4AQIA

Structure of human s100a15 bound to zinc and calcium
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of S100A15 Reveals a Novel Zinc Coordination Site Among S100 Proteins and Altered Surface Chemistry with Functional Implications for Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords PROTEIN S100-A7A
total genus 37
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4aqiA00
1CTRA 1PK0D 2M9GA 4OKHA 2LMVA 3OX6A 2G2BA 2HQ8A 1SKTA 3TUYC 4CPVA 1RTP1 1YTZC 1S36A 1TNWA 5DKNA 1ZACA 4TNCA 1BODA 1ZUZA 1B47A 3CR4X 1IQ5A 3ICBA 1JF0A 1B8CA 2ZNEA 3LL8B 2F3YA 5I2LA 1M63B 1CDMA 1XFXO 1S6IA 2LLTA 3NSIA 1H4BA 1MQ1A 3KEVA 4C0KA 3JVTB 5K89A 5J3XA 1YX7A 4N1FA 2PVBA 1DT7B 1SY9A 4PE7A 1SNLA 5CSNA 3AAKA 3KF9A 1TNQA 4PHMA 1IJ5A 2BL0C 4AOMA 3BUWB 2CT9A 2M8UA 3CGAA 1YRUB 4M2QA 5HLVA 3DVMA 2KQ6A 2MLFC 2L2EA 2A4JA 4L9MA 1MHOA 1YUSA 4DIRA 2BCXA 2BE6A 2PALA 1RROA 3PATA 1EL4A 4I5JA 2AUCA 1XO5A 2MHHA 1CKKA 3EK7A 4ICBA 1SL8A 3FWBA 1KQVA 3OX5A 1EXRA 5KSZA 1MXEA 2KGBC 3DVJA 1SL7A 1FF1A 1BOCA 1L2OB 1Y1XA 1NUBA 5BPJA 1J55A 1NX1A 1N2DA 2CCMA 1UP5A 3EVVA 4QJ4B 2LVIA 1DJZA 2CXJA 1CLBA 1BT6A 5IBWA 1F8HA 2EC6C 1SCVA 3RLZA 4M2PA 1D1OA 4OCIA 3F45A 3CR5X 2CTNA 5HYDA 2ZRTA 1AJ5A 1YRTB 3EVRA 1B7TY 3FS7A 2BL0B 2JXCA 3SG5A 2KI6C 4CLNA 4E68A 3SJSA 1KK7Y 1KSOA 2F2OA 3FIAA 1G8IA 4N5XA 4U8DA 3A4UB 2KFGA 4XJKB 5KTYA 1K2HA 1CMGA 2JT0A 1C7VA 1PVAA 2RGIA 3TDUA 2LAPA 4NQGA 5HLOA 1QV1A 1PVBA 3LK1A 1S3PA 4MZJA 2WCFA 4FTGA 4A4BA 3I5GC 1XFWO 2L51A 1QVIZ 1IG5A 3O78A 1UUSA 3GK2A 2MBXA 4YGAA 4IL1A 1IRJA 2NCPA 1UHIA 2FJUB 3VRNA 1U5IB 1CMFA 1CDNA 1DVIA 4GGFA 1N0YA 2EC6B 1B7TZ 1LVCD 1BJFA 1CDPA 2M7NA 3IQQA 3C1VA 3DVEA 4NDBA 1J7PA 4F0ZB 3BUMB 1RK9A 1PRWA 1K94A 2L5XB 1GGWA 3PSRA 1F55A 1DJIA 2LHIA 1JFKA 1EG4A 5AEQA 3JTDB 4HRHA 4JQ0D 1B1GA 2SCPA 4PHNA 1Y1UA 1M39A 2LHLA 3TDIA 4GGNA 3TUYB 1K93D 1U5IA 1W7IB 1ZOTB 3PN7C 5JJGA 5AXIA 4P5OE 2LM5A 2K7DA 5HKWA 3CLNA 4D1EA 2JC2A 4BY5A 1SL9A 2LANA 4MBEA 1XYDA 3I5GB 1DGVA 1K90D 1QASA 3EK8A 3ZWHA 1FPWA 1LXFC 3VROA 3DVKA 3A8RA 4JWQA 1QTXA 1OZSA 4USLA 3WXAA 3SIAA 1SBJA 1SK6D 3JVTC 2K7CA 5CSJA 1F4OA 2MJWB 2MRDA 2I2RE 4YRUA 2P6BB 2L0PA 1YVHA 2WC8A 3QRXA 3WNXB 3KPXA 1UHJA 2LP2A 1CM4A 3DD4A 4MRYA 2Q4UA 3EKJA 1SPYA 2LE9B 2LNKA 2CNPA 3VRPA 1NCZA 2KGRA 1DF0A 1L7ZA 3SG7A 2PSRA 1IQ3A 1UURA 2Y5IA 3KO0A 1K9UA 1MUXA 4CIDA 1M31A 1C7WA 1CNPA 1WRZA 3O4YA 2L50A 3OHMB 4DS7A 1NCXA 5AFPA 1A4PA 1S6JA 1PSBA 2JULA 1F70A 1DJXA 1L2OC 1PSRA 2PASA 3TDZA 1WRLA 1G4YR 4I5LB 1X02A 4GAOA 1KFXS 4PCWA 2KFFA 2BKIB 2JXLA 1SYMA 4YI8A 1KK8C 1QX5B 1TNPA 1A29A 4C0JA 4YGEB 1TRFA 2KNEA 3GK4X 3PLFB 3VRRA 1FW4A 1CM1A 1GJYA 1R2UA 3PFVA 2K7OA 3D0YA 2HQWA 3FWCA 3HX4A 1IWQA 2L98A 3BUNB 4MZKA 1Y0VH 2LLUA 2M7LA 3OB1B 2LC5A 2ZNDA 3VGOA 4PHKA 1V1FA 1TOPA 1NCYA 5CPVA 2M49B 1XFYO 2KAYA 2F33A 1KSMA 1AUIB 3GK1A 1A2XA 4NDCA 1IJ6A 2BE4A 3EKHA 4OVNF 1RJVA 4WRIA 1CB1A 3VRQA 2KI4B 1EG3A 1PULA 1S26D 3BQ3A 4HRGA 3I5HB 1UHKA 2L4HA 4JPZB 4PALA 4MN0A 2KI6D 2H61A 1B8LA 2GV5A 1Y1AA 1GQMA 1W7JB 5CSIA 1FI6A 3KHEA 5GQQC 1NPQA 4DUQA 1LINA 2JU0A 5D69A 2FOTA 1QIWA 3K21A 1HQVA 3LCPC 1ZFSA 4UPGA 4GFTA 1TIZA 2NXQA 4YGBB 1WRKA 2ZN8A 1KK8B 1QV0A 2AMIA 1YR5A 2QPTA 4ORAB 1FBVA 4BY4A 1DF0B 3LLEA 4I5KA 4MZLA 3NXAA 2LLSA 2BECA 2K8MB 1KFUL 5JOLA 3AKBA 3SG3A 1PALA 1DJHA 1JC2A 2HPSA 5HKYA 3ZNIA 2MLEC 3CZTX 5B8IB 3OP0A 3D0YB 2KQYA 3AAJA 4MVFA 2FCEA 1K95A 2K7BA 1JBAA 1CFDA 1CLMA 1QXPA 1V1GA 1K96A 2G9BA 3JTDC 4DRWA 1B9AA 4ZCUA 2BBMA 2EGDA 4M2OA 5G08A 4DCKA 5AERA 2NZ0A 3PN7B 2JWWA 4AQJA 1AVSA 1TN4A 3EVUA 1CDLA 1N65A 2BCAA 2GGMA 1XK4C 2AAOA 4ZCVA 2EHBA 3CTNA 3MSEB 2OTGC 1BU3A 5I8NA 2WORA 2M97A 2M0RA 3PM8A 1ALWA 1CFCA 1YUUA 1QLSA 2LUXA 4N1GA 1OMDA 2ZN9A 2NLNA 1OMRA 3D10A 1QX2A 1DGUA 2JOJA 4AQIA 2Y1MA 4CFQA 1J1EA 2LVJA 3M0WA 4MSPA 1DJGA 1AK8A 4GUKA 3WHUB 1TCFA 1TTXA 1GGZA 2TN4A 1C07A 4PE0A 1YURA 1WY9A 1G33A 1SCMB 1BF5A 1UWOA 2M1KB 1DJYA 2JTTA 3PALA 2JQ6A 2K2FA 2Y1NA 2H2KA 1NIWA 1NWDA 1KQMB 1KWOB 2Y4QA 4Q04A 1M46A 3BYAA 1JWDA 4YBHB 1AP4A 1S5GY 1YX8A 2F8PA 3CS1A 2KAVA 4GNKB 2F3ZA 2E6WA 1WLMA 2I18A 1F54A 4YGCB 1ZMZA 2OTGB 2ZFDA 4HSZA 3O2PA 4PE4A 2JNFA 1WLZA 2GGZA 1DTLA 4GBAA 2LMUA 2JNXA 1UHHA 4MEWA 3WHTB 1J7OA 1RECA 5F6TA 2I94A 1Q80A 1A75A 3TS5C 1EH2A 1J7RA 2LV7A 2IS9A 4C0LA 2BBNA 1XK4A 4QJ5B 4PDZA 3NSOA 2H61C 1SW8A 1IKUA 1SCMC 4YI9A 4HREE 1QVIY 1F71A 1S5GZ 3TZ1A 1IH0A 2KAXA 2LMTA 1KQMC 1IGVA 1RWYA 3SG2A 2KI4C 4XJKA 2D8NA 1S6CA 5I2QA 4OV2A 1Y6WA 2DOQA 2O60A 3I5HC 1QLKA 1XA5A 2ZRSA 1MF8B 4XYNA 1BMOA 1BR4B 1R6PA 1NSHA 2K61A 2L4IA 3E3RA 1DMOA 1ALVA 1LA3A 2ISDA 3SG6A 2LVVA 1SMGA 2KBMA 1TCOB 1AHRA 1B8RA 1XFZO 2KYFA 4P2YB 2OS8C 1KK7Z 4GPLB 5CSFA 3OB2B 2MA2A 4QJ3B 4MLWA 2LP3A 1K9KA 1CLLA 2KYCA 5TNCA 1QATA 1K8UA 1SR6B 4ORCB 2K0JA 2KBIA 2MAZA 4ETOA 5AANA 3TS5B 1TNXA 1BLQA 3BUOB 2BKHB 5I2OA 2V53A 4OR9B 2HF5A 2JTZA 5ER4X 5DKRA 2KSPA 1OOJA 2KHNA 2PRUA 1OE9B 1F4QA 1MR8A 1OMVA 1J7QA 2SASA 3O6BA 1LKJA 4GGFC 3I5IB 5PALA 2M3WA 3DF0B 4YGDB 3NSLA 1S1EA 1M45A 4MRXA 1WDCB 1QX7A 3BXKA 1SRAA 1LA0A 2JT8A 1KFUS 3SG4A 1A03A 2M29A 3LK0A 1OSAA 3IF7A 1ODBA 3BOWA 2JRFA 4I5NB 2B1UA 2I7AA 2OS8B 4ORBB 3IQOA 4CFRA 1XFVO 3H4SE 2JPTA 1XFUO 2KOTA 1AJ4A 1OZOA 1XVJA 2LVKA 1JF2A 1K9PA 1NYAA 2WCBA 3I5FC 1SR6C 1OQPA 2LCPA 1NX0A 1QS7A 2Q91A 3NSKA 1BR1B 1J1DA 1QIVA 5ER5A 2R2IA 3DF0A 5FYXA 1JUOA 1B4CA 2NCOA 2COLB 2E30A 2ZKMX 1MWNA 1QJTA 1YUTA 4A4CA 1E8AA 4WQ3A 1NX2A 2QACA 2O5GA 1JFJA 4WQ2A 4PHJA 4NDDA 5DKQA 1H8BA 1KCYA 2BCBA 3BUXB 3CWGA 5D7FA 1JSAA 4FQOA 1CFFA 2CBLA 2WCEA 3I5IC 1FI5A 1KWOC 1YVLA 2PMYA 2WNDA 1DJWA 2KFHA 3HCMA 1NX3A 1WDCC 2KDHA 3CR2A 2LUCA 5KU1A 3EK4A 2F2PA 1CFPA 3BOWB 4PE1A 2M1UA 4R1EA 1MXLC 3SIBA 5HKZA 1UHNA 3I5FB 1HT9A 1KFXL 1VRKA 2JT3A 3RM1A 1A75B 2WOSA 2HETA 2K2AA 2VRGA 1NP8A 3AKAA 2OPOA 1RFJA 1BG1A 1EJ3A 2FCDA 2JZIA 3GOFA
