4AQIA

Structure of human s100a15 bound to zinc and calcium
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PROTEIN S100-A7A
publication title Structural Characterization of S100A15 Reveals a Novel Zinc Coordination Site Among S100 Proteins and Altered Surface Chemistry with Functional Implications for Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4aqiA00
1BT6A 1SYMA 2KHNA 3BQ3A 1F4OA 3JTDC 1EG4A 3CS1A 2G2BA 5I2LA 3CLNA 1LVCD 2E6WA 1C7WA 5B8IB 4C0JA 2O5GA 4I5NB 2PASA 3KF9A 1SCMB 1KSMA 1CLMA 4WQ2A 1CB1A 1JUOA 2COLB 1K95A 3VRPA 4CFRA 2M0RA 1UHHA 3IF7A 2KBIA 3AAJA 4ETOA 1XK4A 3GOFA 1EXRA 3JVTB 3PM8A 1PRWA 1WLMA 1IJ5A 1ALVA 1XFYO 2LP2A 1MXLC 2BL0C 1CDNA 2KQ6A 5HYDA 4E68A 1M45A 3VRQA 1AJ4A 2BCXA 2HPSA 2OTGC 2ZRSA 1NCXA 2KFHA 1RJVA 2D8NA 2KI6D 3E3RA 3WHTB 3NSLA 1ZOTB 3AKBA 2AUCA 1B1GA 2K0JA 3BYAA 2HETA 2JNXA 1BR1B 4I5KA 1EH2A 1KQMB 1PVBA 4GPLB 1A2XA 4UPGA 3NSIA 4L9MA 2F33A 1JC2A 4AQIA 4ICBA 3D0YB 2MRDA 3WNXB 1TNWA 1K9KA 1IJ6A 3OX5A 2Y5IA 4PHKA 4PE0A 5ER5A 2L0PA 2M9GA 5BPJA 1BG1A 2F3YA 2MAZA 2BBNA 3TUYC 3PFVA 2GV5A 2A4JA 4MBEA 1V1GA 4JWQA 2HQWA 2LE9B 4BY4A 1TTXA 1XVJA 4C0KA 1DGVA 3IQOA 1BF5A 1TN4A 1AK8A 1XO5A 4MSPA 2K61A 2O60A 1CM4A 1E8AA 2KGBC 5K89A 3EK4A 3C1VA 3WXAA 1RFJA 4A4CA 1QS7A 2KOTA 1SR6C 2JT3A 1QIWA 2JNFA 2CT9A 1L2OB 2ZN8A 1UWOA 3CZTX 3LK0A 3RM1A 2NZ0A 5JOLA 4NQGA 1WRZA 1WDCC 1SL9A 3PALA 4MRXA 2BECA 2KFFA 2QPTA 1L7ZA 4GBAA 1DF0A 2LHIA 1MWNA 1V1FA 4AQJA 2WORA 2PSRA 1UUSA 1CDPA 4R1EA 1EJ3A 2LVIA 1J1EA 1HT9A 3O78A 1DT7B 3BOWA 3NSOA 1CFPA 2LV7A 2M97A 1KFUL 1M39A 2QACA 4YGEB 4OCIA 1CNPA 1CLBA 4GGFC 4HREE 2B1UA 1S3PA 1YVHA 5AERA 1GQMA 2BE4A 1CKKA 1S36A 1K9PA 4PHMA 2BBMA 4XJKB 5TNCA 3K21A 2RGIA 3CR2A 4QJ5B 1F54A 5DKQA 3OX6A 1DJZA 1NX2A 1S6CA 1N2DA 4DRWA 1WLZA 4MZJA 4QJ4B 2KAYA 1IRJA 1MR8A 1CDMA 3TDUA 1NX1A 1QLSA 2KQYA 1RECA 2LM5A 2EC6B 1M31A 1QJTA 1DMOA 1DJWA 1RWYA 1K93D 5CSJA 1SW8A 1QV0A 3SG2A 1PVAA 1S1EA 3I5GC 3ZNIA 1SKTA 3ICBA 2OS8C 4N1GA 3BXKA 1B8LA 4GGNA 2KGRA 1SRAA 3CGAA 3TZ1A 1FI5A 1A4PA 1XYDA 3SIAA 4YI8A 2KDHA 2L50A 1JWDA 3SIBA 1K96A 3SG7A 3EKHA 1XFXO 1A29A 1MHOA 2LVKA 2FOTA 1TIZA 1OSAA 4OV2A 4XYNA 2ZN9A 1WRKA 4JPZB 4MZKA 4N1FA 4HRHA 1PSBA 1AHRA 2KI4B 5CPVA 1CDLA 1ALWA 2L51A 5JJGA 1IQ3A 3FWCA 2I7AA 4U8DA 5AEQA 3RLZA 2JTZA 4PHJA 3HX4A 5GQQC 2I94A 2CTNA 1LA0A 1Y6WA 2LMUA 1M46A 4GGFA 5I2OA 2KAXA 2NLNA 1SPYA 2H2KA 1PALA 2L4HA 3EKJA 1S6JA 2WC8A 1OMRA 2WCFA 1S6IA 2JXLA 5D69A 2KAVA 1F71A 2MLFC 3M0WA 4HRGA 2FCDA 1KK8B 3PN7B 4Q04A 4OR9B 2M7LA 3CTNA 1MUXA 1A75A 2M49B 3A8RA 3TS5B 3I5HB 2PALA 1TCFA 1EL4A 1KFUS 1OZOA 4MRYA 2L98A 3SG6A 1J7OA 1QLKA 1TNPA 3FWBA 2LHLA 2WCEA 4GUKA 1IGVA 1QX7A 3EVUA 1NWDA 1PSRA 1XFWO 3O2PA 1SCMC 2K7BA 2EGDA 5KSZA 2E30A 1U5IA 5KTYA 1A03A 3LL8B 4M2QA 3JVTC 3IQQA 1BU3A 3VRNA 2Y4QA 2JC2A 1LKJA 2G9BA 1NPQA 2P6BB 2JZIA 2M1KB 4PE4A 2ISDA 2LCPA 1XFUO 3EVVA 3O4YA 3BUXB 3I5FB 4NDBA 4YI9A 4ORAB 4CLNA 2JXCA 1BMOA 1KQMC 3GK1A 1KK8C 1SCVA 2M7NA 1Y1XA 1VRKA 3WHUB 1YURA 2PVBA 5F6TA 5IBWA 2CBLA 3VROA 1NX3A 1R2UA 4MZLA 2K2AA 2LLSA 3SJSA 1C07A 4FQOA 3I5HC 3OHMB 1XFVO 3PATA 1Y1UA 1MF8B 1PK0D 1PULA 3KO0A 4JQ0D 2F2PA 2SASA 1WY9A 2NCOA 4F0ZB 1A75B 1UP5A 1BR4B 1MXEA 1EG3A 3FIAA 4PE7A 2TN4A 1IG5A 1QV1A 1LA3A 5HKZA 1QASA 1LINA 2F2OA 2CCMA 1JSAA 2M8UA 1B7TY 3DVMA 1JFKA 1QXPA 3A4UB 2JWWA 4MVFA 1L2OC 4D1EA 4IL1A 2LLUA 2LANA 1ZACA 1KWOB 2KYFA 1KCYA 5HKYA 1AVSA 1SL8A 1CFFA 2JU0A 2JT0A 2L2EA 3KEVA 5D7FA 2PRUA 3OB2B 3KPXA 2NCPA 2GGMA 2NXQA 1NP8A 1DJXA 1OMDA 1S26D 4PDZA 1DVIA 1DJIA 1UHIA 3BUNB 1UURA 1B7TZ 1NYAA 4QJ3B 2IS9A 1J55A 4MEWA 2LAPA 4PALA 5CSIA 1QATA 3NXAA 2F8PA 1DF0B 2R2IA 3LCPC 3MSEB 2KBMA 3DVEA 5HLOA 1QVIY 1YUSA 2L4IA 2MJWB 3BOWB 3DVJA 2MA2A 1B47A 2MHHA 1H8BA 1XA5A 5J3XA 4PE1A 1SNLA 4GFTA 4AOMA 2M3WA 2JULA 1TRFA 2DOQA 4I5JA 1UHNA 1KFXL 1Y1AA 2AAOA 2H61C 1YUUA 2K7CA 2PMYA 4N5XA 4C0LA 1FF1A 2BL0B 1K94A 3OB1B 1NX0A 1DJYA 5I8NA 4YRUA 2EC6C 2OTGB 3D0YA 4OVNF 1JBAA 1K90D 1YRUB 1QVIZ 2FCEA 2HQ8A 3PSRA 2KSPA 3LLEA 5G08A 3H4SE 1ODBA 2ZNEA 4ORBB 3SG5A 1B9AA 1OZSA 1IKUA 1OQPA 3BUOB 3AKAA 1D1OA 1JF0A 2I2RE 1K2HA 1K9UA 3SG4A 4YGDB 2LNKA 2OPOA 2Y1MA 3KHEA 1FI6A 1J7RA 3TUYB 4WQ3A 3SG3A 1G4YR 5AFPA 1CTRA 2K7DA 2LVVA 3F45A 2M1UA 5KU1A 3DF0A 3VGOA 3NSKA 1XFZO 2Q4UA 3BUMB 4OKHA 1JFJA 4YGBB 1SR6B 2F3ZA 1SBJA 2ZKMX 4DIRA 1G33A 2KI4C 4NDDA 1NCZA 3TDIA 3EK7A 4DUQA 3EK8A 1NIWA 1JF2A 1R6PA 1WDCB 4DS7A 2JOJA 1GGWA 2LVJA 2K7OA 1SK6D 1FBVA 3TDZA 4CFQA 1DTLA 3CR4X 1BOCA 3O6BA 1AP4A 2KFGA 1QX2A 2KYCA 4XJKA 4ZCUA 2LUXA 4GNKB 2LP3A 4YGCB 3VRRA 3D10A 3PLFB 2CNPA 1KK7Y 1B8CA 1YX8A 2KI6C 1RROA 4I5LB 5AXIA 2JPTA 1M63B 1RTP1 3PN7C 2I18A 2HF5A 1DJGA 2H61A 1C7VA 3DVKA 3I5IB 1F4QA 1F8HA 3TS5C 1CFDA 1OE9B 2MBXA 1W7IB 1BLQA 5DKRA 2CXJA 1NUBA 1Q80A 1YTZC 3DF0B 2WCBA 4TNCA 2LMVA 1QTXA 3ZWHA 2LMTA 2LC5A 1HQVA 2BKHB 4HSZA 1YR5A 1N65A 1KK7Z 4CPVA 5HKWA 2BKIB 4P2YB 1OMVA 4P5OE 1KSOA 2JRFA 1KFXS 1YVLA 3BUWB 2MLEC 4YGAA 2AMIA 1OOJA 4MN0A 3I5GB 2ZFDA 1J1DA 1MQ1A 1U5IB 1ZMZA 2OS8B 3FS7A 4FTGA 1X02A 1XK4C 1AJ5A 3I5FC 1Y0VH 1SMGA 2GGZA 1QX5B 3EVRA 5FYXA 2FJUB 1N0YA 1UHJA 3AAKA 5CSNA 1SY9A 1NCYA 2Y1NA 2WNDA 2L5XB 2K2FA 4GAOA 1KQVA 3I5IC 1CM1A 4WRIA 5DKNA 5HLVA 2ZNDA 1S5GY 1CFCA 4DCKA 1WRLA 2V53A 1W7JB 4NDCA 3GK4X 2EHBA 1YX7A 1NSHA 1F70A 3DD4A 1K8UA 3HCMA 5AANA 5I2QA 4USLA 3OP0A 5CSFA 2JT8A 1B4CA 1TCOB 3JTDB 1RK9A 4ORCB 5ER4X 1CMGA 3CR5X 4PCWA 3GK2A 1IWQA 1BODA 2KNEA 1QIVA 4YBHB 4MLWA 3LK1A 5PALA 1TNXA 1CMFA 4M2PA 1B8RA 1GJYA 1KWOC 1S5GZ 2Q91A 1J7QA 1UHKA 2LLTA 1TNQA 1DGUA 1J7PA 1YUTA 1CLLA 1SL7A 4M2OA 1G8IA 1BJFA 1LXFC 2WOSA 1AUIB 2LUCA 4PHNA 1IQ5A 2VRGA 1IH0A 1ZUZA 1DJHA 2SCPA 2BCAA 2JQ6A 3CWGA 1ZFSA 1TOPA 4BY5A 1H4BA 1GGZA 1FW4A 1F55A 2JTTA 2BCBA 2K8MB 1YRTB 3QRXA 2BE6A 4ZCVA 2ZRTA 4A4BA 4CIDA 2M29A 1FPWA
