4AQIA

Structure of human s100a15 bound to zinc and calcium
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A7A
publication title Structural Characterization of S100A15 Reveals a Novel Zinc Coordination Site Among S100 Proteins and Altered Surface Chemistry with Functional Implications for Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 37
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4aqiA00
1MWNA 1CLBA 1FBVA 2E6WA 1YURA 2MHHA 3AAJA 1KQVA 4N5XA 4CFRA 1AP4A 2FCEA 3EKJA 4HREE 4PE0A 2KQ6A 3BUOB 1OZOA 1QTXA 3DD4A 5AXIA 2LE9B 4JPZB 4WRIA 2F3YA 2FCDA 3EVVA 2LC5A 1WRLA 4C0LA 1CTRA 1SL9A 3I5FB 1M39A 2JRFA 2K7DA 4GPLB 2Y5IA 1FI5A 2AAOA 1DTLA 2D8NA 3TUYB 2KBIA 2OPOA 1UURA 2SCPA 2R2IA 4YGDB 2M7LA 2KNEA 5JJGA 3I5GB 3CLNA 1A75A 1MUXA 1TN4A 3CR2A 3CR5X 3LCPC 4ICBA 1CM4A 1PSBA 4CFQA 5HKWA 4DCKA 2BL0C 3TDZA 2KOTA 3JVTC 5HYDA 2HETA 3ICBA 2LMTA 3D10A 4MZJA 2L4IA 4ZCVA 5HLOA 4CIDA 2KQYA 1UHIA 5DKNA 3BYAA 1OMDA 1SMGA 3LK0A 1PULA 1G33A 1GJYA 1CKKA 1SCVA 3EK4A 1UHKA 1DF0B 3PALA 3PN7C 1KFUL 1S5GY 4YI8A 5G08A 3WXAA 1SCMC 2L2EA 3VRPA 2B1UA 2GGMA 4E68A 2EC6C 2JU0A 1FW4A 1IKUA 1AHRA 3O6BA 1PALA 3VRRA 1EL4A 2L5XB 1IQ5A 1Y1UA 2NCPA 2JZIA 2ZRSA 3O78A 4WQ2A 3LLEA 5AEQA 1IJ6A 3F45A 1LKJA 1FF1A 1H8BA 1SR6C 1MR8A 2K8MB 1KFXS 3IQQA 2HF5A 3KEVA 2BCXA 2JOJA 1SL7A 1KQMC 2MLFC 3PATA 2LVIA 2BE4A 4CPVA 1LXFC 1LVCD 1XA5A 2NXQA 2MBXA 1CDLA 2K7CA 1ZOTB 5CPVA 1F8HA 2EHBA 1J1EA 1IQ3A 2GGZA 2KBMA 3CS1A 3SG3A 1CFDA 2BBMA 4XJKA 2KFGA 5B8IB 4F0ZB 3VGOA 5AERA 1A29A 1QIVA 1QLKA 1RWYA 4DS7A 2BE6A 2G9BA 1DVIA 1CFFA 4JQ0D 4A4BA 1J7QA 1XFUO 2M29A 2HQWA 3BUMB 3BXKA 1DJYA 2LCPA 2ZKMX 2Q4UA 2Y1MA 1YUTA 3NSOA 4PHMA 1BG1A 