chains in the Genus database with same CATH superfamily
1CTRA 1PK0D 3BFAA 2M9GA 3NGVA 4OKHA 2LMVA 3OX6A 2G2BA 2HQ8A 1SKTA 3TUYC 4CPVA 1RTP1 1YTZC 1S36A 1TNWA 3FE8A 1ZACA 5DKNA 4TNCA 1BODA 1ZUZA 4FQTA 4INXA 1B47A 2P70A 3CR4X 3K1EA 1IQ5A 3ICBA 1JF0A 1B8CA 2ZNEA 3D75A 2F3YA 3LL8B 5I2LA 1M63B 1CDMA 1XFXO 1S6IA 2LLTA 3FE9A 3NSIA 1MQ1A 3PJIA 1H4BA 2K60A 3KEVA 2FJYA 3JVTB 4C0KA 5K89A 5J3XA 1YX7A 4N1FA 2PVBA 1DT7B 3NHTA 1SY9A 4PE7A 1SNLA 5CSNA 3AAKA 3KF9A 1TNQA 4PHMA 1IJ5A 3CZ2A 2BL0C 4AOMA 3BUWB 2CT9A 2M8UA 3CGAA 1YRUB 4M2QA 5HLVA 3DVMA 2KQ6A 2MLFC 2L2EA 2A4JA 4JD9A 4L9MA 1MHOA 1YUSA 4DIRA 2BCXA 2BE6A 2PALA 1RROA 3PATA 1EL4A 4I5JA 2AUCA 1XO5A 2MHHA 3D78A 1CKKA 3EK7A 4ICBA 1SL8A 3FWBA 1KQVA 3OX5A 1EXRA 5KSZA 1MXEA 2KGBC 3DVJA 1SL7A 1FF1A 1BOCA 1L2OB 1Y1XA 3R1PA 1OOHA 3Q8IA 1NUBA 5BPJA 1J55A 1NX1A 1N2DA 2CCMA 1UP5A 3EVVA 4QJ4B 2LVIA 1DJZA 2CXJA 1CLBA 1BT6A 5IBWA 1F8HA 2EC6C 1SCVA 3BFBA 3RLZA 4M2PA 1D1OA 4OCIA 3F45A 3DZTA 3CR5X 2CTNA 5HYDA 2ZRTA 1AJ5A 1YRTB 3EVRA 1B7TY 3FS7A 2BL0B 2JXCA 3SG5A 2KI6C 2QEOA 4CLNA 4E68A 3SJSA 1KK7Y 1KSOA 2F2OA 3FIAA 1G8IA 4N5XA 3PM2A 3R1VA 3A4UB 4U8DA 2KFGA 4XJKB 5KTYA 1K2HA 1CMGA 2JT0A 2WCKA 1C7VA 1PVAA 4INWA 3L4LA 2RGIA 3TDUA 2LAPA 4NQGA 5HLOA 1QV1A 1PVBA 3LK1A 1S3PA 5HL1A 4MZJA 2WCFA 4FTGA 4A4BA 3I5GC 1XFWO 2L51A 1QVIZ 1IG5A 3O78A 1UUSA 3GK2A 1QWVA 2MBXA 4YGAA 4IL1A 1IRJA 2NCPA 3FE6A 1UHIA 2FJUB 3VRNA 1U5IB 1CMFA 3CZ0A 1CDNA 1DVIA 4GGFA 1N0YA 2EC6B 1B7TZ 1LVCD 1BJFA 1CDPA 2M7NA 3IQQA 3C1VA 3DVEA 4NDBA 1J7PA 3B6XA 3BUMB 4F0ZB 2KLDA 1RK9A 1PRWA 1K94A 2L5XB 3B88A 1GGWA 2JPOA 3PSRA 3D73A 1F55A 1DJIA 2LHIA 1JFKA 1EG4A 1DEKA 3JTDB 4HRHA 4JQ0D 5AEQA 2SCPA 1B1GA 4PHNA 1Y1UA 1M39A 2LHLA 3TDIA 4GGNA 3TUYB 1K93D 1U5IA 1W7IB 1ZOTB 3PN7C 1TWOA 5AXIA 4P5OE 3S0EA 5JJGA 2LM5A 1IIOA 2K7DA 2QEHA 3CLNA 5HKWA 2JC2A 4BY5A 4D1EA 1SL9A 3DYEA 2LANA 4JKTA 4MBEA 1XYDA 3I5GB 1DGVA 1K90D 1QASA 3EK8A 3ZWHA 1FPWA 1LXFC 3L47A 5FI6A 3VROA 5D3OA 3DVKA 3SS5A 3RZSA 3A8RA 4JWQA 1QTXA 1OZSA 4USLA 3WXAA 3SIAA 1SBJA 1SK6D 3JVTC 2K7CA 5CSJA 1F4OA 2MJWB 2MRDA 2I2RE 4YRUA 2P6BB 2L0PA 1YVHA 2WC8A 3QRXA 3WNXB 3KPXA 1UHJA 2LP2A 1CM4A 3DD4A 1OW4A 4MRYA 5FI7A 2Q4UA 1ORGA 3EKJA 1SPYA 2LE9B 2LNKA 2CNPA 3VRPA 1NCZA 2KGRA 1DF0A 1L7ZA 1W9ZA 2PSRA 3SG7A 1IQ3A 1UURA 2Y5IA 3KO0A 1K9UA 1MUXA 4CIDA 1M31A 1C7WA 1C3ZA 1CNPA 1WRZA 3O4YA 2L50A 3OHMB 4DS7A 1NCXA 5AFPA 1A4PA 1S6JA 1PSBA 2JULA 1F70A 1DJXA 1L2OC 1PSRA 2PASA 2WCJA 3B87A 3DXLA 1WRLA 3TDZA 1G4YR 4I5LB 3S0BA 1X02A 4GAOA 1KFXS 4PCWA 2KFFA 2BKIB 2JXLA 3N7HA 1SYMA 4YI8A 2BAPA 1KK8C 5I94A 1QX5B 1TNPA 1A29A 4C0JA 4YGEB 1TRFA 2KNEA 3GK4X 3PLFB 3VRRA 1FW4A 1CM1A 1GJYA 1R2UA 3PFVA 2K7OA 3D0YA 2HQWA 3FWCA 3HX4A 1IWQA 2L98A 3BUNB 4MZKA 1Y0VH 2LLUA 2M7LA 3OB1B 2LC5A 2ZNDA 3VGOA 4PHKA 1V1FA 1TOPA 1NCYA 3CABA 3UO9A 5CPVA 2M49B 1XFYO 2KAYA 1Z2CB 2F33A 1KSMA 1AUIB 3GK1A 1A2XA 4NDCA 1IJ6A 2BE4A 3EKHA 4OVNF 1RJVA 4WRIA 2QEVA 1CB1A 3VRQA 2KI4B 1EG3A 1PULA 1S26D 3BQ3A 4HRGA 3I5HB 1UHKA 2L4HA 4JPZB 2PQLA 4PALA 3IVTA 4MN0A 2KI6D 2H61A 1B8LA 2GV5A 1Y1AA 2YGUA 1GQMA 1W7JB 5CSIA 1FI6A 3KHEA 5GQQC 1NPQA 4DUQA 1OOFA 1LINA 2JU0A 5D69A 1QIWA 2FOTA 3K21A 1HQVA 3LCPC 1ZFSA 4UPGA 4GFTA 1TIZA 2NXQA 4YGBB 1WRKA 1C3YA 2ZN8A 1KK8B 1QV0A 2AMIA 1YR5A 2QPTA 4ORAB 1FBVA 3CYZA 4BY4A 1DF0B 3LLEA 4I5KA 4MZLA 3NXAA 2LLSA 2WCMA 2BECA 2K8MB 2L5YA 1KFUL 5JOLA 3AKBA 3SG3A 1PALA 1DJHA 1JC2A 1Z4HA 2HPSA 5HKYA 3O4XA 3ZNIA 2MLEC 3CZTX 5B8IB 3OP0A 3D0YB 2KQYA 3AAJA 4MVFA 2FCEA 1K95A 2K7BA 1JBAA 1CFDA 1CLMA 1QXPA 1V1GA 1K96A 2G9BA 3JTDC 4DRWA 1GM0A 1B9AA 4KYNA 4ZCUA 2H8VA 2BBMA 2EGDA 4M2OA 5G08A 3OBVA 4DCKA 2NZ0A 3PN7B 2JWWA 4AQJA 5AERA 1AVSA 1TN4A 3EVUA 1CDLA 1N65A 2BCAA 2GGMA 1XK4C 2AAOA 4ZCVA 2EHBA 3CTNA 3MSEB 2OTGC 4PT1A 3QMEA 5EL2A 1BU3A 5I8NA 2WORA 2M97A 2M0RA 3CDNA 3PM8A 1ALWA 1CFCA 1YUUA 2L2CA 1QLSA 2LUXA 4N1GA 1OMDA 2ZN9A 2NLNA 1OMRA 3D10A 1QX2A 1DGUA 2JOJA 4AQIA 2Y1MA 4CFQA 1J1EA 2LVJA 3M0WA 4MSPA 5ER5A 1DJGA 1AK8A 4GUKA 3WHUB 1DQEA 1TCFA 1TTXA 1GGZA 2TN4A 3NHIA 1C07A 4PE0A 1YURA 1T14A 1WY9A 1G33A 1SCMB 1BF5A 1UWOA 2M1KB 1DJYA 2JTTA 2WC6A 2JQ6A 3PALA 2K2FA 2Y1NA 4F7FA 2H2KA 1NIWA 1NWDA 1KQMB 1KWOB 2Y4QA 4Q04A 1M46A 3BYAA 1JWDA 4YBHB 2KLEA 1AP4A 1S5GY 1YX8A 2F8PA 3CS1A 2KAVA 4GNKB 2F3ZA 2E6WA 1WLMA 2I18A 1F54A 4YGCB 1ZMZA 2OTGB 2ZFDA 4HSZA 2QEBA 3O2PA 4PE4A 2JNFA 1WLZA 2GGZA 1DTLA 5DICA 4GBAA 2LMUA 2JNXA 1UHHA 4MEWA 3WHTB 1J7OA 1RECA 5F6TA 2I94A 1Q80A 1A75A 3TS5C 3L4AA 1EH2A 2QDIA 1J7RA 2LV7A 2IS9A 4C0LA 2BBNA 1XK4A 4QJ5B 4PDZA 3NSOA 2H61C 1SW8A 1IKUA 1SCMC 4YI9A 4HREE 1QVIY 3SS4A 1F71A 1S5GZ 3TZ1A 1IH0A 2KAXA 2LMTA 1KQMC 1IGVA 1RWYA 3SG2A 2KI4C 4XJKA 2D8NA 1S6CA 3CZ1A 5I2QA 4OV2A 1Y6WA 2DOQA 2O60A 3I5HC 1QLKA 1XA5A 2ZRSA 1MF8B 4XYNA 1BMOA 1BR4B 1R6PA 1NSHA 2K61A 2L4IA 3E3RA 1DMOA 1ALVA 1XFRA 1LA3A 2ISDA 3SG6A 2LVVA 1SMGA 2KBMA 1TCOB 1AHRA 1B8RA 1XFZO 2KYFA 4P2YB 2OS8C 1KK7Z 3S0FA 4GPLB 5CSFA 3OB2B 2MA2A 4QJ3B 4MLWA 1LS8A 1P28A 2LP3A 1K9KA 1CLLA 2KYCA 5TNCA 1QATA 1K8UA 1SR6B 4ORCB 3DY9A 