLN A;  3D0Y A;  1BR1 B;  4ORB B;  4CFR A;  5HKZ A;  3SG6 A;  1L7Z A;  2K7O A;  4GAO A;  2O5G A;  3I5H B;  1NYA A;  2HQW A;  1MF8 B;  4I5J A;  1CDP A;  1N65 A;  3WXA A;  4AQJ A;  1HQV A;  2Q91 A;  1AJ4 A;  3SG2 A;  1REC A;  2LLT A;  2QPT A;  1GQM A;  1QX7 A;  4NDD A;  1TNQ A;  3CZT X;  1J1D A;  1SCM C;  1OZS A;  1OQP A;  3DVM A;  1YUR A;  5HYD A;  3CTN A;  3WNX B;  1IGV A;  1K8U A;  1KK8 B;  2KNE A;  2WND A;  1B7T Y;  4XJK B;  5CSI A;  1DMO A;  2BL0 C;  3SIA A;  1J1E A;  4JPZ B;  2PAL A;  4PCW A;  1QAS A;  3SG3 A;  1BT6 A;  1EG3 A;  3GK2 A;  4M2P A;  2LAP A;  3NSK A;  1OOJ A;  1IKU A;  4MRY A;  4DIR A;  1LA3 A;  2KFH A;  3IF7 A;  3CR5 X;  1MXE A;  2JXL A;  2KSP A;  1J7P A;  2PAS A;  2ZNE A;  1XVJ A;  3CR4 X;  1KQV A;  2JNX A;  4CPV A;  2LMU A;  1J55 A;  1KK7 Y;  4GPL B;  4QJ4 B;  1TN4 A;  3JTD C;  2LHI A;  1QIW A;  2K61 A;  2PVB A;  2TN4 A;  1SL8 A;  2CT9 A;  1IWQ A;  2LMV A;  3KF9 A;  4DCK A;  1H8B A;  1FPW A;  2BL0 B;  3A8R A;  2Y5I A;  2LV7 A;  2K7C A;  2EC6 C;  3BUW B;  2KI6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...