chains in the Genus database with same CATH superfamily
1BT6A 1SYMA 2KHNA 3BQ3A 5HL1A 1F4OA 3JTDC 1EG4A 3CS1A 2G2BA 5I2LA 3CLNA 1LVCD 2E6WA 1C7WA 5B8IB 4C0JA 2O5GA 4I5NB 2PASA 3KF9A 1SCMB 1KSMA 1CLMA 4WQ2A 1CB1A 1JUOA 1OOIX 2COLB 1K95A 5EL2A 3VRPA 4CFRA 2M0RA 2QEOA 1UHHA 3IF7A 2KBIA 3AAJA 4ETOA 1XK4A 3GOFA 1EXRA 3JVTB 3PM8A 1PRWA 1WLMA 1IJ5A 1ALVA 2BNXA 1XFYO 2L5YA 2LP2A 3FE6A 1MXLC 2BL0C 1CDNA 2KPHA 2KQ6A 5HYDA 4E68A 1M45A 3VRQA 1AJ4A 2BCXA 5I94A 2HPSA 2KLDA 2OTGC 2ZRSA 1NCXA 2KFHA 1RJVA 2D8NA 2KI6D 3E3RA 3WHTB 3NSLA 1ZOTB 3AKBA 2AUCA 1B1GA 2K0JA 3BYAA 2HETA 2JNXA 1BR1B 4I5KA 1EH2A 1KQMB 1PVBA 4GPLB 1A2XA 4UPGA 3NSIA 4L9MA 2F33A 3K1EA 1JC2A 4AQIA 4ICBA 3D0YB 2MRDA 2P71A 3WNXB 1TNWA 1K9KA 1IJ6A 3OX5A 2Y5IA 4PHKA 4PE0A 5ER5A 2L0PA 2M9GA 5BPJA 1BG1A 2F3YA 2MAZA 2BBNA 3TUYC 3PFVA 2GV5A 2A4JA 4MBEA 1V1GA 4JWQA 2HQWA 2LE9B 3FE9A 1TTXA 1XVJA 3V2LA 4BY4A 4C0KA 1DGVA 3IQOA 1BF5A 1TN4A 1AK8A 1XO5A 4MSPA 2K61A 2O60A 1CM4A 1OOFA 1E8AA 2KGBC 5K89A 3EK4A 3C1VA 3WXAA 1RFJA 3SS4A 4A4CA 3BJHA 1QS7A 2KOTA 1SR6C 2JT3A 1QIWA 2JNFA 2CT9A 1L2OB 2ZN8A 1UWOA 3CZTX 3LK0A 3RM1A 1QWVA 2NZ0A 5JOLA 2K60A 4NQGA 1WRZA 2ERBA 1WDCC 2YGUA 1SL9A 3PALA 4MRXA 2BECA 2KFFA 2QPTA 1L7ZA 4GBAA 1DF0A 2LHIA 1MWNA 3B86A 1V1FA 4AQJA 2WORA 2PSRA 1UUSA 3D76A 1CDPA 4FQTA 4R1EA 1EJ3A 2LVIA 1J1EA 1HT9A 3O78A 1DT7B 3BOWA 3NSOA 1CFPA 2LV7A 2M97A 1KFUL 1M39A 2QACA 3D77A 4OCIA 4YGEB 1CNPA 4GGFC 4HREE 1CLBA 2B1UA 1S3PA 1YVHA 5AERA 2H8VA 1GQMA 2WCJA 2BE4A 1CKKA 1S36A 1K9PA 4PHMA 2BBMA 4XJKB 5TNCA 3K21A 2RGIA 3CR2A 3CYZA 4QJ5B 1F54A 3B87A 3OX6A 5DKQA 1DJZA 3NGVA 1NX2A 1S6CA 3S0EA 1N2DA 4DRWA 1WLZA 1OOGA 4JD9A 2KAYA 4MZJA 3S0BA 4QJ4B 1IRJA 1MR8A 1CDMA 3TDUA 1NX1A 1QLSA 2KQYA 1RECA 2LM5A 1DEKA 2EC6B 1DC1A 1M31A 1QJTA 1DMOA 1DJWA 1RWYA 1K93D 5CSJA 1SW8A 1QV0A 3SG2A 1PVAA 1S1EA 3I5GC 3ZNIA 1OW4A 1SKTA 3ICBA 2OS8C 4N1GA 3BXKA 1B8LA 4GGNA 2KGRA 1SRAA 3CGAA 3TZ1A 1FI5A 1A4PA 1XYDA 3SIAA 4YI8A 2KDHA 2L50A 3N7HA 1JWDA 3SIBA 1K96A 3SG7A 3EKHA 3CABA 1XFXO 1A29A 1MHOA 2LVKA 2FOTA 1TIZA 1OSAA 1Z2CB 4OV2A 4XYNA 2WC6A 2ZN9A 1WRKA 4JPZB 2JPOA 4MZKA 4N1FA 4HRHA 1PSBA 1AHRA 2KI4B 3S0GA 5CPVA 1CDLA 1ALWA 2L51A 5JJGA 1IQ3A 3FWCA 2I7AA 4U8DA 5AEQA 3UO9A 3RLZA 2JTZA 4PHJA 3HX4A 3BFAA 2I94A 5GQQC 3CZ2A 2CTNA 1LA0A 1Y6WA 3CZ1A 2LMUA 1M46A 4GGFA 5I2OA 2KAXA 2L2CA 2NLNA 2WCMA 1SPYA 2H2KA 1SSEB 1PALA 2L4HA 3VB1A 3EKJA 1S6JA 2QEHA 2WC8A 1OMRA 2WCFA 3OGNA 3D75A 1S6IA 2JXLA 5D69A 2KAVA 3SS5A 3B6XA 1IIOA 1F71A 1LS8A 2MLFC 3M0WA 4HRGA 2FCDA 3UNWA 1KK8B 3PN7B 4Q04A 4OR9B 2M7LA 3CTNA 1MUXA 4INWA 2PYQA 1A75A 2M49B 2WCHA 3A8RA 3TS5B 3I5HB 2PALA 1TCFA 1EL4A 1KFUS 1OZOA 3PJIA 4MRYA 3S0AA 2L98A 3SG6A 1J7OA 1QLKA 1TNPA 3FWBA 2LHLA 2WCEA 4GUKA 1IGVA 3QMEA 1QX7A 3EVUA 1NWDA 1PSRA 1XFWO 3O2PA 3O4XA 1SCMC 2K7BA 2P70A 2EGDA 5KSZA 3PM2A 2E30A 1U5IA 5KTYA 1A03A 3LL8B 4M2QA 3JVTC 3IQQA 1BU3A 3VRNA 2Y4QA 2JC2A 1LKJA 2G9BA 1OOHA 1NPQA 2P6BB 2JZIA 2M1KB 4PE4A 2ISDA 2LCPA 1XFUO 3EVVA 3O4YA 3BUXB 3I5FB 4NDBA 4YI9A 4ORAB 4CLNA 2JXCA 1BMOA 1KQMC 3GK1A 1KK8C 1SCVA 2M7NA 1Y1XA 1VRKA 3WHUB 1YURA 2PVBA 5F6TA 5IBWA 2CBLA 3VROA 1NX3A 1R2UA 4MZLA 2K2AA 2LLSA 3SJSA 1C07A 4FQOA 3I5HC 3OHMB 1XFVO 3D73A 3PATA 1Y1UA 4IJ7A 1MF8B 1PK0D 1PULA 3KO0A 4JQ0D 2F2PA 2SASA 1WY9A 2NCOA 4F0ZB 1A75B 1UP5A 1BR4B 4F7FA 1MXEA 1EG3A 3FIAA 4PE7A 2TN4A 2QEVA 1IG5A 1QV1A 1LA3A 5HKZA 1QASA 3D78A 1LINA 2F2OA 2CCMA 1JSAA 2M8UA 1B7TY 5FI6A 3DVMA 1JFKA 1QXPA 3A4UB 2JWWA 4MVFA 1L2OC 4D1EA 4IL1A 2LLUA 2LANA 1ZACA 1KWOB 2KYFA 1KCYA 5HKYA 1AVSA 1SL8A 1CFFA 2JU0A 2JT0A 2L2EA 3KEVA 5D7FA 2WC5A 2PRUA 3OB2B 3KPXA 2NCPA 2GGMA 2NXQA 1NP8A 1DJXA 1OMDA 1S26D 4PDZA 1DVIA 1DJIA 1UHIA 3BUNB 1UURA 1B7TZ 1NYAA 4QJ3B 2IS9A 1J55A 4MEWA 2LAPA 3BFHA 4PALA 5CSIA 1QATA 1T14A 2F8PA 3NXAA 1DF0B 2R2IA 3LCPC 3MSEB 2KBMA 3DVEA 5HLOA 1C3YA 1QVIY 1YUSA 4KYNA 2L4IA 2MJWB 3BOWB 3DVJA 2MA2A 3EG5B 1B47A 2MHHA 4PT1A 1XA5A 1H8BA 3DXLA 5J3XA 4PE1A 1SNLA 3FE8A 4GFTA 3NHTA 2M3WA 3NHIA 2JULA 4AOMA 1TRFA 2DOQA 4I5JA 1UHNA 1KFXL 1Y1AA 2AAOA 2H61C 1YUUA 2K7CA 2PMYA 3L4LA 4N5XA 4C0LA 1FF1A 2BL0B 1K94A 3OB1B 1NX0A 1DJYA 1TUJA 4YRUA 5I8NA 5D3OA 2EC6C 2OTGB 3D0YA 4OVNF 1JBAA 1K90D 1YRUB 1QVIZ 2FCEA 3R1OA 2HQ8A 3PSRA 2KSPA 3LLEA 3Q8IA 3H4SE 5G08A 1ODBA 5FI7A 1W9ZA 2ZNEA 4ORBB 1B9AA 3SG5A 1OZSA 1IKUA 3BFBA 1OQPA 3BUOB 3AKAA 1D1OA 5FI2A 1JF0A 2I2RE 1K2HA 1K9UA 3SG4A 4YGDB 2LNKA 2OPOA 2Y1MA 3KHEA 1FI6A 1J7RA 3TUYB 4WQ3A 3SG3A 1G4YR 5AFPA 1CTRA 3CDNA 2K7DA 2LVVA 3F45A 2M1UA 5KU1A 3DF0A 3VGOA 1TWOA 3NSKA 1XFZO 2Q4UA 3BUMB 4OKHA 1JFJA 4YGBB 1SR6B 1P28A 2F3ZA 1SBJA 2ZKMX 3R1PA 4DIRA 1G33A 2KI4C 4NDDA 1NCZA 3TDIA 3EK7A 4DUQA 3EK8A 1NIWA 3D74A 2QEBA 1TUZA 1JF2A 1R6PA 1WDCB 4DS7A 2JOJA 1GGWA 2LVJA 3S0FA 2K7OA 1SK6D 1FBVA 3TDZA 4CFQA 1DELA 1DTLA 3CR4X 1BOCA 3O6BA 1AP4A 2KFGA 1Z4HA 1QX2A 2KYCA 4XJKA 4ZCUA 2LUXA 4INXA 4GNKB 2LP3A 4YGCB 3VRRA 3D10A 3PLFB 2CNPA 3B88A 1KK7Y 1B8CA 1YX8A 2KI6C 1RROA 4I5LB 5AXIA 2JPTA 1M63B 1RTP1 3IVTA 2I18A 2HF5A 3PN7C 3R1VA 3R72A 3DYEA 1DJGA 2H61A 1C7VA 3DVKA 