2K0JA 3VB1A 2KBIA 2MAZA 4ETOA 5AANA 3D74A 1TNXA 3TS5B 1BLQA 3BUOB 2BKHB 1OOIX 3OGNA 5I2OA 4OZDA 2V53A 4OR9B 2HF5A 2JTZA 5ER4X 5DKRA 3R1OA 2KSPA 1OOJA 2KHNA 2PRUA 1OE9B 1F4QA 1MR8A 1OMVA 1TUZA 2SASA 3O6BA 1J7QA 1LKJA 4GGFC 3I5IB 5PALA 2WC5A 2M3WA 3DF0B 2WCLA 3EG5B 4YGDB 3NSLA 1S1EA 1M45A 4MRXA 1WDCB 1QX7A 3BXKA 1SRAA 1LA0A 2JT8A 1KFUS 3SG4A 1A03A 2M29A 2ERBA 2WCHA 3LK0A 1OSAA 3IF7A 1ODBA 3BOWA 2JRFA 4I5NB 2B1UA 2I7AA 2OS8B 4ORBB 3IQOA 4CFRA 1XFVO 3H4SE 3D77A 2JPTA 1XFUO 2KOTA 1AJ4A 1OZOA 1XVJA 2LVKA 1JF2A 1K9PA 1NYAA 2WCBA 3I5FC 3R72A 5FI2A 1SR6C 1OQPA 2LCPA 1NX0A 1QS7A 2Q91A 3NSKA 1BR1B 1J1DA 1QIVA 2P71A 2R2IA 3DF0A 5FYXA 1JUOA 1B4CA 2NCOA 2COLB 3SS3A 2E30A 2ZKMX 1MWNA 1QJTA 1YUTA 4A4CA 1E8AA 1OOGA 3B86A 2KPHA 1NX2A 2QACA 2O5GA 1DELA 3BJHA 4WQ2A 4WQ3A 3V2LA 4PHJA 1JFJA 1TUJA 4NDDA 5DKQA 1H8BA 1KCYA 2BCBA 3BUXB 3CWGA 5D7FA 1JSAA 4FQOA 1CFFA 2CBLA 2WCEA 4IJ7A 3I5IC 1FI5A 1KWOC 1YVLA 2PMYA 2WNDA 1DJWA 2KFHA 3HCMA 1NX3A 1WDCC 2KDHA 3CR2A 2BNXA 2LUCA 5KU1A 3EK4A 2F2PA 1CFPA 3BFHA 3D76A 3BOWB 4PE1A 2M1UA 4R1EA 3S0GA 1MXLC 3SIBA 5HKZA 1UHNA 3I5FB 1HT9A 1KFXL 1VRKA 2JT3A 3RM1A 3UNWA 1A75B 2WOSA 2HETA 2K2AA 2PYQA 2VRGA 3B7AA 2GTEA 1DC1A 1NP8A 1SSEB 2OPOA 3AKAA 1RFJA 1BG1A 3S0DA 3S0AA 1EJ3A 2FCDA 2JZIA 3GOFA
chains in the Genus database with same CATH topology
1CTRA 1PK0D 2M9GA 4OKHA 2LMVA 3OX6A 2G2BA 2HQ8A 1SKTA 3TUYC 4CPVA 1RTP1 1YTZC 1S36A 1TNWA 5DKNA 1ZACA 4TNCA 1BODA 1ZUZA 1B47A 3CR4X 1IQ5A 3ICBA 1JF0A 1B8CA 2ZNEA 3LL8B 2F3YA 5I2LA 1M63B 1CDMA 1XFXO 1S6IA 2LLTA 3NSIA 1H4BA 1MQ1A 3KEVA 4C0KA 3JVTB 5K89A 5J3XA 1YX7A 4N1FA 2PVBA 1DT7B 1SY9A 4PE7A 1SNLA 5CSNA 3AAKA 3KF9A 1TNQA 4PHMA 1IJ5A 2BL0C 4AOMA 3BUWB 2CT9A 2M8UA 3CGAA 1YRUB 4M2QA 5HLVA 3DVMA 2KQ6A 2MLFC 2L2EA 2A4JA 4L9MA 1MHOA 1YUSA 4DIRA 2BCXA 2BE6A 2PALA 1RROA 3PATA 1EL4A 4I5JA 2AUCA 1XO5A 2MHHA 1CKKA 3EK7A 4ICBA 1SL8A 3FWBA 1KQVA 3OX5A 1EXRA 5KSZA 1MXEA 2KGBC 3DVJA 1SL7A 1FF1A 1BOCA 1L2OB 1Y1XA 1NUBA 5BPJA 1J55A 1NX1A 1N2DA 2CCMA 1UP5A 3EVVA 4QJ4B 2LVIA 1DJZA 2CXJA 1CLBA 1BT6A 5IBWA 1F8HA 2EC6C 1SCVA 3RLZA 4M2PA 1D1OA 4OCIA 3F45A 3CR5X 2CTNA 5HYDA 2ZRTA 1AJ5A 1YRTB 3EVRA 1B7TY 3FS7A 2BL0B 2JXCA 3SG5A 2KI6C 4CLNA 4E68A 3SJSA 1KK7Y 1KSOA 2F2OA 3FIAA 1G8IA 4N5XA 4U8DA 3A4UB 2KFGA 4XJKB 5KTYA 1K2HA 1CMGA 2JT0A 1C7VA 1PVAA 2RGIA 3TDUA 2LAPA 4NQGA 5HLOA 1QV1A 1PVBA 3LK1A 1S3PA 4MZJA 2WCFA 4FTGA 4A4BA 3I5GC 1XFWO 2L51A 1QVIZ 1IG5A 3O78A 1UUSA 3GK2A 2MBXA 4YGAA 4IL1A 1IRJA 2NCPA 1UHIA 2FJUB 3VRNA 1U5IB 1CMFA 1CDNA 1DVIA 4GGFA 1N0YA 2EC6B 1B7TZ 1LVCD 1BJFA 1CDPA 2M7NA 3IQQA 3C1VA 3DVEA 4NDBA 1J7PA 4F0ZB 3BUMB 1RK9A 1PRWA 1K94A 2L5XB 1GGWA 3PSRA 1F55A 1DJIA 2LHIA 1JFKA 1EG4A 5AEQA 3JTDB 4HRHA 4JQ0D 1B1GA 2SCPA 4PHNA 1Y1UA 1M39A 2LHLA 3TDIA 4GGNA 3TUYB 1K93D 1U5IA 1W7IB 1ZOTB 3PN7C 5JJGA 5AXIA 4P5OE 2LM5A 2K7DA 5HKWA 3CLNA 4D1EA 2JC2A 4BY5A 1SL9A 2LANA 4MBEA 1XYDA 3I5GB 1DGVA 1K90D 1QASA 3EK8A 3ZWHA 1FPWA 1LXFC 3VROA 3DVKA 3A8RA 4JWQA 1QTXA 1OZSA 4USLA 3WXAA 3SIAA 1SBJA 1SK6D 3JVTC 2K7CA 5CSJA 1F4OA 2MJWB 2MRDA 2I2RE 4YRUA 2P6BB 2L0PA 1YVHA 2WC8A 3QRXA 3WNXB 3KPXA 1UHJA 2LP2A 1CM4A 3DD4A 4MRYA 2Q4UA 3EKJA 1SPYA 2LE9B 2LNKA 2CNPA 3VRPA 1NCZA 2KGRA 1DF0A 1L7ZA 3SG7A 2PSRA 1IQ3A 1UURA 2Y5IA 3KO0A 1K9UA 1MUXA 4CIDA 1M31A 1C7WA 1CNPA 1WRZA 3O4YA 2L50A 3OHMB 4DS7A 1NCXA 5AFPA 1A4PA 1S6JA 1PSBA 2JULA 1F70A 1DJXA 1L2OC 1PSRA 2PASA 3TDZA 1WRLA 1G4YR 4I5LB 1X02A 4GAOA 1KFXS 4PCWA 2KFFA 2BKIB 2JXLA 1SYMA 4YI8A 1KK8C 1QX5B 1TNPA 1A29A 4C0JA 4YGEB 1TRFA 2KNEA 3GK4X 3PLFB 3VRRA 1FW4A 1CM1A 1GJYA 1R2UA 3PFVA 2K7OA 3D0YA 2HQWA 3FWCA 3HX4A 1IWQA 2L98A 3BUNB 4MZKA 1Y0VH 2LLUA 2M7LA 3OB1B 2LC5A 2ZNDA 3VGOA 4PHKA 1V1FA 1TOPA 1NCYA 5CPVA 2M49B 1XFYO 2KAYA 2F33A 1KSMA 1AUIB 3GK1A 1A2XA 4NDCA 1IJ6A 2BE4A 3EKHA 4OVNF 1RJVA 4WRIA 1CB1A 3VRQA 2KI4B 1EG3A 1PULA 1S26D 3BQ3A 4HRGA 3I5HB 1UHKA 2L4HA 4JPZB 4PALA 4MN0A 2KI6D 2H61A 1B8LA 2GV5A 1Y1AA 1GQMA 1W7JB 5CSIA 1FI6A 3KHEA 5GQQC 1NPQA 4DUQA 1LINA 2JU0A 5D69A 2FOTA 1QIWA 3K21A 1HQVA 3LCPC 1ZFSA 4UPGA 4GFTA 1TIZA 2NXQA 4YGBB 1WRKA 2ZN8A 1KK8B 1QV0A 2AMIA 1YR5A 2QPTA 4ORAB 1FBVA 4BY4A 1DF0B 3LLEA 4I5KA 4MZLA 3NXAA 2LLSA 2BECA 2K8MB 1KFUL 5JOLA 3AKBA 3SG3A 1PALA 1DJHA 1JC2A 2HPSA 5HKYA 3ZNIA 2MLEC 3CZTX 5B8IB 3OP0A 3D0YB 2KQYA 3AAJA 4MVFA 2FCEA 1K95A 2K7BA 1JBAA 1CFDA 1CLMA 1QXPA 1V1GA 1K96A 2G9BA 3JTDC 4DRWA 1B9AA 4ZCUA 2BBMA 2EGDA 4M2OA 5G08A 4DCKA 5AERA 2NZ0A 3PN7B 2JWWA 4AQJA 1AVSA 1TN4A 3EVUA 1CDLA 1N65A 2BCAA 2GGMA 1XK4C 2AAOA 4ZCVA 2EHBA 3CTNA 3MSEB 2OTGC 1BU3A 5I8NA 2WORA 2M97A 2M0RA 3PM8A 1ALWA 1CFCA 1YUUA 1QLSA 2LUXA 4N1GA 1OMDA 2ZN9A 2NLNA 1OMRA 3D10A 1QX2A 1DGUA 2JOJA 4AQIA 2Y1MA 4CFQA 1J1EA 2LVJA 3M0WA 4MSPA 1DJGA 1AK8A 4GUKA 3WHUB 1TCFA 1TTXA 1GGZA 2TN4A 1C07A 4PE0A 1YURA 1WY9A 1G33A 1SCMB 1BF5A 1UWOA 2M1KB 1DJYA 2JTTA 3PALA 2JQ6A 2K2FA 2Y1NA 2H2KA 1NIWA 1NWDA 1KQMB 1KWOB 2Y4QA 4Q04A 1M46A 3BYAA 1JWDA 4YBHB 1AP4A 1S5GY 1YX8A 2F8PA 3CS1A 2KAVA 4GNKB 2F3ZA 2E6WA 1WLMA 2I18A 1F54A 4YGCB 1ZMZA 2OTGB 2ZFDA 4HSZA 3O2PA 4PE4A 2JNFA 1WLZA 2GGZA 1DTLA 4GBAA 2LMUA 2JNXA 1UHHA 4MEWA 3WHTB 1J7OA 1RECA 5F6TA 2I94A 1Q80A 1A75A 3TS5C 1EH2A 1J7RA 2LV7A 2IS9A 4C0LA 2BBNA 1XK4A 4QJ5B 4PDZA 3NSOA 2H61C 1SW8A 1IKUA 1SCMC 4YI9A 4HREE 1QVIY 1F71A 1S5GZ 3TZ1A 1IH0A 2KAXA 2LMTA 1KQMC 1IGVA 1RWYA 3SG2A 2KI4C 4XJKA 2D8NA 1S6CA 5I2QA 4OV2A 1Y6WA 2DOQA 2O60A 3I5HC 1QLKA 1XA5A 2ZRSA 