4I5NB 2BKIB 1KSOA 2M1UA 1TTXA 4MZKA 3WNXB 3VRNA 5KSZA 4CLNA 2L50A 2LVKA 2LANA 4NDCA 1K94A 2G2BA 1SKTA 2KDHA 5D7FA 2KGBC 4MVFA 1XVJA 2E30A 3I5GC 3TDUA 1JSAA 4AOMA 4PHKA 3LK1A 3FIAA 5CSNA 2L98A 2K7OA 1CDMA 4AQJA 3OX6A 1J7PA 3JTDB 4M2QA 1TNQA 5FYXA 1S1EA 4FTGA 2WCEA 2F3ZA 1M46A 3PM8A 1QV1A 1XFZO 2AMIA 4MBEA 1F4OA 1B8RA 1KFUS 2WOSA 2WCFA 1ALVA 2PASA 3SIBA 3GK1A 1SBJA 2CCMA 4PDZA 1XYDA 2NLNA 1NX2A 2LVVA 4YI9A 4MZLA 2Y4QA 2BECA 1RECA 3DF0B 4MRYA 2WORA 1SNLA 1KK7Y 4C0KA 4NDBA 2F8PA 4YGEB 2CTNA 1S6CA 2NZ0A 4FQOA 3BQ3A 2H61C 4GAOA 4P2YB 4M2OA 1SW8A 2DOQA 1J7RA 4R1EA 3CTNA 4GBAA 2JPTA 4XYNA 1DT7B 1CB1A 2L4HA 1NCZA 5I2LA 3D0YB 4QJ3B 4DRWA 5I2OA 1V1GA 2HQ8A 4UPGA 4MLWA 5IBWA 2LVJA 2PRUA 1FI6A 2I2RE 1EG4A 1M31A 1WDCC 2JXLA 5I8NA 3SG5A 3PSRA 3ZNIA 1AJ5A 3EVRA 4I5LB 1CDPA 1UP5A 2K2AA 1ZACA 1CMGA 1C7VA 1KK8B 2O5GA 1PRWA 3TS5C 1D1OA 1K93D 3NSKA 4C0JA 3OP0A 1CM1A 1BLQA 1G4YR 1N0YA 2FJUB 4QJ4B 2KI4C 5BPJA 2OTGB 2ZN8A 1YX8A 1YRTB 1QX2A 1HQVA 2LV7A 5J3XA 2SASA 2F2OA 2L51A 2F33A 3BUWB 1QX5B 3D0YA 1TIZA 2JXCA 4ORCB 5CSIA 1S5GZ 1XO5A 2JC2A 1K90D 1KWOC 2IS9A 4PCWA 1YTZC 1L2OC 4DIRA 1CLLA 1PSRA 1IRJA 1UHHA 1QJTA 1GGZA 3TDIA 1B47A 2P6BB 2ZRTA 2PSRA 3EKHA 1NUBA 2KAYA 4USLA 1IG5A 2H2KA 2I7AA 1A2XA 1WRZA 1B7TY 5ER5A 2Q91A 4PHJA 2JTTA 2CBLA 1Y6WA 1MXEA 1PK0D 2KI6C 1S6JA 1BOCA 3I5HB 2M7NA 3CGAA 1CFPA 1TNPA 3A8RA 3JTDC 2OS8B 2VRGA 4Q04A 2COLB 1BMOA 3I5IC 1DF0A 3TZ1A 1Q80A 1QXPA 1JF2A 1QV0A 1CDNA 2LNKA 1SL8A 1E8AA 5CSFA 4HRHA 1J7OA 3DVMA 5TNCA 1G8IA 1OMRA 5I2QA 5KTYA 3AKBA 5DKQA 4U8DA 4JWQA 2BCBA 4ZCUA 1JWDA 1K9PA 1PVBA 1JFKA 3NSLA 1B9AA 1SRAA 2PALA 3OB1B 2I18A 4I5JA 3M0WA 1M45A 3C1VA 1KSMA 2LP2A 1WY9A 1RFJA 