3I5IB 1F4QA 2BAPA 1F8HA 3TS5C 1CFDA 1OE9B 1C3ZA 2MBXA 1W7IB 1BLQA 5DKRA 2CXJA 1NUBA 1Q80A 1YTZC 3DF0B 2WCBA 4TNCA 2LMVA 1QTXA 3ZWHA 2LMTA 2LC5A 1XFRA 1HQVA 2BKHB 4HSZA 1YR5A 1N65A 1KK7Z 2QDIA 2WCKA 4CPVA 5HKWA 2BKIB 4P2YB 1OMVA 1ORGA 1KSOA 4P5OE 2JRFA 2PQLA 3L4AA 1KFXS 3OBVA 1YVLA 3BUWB 2MLEC 4YGAA 2AMIA 1OOJA 4MN0A 1GM0A 3I5GB 2ZFDA 1J1DA 1MQ1A 1U5IB 1ZMZA 2OS8B 3FS7A 4FTGA 1X02A 1XK4C 1AJ5A 2GTEA 3I5FC 1Y0VH 1SMGA 2GGZA 1QX5B 3EVRA 5FYXA 2FJUB 1N0YA 1UHJA 3AAKA 5CSNA 1SY9A 1NCYA 2Y1NA 3L47A 2WNDA 2L5XB 2K2FA 4GAOA 1KQVA 3I5IC 1CM1A 4WRIA 5DKNA 5HLVA 2ZNDA 1S5GY 1CFCA 4DCKA 1WRLA 2V53A 1W7JB 2WCLA 3CZ0A 3GK4X 2EHBA 1YX7A 4NDCA 1NSHA 1F70A 3DD4A 1K8UA 3HCMA 5AANA 5I2QA 4USLA 3OP0A 5CSFA 2JT8A 5DICA 1B4CA 1TCOB 3JTDB 1DQEA 1RK9A 4ORCB 5ER4X 1CMGA 3CR5X 4PCWA 3GK2A 1IWQA 1BODA 2KNEA 3RZSA 1QIVA 2KLEA 3DZTA 4MLWA 4YBHB 3LK1A 5PALA 1TNXA 1CMFA 4M2PA 1B8RA 1GJYA 1KWOC 3SS3A 1S5GZ 2Q91A 1J7QA 1UHKA 4JKTA 2LLTA 1TNQA 1DGUA 1J7PA 1YUTA 1CLLA 1SL7A 3B7AA 4M2OA 1G8IA 1BJFA 1LXFC 2WOSA 1AUIB 2LUCA 4PHNA 1IQ5A 4OZDA 2VRGA 3S0DA 1ZUZA 1DJHA 2SCPA 1IH0A 2BCAA 2JQ6A 3CWGA 1ZFSA 1TOPA 3DY9A 4BY5A 1H4BA 1GGZA 1FW4A 1F55A 2JTTA 2BCBA 2K8MB 1YRTB 3QRXA 2BE6A 4ZCVA 2ZRTA 4A4BA 4CIDA 2M29A 2FJYA 1FPWA
chains in the Genus database with same CATH topology
1BT6A 1SYMA 2KHNA 3BQ3A 1F4OA 3JTDC 1EG4A 3CS1A 2G2BA 5I2LA 3CLNA 1LVCD 2E6WA 1C7WA 5B8IB 4C0JA 2O5GA 4I5NB 2PASA 3KF9A 1SCMB 1KSMA 1CLMA 4WQ2A 1CB1A 1JUOA 2COLB 1K95A 3VRPA 4CFRA 2M0RA 1UHHA 3IF7A 2KBIA 3AAJA 4ETOA 1XK4A 3GOFA 1EXRA 3JVTB 3PM8A 1PRWA 1WLMA 1IJ5A 1ALVA 1XFYO 2LP2A 1MXLC 2BL0C 1CDNA 2KQ6A 5HYDA 4E68A 1M45A 3VRQA 1AJ4A 2BCXA 2HPSA 2OTGC 2ZRSA 1NCXA 2KFHA 1RJVA 2D8NA 2KI6D 3E3RA 3WHTB 3NSLA 1ZOTB 3AKBA 2AUCA 1B1GA 2K0JA 3BYAA 2HETA 2JNXA 1BR1B 4I5KA 1EH2A 1KQMB 1PVBA 4GPLB 1A2XA 4UPGA 3NSIA 4L9MA 2F33A 1JC2A 4AQIA 4ICBA 3D0YB 2MRDA 3WNXB 1TNWA 1K9KA 1IJ6A 3OX5A 2Y5IA 4PHKA 4PE0A 5ER5A 2L0PA 2M9GA 5BPJA 1BG1A 2F3YA 2MAZA 2BBNA 3TUYC 3PFVA 2GV5A 2A4JA 4MBEA 1V1GA 4JWQA 2HQWA 2LE9B 4BY4A 1TTXA 1XVJA 4C0KA 1DGVA 3IQOA 1BF5A 1TN4A 1AK8A 1XO5A 4MSPA 2K61A 2O60A 1CM4A 1E8AA 2KGBC 5K89A 3EK4A 3C1VA 3WXAA 1RFJA 4A4CA 1QS7A 2KOTA 1SR6C 2JT3A 1QIWA 2JNFA 2CT9A 1L2OB 2ZN8A 1UWOA 3CZTX 3LK0A 3RM1A 2NZ0A 5JOLA 4NQGA 1WRZA 1WDCC 1SL9A 3PALA 4MRXA 2BECA 2KFFA 2QPTA 1L7ZA 4GBAA 1DF0A 2LHIA 1MWNA 1V1FA 4AQJA 2WORA 2PSRA 1UUSA 1CDPA 4R1EA 1EJ3A 2LVIA 1J1EA 1HT9A 3O78A 1DT7B 3BOWA 3NSOA 1CFPA 2LV7A 2M97A 1KFUL 1M39A 2QACA 4YGEB 4OCIA 1CNPA 1CLBA 4GGFC 4HREE 2B1UA 1S3PA 1YVHA 5AERA 1GQMA 2BE4A 1CKKA 1S36A 1K9PA 4PHMA 2BBMA 4XJKB 5TNCA 3K21A 2RGIA 3CR2A 4QJ5B 1F54A 5DKQA 3OX6A 1DJZA 1NX2A 1S6CA 1N2DA 4DRWA 1WLZA 4MZJA 4QJ4B 2KAYA 1IRJA 1MR8A 1CDMA 3TDUA 1NX1A 1QLSA 2KQYA 1RECA 2LM5A 2EC6B 1M31A 1QJTA 1DMOA 1DJWA 1RWYA 1K93D 5CSJA 1SW8A 1QV0A 3SG2A 1PVAA 1S1EA 3I5GC 3ZNIA 1SKTA 3ICBA 2OS8C 4N1GA 3BXKA 1B8LA 4GGNA 2KGRA 1SRAA 3CGAA 3TZ1A 1FI5A 1A4PA 1XYDA 3SIAA 4YI8A 2KDHA 2L50A 1JWDA 3SIBA 1K96A 3SG7A 3EKHA 1XFXO 1A29A 1MHOA 2LVKA 2FOTA 1TIZA 1OSAA 4OV2A 4XYNA 2ZN9A 1WRKA 4JPZB 4MZKA 4N1FA 4HRHA 1PSBA 1AHRA 2KI4B 5CPVA 1CDLA 1ALWA 2L51A 5JJGA 1IQ3A 3FWCA 2I7AA 4U8DA 5AEQA 3RLZA 2JTZA 4PHJA 3HX4A 5GQQC 2I94A 2CTNA 1LA0A 1Y6WA 2LMUA 1M46A 4GGFA 5I2OA 2KAXA 2NLNA 1SPYA 2H2KA 1PALA 2L4HA 3EKJA 1S6JA 2WC8A 1OMRA 2WCFA 1S6IA 2JXLA 5D69A 2KAVA 1F71A 2MLFC 3M0WA 4HRGA 2FCDA 1KK8B 3PN7B 4Q04A 4OR9B 2M7LA 3CTNA 1MUXA 1A75A 2M49B 3A8RA 3TS5B 3I5HB 2PALA 1TCFA 1EL4A 1KFUS 1OZOA 4MRYA 2L98A 3SG6A 1J7OA 1QLKA 1TNPA 3FWBA 2LHLA 2WCEA 4GUKA 1IGVA 1QX7A 3EVUA 1NWDA 1PSRA 1XFWO 3O2PA 1SCMC 2K7BA 2EGDA 5KSZA 2E30A 1U5IA 5KTYA 1A03A 3LL8B 4M2QA 3JVTC 3IQQA 1BU3A 3VRNA 2Y4QA 2JC2A 1LKJA 2G9BA 1NPQA 2P6BB 2JZIA 2M1KB 4PE4A 2ISDA 2LCPA 1XFUO 3EVVA 3O4YA 3BUXB 3I5FB 4NDBA 4YI9A 4ORAB 4CLNA 2JXCA 1BMOA 1KQMC 3GK1A 1KK8C 1SCVA 2M7NA 1Y1XA 1VRKA 3WHUB 1YURA 2PVBA 5F6TA 5IBWA 2CBLA 3VROA 1NX3A 1R2UA 4MZLA 2K2AA 2LLSA 3SJSA 1C07A 4FQOA 3I5HC 3OHMB 1XFVO 3PATA 1Y1UA 1MF8B 1PK0D 1PULA 3KO0A 4JQ0D 2F2PA 2SASA 1WY9A 2NCOA 4F0ZB 1A75B 1UP5A 1BR4B 1MXEA 1EG3A 3FIAA 4PE7A 2TN4A 1IG5A 1QV1A 1LA3A 5HKZA 1QASA 1LINA 2F2OA 2CCMA 1JSAA 2M8UA 1B7TY 3DVMA 1JFKA 1QXPA 3A4UB 2JWWA 4MVFA 1L2OC 4D1EA 4IL1A 2LLUA 2LANA 1ZACA 1KWOB 2KYFA 1KCYA 5HKYA 1AVSA 1SL8A 1CFFA 2JU0A 2JT0A 2L2EA 3KEVA 5D7FA 2PRUA 3OB2B 3KPXA 2NCPA 2GGMA 2NXQA 1NP8A 1DJXA 1OMDA 1S26D 4PDZA 1DVIA 1DJIA 1UHIA 3BUNB 1UURA 1B7TZ 1NYAA 4QJ3B 2IS9A 1J55A 4MEWA 2LAPA 4PALA 5CSIA 1QATA 3NXAA 2F8PA 1DF0B 2R2IA 3LCPC 3MSEB 2KBMA 3DVEA 5HLOA 1QVIY 1YUSA 2L4IA 2MJWB 3BOWB 3DVJA 2MA2A 1B47A 2MHHA 1H8BA 1XA5A 5J3XA 4PE1A 1SNLA 4GFTA 4AOMA 2M3WA 2JULA 1TRFA 2DOQA 4I5JA 1UHNA 1KFXL 1Y1AA 2AAOA 2H61C 1YUUA 2K7CA 2PMYA 4N5XA 4C0LA 1FF1A 2BL0B 1K94A 3OB1B 1NX0A 1DJYA 5I8NA 4YRUA 2EC6C 2OTGB 3D0YA 4OVNF 1JBAA 1K90D 1YRUB 1QVIZ 2FCEA 2HQ8A 3PSRA 2KSPA 3LLEA 5G08A 3H4SE 1ODBA 2ZNEA 4ORBB 3SG5A 1B9AA 1OZSA 1IKUA 1OQPA 3BUOB 3AKAA 1D1OA 1JF0A 2I2RE 1K2HA 1K9UA 3SG4A 4YGDB 2LNKA 2OPOA 2Y1MA 3KHEA 1FI6A 1J7RA 3TUYB 4WQ3A 3SG3A 1G4YR 5AFPA 1CTRA 2K7DA 2LVVA 3F45A 2M1UA 5KU1A 3DF0A 3VGOA 3NSKA 1XFZO 2Q4UA 3BUMB 4OKHA 1JFJA 4YGBB 1SR6B 2F3ZA 1SBJA 2ZKMX 4DIRA 1G33A 2KI4C 4NDDA 1NCZA 3TDIA 3EK7A 4DUQA 3EK8A 1NIWA 1JF2A 1R6PA 1WDCB 4DS7A 2JOJA 1GGWA 2LVJA 2K7OA 1SK6D 1FBVA 3TDZA 4CFQA 1DTLA 3CR4X 1BOCA 3O6BA 