1MF8B 4XYNA 1BMOA 1BR4B 1R6PA 1NSHA 2K61A 2L4IA 3E3RA 1DMOA 1ALVA 1LA3A 2ISDA 3SG6A 2LVVA 1SMGA 2KBMA 1TCOB 1AHRA 1B8RA 1XFZO 2KYFA 4P2YB 2OS8C 1KK7Z 4GPLB 5CSFA 3OB2B 2MA2A 4QJ3B 4MLWA 2LP3A 1K9KA 1CLLA 2KYCA 5TNCA 1QATA 1K8UA 1SR6B 4ORCB 2K0JA 2KBIA 2MAZA 4ETOA 5AANA 3TS5B 1TNXA 1BLQA 3BUOB 2BKHB 5I2OA 2V53A 4OR9B 2HF5A 2JTZA 5ER4X 5DKRA 2KSPA 1OOJA 2KHNA 2PRUA 1OE9B 1F4QA 1MR8A 1OMVA 1J7QA 2SASA 3O6BA 1LKJA 4GGFC 3I5IB 5PALA 2M3WA 3DF0B 4YGDB 3NSLA 1S1EA 1M45A 4MRXA 1WDCB 1QX7A 3BXKA 1SRAA 1LA0A 2JT8A 1KFUS 3SG4A 1A03A 2M29A 3LK0A 1OSAA 3IF7A 1ODBA 3BOWA 2JRFA 4I5NB 2B1UA 2I7AA 2OS8B 4ORBB 3IQOA 4CFRA 1XFVO 3H4SE 2JPTA 1XFUO 2KOTA 1AJ4A 1OZOA 1XVJA 2LVKA 1JF2A 1K9PA 1NYAA 2WCBA 3I5FC 1SR6C 1OQPA 2LCPA 1NX0A 1QS7A 2Q91A 3NSKA 1BR1B 1J1DA 1QIVA 5ER5A 2R2IA 3DF0A 5FYXA 1JUOA 1B4CA 2NCOA 2COLB 2E30A 2ZKMX 1MWNA 1QJTA 1YUTA 4A4CA 1E8AA 4WQ3A 1NX2A 2QACA 2O5GA 1JFJA 4WQ2A 4PHJA 4NDDA 5DKQA 1H8BA 1KCYA 2BCBA 3BUXB 3CWGA 5D7FA 1JSAA 4FQOA 1CFFA 2CBLA 2WCEA 3I5IC 1FI5A 1KWOC 1YVLA 2PMYA 2WNDA 1DJWA 2KFHA 3HCMA 1NX3A 1WDCC 2KDHA 3CR2A 2LUCA 5KU1A 3EK4A 2F2PA 1CFPA 3BOWB 4PE1A 2M1UA 4R1EA 1MXLC 3SIBA 5HKZA 1UHNA 3I5FB 1HT9A 1KFXL 1VRKA 2JT3A 3RM1A 1A75B 2WOSA 2HETA 2K2AA 2VRGA 1NP8A 3AKAA 2OPOA 1RFJA 1BG1A 1EJ3A 2FCDA 2JZIA 3GOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTR A;  1PK0 D;  2M9G A;  4OKH A;  2LMV A;  3OX6 A;  2G2B A;  2HQ8 A;  1SKT A;  3TUY C;  4CPV A;  1RTP 1;  1YTZ C;  1S36 A;  1TNW A;  5DKN A;  1ZAC A;  4TNC A;  1BOD A;  1ZUZ A;  1B47 A;  3CR4 X;  1IQ5 A;  3ICB A;  1JF0 A;  1B8C A;  2ZNE A;  3LL8 B;  2F3Y A;  5I2L A;  1M63 B;  1CDM A;  1XFX O;  1S6I A;  2LLT A;  3NSI A;  1H4B A;  1MQ1 A;  3KEV A;  4C0K A;  3JVT B;  5K89 A;  5J3X A;  1YX7 A;  4N1F A;  2PVB A;  1DT7 B;  1SY9 A;  4PE7 A;  1SNL A;  5CSN A;  3AAK A;  3KF9 A;  1TNQ A;  4PHM A;  1IJ5 A;  2BL0 C;  4AOM A;  3BUW B;  2CT9 A;  2M8U A;  3CGA A;  1YRU B;  4M2Q A;  5HLV A;  3DVM A;  2KQ6 A;  2MLF C;  2L2E A;  2A4J A;  4L9M A;  1MHO A;  1YUS A;  4DIR A;  2BCX A;  2BE6 A;  2PAL A;  1RRO A;  3PAT A;  1EL4 A;  4I5J A;  2AUC A;  1XO5 A;  2MHH A;  1CKK A;  3EK7 A;  4ICB A;  1SL8 A;  3FWB A;  1KQV A;  3OX5 A;  1EXR A;  5KSZ A;  1MXE A;  2KGB C;  3DVJ A;  1SL7 A;  1FF1 A;  1BOC A;  1L2O B;  1Y1X A;  1NUB A;  5BPJ A;  1J55 A;  1NX1 A;  1N2D A;  2CCM A;  1UP5 A;  3EVV A;  4QJ4 B;  2LVI A;  1DJZ A;  2CXJ A;  1CLB A;  1BT6 A;  5IBW A;  1F8H A;  2EC6 C;  1SCV A;  3RLZ A;  4M2P A;  1D1O A;  4OCI A;  3F45 A;  3CR5 X;  2CTN A;  5HYD A;  2ZRT A;  1AJ5 A;  1YRT B;  3EVR A;  1B7T Y;  3FS7 A;  2BL0 B;  2JXC A;  3SG5 A;  2KI6 C;  4CLN A;  4E68 A;  3SJS A;  1KK7 Y;  1KSO A;  2F2O A;  3FIA A;  1G8I A;  4N5X A;  4U8D A;  3A4U B;  2KFG A;  4XJK B;  5KTY A;  1K2H A;  1CMG A;  2JT0 A;  1C7V A;  1PVA A;  2RGI A;  3TDU A;  2LAP A;  4NQG A;  5HLO A;  1QV1 A;  1PVB A;  3LK1 A;  1S3P A;  4MZJ A;  2WCF A;  4FTG A;  4A4B A;  3I5G C;  1XFW O;  2L51 A;  1QVI Z;  1IG5 A;  3O78 A;  1UUS A;  3GK2 A;  2MBX A;  4YGA A;  4IL1 A;  1IRJ A;  2NCP A;  1UHI A;  2FJU B;  3VRN A;  1U5I B;  1CMF A;  1CDN A;  1DVI A;  4GGF A;  1N0Y A;  2EC6 B;  1B7T Z;  1LVC D;  1BJF A;  1CDP A;  2M7N A;  3IQQ A;  3C1V A;  3DVE A;  4NDB A;  1J7P A;  4F0Z B;  3BUM B;  1RK9 A;  1PRW A;  1K94 A;  2L5X B;  1GGW A;  3PSR A;  1F55 A;  1DJI A;  2LHI A;  1JFK A;  1EG4 A;  5AEQ A;  3JTD B;  4HRH A;  4JQ0 D;  1B1G A;  2SCP A;  4PHN A;  1Y1U A;  1M39 A;  2LHL A;  3TDI A;  4GGN A;  3TUY B;  1K93 D;  1U5I A;  1W7I B;  1ZOT B;  3PN7 C;  5JJG A;  5AXI A;  4P5O E;  2LM5 A;  2K7D A;  5HKW A;  3CLN A;  4D1E A;  2JC2 A;  4BY5 A;  1SL9 A;  2LAN A;  4MBE A;  1XYD A;  3I5G B;  1DGV A;  1K90 D;  1QAS A;  3EK8 A;  3ZWH A;  1FPW A;  1LXF C;  3VRO A;  3DVK A;  3A8R A;  4JWQ A;  1QTX A;  1OZS A;  4USL A;  3WXA A;  3SIA A;  1SBJ A;  1SK6 D;  3JVT C;  2K7C A;  5CSJ A;  1F4O A;  2MJW B;  2MRD A;  2I2R E;  4YRU A;  2P6B B;  2L0P A;  1YVH A;  2WC8 A;  3QRX A;  3WNX B;  3KPX A;  1UHJ A;  2LP2 A;  1CM4 A;  3DD4 A;  4MRY A;  2Q4U A;  3EKJ A;  1SPY A;  2LE9 B;  2LNK A;  2CNP A;  3VRP A;  1NCZ A;  2KGR A;  1DF0 A;  1L7Z A;  3SG7 A;  2PSR A;  1IQ3 A;  1UUR A;  2Y5I A;  3KO0 A;  1K9U A;  1MUX A;  4CID A;  1M31 A;  1C7W A;  1CNP A;  1WRZ A;  3O4Y A;  2L50 A;  3OHM B;  4DS7 A;  1NCX A;  5AFP A;  1A4P A;  1S6J A;  1PSB A;  2JUL A;  1F70 A;  1DJX A;  1L2O C;  1PSR A;  2PAS A;  3TDZ A;  1WRL A;  1G4Y R;  4I5L B;  1X02 A;  4GAO A;  1KFX S;  4PCW A;  2KFF A;  2BKI B;  2JXL A;  1SYM A;  4YI8 A;  1KK8 C;  1QX5 B;  1TNP A;  1A29 A;  4C0J A;  4YGE B;  1TRF A;  2KNE A;  3GK4 X;  3PLF B;  3VRR A;  1FW4 A;  1CM1 A;  1GJY A;  1R2U A;  3PFV A;  2K7O A;  3D0Y A;  2HQW A;  3FWC A;  3HX4 A;  1IWQ A;  2L98 A;  3BUN B;  4MZK A;  1Y0V H;  2LLU A;  2M7L A;  3OB1 B;  2LC5 A;  2ZND A;  3VGO A;  4PHK A;  1V1F A;  1TOP A;  1NCY A;  5CPV A;  2M49 B;  1XFY O;  2KAY A;  2F33 A;  1KSM A;  1AUI B;  3GK1 A;  1A2X A;  4NDC A;  1IJ6 A;  2BE4 A;  3EKH A;  4OVN F;  1RJV A;  4WRI A;  1CB1 A;  3VRQ A;  2KI4 B;  1EG3 A;  1PUL A;  1S26 D;  3BQ3 A;  4HRG A;  3I5H B;  1UHK A;  2L4H A;  4JPZ B;  4PAL A;  4MN0 A;  2KI6 D;  2H61 A;  1B8L A;  2GV5 A;  1Y1A A;  1GQM A;  1W7J B;  5CSI A;  1FI6 A;  3KHE A;  5GQQ C;  1NPQ A;  4DUQ A;  1LIN A;  2JU0 A;  5D69 A;  2FOT A;  1QIW A;  3K21 A;  1HQV A;  3LCP C;  1ZFS