2BL0B 3JVTB 1JUOA 1WLZA 2K2FA 1TRFA 2M97A 2MJWB 3I5FC 4YRUA 2KFHA 3TUYC 3CZTX 1B4CA 3LL8B 1JC2A 4OR9B 1NP8A 2M8UA 1F70A 1S6IA 1U5IB 1QVIY 1YX7A 3PN7B 1QVIZ 2LMVA 1H4BA 3RM1A 1ZUZA 2MA2A 3FS7A 2BCAA 1SCMB 3SG2A 3IF7A 1NCYA 2AUCA 2LLTA 1LA3A 1NX3A 2EC6B 3SIAA 1DGUA 5CSJA 4A4CA 1DJIA 1QS7A 2JTZA 2KYFA 1XFXO 2OTGC 1OSAA 3AKAA 3GK4X 4GFTA 1K2HA 3WHUB 1HT9A 2ZNDA 4D1EA 2LMUA 1CNPA 4HRGA 4GGFA 1OQPA 1EJ3A 2KGRA 2TN4A 2ZN9A 5HLVA 4NDDA 1SR6B 1KK7Z 4N1FA 3H4SE 1MQ1A 1DJXA 4L9MA 1BODA 3IQOA 1K9KA 1SY9A 1GQMA 4YGCB 1KQMB 1X02A 2LLUA 5AANA 4ORBB 2KYCA 3OB2B 4OV2A 4PHNA 3NSIA 1FPWA 2MAZA 2L0PA 1ALWA 2MRDA 4MEWA 3O4YA 4OKHA 1Y1AA 2CXJA 4GNKB 1A03A 2KAXA 1TCOB 1SYMA 1ODBA 3DVKA 1LINA 2M3WA 2RGIA 3DF0A 1OOJA 1XFWO 2CT9A 1C07A 1BR4B 3KPXA 4MN0A 3WHTB 3ZWHA 2K0JA 5KU1A 3RLZA 1IGVA 1V1FA 1W7IB 1ZMZA 2A4JA 2JT0A 1S3PA 3GOFA 4IL1A 5PALA 2V53A 1BT6A 2QPTA 4PE4A 1TNWA 2I94A 2KAVA 4PE1A 1K8UA 1AK8A 3BUNB 4QJ5B 2WNDA 2EGDA 1XFVO 1B1GA 1QASA 2LUCA 1CFCA 3NXAA 4I5KA 1DJZA 2ZFDA 1IH0A 4HSZA 1J55A 2QACA 1R6PA 2WCBA 1C7WA 1XFYO 3OHMB 2Y1NA 4GGFC 3MSEB 1F54A 1RJVA 1EG3A 1B7TZ 1ZFSA 1AUIB 2K61A 3SG6A 1W7JB 3SJSA 1YR5A 1Y1XA 3GK2A 2KHNA 5HKYA 4BY4A 1AJ4A 1AVSA 1M63B 4YBHB 1NSHA 4M2PA 1YVLA 2WC8A 1B8LA 2KSPA 1TOPA 3OX5A 1YRUB 1OE9B 1XK4A 4XJKB 2ISDA 3EK8A 1QATA 4PALA 1NX1A 1YUSA 2GV5A 1OZSA 1S26D 4YGBB 2CNPA 2M9GA 2M49B 4YGAA 1DGVA 1DMOA 3EK7A 3CWGA 1SPYA 1CMFA 2JQ6A 4MRXA 4N1GA 1RROA 1GGWA 1WDCB 1K96A 5F6TA 1PVAA 2NCOA 4MSPA 3VROA 2BBNA 4ORAB 5AFPA 1NCXA 3E3RA 3A4UB 1UWOA 3QRXA 1TNXA 4DUQA 2KFFA 5K89A 2JNFA 1F55A 3TS5B 3K21A 1RTP1 3DVEA 1JBAA 3CR4X 2O60A 1IWQA 2H61A 2KI4B 2M1KB 3BUXB 1WRKA 2JT8A 1VRKA 4OVNF 1NYAA 1BR1B 5DKRA 2LLSA 1QLSA 1KK8C 1JFJA 1BF5A 1BU3A 1MF8B 5D69A 1KWOB 4P5OE 1DJHA 3HCMA 3PFVA 4PE7A 1R2UA 1L2OB 2FOTA 2JWWA 1WLMA 1F71A 1J1DA 3BOWB 1QIWA 1NWDA 1UHJA 4OCIA 2LP3A 2JULA 1NPQA 2PVBA 2JNXA 3O2PA 1IJ5A 1S36A 3FWCA 2HPSA 1DJGA 3KF9A 1NX0A 3EVUA 1YVHA 2JT3A 1XK4C 1MXLC 4GUKA 1TCFA 2MLEC 4GGNA 1B8CA 3PLFB 2ZNEA 5JOLA 3VRQA 4AQIA 1DJWA 1QX7A 3KO0A 5ER4X 1N2DA 1MHOA 3KHEA 2LHIA 1YUUA 2BKHB 1U5IA 3I5IB 1F4QA 1LA0A 5GQQC 2PMYA 1KFXL 1A4PA 4WQ3A 4ETOA 3DVJA 3SG7A 4TNCA 3HX4A 1CLMA 2KI6D 1K9UA 2LAPA 1EH2A 1EXRA 4BY5A 3AAKA 3BOWA 1RK9A 2M0RA 1NIWA 1K95A 1Y0VH 2F2PA 3I5HC 1UHNA 1UUSA 1A75B 1BJFA 2LM5A 2OS8C 3SG4A 1OMVA 2K7BA 1JF0A 2LHLA 3FWBA 2LUXA 4NQGA 1KCYA 1N65A 1SK6D 5HKZA 1L7ZA
chains in the Genus database with same CATH superfamily
1MWNA 1CLBA 1FBVA 2E6WA 1YURA 2MHHA 3AAJA 1KQVA 4N5XA 4CFRA 1AP4A 2FCEA 3EKJA 4HREE 4PE0A 2KQ6A 3BUOB 3D75A 1OZOA 1QTXA 3DD4A 5AXIA 2LE9B 4JPZB 4WRIA 2F3YA 2FCDA 3EVVA 2LC5A 3EG5B 1WRLA 4C0LA 1CTRA 1SL9A 3I5FB 1M39A 2JRFA 2K7DA 4GPLB 2Y5IA 1FI5A 2AAOA 1DTLA 2D8NA 3TUYB 2KBIA 2OPOA 1UURA 2SCPA 2R2IA 4YGDB 2M7LA 2KNEA 5JJGA 1ORGA 3VB1A 3I5GB 3CLNA 1A75A 1MUXA 1TN4A 3CR2A 3CR5X 3LCPC 4ICBA 1CM4A 1PSBA 4CFQA 5HKWA 4DCKA 2BL0C 3TDZA 2KOTA 3IVTA 3JVTC 5HYDA 2HETA 3ICBA 2LMTA 3D10A 4MZJA 2L4IA 4ZCVA 5HLOA 4CIDA 2KQYA 1UHIA 5DKNA 3BYAA 1OMDA 1SMGA 3LK0A 1PULA 1G33A 1GJYA 1CKKA 1SCVA 3EK4A 1UHKA 1DF0B 3PALA 3PN7C 1KFUL 1S5GY 4YI8A 5G08A 3WXAA 1IIOA 1SCMC 2L2EA 3VRPA 2B1UA 2GGMA 4E68A 2EC6C 2JU0A 1FW4A 1IKUA 1AHRA 3O6BA 1PALA 3VRRA 1EL4A 2L5XB 1IQ5A 1Y1UA 2WCJA 2NCPA 2JZIA 2ZRSA 3O78A 4WQ2A 3LLEA 5AEQA 1IJ6A 3F45A 3CABA 1LKJA 1FF1A 1H8BA 1SR6C 1MR8A 2K8MB 