1AP4A 2KFGA 1QX2A 2KYCA 4XJKA 4ZCUA 2LUXA 4GNKB 2LP3A 4YGCB 3VRRA 3D10A 3PLFB 2CNPA 1KK7Y 1B8CA 1YX8A 2KI6C 1RROA 4I5LB 5AXIA 2JPTA 1M63B 1RTP1 3PN7C 2I18A 2HF5A 1DJGA 2H61A 1C7VA 3DVKA 3I5IB 1F4QA 1F8HA 3TS5C 1CFDA 1OE9B 2MBXA 1W7IB 1BLQA 5DKRA 2CXJA 1NUBA 1Q80A 1YTZC 3DF0B 2WCBA 4TNCA 2LMVA 1QTXA 3ZWHA 2LMTA 2LC5A 1HQVA 2BKHB 4HSZA 1YR5A 1N65A 1KK7Z 4CPVA 5HKWA 2BKIB 4P2YB 1OMVA 4P5OE 1KSOA 2JRFA 1KFXS 1YVLA 3BUWB 2MLEC 4YGAA 2AMIA 1OOJA 4MN0A 3I5GB 2ZFDA 1J1DA 1MQ1A 1U5IB 1ZMZA 2OS8B 3FS7A 4FTGA 1X02A 1XK4C 1AJ5A 3I5FC 1Y0VH 1SMGA 2GGZA 1QX5B 3EVRA 5FYXA 2FJUB 1N0YA 1UHJA 3AAKA 5CSNA 1SY9A 1NCYA 2Y1NA 2WNDA 2L5XB 2K2FA 4GAOA 1KQVA 3I5IC 1CM1A 4WRIA 5DKNA 5HLVA 2ZNDA 1S5GY 1CFCA 4DCKA 1WRLA 2V53A 1W7JB 4NDCA 3GK4X 2EHBA 1YX7A 1NSHA 1F70A 3DD4A 1K8UA 3HCMA 5AANA 5I2QA 4USLA 3OP0A 5CSFA 2JT8A 1B4CA 1TCOB 3JTDB 1RK9A 4ORCB 5ER4X 1CMGA 3CR5X 4PCWA 3GK2A 1IWQA 1BODA 2KNEA 1QIVA 4YBHB 4MLWA 3LK1A 5PALA 1TNXA 1CMFA 4M2PA 1B8RA 1GJYA 1KWOC 1S5GZ 2Q91A 1J7QA 1UHKA 2LLTA 1TNQA 1DGUA 1J7PA 1YUTA 1CLLA 1SL7A 4M2OA 1G8IA 1BJFA 1LXFC 2WOSA 1AUIB 2LUCA 4PHNA 1IQ5A 2VRGA 1IH0A 1ZUZA 1DJHA 2SCPA 2BCAA 2JQ6A 3CWGA 1ZFSA 1TOPA 4BY5A 1H4BA 1GGZA 1FW4A 1F55A 2JTTA 2BCBA 2K8MB 1YRTB 3QRXA 2BE6A 4ZCVA 2ZRTA 4A4BA 4CIDA 2M29A 1FPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT6 A;  1SYM A;  2KHN A;  3BQ3 A;  1F4O A;  3JTD C;  1EG4 A;  3CS1 A;  2G2B A;  5I2L A;  3CLN A;  1LVC D;  2E6W A;  1C7W A;  5B8I B;  4C0J A;  2O5G A;  4I5N B;  2PAS A;  3KF9 A;  1SCM B;  1KSM A;  1CLM A;  4WQ2 A;  1CB1 A;  1JUO A;  2COL B;  1K95 A;  3VRP A;  4CFR A;  2M0R A;  1UHH A;  3IF7 A;  2KBI A;  3AAJ A;  4ETO A;  1XK4 A;  3GOF A;  1EXR A;  3JVT B;  3PM8 A;  1PRW A;  1WLM A;  1IJ5 A;  1ALV A;  1XFY O;  2LP2 A;  1MXL C;  2BL0 C;  1CDN A;  2KQ6 A;  5HYD A;  4E68 A;  1M45 A;  3VRQ A;  1AJ4 A;  2BCX A;  2HPS A;  2OTG C;  2ZRS A;  1NCX A;  2KFH A;  1RJV A;  2D8N A;  2KI6 D;  3E3R A;  3WHT B;  3NSL A;  1ZOT B;  3AKB A;  2AUC A;  1B1G A;  2K0J A;  3BYA A;  2HET A;  2JNX A;  1BR1 B;  4I5K A;  1EH2 A;  1KQM B;  1PVB A;  4GPL B;  1A2X A;  4UPG A;  3NSI A;  4L9M A;  2F33 A;  1JC2 A;  4AQI A;  4ICB A;  3D0Y B;  2MRD A;  3WNX B;  1TNW A;  1K9K A;  1IJ6 A;  3OX5 A;  2Y5I A;  4PHK A;  4PE0 A;  5ER5 A;  2L0P A;  2M9G A;  5BPJ A;  1BG1 A;  2F3Y A;  2MAZ A;  2BBN A;  3TUY C;  3PFV A;  2GV5 A;  2A4J A;  4MBE A;  1V1G A;  4JWQ A;  2HQW A;  2LE9 B;  4BY4 A;  1TTX A;  1XVJ A;  4C0K A;  1DGV A;  3IQO A;  1BF5 A;  1TN4 A;  1AK8 A;  1XO5 A;  4MSP A;  2K61 A;  2O60 A;  1CM4 A;  1E8A A;  2KGB C;  5K89 A;  3EK4 A;  3C1V A;  3WXA A;  1RFJ A;  4A4C A;  1QS7 A;  2KOT A;  1SR6 C;  2JT3 A;  1QIW A;  2JNF A;  2CT9 A;  1L2O B;  2ZN8 A;  1UWO A;  3CZT X;  3LK0 A;  3RM1 A;  2NZ0 A;  5JOL A;  4NQG A;  1WRZ A;  1WDC C;  1SL9 A;  3PAL A;  4MRX A;  2BEC A;  2KFF A;  2QPT A;  1L7Z A;  4GBA A;  1DF0 A;  2LHI A;  1MWN A;  1V1F A;  4AQJ A;  2WOR A;  2PSR A;  1UUS A;  1CDP A;  4R1E A;  1EJ3 A;  2LVI A;  1J1E A;  1HT9 A;  3O78 A;  1DT7 B;  3BOW A;  3NSO A;  1CFP A;  2LV7 A;  2M97 A;  1KFU L;  1M39 A;  2QAC A;  4YGE B;  4OCI A;  1CNP A;  1CLB A;  4GGF C;  4HRE E;  2B1U A;  1S3P A;  1YVH A;  5AER A;  1GQM A;  2BE4 A;  1CKK A;  1S36 A;  1K9P A;  4PHM A;  2BBM A;  4XJK B;  5TNC A;  3K21 A;  2RGI A;  3CR2 A;  4QJ5 B;  1F54 A;  5DKQ A;  3OX6 A;  1DJZ A;  1NX2 A;  1S6C A;  1N2D A;  4DRW A;  1WLZ A;  4MZJ A;  4QJ4 B;  2KAY A;  1IRJ A;  1MR8 A;  1CDM A;  3TDU A;  1NX1 A;  1QLS A;  2KQY A;  1REC A;  2LM5 A;  2EC6 B;  1M31 A;  1QJT A;  1DMO A;  1DJW A;  1RWY A;  1K93 D;  5CSJ A;  1SW8 A;  1QV0 A;  3SG2 A;  1PVA A;  1S1E A;  3I5G C;  3ZNI A;  1SKT A;  3ICB A;  2OS8 C;  4N1G A;  3BXK A;  1B8L A;  4GGN A;  2KGR A;  1SRA A;  3CGA A;  3TZ1 A;  1FI5 A;  1A4P A;  1XYD A;  3SIA A;  4YI8 A;  2KDH A;  2L50 A;  1JWD A;  3SIB A;  1K96 A;  3SG7 A;  3EKH A;  1XFX O;  1A29 A;  1MHO A;  2LVK A;  2FOT A;  1TIZ A;  1OSA A;  4OV2 A;  4XYN A;  2ZN9 A;  1WRK A;  4JPZ B;  4MZK A;  4N1F A;  4HRH A;  1PSB A;  1AHR A;  2KI4 B;  5CPV A;  1CDL A;  1ALW A;  2L51 A;  5JJG A;  1IQ3 A;  3FWC A;  2I7A A;  4U8D A;  5AEQ A;  3RLZ A;  2JTZ A;  4PHJ A;  3HX4 A;  5GQQ C;  2I94 A;  2CTN A;  1LA0 A;  1Y6W A;  2LMU A;  1M46 A;  4GGF A;  5I2O A;  2KAX A;  2NLN A;  1SPY A;  2H2K A;  1PAL A;  2L4H A;  3EKJ A;  1S6J A;  2WC8 A;  1OMR A;  2WCF A;  1S6I A;  2JXL A;  5D69 A;  2KAV A;  1F71 A;  2MLF C;  3M0W A;  4HRG A;  2FCD A;  1KK8 B;  3PN7 B;  4Q04 A;  4OR9 B;  2M7L A;  3CTN A;  1MUX A;  1A75 A;  2M49 B;  3A8R A;  3TS5 B;  3I5H B;  2PAL A;  1TCF A;  1EL4 A;  1KFU S;  1OZO A;  4MRY A;  2L98 A;  3SG6 A;  1J7O A;  1QLK A;  1TNP A;  3FWB A;  2LHL A;  2WCE A;  4GUK A;  1IGV A;  1QX7 A;  3EVU A;  1NWD A;  1PSR A;  1XFW O;  3O2P A;  1SCM C;  2K7B A;  2EGD A;  5KSZ A;  2E30 A;  1U5I A;  5KTY A;  1A03 A;  3LL8 B;  4M2Q A;  3JVT C;  3IQQ A;  1BU3 A;  3VRN A;  2Y4Q A;  2JC2 A;  1LKJ A;  2G9B A;  1NPQ A;  2P6B B;  2JZI A;  2M1K B;  4PE4 A;  2ISD A;  2LCP A;  1XFU O;  3EVV A;  3O4Y A;  3BUX B;  3I5F B;  4NDB A;  4YI9 A;  4ORA B;  4CLN A;  2JXC A;  1BMO A;  1KQM C;  3GK1 A;  1KK8 C;  1SCV A;  2M7N A;  1Y1X A;  1VRK A;  3WHU B;  1YUR A;  2PVB A;  5F6T A;  5IBW A;  2CBL A;  3VRO A;  1NX3 A;  1R2U A;  4MZL A;  2K2A A;  2LLS A;  3SJS A;  1C07 A;  4FQO A;  3I5H C;  3OHM B;  1XFV O;  