A;  4UPG A;  4GFT A;  1TIZ A;  2NXQ A;  4YGB B;  1WRK A;  2ZN8 A;  1KK8 B;  1QV0 A;  2AMI A;  1YR5 A;  2QPT A;  4ORA B;  1FBV A;  4BY4 A;  1DF0 B;  3LLE A;  4I5K A;  4MZL A;  3NXA A;  2LLS A;  2BEC A;  2K8M B;  1KFU L;  5JOL A;  3AKB A;  3SG3 A;  1PAL A;  1DJH A;  1JC2 A;  2HPS A;  5HKY A;  3ZNI A;  2MLE C;  3CZT X;  5B8I B;  3OP0 A;  3D0Y B;  2KQY A;  3AAJ A;  4MVF A;  2FCE A;  1K95 A;  2K7B A;  1JBA A;  1CFD A;  1CLM A;  1QXP A;  1V1G A;  1K96 A;  2G9B A;  3JTD C;  4DRW A;  1B9A A;  4ZCU A;  2BBM A;  2EGD A;  4M2O A;  5G08 A;  4DCK A;  5AER A;  2NZ0 A;  3PN7 B;  2JWW A;  4AQJ A;  1AVS A;  1TN4 A;  3EVU A;  1CDL A;  1N65 A;  2BCA A;  2GGM A;  1XK4 C;  2AAO A;  4ZCV A;  2EHB A;  3CTN A;  3MSE B;  2OTG C;  1BU3 A;  5I8N A;  2WOR A;  2M97 A;  2M0R A;  3PM8 A;  1ALW A;  1CFC A;  1YUU A;  1QLS A;  2LUX A;  4N1G A;  1OMD A;  2ZN9 A;  2NLN A;  1OMR A;  3D10 A;  1QX2 A;  1DGU A;  2JOJ A;  4AQI A;  2Y1M A;  4CFQ A;  1J1E A;  2LVJ A;  3M0W A;  4MSP A;  1DJG A;  1AK8 A;  4GUK A;  3WHU B;  1TCF A;  1TTX A;  1GGZ A;  2TN4 A;  1C07 A;  4PE0 A;  1YUR A;  1WY9 A;  1G33 A;  1SCM B;  1BF5 A;  1UWO A;  2M1K B;  1DJY A;  2JTT A;  3PAL A;  2JQ6 A;  2K2F A;  2Y1N A;  2H2K A;  1NIW A;  1NWD A;  1KQM B;  1KWO B;  2Y4Q A;  4Q04 A;  1M46 A;  3BYA A;  1JWD A;  4YBH B;  1AP4 A;  1S5G Y;  1YX8 A;  2F8P A;  3CS1 A;  2KAV A;  4GNK B;  2F3Z A;  2E6W A;  1WLM A;  2I18 A;  1F54 A;  4YGC B;  1ZMZ A;  2OTG B;  2ZFD A;  4HSZ A;  3O2P A;  4PE4 A;  2JNF A;  1WLZ A;  2GGZ A;  1DTL A;  4GBA A;  2LMU A;  2JNX A;  1UHH A;  4MEW A;  3WHT B;  1J7O A;  1REC A;  5F6T A;  2I94 A;  1Q80 A;  1A75 A;  3TS5 C;  1EH2 A;  1J7R A;  2LV7 A;  2IS9 A;  4C0L A;  2BBN A;  1XK4 A;  4QJ5 B;  4PDZ A;  3NSO A;  2H61 C;  1SW8 A;  1IKU A;  1SCM C;  4YI9 A;  4HRE E;  1QVI Y;  1F71 A;  1S5G Z;  3TZ1 A;  1IH0 A;  2KAX A;  2LMT A;  1KQM C;  1IGV A;  1RWY A;  3SG2 A;  2KI4 C;  4XJK A;  2D8N A;  1S6C A;  5I2Q A;  4OV2 A;  1Y6W A;  2DOQ A;  2O60 A;  3I5H C;  1QLK A;  1XA5 A;  2ZRS A;  1MF8 B;  4XYN A;  1BMO A;  1BR4 B;  1R6P A;  1NSH A;  2K61 A;  2L4I A;  3E3R A;  1DMO A;  1ALV A;  1LA3 A;  2ISD A;  3SG6 A;  2LVV A;  1SMG A;  2KBM A;  1TCO B;  1AHR A;  1B8R A;  1XFZ O;  2KYF A;  4P2Y B;  2OS8 C;  1KK7 Z;  4GPL B;  5CSF A;  3OB2 B;  2MA2 A;  4QJ3 B;  4MLW A;  2LP3 A;  1K9K A;  1CLL A;  2KYC A;  5TNC A;  1QAT A;  1K8U A;  1SR6 B;  4ORC B;  2K0J A;  2KBI A;  2MAZ A;  4ETO A;  5AAN A;  3TS5 B;  1TNX A;  1BLQ A;  3BUO B;  2BKH B;  5I2O A;  2V53 A;  4OR9 B;  2HF5 A;  2JTZ A;  5ER4 X;  5DKR A;  2KSP A;  1OOJ A;  2KHN A;  2PRU A;  1OE9 B;  1F4Q A;  1MR8 A;  1OMV A;  1J7Q A;  2SAS A;  3O6B A;  1LKJ A;  4GGF C;  3I5I B;  5PAL A;  2M3W A;  3DF0 B;  4YGD B;  3NSL A;  1S1E A;  1M45 A;  4MRX A;  1WDC B;  1QX7 A;  3BXK A;  1SRA A;  1LA0 A;  2JT8 A;  1KFU S;  3SG4 A;  1A03 A;  2M29 A;  3LK0 A;  1OSA A;  3IF7 A;  1ODB A;  3BOW A;  2JRF A;  4I5N B;  2B1U A;  2I7A A;  2OS8 B;  4ORB B;  3IQO A;  4CFR A;  1XFV O;  3H4S E;  2JPT A;  1XFU O;  2KOT A;  1AJ4 A;  1OZO A;  1XVJ A;  2LVK A;  1JF2 A;  1K9P A;  1NYA A;  2WCB A;  3I5F C;  1SR6 C;  1OQP A;  2LCP A;  1NX0 A;  1QS7 A;  2Q91 A;  3NSK A;  1BR1 B;  1J1D A;  1QIV A;  5ER5 A;  2R2I A;  3DF0 A;  5FYX A;  1JUO A;  1B4C A;  2NCO A;  2COL B;  2E30 A;  2ZKM X;  1MWN A;  1QJT A;  1YUT A;  4A4C A;  1E8A A;  4WQ3 A;  1NX2 A;  2QAC A;  2O5G A;  1JFJ A;  4WQ2 A;  4PHJ A;  4NDD A;  5DKQ A;  1H8B A;  1KCY A;  2BCB A;  3BUX B;  3CWG A;  5D7F A;  1JSA A;  4FQO A;  1CFF A;  2CBL A;  2WCE A;  3I5I C;  1FI5 A;  1KWO C;  1YVL A;  2PMY A;  2WND A;  1DJW A;  2KFH A;  3HCM A;  1NX3 A;  1WDC C;  2KDH A;  3CR2 A;  2LUC A;  5KU1 A;  3EK4 A;  2F2P A;  1CFP A;  3BOW B;  4PE1 A;  2M1U A;  4R1E A;  1MXL C;  3SIB A;  5HKZ A;  1UHN A;  3I5F B;  1HT9 A;  1KFX L;  1VRK A;  2JT3 A;  3RM1 A;  1A75 B;  2WOS A;  2HET A;  2K2A A;  2VRG A;  1NP8 A;  3AKA A;  2OPO A;  1RFJ A;  1BG1 A;  1EJ3 A;  2FCD A;  2JZI A;  3GOF A; 
#chains in the Genus database with same CATH topology
 1CTR A;  1PK0 D;  3BFA A;  2M9G A;  3NGV A;  4OKH A;  2LMV A;  3OX6 A;  2G2B A;  2HQ8 A;  1SKT A;  3TUY C;  4CPV A;  1RTP 1;  1YTZ C;  1S36 A;  1TNW A;  3FE8 A;  1ZAC A;  5DKN A;  4TNC A;  1BOD A;  1ZUZ A;  4FQT A;  4INX A;  1B47 A;  2P70 A;  3CR4 X;  3K1E A;  1IQ5 A;  3ICB A;  1JF0 A;  1B8C A;  2ZNE A;  3D75 A;  2F3Y A;  3LL8 B;  5I2L A;  1M63 B;  1CDM A;  1XFX O;  1S6I A;  2LLT A;  3FE9 A;  3NSI A;  1MQ1 A;  3PJI A;  1H4B A;  2K60 A;  3KEV A;  2FJY A;  3JVT B;  4C0K A;  5K89 A;  5J3X A;  1YX7 A;  4N1F A;  2PVB A;  1DT7 B;  3NHT A;  1SY9 A;  4PE7 A;  1SNL A;  5CSN A;  3AAK A;  3KF9 A;  1TNQ A;  4PHM A;  1IJ5 A;  3CZ2 A;  2BL0 C;  4AOM A;  3BUW B;  2CT9 A;  2M8U A;  3CGA A;  1YRU B;  4M2Q A;  5HLV A;  3DVM A;  2KQ6 A;  2MLF C;  2L2E A;  2A4J A;  4JD9 A;  4L9M A;  1MHO A;  1YUS A;  4DIR A;  2BCX A;  2BE6 A;  2PAL A;  1RRO A;  3PAT A;  1EL4 A;  4I5J A;  2AUC A;  1XO5 A;  2MHH A;  3D78 A;  1CKK A;  3EK7 A;  4ICB A;  1SL8 A;  3FWB A;  1KQV A;  3OX5 A;  1EXR A;  5KSZ A;  1MXE A;  2KGB C;  3DVJ A;  1SL7 A;  1FF1 A;  1BOC A;  1L2O B;  1Y1X A;  3R1P A;  1OOH A;  3Q8I A;  1NUB A;  5BPJ A;  1J55 A;  1NX1 A;  1N2D A;  2CCM A;  1UP5 A;  3EVV A;  4QJ4 B;  2LVI A;  1DJZ A;  2CXJ A;  1CLB A;  1BT6 A;  5IBW A;  1F8H A;  2EC6 C;  1SCV A;  3BFB A;  3RLZ A;  4M2P A;  1D1O A;  4OCI A;  3F45 A;  3DZT A;  3CR5 X;  2CTN A;  5HYD A;  2ZRT A;  1AJ5 A;  1YRT B;  3EVR A;  1B7T Y;  3FS7 A;  2BL0 B;  2JXC A;  3SG5 A;  2KI6 C;  2QEO A;  4CLN A;  4E68 A;  3SJS A;  1KK7 Y;  1KSO A;  2F2O A;  3FIA A;  1G8I A;  4N5X A;  3PM2 A;  3R1V A;  3A4U B;  4U8D A;  2KFG A;  4XJK B;  5KTY A;  1K2H A;  1CMG A;  2JT0 A;  2WCK A;  1C7V A;  1PVA A;  4INW A;  3L4L A;  2RGI A;  3TDU A;  2LAP A;  4NQG A;  5HLO A;  1QV1 A;  1PVB A;  3LK1 A;  1S3P A;  5HL1 A;  4MZJ A;  2WCF A;  4FTG A;  4A4B A;  3I5G C;  1XFW O;  2L51 A;  1QVI Z;  1IG5 A;  3O78 A;  1UUS A;  3GK2 A;  1QWV A;  2MBX A;  4YGA A;  4IL1 A;  1IRJ A;  2NCP A;  3FE6 A;  1UHI A;  2FJU B;  3VRN A;  1U5I B;  1CMF A;  3CZ0 A;  1CDN A;  1DVI A;  4GGF A;  1N0Y A;  2EC6 B;  1B7T Z;  1LVC D;  1BJF A;  1CDP A;  2M7N A;  3IQQ A;  3C1V A;  3DVE A;  4NDB A;  1J7P A;  3B6X A;  3BUM B;  4F0Z B;  2KLD A;  1RK9 A;  1PRW A;  1K94 A;  2L5X B;  3B88 A;  1GGW A;  2JPO A;  3PSR A;  3D73 A;  1F55 A;  1DJI A;  2LHI A;  1JFK A;  1EG4 A;  1DEK A;  3JTD B;  4HRH A;  4JQ0 D;  5AEQ A;  2SCP A;  1B1G A;  4PHN A;  1Y1U A;  1M39 A;  2LHL A;  3TDI A;  4GGN A;  3TUY B;  1K93 D;  1U5I A;  1W7I B;  1ZOT B;  3PN7 C;  1TWO A;  5AXI A;  4P5O E;  3S0E A;  5JJG A;  2LM5 A;  1IIO A;  2K7D A;  2QEH A;  3CLN A;  5HKW A;  2JC2 A;  4BY5 A;  4D1E A;  1SL9 A;  3DYE A;  2LAN A;  4JKT A;  4MBE A;  1XYD A;  3I5G B;  1DGV A;  1K90 D;  1QAS A;  3EK8 A;  3ZWH A;  1FPW A;  1LXF C;  3L47 A;  5FI6 A;  3VRO A;  5D3O A;  3DVK A;  3SS5 A;  3RZS A;  3A8R A;  4JWQ A;  1QTX A;  1OZS A;  4USL A;  3WXA A;  3SIA A;  1SBJ A;  1SK6 D;  3JVT C;  2K7C A;  5CSJ A;  1F4O A;  2MJW B;  2MRD A;  2I2R E;  4YRU A;  2P6B B;  2L0P A;  1YVH A;  2WC8 A;  3QRX A;  3WNX B;  3KPX A;  1UHJ A;  2LP2 A;  1CM4 A;  3DD4 A;  1OW4 A;  4MRY A;  5FI7 A;  2Q4U A;  1ORG A;  3EKJ A;  1SPY A;  2LE9 B;  2LNK A;  2CNP A;  3VRP A;  1NCZ A;  2KGR A;  1DF0 A;  1L7Z A;  1W9Z A;  2PSR A;  3SG7 A;  1IQ3 A;  1UUR A;  2Y5I A;  3KO0 A;  1K9U A;  1MUX A;  4CID A;  1M31 A;  1C7W A;  1C3Z A;  1CNP A;  1WRZ A;  3O4Y A;  2L50 A;  3OHM B;  4DS7 A;  1NCX A;  5AFP A;  1A4P A;  1S6J A;  1PSB A;  2JUL A;  1F70 A;  1DJX A;  1L2O C;  1PSR A;  2PAS A;  2WCJ A;  3B87 A;  3DXL A;  1WRL A;  3TDZ A;  1G4Y R;  4I5L B;  3S0B A;  1X02 A;  4GAO A;  1KFX S;  4PCW A;  2KFF A;  2BKI B;  2JXL A;  3N7H A;  1SYM A;  4YI8 A;  2BAP A;  1KK8 C;  5I94 A;  1QX5 B;  1TNP A;  1A29 A;  4C0J A;  4YGE B;  1TRF A;  2KNE A;  3GK4 X;  3PLF B;  3VRR A;  1FW4 A;  1CM1 A;  1GJY A;  1R2U A;  3PFV A;  2K7O A;  3D0Y A;  2HQW A;  3FWC A;  3HX4 A;  1IWQ A;  2L98 A;  3BUN B;  4MZK A;  1Y0V H;  2LLU A;  2M7L A;  3OB1 B;  2LC5 A;  2ZND A;  3VGO A;  4PHK A;  1V1F A;  1TOP A;  1NCY A;  3CAB A;  3UO9 A;  5CPV A;  2M49 B;  1XFY O;  2KAY A;  1Z2C B;  2F33 A;  1KSM A;  1AUI B;  3GK1 A;  1A2X A;  4NDC A;  1IJ6 A;  2BE4 A;  3EKH A;  4OVN F;  1RJV A;  4WRI A;  2QEV A;  1CB1 A;  3VRQ A;  2KI4 B;  1EG3 A;  1PUL A;  1S26 D;  3BQ3 A;  4HRG A;  3I5H B;  1UHK A;  2L4H A;  4JPZ B;  2PQL A;  4PAL A;  3IVT A;  4MN0 A;  2KI6 D;  2H61 A;  1B8L A;  2GV5 A;  1Y1A A;  2YGU A;  1GQM A;  1W7J B;  5CSI A;  1FI6 A;  3KHE A;  5GQQ C;  1NPQ A;  4DUQ A;  1OOF A;  1LIN A;  2JU0 A;  5D69 A;  1QIW A;  2FOT A;  3K21 A;  1HQV A;  3LCP C;  1ZFS A;  4UPG A;  4GFT A;  1TIZ A;  2NXQ A;  4YGB B;  1WRK A;  1C3Y A;  2ZN8 A;  1KK8 B;  1QV0 A;  2AMI A;  1YR5 A;  2QPT A;  4ORA B;  1FBV A;  3CYZ A;  4BY4 A;  1DF0 B;  3LLE A;  4I5K A;  4MZL A;  3NXA A;  2LLS A;  2WCM A;  2BEC A;  2K8M B;  2L5Y A;  1KFU L;  5JOL A;  3AKB A;  3SG3 A;  1PAL A;  1DJH A;  1JC2 A;  1Z4H A;  2HPS A;  5HKY A;  3O4X A;  3ZNI A;  2MLE C;  3CZT X;  5B8I B;  3OP0 A;  3D0Y B;  2KQY A;  3AAJ A;  4MVF A;  2FCE A;  1K95 A;  2K7B A;  1JBA A;  1CFD A;  1CLM A;  1QXP A;  1V1G A;  1K96 A;  2G9B A;  3JTD C;  4DRW A;  1GM0 A;  1B9A A;  4KYN A;  4ZCU A;  2H8V A;  2BBM A;  2EGD A;  4M2O A;  5G08 A;  3OBV A;  4DCK A;  2NZ0 A;  3PN7 B;  2JWW A;  4AQJ A;  5AER A;  1AVS A;  1TN4 A;  3EVU A;  1CDL A;  1N65 A;  2BCA A;  2GGM A;  1XK4 C;  2AAO A;  4ZCV A;  2EHB A;  3CTN A;  3MSE B;  2OTG C;  4PT1 A;  3QME A;  5EL2 A;  1BU3 A;  5I8N A;  2WOR A;  2M97 A;  2M0R A;  3CDN A;  3PM8 A;  1ALW A;  1CFC A;  1YUU A;  2L2C A;  1QLS A;  2LUX A;  4N1G A;  1OMD A;  2ZN9 A;  2NLN A;  1OMR A;  3D10 A;  1QX2 A;  1DGU A;  2JOJ A;  4AQI A;  2Y1M A;  4CFQ A;  1J1E A;  2LVJ A;  3M0W A;  4MSP A;  5ER5 A;  1DJG A;  1AK8 A;  4GUK A;  3WHU B;  1DQE A;  1TCF A;  1TTX A;  1GGZ A;  2TN4 A;  3NHI A;  1C07 A;  4PE0 A;  1YUR A;  1T14 A;  1WY9 A;  1G33 A;  1SCM B;  1BF5 A;  1UWO A;  2M1K B;  1DJY A;  2JTT A;  2WC6 A;  2JQ6 A;  3PAL A;  2K2F A;  2Y1N A;  4F7F A;  2H2K A;  1NIW A;  1NWD A;  1KQM B;  1KWO B;  2Y4Q A;  4Q04 A;  1M46 A;  3BYA A;  1JWD A;  4YBH B;  2KLE A;  1AP4 A;  1S5G Y;  1YX8 A;  2F8P A;  3CS1 A;  2KAV A;  4GNK B;  2F3Z A;  2E6W A;  1WLM A;  2I18 A;  1F54 A;  4YGC B;  1ZMZ A;  2OTG B;  2ZFD A;  4HSZ A;  2QEB A;  3O2P A;  4PE4 A;  2JNF A;  1WLZ A;  2GGZ A;  1DTL A;  5DIC A;  4GBA A;  2LMU A;  2JNX A;  1UHH A;  4MEW A;  3WHT B;  1J7O A;  1REC A;  5F6T A;  2I94 A;  1Q80 A;  1A75 A;  3TS5 C;  3L4A A;  1EH2 A;  2QDI A;  1J7R A;  2LV7 A;  2IS9 A;  4C0L A;  2BBN A;  1XK4 A;  4QJ5 B;  4PDZ A;  3NSO A;  2H61 C;  1SW8 A;  1IKU