2L5YA 1KFXS 3IQQA 3SS4A 2HF5A 3KEVA 2BCXA 2JOJA 1SL7A 1KQMC 2MLFC 3PATA 2LVIA 2BE4A 4CPVA 1LXFC 1LVCD 1XA5A 2NXQA 2MBXA 1CDLA 2K7CA 1ZOTB 5CPVA 1F8HA 2EHBA 1J1EA 1IQ3A 2GGZA 2KBMA 3CS1A 3SG3A 1CFDA 5EL2A 2BBMA 4XJKA 2KFGA 1C3ZA 4F0ZB 3VGOA 5B8IB 5AERA 1A29A 1QIVA 1QLKA 1RWYA 4DS7A 2BE6A 2G9BA 4GFTA 1DVIA 5D3OA 1CFFA 4JQ0D 4A4BA 1J7QA 1XFUO 2M29A 2HQWA 3BUMB 3BXKA 1DJYA 2LCPA 3B86A 2ZKMX 1C3YA 2Q4UA 2Y1MA 1YUTA 3RZSA 3NSOA 4PHMA 1BG1A 4I5NB 3S0FA 2BKIB 1KSOA 2M1UA 1TTXA 3Q8IA 4MZKA 3WNXB 3VRNA 5KSZA 3N7HA 4CLNA 2L50A 2LVKA 2LANA 4NDCA 1K94A 2G2BA 1SKTA 2KDHA 5D7FA 2KGBC 3B6XA 4MVFA 3B7AA 1XVJA 1OOIX 2E30A 3I5GC 3TDUA 1JSAA 4AOMA 4PHKA 3LK1A 3FIAA 5CSNA 2L98A 1OOGA 1CDMA 2K7OA 4AQJA 3OX6A 1J7PA 3JTDB 4M2QA 2QEBA 1TNQA 2QEHA 2QEOA 5FYXA 1S1EA 4FTGA 2WCEA 2F3ZA 2WCMA 1M46A 2K60A 1QV1A 1XFZO 2AMIA 3PM8A 5DICA 4MBEA 1F4OA 1B8RA 1KFUS 3DZTA 2WOSA 2WCFA 1ALVA 2PASA 3B88A 2GTEA 1SBJA 2CCMA 3GK1A 3SIBA 4PDZA 1XYDA 2NLNA 1NX2A 2LVVA 4YI9A 4MZLA 2Y4QA 2BECA 1RECA 2WCLA 3DF0B 4MRYA 2WORA 1SNLA 1KK7Y 2BAPA 2WCHA 1DEKA 4C0KA 4NDBA 2F8PA 4YGEB 2CTNA 1S6CA 2NZ0A 4FQOA 3BQ3A 2H61C 4GAOA 4P2YB 1DC1A 4M2OA 1SW8A 2DOQA 1J7RA 4R1EA 3CTNA 4GBAA 2JPTA 4XYNA 1DT7B 1CB1A 2L4HA 1NCZA 5I2LA 3S0AA 3D0YB 4JKTA 4QJ3B 4DRWA 1V1GA 5I2OA 2HQ8A 2WC5A 4MLWA 4UPGA 5IBWA 2LVJA 2PRUA 1FI6A 2I2RE 3OGNA 1EG4A 1M31A 1WDCC 2JXLA 5I8NA 3SG5A 3L4LA 3PSRA 3ZNIA 2L2CA 1AJ5A 3EVRA 4I5LB 2QDIA 1CDPA 1UP5A 2K2AA 1ZACA 1CMGA 1C7VA 1KK8B 2O5GA 1PRWA 2P71A 3TS5C 1D1OA 1K93D 3NSKA 5HL1A 4C0JA 3OP0A 1CM1A 1BLQA 1SSEB 1G4YR 1N0YA 2FJUB 4QJ4B 2KI4C 2WCKA 5BPJA 2OTGB 2ZN8A 1YX8A 1YRTB 1QX2A 1HQVA 2LV7A 5J3XA 3PJIA 2SASA 2F2OA 2L51A 