3PAT A;  1Y1U A;  1MF8 B;  1PK0 D;  1PUL A;  3KO0 A;  4JQ0 D;  2F2P A;  2SAS A;  1WY9 A;  2NCO A;  4F0Z B;  1A75 B;  1UP5 A;  1BR4 B;  1MXE A;  1EG3 A;  3FIA A;  4PE7 A;  2TN4 A;  1IG5 A;  1QV1 A;  1LA3 A;  5HKZ A;  1QAS A;  1LIN A;  2F2O A;  2CCM A;  1JSA A;  2M8U A;  1B7T Y;  3DVM A;  1JFK A;  1QXP A;  3A4U B;  2JWW A;  4MVF A;  1L2O C;  4D1E A;  4IL1 A;  2LLU A;  2LAN A;  1ZAC A;  1KWO B;  2KYF A;  1KCY A;  5HKY A;  1AVS A;  1SL8 A;  1CFF A;  2JU0 A;  2JT0 A;  2L2E A;  3KEV A;  5D7F A;  2PRU A;  3OB2 B;  3KPX A;  2NCP A;  2GGM A;  2NXQ A;  1NP8 A;  1DJX A;  1OMD A;  1S26 D;  4PDZ A;  1DVI A;  1DJI A;  1UHI A;  3BUN B;  1UUR A;  1B7T Z;  1NYA A;  4QJ3 B;  2IS9 A;  1J55 A;  4MEW A;  2LAP A;  4PAL A;  5CSI A;  1QAT A;  3NXA A;  2F8P A;  1DF0 B;  2R2I A;  3LCP C;  3MSE B;  2KBM A;  3DVE A;  5HLO A;  1QVI Y;  1YUS A;  2L4I A;  2MJW B;  3BOW B;  3DVJ A;  2MA2 A;  1B47 A;  2MHH A;  1H8B A;  1XA5 A;  5J3X A;  4PE1 A;  1SNL A;  4GFT A;  4AOM A;  2M3W A;  2JUL A;  1TRF A;  2DOQ A;  4I5J A;  1UHN A;  1KFX L;  1Y1A A;  2AAO A;  2H61 C;  1YUU A;  2K7C A;  2PMY A;  4N5X A;  4C0L A;  1FF1 A;  2BL0 B;  1K94 A;  3OB1 B;  1NX0 A;  1DJY A;  5I8N A;  4YRU A;  2EC6 C;  2OTG B;  3D0Y A;  4OVN F;  1JBA A;  1K90 D;  1YRU B;  1QVI Z;  2FCE A;  2HQ8 A;  3PSR A;  2KSP A;  3LLE A;  5G08 A;  3H4S E;  1ODB A;  2ZNE A;  4ORB B;  3SG5 A;  1B9A A;  1OZS A;  1IKU A;  1OQP A;  3BUO B;  3AKA A;  1D1O A;  1JF0 A;  2I2R E;  1K2H A;  1K9U A;  3SG4 A;  4YGD B;  2LNK A;  2OPO A;  2Y1M A;  3KHE A;  1FI6 A;  1J7R A;  3TUY B;  4WQ3 A;  3SG3 A;  1G4Y R;  5AFP A;  1CTR A;  2K7D A;  2LVV A;  3F45 A;  2M1U A;  5KU1 A;  3DF0 A;  3VGO A;  3NSK A;  1XFZ O;  2Q4U A;  3BUM B;  4OKH A;  1JFJ A;  4YGB B;  1SR6 B;  2F3Z A;  1SBJ A;  2ZKM X;  4DIR A;  1G33 A;  2KI4 C;  4NDD A;  1NCZ A;  3TDI A;  3EK7 A;  4DUQ A;  3EK8 A;  1NIW A;  1JF2 A;  1R6P A;  1WDC B;  4DS7 A;  2JOJ A;  1GGW A;  2LVJ A;  2K7O A;  1SK6 D;  1FBV A;  3TDZ A;  4CFQ A;  1DTL A;  3CR4 X;  1BOC A;  3O6B A;  1AP4 A;  2KFG A;  1QX2 A;  2KYC A;  4XJK A;  4ZCU A;  2LUX A;  4GNK B;  2LP3 A;  4YGC B;  3VRR A;  3D10 A;  3PLF B;  2CNP A;  1KK7 Y;  1B8C A;  1YX8 A;  2KI6 C;  1RRO A;  4I5L B;  5AXI A;  2JPT A;  1M63 B;  1RTP 1;  3PN7 C;  2I18 A;  2HF5 A;  1DJG A;  2H61 A;  1C7V A;  3DVK A;  3I5I B;  1F4Q A;  1F8H A;  3TS5 C;  1CFD A;  1OE9 B;  2MBX A;  1W7I B;  1BLQ A;  5DKR A;  2CXJ A;  1NUB A;  1Q80 A;  1YTZ C;  3DF0 B;  2WCB A;  4TNC A;  2LMV A;  1QTX A;  3ZWH A;  2LMT A;  2LC5 A;  1HQV A;  2BKH B;  4HSZ A;  1YR5 A;  1N65 A;  1KK7 Z;  4CPV A;  5HKW A;  2BKI B;  4P2Y B;  1OMV A;  4P5O E;  1KSO A;  2JRF A;  1KFX S;  1YVL A;  3BUW B;  2MLE C;  4YGA A;  2AMI A;  1OOJ A;  4MN0 A;  3I5G B;  2ZFD A;  1J1D A;  1MQ1 A;  1U5I B;  1ZMZ A;  2OS8 B;  3FS7 A;  4FTG A;  1X02 A;  1XK4 C;  1AJ5 A;  3I5F C;  1Y0V H;  1SMG A;  2GGZ A;  1QX5 B;  3EVR A;  5FYX A;  2FJU B;  1N0Y A;  1UHJ A;  3AAK A;  5CSN A;  1SY9 A;  1NCY A;  2Y1N A;  2WND A;  2L5X B;  2K2F A;  4GAO A;  1KQV A;  3I5I C;  1CM1 A;  4WRI A;  5DKN A;  5HLV A;  2ZND A;  1S5G Y;  1CFC A;  4DCK A;  1WRL A;  2V53 A;  1W7J B;  4NDC A;  3GK4 X;  2EHB A;  1YX7 A;  1NSH A;  1F70 A;  3DD4 A;  1K8U A;  3HCM A;  5AAN A;  5I2Q A;  4USL A;  3OP0 A;  5CSF A;  2JT8 A;  1B4C A;  1TCO B;  3JTD B;  1RK9 A;  4ORC B;  5ER4 X;  1CMG A;  3CR5 X;  4PCW A;  3GK2 A;  1IWQ A;  1BOD A;  2KNE A;  1QIV A;  4YBH B;  4MLW A;  3LK1 A;  5PAL A;  1TNX A;  1CMF A;  4M2P A;  1B8R A;  1GJY A;  1KWO C;  1S5G Z;  2Q91 A;  1J7Q A;  1UHK A;  2LLT A;  1TNQ A;  1DGU A;  1J7P A;  1YUT A;  1CLL A;  1SL7 A;  4M2O A;  1G8I A;  1BJF A;  1LXF C;  2WOS A;  1AUI B;  2LUC A;  4PHN A;  1IQ5 A;  2VRG A;  1IH0 A;  1ZUZ A;  1DJH A;  2SCP A;  2BCA A;  2JQ6 A;  3CWG A;  1ZFS A;  1TOP A;  4BY5 A;  1H4B A;  1GGZ A;  1FW4 A;  1F55 A;  2JTT A;  2BCB A;  2K8M B;  1YRT B;  3QRX A;  2BE6 A;  4ZCV A;  2ZRT A;  4A4B A;  4CID A;  2M29 A;  1FPW A; 
#chains in the Genus database with same CATH topology
 1BT6 A;  1SYM A;  2KHN A;  3BQ3 A;  5HL1 A;  1F4O A;  3JTD C;  1EG4 A;  3CS1 A;  2G2B A;  5I2L A;  3CLN A;  1LVC D;  2E6W A;  1C7W A;  5B8I B;  4C0J A;  2O5G A;  4I5N B;  2PAS A;  3KF9 A;  1SCM B;  1KSM A;  1CLM A;  4WQ2 A;  1CB1 A;  1JUO A;  1OOI X;  2COL B;  1K95 A;  5EL2 A;  3VRP A;  4CFR A;  2M0R A;  2QEO A;  1UHH A;  3IF7 A;  2KBI A;  3AAJ A;  4ETO A;  1XK4 A;  3GOF A;  1EXR A;  3JVT B;  3PM8 A;  1PRW A;  1WLM A;  1IJ5 A;  1ALV A;  2BNX A;  1XFY O;  2L5Y A;  2LP2 A;  3FE6 A;  1MXL C;  2BL0 C;  1CDN A;  2KPH A;  2KQ6 A;  5HYD A;  4E68 A;  1M45 A;  3VRQ A;  1AJ4 A;  2BCX A;  5I94 A;  2HPS A;  2KLD A;  2OTG C;  2ZRS A;  1NCX A;  2KFH A;  1RJV A;  2D8N A;  2KI6 D;  3E3R A;  3WHT B;  3NSL A;  1ZOT B;  3AKB A;  2AUC A;  1B1G A;  2K0J A;  3BYA A;  2HET A;  2JNX A;  1BR1 B;  4I5K A;  1EH2 A;  1KQM B;  1PVB A;  4GPL B;  1A2X A;  4UPG A;  3NSI A;  4L9M A;  2F33 A;  3K1E A;  1JC2 A;  4AQI A;  4ICB A;  3D0Y B;  2MRD A;  2P71 A;  3WNX B;  1TNW A;  1K9K A;  1IJ6 A;  3OX5 A;  2Y5I A;  4PHK A;  4PE0 A;  5ER5 A;  2L0P A;  2M9G A;  5BPJ A;  1BG1 A;  2F3Y A;  2MAZ A;  2BBN A;  3TUY C;  3PFV A;  2GV5 A;  2A4J A;  4MBE A;  1V1G A;  4JWQ A;  2HQW A;  2LE9 B;  3FE9 A;  1TTX A;  1XVJ A;  3V2L A;  4BY4 A;  4C0K A;  1DGV A;  3IQO A;  1BF5 A;  1TN4 A;  1AK8 A;  1XO5 