A;  1SCM C;  4YI9 A;  4HRE E;  1QVI Y;  3SS4 A;  1F71 A;  1S5G Z;  3TZ1 A;  1IH0 A;  2KAX A;  2LMT A;  1KQM C;  1IGV A;  1RWY A;  3SG2 A;  2KI4 C;  4XJK A;  2D8N A;  1S6C A;  3CZ1 A;  5I2Q A;  4OV2 A;  1Y6W A;  2DOQ A;  2O60 A;  3I5H C;  1QLK A;  1XA5 A;  2ZRS A;  1MF8 B;  4XYN A;  1BMO A;  1BR4 B;  1R6P A;  1NSH A;  2K61 A;  2L4I A;  3E3R A;  1DMO A;  1ALV A;  1XFR A;  1LA3 A;  2ISD A;  3SG6 A;  2LVV A;  1SMG A;  2KBM A;  1TCO B;  1AHR A;  1B8R A;  1XFZ O;  2KYF A;  4P2Y B;  2OS8 C;  1KK7 Z;  3S0F A;  4GPL B;  5CSF A;  3OB2 B;  2MA2 A;  4QJ3 B;  4MLW A;  1LS8 A;  1P28 A;  2LP3 A;  1K9K A;  1CLL A;  2KYC A;  5TNC A;  1QAT A;  1K8U A;  1SR6 B;  4ORC B;  3DY9 A;  2K0J A;  3VB1 A;  2KBI A;  2MAZ A;  4ETO A;  5AAN A;  3D74 A;  1TNX A;  3TS5 B;  1BLQ A;  3BUO B;  2BKH B;  1OOI X;  3OGN A;  5I2O A;  4OZD A;  2V53 A;  4OR9 B;  2HF5 A;  2JTZ A;  5ER4 X;  5DKR A;  3R1O A;  2KSP A;  1OOJ A;  2KHN A;  2PRU A;  1OE9 B;  1F4Q A;  1MR8 A;  1OMV A;  1TUZ A;  2SAS A;  3O6B A;  1J7Q A;  1LKJ A;  4GGF C;  3I5I B;  5PAL A;  2WC5 A;  2M3W A;  3DF0 B;  2WCL A;  3EG5 B;  4YGD B;  3NSL A;  1S1E A;  1M45 A;  4MRX A;  1WDC B;  1QX7 A;  3BXK A;  1SRA A;  1LA0 A;  2JT8 A;  1KFU S;  3SG4 A;  1A03 A;  2M29 A;  2ERB A;  2WCH A;  3LK0 A;  1OSA A;  3IF7 A;  1ODB A;  3BOW A;  2JRF A;  4I5N B;  2B1U A;  2I7A A;  2OS8 B;  4ORB B;  3IQO A;  4CFR A;  1XFV O;  3H4S E;  3D77 A;  2JPT A;  1XFU O;  2KOT A;  1AJ4 A;  1OZO A;  1XVJ A;  2LVK A;  1JF2 A;  1K9P A;  1NYA A;  2WCB A;  3I5F C;  3R72 A;  5FI2 A;  1SR6 C;  1OQP A;  2LCP A;  1NX0 A;  1QS7 A;  2Q91 A;  3NSK A;  1BR1 B;  1J1D A;  1QIV A;  2P71 A;  2R2I A;  3DF0 A;  5FYX A;  1JUO A;  1B4C A;  2NCO A;  2COL B;  3SS3 A;  2E30 A;  2ZKM X;  1MWN A;  1QJT A;  1YUT A;  4A4C A;  1E8A A;  1OOG A;  3B86 A;  2KPH A;  1NX2 A;  2QAC A;  2O5G A;  1DEL A;  3BJH A;  4WQ2 A;  4WQ3 A;  3V2L A;  4PHJ A;  1JFJ A;  1TUJ A;  4NDD A;  5DKQ A;  1H8B A;  1KCY A;  2BCB A;  3BUX B;  3CWG A;  5D7F A;  1JSA A;  4FQO A;  1CFF A;  2CBL A;  2WCE A;  4IJ7 A;  3I5I C;  1FI5 A;  1KWO C;  1YVL A;  2PMY A;  2WND A;  1DJW A;  2KFH A;  3HCM A;  1NX3 A;  1WDC C;  2KDH A;  3CR2 A;  2BNX A;  2LUC A;  5KU1 A;  3EK4 A;  2F2P A;  1CFP A;  3BFH A;  3D76 A;  3BOW B;  4PE1 A;  2M1U A;  4R1E A;  3S0G A;  1MXL C;  3SIB A;  5HKZ A;  1UHN A;  3I5F B;  1HT9 A;  1KFX L;  1VRK A;  2JT3 A;  3RM1 A;  3UNW A;  1A75 B;  2WOS A;  2HET A;  2K2A A;  2PYQ A;  2VRG A;  3B7A A;  2GTE A;  1DC1 A;  1NP8 A;  1SSE B;  2OPO A;  3AKA A;  1RFJ A;  1BG1 A;  3S0D A;  3S0A A;  1EJ3 A;  2FCD A;  2JZI A;  3GOF A; 
#chains in the Genus database with same CATH homology
 1CTR A;  1PK0 D;  2M9G A;  4OKH A;  2LMV A;  3OX6 A;  2G2B A;  2HQ8 A;  1SKT A;  3TUY C;  4CPV A;  1RTP 1;  1YTZ C;  1S36 A;  1TNW A;  5DKN A;  1ZAC A;  4TNC A;  1BOD A;  1ZUZ A;  1B47 A;  3CR4 X;  1IQ5 A;  3ICB A;  1JF0 A;  1B8C A;  2ZNE A;  3LL8 B;  2F3Y A;  5I2L A;  1M63 B;  1CDM A;  1XFX O;  1S6I A;  2LLT A;  3NSI A;  1H4B A;  1MQ1 A;  3KEV A;  4C0K A;  3JVT B;  5K89 A;  5J3X A;  1YX7 A;  4N1F A;  2PVB A;  1DT7 B;  1SY9 A;  4PE7 A;  1SNL A;  5CSN A;  3AAK A;  3KF9 A;  1TNQ A;  4PHM A;  1IJ5 A;  2BL0 C;  4AOM A;  3BUW B;  2CT9 A;  2M8U A;  3CGA A;  1YRU B;  4M2Q A;  5HLV A;  3DVM A;  2KQ6 A;  2MLF C;  2L2E A;  2A4J A;  4L9M A;  1MHO A;  1YUS A;  4DIR A;  2BCX A;  2BE6 A;  2PAL A;  1RRO A;  3PAT A;  1EL4 A;  4I5J A;  2AUC A;  1XO5 A;  2MHH A;  1CKK A;  3EK7 A;  4ICB A;  1SL8 A;  3FWB A;  1KQV A;  3OX5 A;  1EXR A;  5KSZ A;  1MXE A;  2KGB C;  3DVJ A;  1SL7 A;  1FF1 A;  1BOC A;  1L2O B;  1Y1X A;  1NUB A;  5BPJ A;  1J55 A;  1NX1 A;  1N2D A;  2CCM A;  1UP5 A;  3EVV A;  4QJ4 B;  2LVI A;  1DJZ A;  2CXJ A;  1CLB A;  1BT6 A;  5IBW A;  1F8H A;  2EC6 C;  1SCV A;  3RLZ A;  4M2P A;  1D1O A;  4OCI A;  3F45 A;  3CR5 X;  2CTN A;  5HYD A;  2ZRT A;  1AJ5 A;  1YRT B;  3EVR A;  1B7T Y;  3FS7 A;  2BL0 B;  2JXC A;  3SG5 A;  2KI6 C;  4CLN A;  4E68 A;  3SJS A;  1KK7 Y;  1KSO A;  2F2O A;  3FIA A;  1G8I A;  4N5X A;  4U8D A;  3A4U B;  2KFG A;  4XJK B;  5KTY A;  1K2H A;  1CMG A;  2JT0 A;  1C7V A;  1PVA A;  2RGI A;  3TDU A;  2LAP A;  4NQG A;  5HLO A;  1QV1 A;  1PVB A;  3LK1 A;  1S3P A;  4MZJ A;  2WCF A;  4FTG A;  4A4B A;  3I5G C;  1XFW O;  2L51 A;  1QVI Z;  1IG5 A;  3O78 A;  1UUS A;  3GK2 A;  2MBX A;  4YGA A;  4IL1 A;  1IRJ A;  2NCP A;  1UHI A;  2FJU B;  3VRN A;  1U5I B;  1CMF A;  1CDN A;  1DVI A;  4GGF A;  1N0Y A;  2EC6 B;  1B7T Z;  1LVC D;  1BJF A;  1CDP A;  2M7N A;  3IQQ A;  3C1V A;  3DVE A;  4NDB A;  1J7P A;  4F0Z B;  3BUM B;  1RK9 A;  1PRW A;  1K94 A;  2L5X B;  1GGW A;  3PSR A;  1F55 A;  1DJI A;  2LHI A;  1JFK A;  1EG4 A;  5AEQ A;  3JTD B;  4HRH A;  4JQ0 D;  1B1G A;  2SCP A;  4PHN A;  1Y1U A;  1M39 A;  2LHL A;  3TDI A;  4GGN A;  3TUY B;  1K93 D;  1U5I A;  1W7I B;  1ZOT B;  3PN7 C;  5JJG A;  5AXI A;  4P5O E;  2LM5 A;  2K7D A;  5HKW A;  3CLN A;  4D1E A;  2JC2 A;  4BY5 A;  1SL9 A;  2LAN A;  4MBE A;  1XYD A;  3I5G B;  1DGV A;  1K90 D;  1QAS A;  3EK8 A;  3ZWH A;  1FPW A;  1LXF C;  3VRO A;  3DVK A;  3A8R A;  4JWQ A;  1QTX A;  1OZS A;  4USL A;  3WXA A;  3SIA A;  1SBJ A;  1SK6 D;  3JVT C;  2K7C A;  5CSJ A;  1F4O A;  2MJW B;  2MRD A;  2I2R E;  4YRU A;  2P6B B;  2L0P A;  1YVH A;  2WC8 A;  3QRX A;  3WNX B;  3KPX A;  1UHJ A;  2LP2 A;  1CM4 A;  3DD4 A;  4MRY