A;  4MSP A;  2K61 A;  2O60 A;  1CM4 A;  1OOF A;  1E8A A;  2KGB C;  5K89 A;  3EK4 A;  3C1V A;  3WXA A;  1RFJ A;  3SS4 A;  4A4C A;  3BJH A;  1QS7 A;  2KOT A;  1SR6 C;  2JT3 A;  1QIW A;  2JNF A;  2CT9 A;  1L2O B;  2ZN8 A;  1UWO A;  3CZT X;  3LK0 A;  3RM1 A;  1QWV A;  2NZ0 A;  5JOL A;  2K60 A;  4NQG A;  1WRZ A;  2ERB A;  1WDC C;  2YGU A;  1SL9 A;  3PAL A;  4MRX A;  2BEC A;  2KFF A;  2QPT A;  1L7Z A;  4GBA A;  1DF0 A;  2LHI A;  1MWN A;  3B86 A;  1V1F A;  4AQJ A;  2WOR A;  2PSR A;  1UUS A;  3D76 A;  1CDP A;  4FQT A;  4R1E A;  1EJ3 A;  2LVI A;  1J1E A;  1HT9 A;  3O78 A;  1DT7 B;  3BOW A;  3NSO A;  1CFP A;  2LV7 A;  2M97 A;  1KFU L;  1M39 A;  2QAC A;  3D77 A;  4OCI A;  4YGE B;  1CNP A;  4GGF C;  4HRE E;  1CLB A;  2B1U A;  1S3P A;  1YVH A;  5AER A;  2H8V A;  1GQM A;  2WCJ A;  2BE4 A;  1CKK A;  1S36 A;  1K9P A;  4PHM A;  2BBM A;  4XJK B;  5TNC A;  3K21 A;  2RGI A;  3CR2 A;  3CYZ A;  4QJ5 B;  1F54 A;  3B87 A;  3OX6 A;  5DKQ A;  1DJZ A;  3NGV A;  1NX2 A;  1S6C A;  3S0E A;  1N2D A;  4DRW A;  1WLZ A;  1OOG A;  4JD9 A;  2KAY A;  4MZJ A;  3S0B A;  4QJ4 B;  1IRJ A;  1MR8 A;  1CDM A;  3TDU A;  1NX1 A;  1QLS A;  2KQY A;  1REC A;  2LM5 A;  1DEK A;  2EC6 B;  1DC1 A;  1M31 A;  1QJT A;  1DMO A;  1DJW A;  1RWY A;  1K93 D;  5CSJ A;  1SW8 A;  1QV0 A;  3SG2 A;  1PVA A;  1S1E A;  3I5G C;  3ZNI A;  1OW4 A;  1SKT A;  3ICB A;  2OS8 C;  4N1G A;  3BXK A;  1B8L A;  4GGN A;  2KGR A;  1SRA A;  3CGA A;  3TZ1 A;  1FI5 A;  1A4P A;  1XYD A;  3SIA A;  4YI8 A;  2KDH A;  2L50 A;  3N7H A;  1JWD A;  3SIB A;  1K96 A;  3SG7 A;  3EKH A;  3CAB A;  1XFX O;  1A29 A;  1MHO A;  2LVK A;  2FOT A;  1TIZ A;  1OSA A;  1Z2C B;  4OV2 A;  4XYN A;  2WC6 A;  2ZN9 A;  1WRK A;  4JPZ B;  2JPO A;  4MZK A;  4N1F A;  4HRH A;  1PSB A;  1AHR A;  2KI4 B;  3S0G A;  5CPV A;  1CDL A;  1ALW A;  2L51 A;  5JJG A;  1IQ3 A;  3FWC A;  2I7A A;  4U8D A;  5AEQ A;  3UO9 A;  3RLZ A;  2JTZ A;  4PHJ A;  3HX4 A;  3BFA A;  2I94 A;  5GQQ C;  3CZ2 A;  2CTN A;  1LA0 A;  1Y6W A;  3CZ1 A;  2LMU A;  1M46 A;  4GGF A;  5I2O A;  2KAX A;  2L2C A;  2NLN A;  2WCM A;  1SPY A;  2H2K A;  1SSE B;  1PAL A;  2L4H A;  3VB1 A;  3EKJ A;  1S6J A;  2QEH A;  2WC8 A;  1OMR A;  2WCF A;  3OGN A;  3D75 A;  1S6I A;  2JXL A;  5D69 A;  2KAV A;  3SS5 A;  3B6X A;  1IIO A;  1F71 A;  1LS8 A;  2MLF C;  3M0W A;  4HRG A;  2FCD A;  3UNW A;  1KK8 B;  3PN7 B;  4Q04 A;  4OR9 B;  2M7L A;  3CTN A;  1MUX A;  4INW A;  2PYQ A;  1A75 A;  2M49 B;  2WCH A;  3A8R A;  3TS5 B;  3I5H B;  2PAL A;  1TCF A;  1EL4 A;  1KFU S;  1OZO A;  3PJI A;  4MRY A;  3S0A A;  2L98 A;  3SG6 A;  1J7O A;  1QLK A;  1TNP A;  3FWB A;  2LHL A;  2WCE A;  4GUK A;  1IGV A;  3QME A;  1QX7 A;  3EVU A;  1NWD A;  1PSR A;  1XFW O;  3O2P A;  3O4X A;  1SCM C;  2K7B A;  2P70 A;  2EGD A;  5KSZ A;  3PM2 A;  2E30 A;  1U5I A;  5KTY A;  1A03 A;  3LL8 B;  4M2Q A;  3JVT C;  3IQQ A;  1BU3 A;  3VRN A;  2Y4Q A;  2JC2 A;  1LKJ A;  2G9B A;  1OOH A;  1NPQ A;  2P6B B;  2JZI A;  2M1K B;  4PE4 A;  2ISD A;  2LCP A;  1XFU O;  3EVV A;  3O4Y A;  3BUX B;  3I5F B;  4NDB A;  4YI9 A;  4ORA B;  4CLN A;  2JXC A;  1BMO A;  1KQM C;  3GK1 A;  1KK8 C;  1SCV A;  2M7N A;  1Y1X A;  1VRK A;  3WHU B;  1YUR A;  2PVB A;  5F6T A;  5IBW A;  2CBL A;  3VRO A;  1NX3 A;  1R2U A;  4MZL A;  2K2A A;  2LLS A;  3SJS A;  1C07 A;  4FQO A;  3I5H C;  3OHM B;  1XFV O;  3D73 A;  3PAT A;  1Y1U A;  4IJ7 A;  1MF8 B;  1PK0 D;  1PUL A;  3KO0 A;  4JQ0 D;  2F2P A;  2SAS A;  1WY9 A;  2NCO A;  4F0Z B;  1A75 B;  1UP5 A;  1BR4 B;  4F7F A;  1MXE A;  1EG3 A;  3FIA A;  4PE7 A;  2TN4 A;  2QEV A;  1IG5 A;  1QV1 A;  1LA3 A;  5HKZ A;  1QAS A;  3D78 A;  1LIN A;  2F2O A;  2CCM A;  1JSA A;  2M8U A;  1B7T Y;  5FI6 A;  3DVM A;  1JFK A;  1QXP A;  3A4U B;  2JWW A;  4MVF A;  1L2O C;  4D1E A;  4IL1 A;  2LLU A;  2LAN A;  1ZAC A;  1KWO B;  2KYF A;  1KCY A;  5HKY A;  1AVS A;  1SL8 A;  1CFF A;  2JU0 A;  2JT0 A;  2L2E A;  3KEV A;  5D7F A;  2WC5 A;  2PRU A;  3OB2 B;  3KPX A;  2NCP A;  2GGM A;  2NXQ A;  1NP8 A;  1DJX A;  1OMD A;  1S26 D;  4PDZ A;  1DVI A;  1DJI A;  1UHI A;  3BUN B;  1UUR A;  1B7T Z;  1NYA A;  4QJ3 B;  2IS9 A;  1J55 A;  4MEW A;  2LAP A;  3BFH A;  4PAL A;  5CSI A;  1QAT A;  1T14 A;  2F8P A;  3NXA A;  1DF0 B;  2R2I A;  3LCP C;  3MSE B;  2KBM A;  3DVE A;  5HLO A;  1C3Y A;  1QVI Y;  1YUS A;  4KYN A;  2L4I A;  2MJW B;  3BOW B;  3DVJ A;  2MA2 A;  3EG5 B;  1B47 A;  2MHH A;  4PT1 A;  1XA5 A;  1H8B A;  3DXL A;  5J3X A;  4PE1 A;  1SNL A;  3FE8 A;  4GFT A;  3NHT A;  2M3W A;  3NHI A;  2JUL A;  4AOM A;  1TRF A;  2DOQ A;  4I5J A;  1UHN A;  1KFX L;  1Y1A A;  2AAO A;  2H61 C;  1YUU A;  2K7C A;  2PMY A;  3L4L A;  4N5X A;  4C0L A;  1FF1 A;  2BL0 B;  1K94 A;  3OB1 B;  1NX0 A;  1DJY A;  1TUJ A;  4YRU A;  5I8N A;  5D3O A;  2EC6 C;  2OTG B;  3D0Y A;  4OVN F;  1JBA A;  1K90 D;  1YRU B;  1QVI Z;  2FCE A;  3R1O A;  2HQ8 A;  3PSR A;  2KSP A;  3LLE A;  3Q8I A;  3H4S E;  5G08 A;  1ODB A;  5FI7 A;  1W9Z A;  2ZNE A;  4ORB B;  1B9A A;  3SG5 A;  1OZS A;  1IKU A;  3BFB A;  1OQP A;  3BUO B;  3AKA A;  1D1O A;  5FI2 A;  1JF0 A;  2I2R E;  1K2H A;  1K9U A;  3SG4 A;  4YGD B;  2LNK A;  2OPO A;  2Y1M A;  3KHE A;  1FI6 A;  1J7R A;  3TUY B;  4WQ3 A;  3SG3 A;  1G4Y R;  5AFP A;  1CTR A;  3CDN A;  2K7D A;  2LVV A;  3F45 A;  2M1U A;  5KU1 A;  3DF0 A;  3VGO A;  1TWO A;  3NSK A;  1XFZ O;  2Q4U A;  3BUM B;  4OKH A;  1JFJ A;  4YGB B;  1SR6 B;  1P28 A;  2F3Z A;  1SBJ A;  2ZKM X;  3R1P A;  4DIR A;  1G33 A;  2KI4 C;  4NDD A;  1NCZ A;  3TDI A;  3EK7 A;  4DUQ A;  3EK8 A;  1NIW A;  3D74 A;  2QEB A;  1TUZ A;  1JF2 A;  1R6P A;  1WDC B;  4DS7 A;  2JOJ A;  1GGW A;  2LVJ A;  3S0F A;  2K7O A;  1SK6 D;  1FBV A;  3TDZ A;  4CFQ A;  1DEL A;  1DTL A;  3CR4 X;  1BOC A;  3O6B A;  1AP4 A;  2KFG A;  1Z4H A;  1QX2 A;  2KYC A;  4XJK A;  4ZCU A;  2LUX A;  4INX A;  4GNK B;  2LP3 A;  4YGC B;  3VRR A;  3D10 A;  3PLF B;  2CNP A;  3B88 A;  1KK7 Y;  1B8C A;  1YX8 A;  2KI6 C;  1RRO A;  4I5L B;  5AXI A;  2JPT A;  1M63 B;  1RTP 1;  3IVT A;  2I18 A;  2HF5 A;  3PN7 C;  3R1V A;  3R72 A;  3DYE A;  1DJG A;  2H61 A;  1C7V A;  3DVK A;  3I5I B;  1F4Q A;  2BAP A;  1F8H A;  3TS5 C;  1CFD A;  1OE9 B;  1C3Z A;  2MBX A;  1W7I B;  1BLQ A;  5DKR A;  2CXJ A;  1NUB A;  1Q80 A;  1YTZ C;  3DF0 B;  2WCB A;  4TNC A;  2LMV A;  1QTX A;  3ZWH A;  2LMT A;  2LC5 A;  1XFR A;  1HQV A;  2BKH B;  4HSZ A;  1YR5 A;  1N65 A;  1KK7 Z;  2QDI A;  2WCK A;  4CPV A;  5HKW A;  2BKI B;  4P2Y B;  1OMV A;  1ORG A;  1KSO A;  4P5O E;  2JRF A;  2PQL A;  3L4A A;  1KFX S;  3OBV A;  1YVL A;  3BUW B;  2MLE C;  4YGA A;  2AMI A;  1OOJ A;  4MN0 A;  1GM0 A;  3I5G B;  2ZFD A;  1J1D A;  1MQ1 A;  1U5I B;  1ZMZ A;  2OS8 B;  3FS7 A;  4FTG A;  1X02 A;  1XK4 C;  1AJ5 A;  2GTE A;  3I5F C;  1Y0V H;  1SMG A;  2GGZ A;  1QX5 B;  3EVR A;  5FYX A;  2FJU B;  1N0Y A;  1UHJ A;  3AAK A;  5CSN A;  1SY9 A;  1NCY A;  2Y1N A;  3L47 A;  2WND A;  2L5X B;  2K2F A;  4GAO A;  1KQV A;  3I5I C;  1CM1 A;  4WRI A;  5DKN A;  5HLV A;  2ZND A;  1S5G Y;  1CFC A;  4DCK A;  1WRL A;  2V53 A;  1W7J B;  2WCL A;  3CZ0 A;  3GK4 X;  2EHB A;  1YX7 A;  4NDC A;  1NSH A;  1F70 A;  3DD4 A;  1K8U A;  3HCM A;  5AAN A;  5I2Q A;  4USL A;  3OP0 A;  5CSF A;  2JT8 A;  5DIC A;  1B4C A;  1TCO B;  3JTD B;  1DQE A;  1RK9 A;  4ORC B;  5ER4 X;  1CMG A;  3CR5 X;  4PCW A;  3GK2 A;  1IWQ A;  1BOD A;  2KNE A;  3RZS A;  1QIV A;  2KLE A;  3DZT A;  4MLW A;  4YBH B;  3LK1 A;  5PAL A;  1TNX A;  1CMF A;  4M2P A;  1B8R A;  1GJY A;  1KWO C;  3SS3 A;  1S5G Z;  2Q91 A;  1J7Q A;  1UHK A;  4JKT A;  2LLT A;  1TNQ A;  1DGU A;  1J7P A;  1YUT A;  1CLL A;  1SL7 A;  3B7A A;  4M2O A;  1G8I A;  1BJF A;  1LXF C;  2WOS A;  1AUI B;  2LUC A;  4PHN A;  1IQ5 A;  4OZD A;  2VRG A;  3S0D A;  1ZUZ A;  1DJH A;  2SCP A;  1IH0 A;  2BCA A;  2JQ6 A;  3CWG A;  1ZFS A;  1TOP A;  3DY9 A;  4BY5 A;  1H4B A;  1GGZ A;  1FW4 A;  1F55 A;  2JTT A;  2BCB A;  2K8M B;  1YRT B;  3QRX A;  2BE6 A;  4ZCV A;  2ZRT A;  4A4B A;  4CID A;  2M29 A;  2FJY A;  1FPW A; 
#chains in the Genus database with same CATH homology
 1BT6 A;  1SYM A;  2KHN A;  3BQ3 A;  1F4O A;  3JTD C;  1EG4 A;  3CS1 A;  2G2B A;  5I2L A;  3CLN A;  1LVC D;  2E6W A;  1C7W A;  5B8I B;  4C0J A;  2O5G A;  4I5N B;  2PAS A;  3KF9 A;  1SCM B;  1KSM A;  1CLM A;  4WQ2 A;  1CB1 A;  1JUO A;  2COL B;  1K95 A;  3VRP A;  4CFR A;  2M0R A;  1UHH A;  3IF7 A;  2KBI A;  3AAJ A;  4ETO A;  1XK4 A;  3GOF A;  1EXR A;  3JVT B;  3PM8 A;  1PRW A;  1WLM A;  1IJ5 A;  1ALV A;  1XFY O;  2LP2 A;  1MXL C;  2BL0 C;  1CDN A;  2KQ6 A;  5HYD A;  4E68 A;  1M45 A;  3VRQ A;  1AJ4 A;  2BCX A;  2HPS A;  2OTG C;  2ZRS A;  1NCX A;  2KFH A;  1RJV A;  2D8N A;  2KI6 D;  3E3R A;  3WHT B;  3NSL A;  1ZOT B;  3AKB A;  2AUC A;  1B1G A;  2K0J A;  3BYA A;  2HET A;  2JNX A;  1BR1 B;  4I5K A;  1EH2 A;  1KQM B;  1PVB A;  4GPL B;  1A2X A;  4UPG A;  3NSI A;  4L9M A;  2F33 A;  1JC2 A;  4AQI A;  4ICB A;  3D0Y B;  2MRD A;  3WNX B;  1TNW A;  1K9K A;  1IJ6 A;  3OX5 A;  2Y5I A;  4PHK A;  4PE0 A;  5ER5 A;  2L0P A;  2M9G A;  5BPJ A;  1BG1 A;  2F3Y A;  2MAZ A;  2BBN A;  3TUY C;  3PFV A;  2GV5 A;  2A4J A;  4MBE A;  1V1G A;  4JWQ A;  2HQW A;  2LE9 B;  4BY4 A;  1TTX A;  1XVJ A;  4C0K A;  1DGV A;  3IQO A;  1BF5 A;  1TN4 A;  1AK8 A;  1XO5 A;  4MSP A;  2K61 A;  2O60 A;  1CM4 A;  1E8A A;  2KGB C;  5K89 A;  3EK4 A;  3C1V A;  3WXA A;  1RFJ A;  4A4C A;  1QS7 A;  2KOT A;  1SR6 C;  2JT3 A;  1QIW A;  2JNF A;  2CT9 A;  1L2O B;  2ZN8 A;  1UWO A;  3CZT X;  3LK0 A;  3RM1 A;  2NZ0 A;  5JOL A;  4NQG A;  1WRZ A;  1WDC C;  1SL9 A;  3PAL A;  4MRX A;  2BEC A;  2KFF A;  2QPT A;  1L7Z A;  4GBA A;  1DF0 A;  2LHI A;  1MWN A;  1V1F A;  4AQJ A;  2WOR A;  2PSR A;  1UUS A;  1CDP A;  4R1E A;  1EJ3 A;  2LVI A;  1J1E A;  1HT9 A;  3O78 A;  1DT7 B;  3BOW A;  3NSO A;  1CFP A;  2LV7 A;  2M97 A;  1KFU L;  1M39 A;  2QAC A;  4YGE B;  4OCI A;  1CNP A;  1CLB A;  4GGF C;  4HRE E;  2B1U A;  1S3P A;  1YVH A;  5AER A;  1GQM A;  2BE4 A;  1CKK A;  1S36 A;  1K9P A;  4PHM A;  2BBM A;  4XJK B;  5TNC A;  3K21 A;  2RGI A;  3CR2 A;  4QJ5 B;  1F54 A;  5DKQ A;  3OX6 A;  1DJZ A;  1NX2 A;  1S6C A;  1N2D A;  4DRW A;  1WLZ A;  4MZJ A;  4QJ4 B;  2KAY A;  1IRJ A;  1MR8 A;  1CDM A;  3TDU A;  1NX1 A;  1QLS A;  2KQY A;  1REC A;  2LM5 A;  2EC6 B;  1M31 A;  1QJT A;  1DMO A;  1DJW A;  1RWY A;  1K93 D;  5CSJ A;  1SW8 A;  1QV0 A;  3SG2 A;  1PVA A;  1S1E A;  3I5G C;  3ZNI A;  1SKT A;  3ICB A;  2OS8 C;  4N1G A;  3BXK A;  1B8L A;  4GGN A;  2KGR A;  1SRA A;  3CGA A;  3TZ1 A;  1FI5 A;  1A4P A;  1XYD A;  3SIA A;  4YI8 A;  2KDH A;  2L50 A;  1JWD A;  3SIB A;  1K96 A;  3SG7 A;  3EKH A;  1XFX O;  1A29 A;  1MHO A;  2LVK A;  2FOT A;  1TIZ A;  1OSA A;  4OV2 A;  4XYN A;  2ZN9 A;  1WRK A;  4JPZ B;  4MZK A;  4N1F A;  4HRH A;  