A;  2Q4U A;  3EKJ A;  1SPY A;  2LE9 B;  2LNK A;  2CNP A;  3VRP A;  1NCZ A;  2KGR A;  1DF0 A;  1L7Z A;  3SG7 A;  2PSR A;  1IQ3 A;  1UUR A;  2Y5I A;  3KO0 A;  1K9U A;  1MUX A;  4CID A;  1M31 A;  1C7W A;  1CNP A;  1WRZ A;  3O4Y A;  2L50 A;  3OHM B;  4DS7 A;  1NCX A;  5AFP A;  1A4P A;  1S6J A;  1PSB A;  2JUL A;  1F70 A;  1DJX A;  1L2O C;  1PSR A;  2PAS A;  3TDZ A;  1WRL A;  1G4Y R;  4I5L B;  1X02 A;  4GAO A;  1KFX S;  4PCW A;  2KFF A;  2BKI B;  2JXL A;  1SYM A;  4YI8 A;  1KK8 C;  1QX5 B;  1TNP A;  1A29 A;  4C0J A;  4YGE B;  1TRF A;  2KNE A;  3GK4 X;  3PLF B;  3VRR A;  1FW4 A;  1CM1 A;  1GJY A;  1R2U A;  3PFV A;  2K7O A;  3D0Y A;  2HQW A;  3FWC A;  3HX4 A;  1IWQ A;  2L98 A;  3BUN B;  4MZK A;  1Y0V H;  2LLU A;  2M7L A;  3OB1 B;  2LC5 A;  2ZND A;  3VGO A;  4PHK A;  1V1F A;  1TOP A;  1NCY A;  5CPV A;  2M49 B;  1XFY O;  2KAY A;  2F33 A;  1KSM A;  1AUI B;  3GK1 A;  1A2X A;  4NDC A;  1IJ6 A;  2BE4 A;  3EKH A;  4OVN F;  1RJV A;  4WRI A;  1CB1 A;  3VRQ A;  2KI4 B;  1EG3 A;  1PUL A;  1S26 D;  3BQ3 A;  4HRG A;  3I5H B;  1UHK A;  2L4H A;  4JPZ B;  4PAL A;  4MN0 A;  2KI6 D;  2H61 A;  1B8L A;  2GV5 A;  1Y1A A;  1GQM A;  1W7J B;  5CSI A;  1FI6 A;  3KHE A;  5GQQ C;  1NPQ A;  4DUQ A;  1LIN A;  2JU0 A;  5D69 A;  2FOT A;  1QIW A;  3K21 A;  1HQV A;  3LCP C;  1ZFS A;  4UPG A;  4GFT A;  1TIZ A;  2NXQ A;  4YGB B;  1WRK A;  2ZN8 A;  1KK8 B;  1QV0 A;  2AMI A;  1YR5 A;  2QPT A;  4ORA B;  1FBV A;  4BY4 A;  1DF0 B;  3LLE A;  4I5K A;  4MZL A;  3NXA A;  2LLS A;  2BEC A;  2K8M B;  1KFU L;  5JOL A;  3AKB A;  3SG3 A;  1PAL A;  1DJH A;  1JC2 A;  2HPS A;  5HKY A;  3ZNI A;  2MLE C;  3CZT X;  5B8I B;  3OP0 A;  3D0Y B;  2KQY A;  3AAJ A;  4MVF A;  2FCE A;  1K95 A;  2K7B A;  1JBA A;  1CFD A;  1CLM A;  1QXP A;  1V1G A;  1K96 A;  2G9B A;  3JTD C;  4DRW A;  1B9A A;  4ZCU A;  2BBM A;  2EGD A;  4M2O A;  5G08 A;  4DCK A;  5AER A;  2NZ0 A;  3PN7 B;  2JWW A;  4AQJ A;  1AVS A;  1TN4 A;  3EVU A;  1CDL A;  1N65 A;  2BCA A;  2GGM A;  1XK4 C;  2AAO A;  4ZCV A;  2EHB A;  3CTN A;  3MSE B;  2OTG C;  1BU3 A;  5I8N A;  2WOR A;  2M97 A;  2M0R A;  3PM8 A;  1ALW A;  1CFC A;  1YUU A;  1QLS A;  2LUX A;  4N1G A;  1OMD A;  2ZN9 A;  2NLN A;  1OMR A;  3D10 A;  1QX2 A;  1DGU A;  2JOJ A;  4AQI A;  2Y1M A;  4CFQ A;  1J1E A;  2LVJ A;  3M0W A;  4MSP A;  1DJG A;  1AK8 A;  4GUK A;  3WHU B;  1TCF A;  1TTX A;  1GGZ A;  2TN4 A;  1C07 A;  4PE0 A;  1YUR A;  1WY9 A;  1G33 A;  1SCM B;  1BF5 A;  1UWO A;  2M1K B;  1DJY A;  2JTT A;  3PAL A;  2JQ6 A;  2K2F A;  2Y1N A;  2H2K A;  1NIW A;  1NWD A;  1KQM B;  1KWO B;  2Y4Q A;  4Q04 A;  1M46 A;  3BYA A;  1JWD A;  4YBH B;  1AP4 A;  1S5G Y;  1YX8 A;  2F8P A;  3CS1 A;  2KAV A;  4GNK B;  2F3Z A;  2E6W A;  1WLM A;  2I18 A;  1F54 A;  4YGC B;  1ZMZ A;  2OTG B;  2ZFD A;  4HSZ A;  3O2P A;  4PE4 A;  2JNF A;  1WLZ A;  2GGZ A;  1DTL A;  4GBA A;  2LMU A;  2JNX A;  1UHH A;  4MEW A;  3WHT B;  1J7O A;  1REC A;  5F6T A;  2I94 A;  1Q80 A;  1A75 A;  3TS5 C;  1EH2 A;  1J7R A;  2LV7 A;  2IS9 A;  4C0L A;  2BBN A;  1XK4 A;  4QJ5 B;  4PDZ A;  3NSO A;  2H61 C;  1SW8 A;  1IKU A;  1SCM C;  4YI9 A;  4HRE E;  1QVI Y;  1F71 A;  1S5G Z;  3TZ1 A;  1IH0 A;  2KAX A;  2LMT A;  1KQM C;  1IGV A;  1RWY A;  3SG2 A;  2KI4 C;  4XJK A;  2D8N A;  1S6C A;  5I2Q A;  4OV2 A;  1Y6W A;  2DOQ A;  2O60 A;  3I5H C;  1QLK A;  1XA5 A;  2ZRS A;  1MF8 B;  4XYN A;  1BMO A;  1BR4 B;  1R6P A;  1NSH A;  2K61 A;  2L4I A;  3E3R A;  1DMO A;  1ALV A;  1LA3 A;  2ISD A;  3SG6 A;  2LVV A;  1SMG A;  2KBM A;  1TCO B;  1AHR A;  1B8R A;  1XFZ O;  2KYF A;  4P2Y B;  2OS8 C;  1KK7 Z;  4GPL B;  5CSF A;  3OB2 B;  2MA2 A;  4QJ3 B;  4MLW A;  2LP3 A;  1K9K A;  1CLL A;  2KYC A;  5TNC A;  1QAT A;  1K8U A;  1SR6 B;  4ORC B;  2K0J A;  2KBI A;  2MAZ A;  4ETO A;  5AAN A;  3TS5 B;  1TNX A;  1BLQ A;  3BUO B;  2BKH B;  5I2O A;  2V53 A;  4OR9 B;  2HF5 A;  2JTZ A;  5ER4 X;  5DKR A;  2KSP A;  1OOJ A;  2KHN A;  2PRU A;  1OE9 B;  1F4Q A;  1MR8 A;  1OMV A;  1J7Q A;  2SAS A;  3O6B A;  1LKJ A;  4GGF C;  3I5I B;  5PAL A;  2M3W A;  3DF0 B;  4YGD B;  3NSL A;  1S1E A;  1M45 A;  4MRX A;  1WDC B;  1QX7 A;  3BXK A;  1SRA A;  1LA0 A;  2JT8 A;  1KFU S;  3SG4 A;  1A03 A;  2M29 A;  3LK0 A;  1OSA A;  3IF7 A;  1ODB A;  3BOW A;  2JRF A;  4I5N B;  2B1U A;  2I7A A;  2OS8 B;  4ORB B;  3IQO A;  4CFR A;  1XFV O;  3H4S E;  2JPT A;  1XFU O;  2KOT A;  1AJ4 A;  1OZO A;  1XVJ A;  2LVK A;  1JF2 A;  1K9P A;  1NYA A;  2WCB A;  3I5F C;  1SR6 C;  1OQP A;  2LCP A;  1NX0 A;  1QS7 A;  2Q91 A;  3NSK A;  1BR1 B;  1J1D A;  1QIV A;  5ER5 A;  2R2I A;  3DF0 A;  5FYX A;  1JUO A;  1B4C A;  2NCO A;  2COL B;  2E30 A;  2ZKM X;  1MWN A;  1QJT A;  1YUT A;  4A4C A;  1E8A A;  4WQ3 A;  1NX2 A;  2QAC A;  2O5G A;  1JFJ A;  4WQ2 A;  4PHJ A;  4NDD A;  5DKQ A;  1H8B A;  1KCY A;  2BCB A;  3BUX B;  3CWG A;  5D7F A;  1JSA A;  4FQO A;  1CFF A;  2CBL A;  2WCE A;  3I5I C;  1FI5 A;  1KWO C;  1YVL A;  2PMY A;  2WND A;  1DJW A;  2KFH A;  3HCM A;  1NX3 A;  1WDC C;  2KDH A;  3CR2 A;  2LUC A;  5KU1 A;  3EK4 A;  2F2P A;  1CFP A;  3BOW B;  4PE1 A;  2M1U A;  4R1E A;  1MXL C;  3SIB A;  5HKZ A;  1UHN A;  3I5F B;  1HT9 A;  1KFX L;  1VRK A;  2JT3 A;  3RM1 A;  1A75 B;  2WOS A;  2HET A;  2K2A A;  2VRG A;  1NP8 A;  3AKA A;  2OPO A;  1RFJ A;  1BG1 A;  1EJ3 A;  2FCD A;  2JZI A;  3GOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...