1PSB A;  1AHR A;  2KI4 B;  5CPV A;  1CDL A;  1ALW A;  2L51 A;  5JJG A;  1IQ3 A;  3FWC A;  2I7A A;  4U8D A;  5AEQ A;  3RLZ A;  2JTZ A;  4PHJ A;  3HX4 A;  5GQQ C;  2I94 A;  2CTN A;  1LA0 A;  1Y6W A;  2LMU A;  1M46 A;  4GGF A;  5I2O A;  2KAX A;  2NLN A;  1SPY A;  2H2K A;  1PAL A;  2L4H A;  3EKJ A;  1S6J A;  2WC8 A;  1OMR A;  2WCF A;  1S6I A;  2JXL A;  5D69 A;  2KAV A;  1F71 A;  2MLF C;  3M0W A;  4HRG A;  2FCD A;  1KK8 B;  3PN7 B;  4Q04 A;  4OR9 B;  2M7L A;  3CTN A;  1MUX A;  1A75 A;  2M49 B;  3A8R A;  3TS5 B;  3I5H B;  2PAL A;  1TCF A;  1EL4 A;  1KFU S;  1OZO A;  4MRY A;  2L98 A;  3SG6 A;  1J7O A;  1QLK A;  1TNP A;  3FWB A;  2LHL A;  2WCE A;  4GUK A;  1IGV A;  1QX7 A;  3EVU A;  1NWD A;  1PSR A;  1XFW O;  3O2P A;  1SCM C;  2K7B A;  2EGD A;  5KSZ A;  2E30 A;  1U5I A;  5KTY A;  1A03 A;  3LL8 B;  4M2Q A;  3JVT C;  3IQQ A;  1BU3 A;  3VRN A;  2Y4Q A;  2JC2 A;  1LKJ A;  2G9B A;  1NPQ A;  2P6B B;  2JZI A;  2M1K B;  4PE4 A;  2ISD A;  2LCP A;  1XFU O;  3EVV A;  3O4Y A;  3BUX B;  3I5F B;  4NDB A;  4YI9 A;  4ORA B;  4CLN A;  2JXC A;  1BMO A;  1KQM C;  3GK1 A;  1KK8 C;  1SCV A;  2M7N A;  1Y1X A;  1VRK A;  3WHU B;  1YUR A;  2PVB A;  5F6T A;  5IBW A;  2CBL A;  3VRO A;  1NX3 A;  1R2U A;  4MZL A;  2K2A A;  2LLS A;  3SJS A;  1C07 A;  4FQO A;  3I5H C;  3OHM B;  1XFV O;  3PAT A;  1Y1U A;  1MF8 B;  1PK0 D;  1PUL A;  3KO0 A;  4JQ0 D;  2F2P A;  2SAS A;  1WY9 A;  2NCO A;  4F0Z B;  1A75 B;  1UP5 A;  1BR4 B;  1MXE A;  1EG3 A;  3FIA A;  4PE7 A;  2TN4 A;  1IG5 A;  1QV1 A;  1LA3 A;  5HKZ A;  1QAS A;  1LIN A;  2F2O A;  2CCM A;  1JSA A;  2M8U A;  1B7T Y;  3DVM A;  1JFK A;  1QXP A;  3A4U B;  2JWW A;  4MVF A;  1L2O C;  4D1E A;  4IL1 A;  2LLU A;  2LAN A;  1ZAC A;  1KWO B;  2KYF A;  1KCY A;  5HKY A;  1AVS A;  1SL8 A;  1CFF A;  2JU0 A;  2JT0 A;  2L2E A;  3KEV A;  5D7F A;  2PRU A;  3OB2 B;  3KPX A;  2NCP A;  2GGM A;  2NXQ A;  1NP8 A;  1DJX A;  1OMD A;  1S26 D;  4PDZ A;  1DVI A;  1DJI A;  1UHI A;  3BUN B;  1UUR A;  1B7T Z;  1NYA A;  4QJ3 B;  2IS9 A;  1J55 A;  4MEW A;  2LAP A;  4PAL A;  5CSI A;  1QAT A;  3NXA A;  2F8P A;  1DF0 B;  2R2I A;  3LCP C;  3MSE B;  2KBM A;  3DVE A;  5HLO A;  1QVI Y;  1YUS A;  2L4I A;  2MJW B;  3BOW B;  3DVJ A;  2MA2 A;  1B47 A;  2MHH A;  1H8B A;  1XA5 A;  5J3X A;  4PE1 A;  1SNL A;  4GFT A;  4AOM A;  2M3W A;  2JUL A;  1TRF A;  2DOQ A;  4I5J A;  1UHN A;  1KFX L;  1Y1A A;  2AAO A;  2H61 C;  1YUU A;  2K7C A;  2PMY A;  4N5X A;  4C0L A;  1FF1 A;  2BL0 B;  1K94 A;  3OB1 B;  1NX0 A;  1DJY A;  5I8N A;  4YRU A;  2EC6 C;  2OTG B;  3D0Y A;  4OVN F;  1JBA A;  1K90 D;  1YRU B;  1QVI Z;  2FCE A;  2HQ8 A;  3PSR A;  2KSP A;  3LLE A;  5G08 A;  3H4S E;  1ODB A;  2ZNE A;  4ORB B;  3SG5 A;  1B9A A;  1OZS A;  1IKU A;  1OQP A;  3BUO B;  3AKA A;  1D1O A;  1JF0 A;  2I2R E;  1K2H A;  1K9U A;  3SG4 A;  4YGD B;  2LNK A;  2OPO A;  2Y1M A;  3KHE A;  1FI6 A;  1J7R A;  3TUY B;  4WQ3 A;  3SG3 A;  1G4Y R;  5AFP A;  1CTR A;  2K7D A;  2LVV A;  3F45 A;  2M1U A;  5KU1 A;  3DF0 A;  3VGO A;  3NSK A;  1XFZ O;  2Q4U A;  3BUM B;  4OKH A;  1JFJ A;  4YGB B;  1SR6 B;  2F3Z A;  1SBJ A;  2ZKM X;  4DIR A;  1G33 A;  2KI4 C;  4NDD A;  1NCZ A;  3TDI A;  3EK7 A;  4DUQ A;  3EK8 A;  1NIW A;  1JF2 A;  1R6P A;  1WDC B;  4DS7 A;  2JOJ A;  1GGW A;  2LVJ A;  2K7O A;  1SK6 D;  1FBV A;  3TDZ A;  4CFQ A;  1DTL A;  3CR4 X;  1BOC A;  3O6B A;  1AP4 A;  2KFG A;  1QX2 A;  2KYC A;  4XJK A;  4ZCU A;  2LUX A;  4GNK B;  2LP3 A;  4YGC B;  3VRR A;  3D10 A;  3PLF B;  2CNP A;  1KK7 Y;  1B8C A;  1YX8 A;  2KI6 C;  1RRO A;  4I5L B;  5AXI A;  2JPT A;  1M63 B;  1RTP 1;  3PN7 C;  2I18 A;  2HF5 A;  1DJG A;  2H61 A;  1C7V A;  3DVK A;  3I5I B;  1F4Q A;  1F8H A;  3TS5 C;  1CFD A;  1OE9 B;  2MBX A;  1W7I B;  1BLQ A;  5DKR A;  2CXJ A;  1NUB A;  1Q80 A;  1YTZ C;  3DF0 B;  2WCB A;  4TNC A;  2LMV A;  1QTX A;  3ZWH A;  2LMT A;  2LC5 A;  1HQV A;  2BKH B;  4HSZ A;  1YR5 A;  1N65 A;  1KK7 Z;  4CPV A;  5HKW A;  2BKI B;  4P2Y B;  1OMV A;  4P5O E;  1KSO A;  2JRF A;  1KFX S;  1YVL A;  3BUW B;  2MLE C;  4YGA A;  2AMI A;  1OOJ A;  4MN0 A;  3I5G B;  2ZFD A;  1J1D A;  1MQ1 A;  1U5I B;  1ZMZ A;  2OS8 B;  3FS7 A;  4FTG A;  1X02 A;  1XK4 C;  1AJ5 A;  3I5F C;  1Y0V H;  1SMG A;  2GGZ A;  1QX5 B;  3EVR A;  5FYX A;  2FJU B;  1N0Y A;  1UHJ A;  3AAK A;  5CSN A;  1SY9 A;  1NCY A;  2Y1N A;  2WND A;  2L5X B;  2K2F A;  4GAO A;  1KQV A;  3I5I C;  1CM1 A;  4WRI A;  5DKN A;  5HLV A;  2ZND A;  1S5G Y;  1CFC A;  4DCK A;  1WRL A;  2V53 A;  1W7J B;  4NDC A;  3GK4 X;  2EHB A;  1YX7 A;  1NSH A;  1F70 A;  3DD4 A;  1K8U A;  3HCM A;  5AAN A;  5I2Q A;  4USL A;  3OP0 A;  5CSF A;  2JT8 A;  1B4C A;  1TCO B;  3JTD B;  1RK9 A;  4ORC B;  5ER4 X;  1CMG A;  3CR5 X;  4PCW A;  3GK2 A;  1IWQ A;  1BOD A;  2KNE A;  1QIV A;  4YBH B;  4MLW A;  3LK1 A;  5PAL A;  1TNX A;  1CMF A;  4M2P A;  1B8R A;  1GJY A;  1KWO C;  1S5G Z;  2Q91 A;  1J7Q A;  1UHK A;  2LLT A;  1TNQ A;  1DGU A;  1J7P A;  1YUT A;  1CLL A;  1SL7 A;  4M2O A;  1G8I A;  1BJF A;  1LXF C;  2WOS A;  1AUI B;  2LUC A;  4PHN A;  1IQ5 A;  2VRG A;  1IH0 A;  1ZUZ A;  1DJH A;  2SCP A;  2BCA A;  2JQ6 A;  3CWG A;  1ZFS A;  1TOP A;  4BY5 A;  1H4B A;  1GGZ A;  1FW4 A;  1F55 A;  2JTT A;  2BCB A;  2K8M B;  1YRT B;  3QRX A;  2BE6 A;  4ZCV A;  2ZRT A;  4A4B A;  4CID A;  2M29 A;  1FPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...