2F33A 3BUWB 1QX5B 3D0YA 5FI2A 1TIZA 2JXCA 4ORCB 4F7FA 5CSIA 1S5GZ 1XO5A 2JC2A 1K90D 1KWOC 2IS9A 4PCWA 1YTZC 3BFAA 1L2OC 4KYNA 4DIRA 1CLLA 1PSRA 1IRJA 1UHHA 1QJTA 1GGZA 3TDIA 1B47A 2P6BB 2ZRTA 2PSRA 3EKHA 1NUBA 2KAYA 4USLA 1IG5A 2H2KA 2I7AA 1A2XA 1WRZA 1B7TY 5ER5A 2Q91A 4PHJA 2JTTA 2CBLA 1Y6WA 4FQTA 2KPHA 1MXEA 1PK0D 2KI6C 1S6JA 1BOCA 3I5HB 2M7NA 2JPOA 3CGAA 3FE9A 1CFPA 1TNPA 3A8RA 2BNXA 3JTDC 2OS8B 2VRGA 4Q04A 2COLB 1BMOA 3I5IC 1DF0A 3TZ1A 3S0BA 1Q80A 1QXPA 2KLEA 1JF2A 3S0EA 1QV0A 1CDNA 3L47A 2LNKA 1SL8A 1E8AA 5CSFA 4HRHA 1J7OA 3DVMA 5TNCA 1G8IA 1OMRA 5I2QA 5KTYA 3AKBA 5DKQA 4U8DA 4JWQA 2BCBA 1TUJA 1P28A 3OBVA 3R1PA 4ZCUA 1JWDA 1K9PA 1PVBA 1JFKA 3NSLA 1B9AA 1SRAA 2PALA 3OB1B 2I18A 4I5JA 3M0WA 1M45A 3C1VA 3PM2A 1KSMA 2LP2A 1WY9A 1RFJA 2BL0B 3JVTB 1JUOA 1WLZA 2K2FA 1TRFA 2P70A 2M97A 2MJWB 3I5FC 4YRUA 2KFHA 3TUYC 1Z4HA 2FJYA 3CZTX 1TUZA 1B4CA 3LL8B 4IJ7A 4OR9B 1JC2A 1NP8A 2M8UA 1F70A 1S6IA 1U5IB 1QVIY 1YX7A 2WC6A 3PN7B 1QVIZ 2LMVA 1H4BA 3RM1A 1ZUZA 2MA2A 3FS7A 2BCAA 1SCMB 3SG2A 3IF7A 1NCYA 2AUCA 2LLTA 1LA3A 1NX3A 2EC6B 3BFBA 3SIAA 1DGUA 5CSJA 4A4CA 1DJIA 1QS7A 2JTZA 2KYFA 1XFXO 2OTGC 1OSAA 3AKAA 3DXLA 3GK4X 1K2HA 3R1VA 3WHUB 1HT9A 4INWA 2ZNDA 4D1EA 2LMUA 1CNPA 4HRGA 4GGFA 1OQPA 1EJ3A 2KGRA 1OW4A 2TN4A 2ZN9A 5HLVA 4NDDA 1SR6B 1KK7Z 3L4AA 3H4SE 4N1FA 3S0DA 1MQ1A 1DJXA 3CZ2A 4L9MA 1BODA 3FE6A 3IQOA 1K9KA 1SY9A 1GQMA 3D77A 1KQMB 1X02A 2LLUA 3D73A 4YGCB 5AANA 4ORBB 3BJHA 2KYCA 3OB2B 4OV2A 4PHNA 3NSIA 1FPWA 2MAZA 1GM0A 2L0PA 1ALWA 2MRDA 3BFHA 4MEWA 3CZ0A 3O4YA 4OKHA 1Y1AA 2CXJA 4GNKB 3D76A 1A03A 3DY9A 2KAXA 3UNWA 1TCOB 1SYMA 1ODBA 3DVKA 1LINA 2M3WA 2RGIA 4OZDA 3DF0A 1OOJA 1XFWO 2CT9A 1C07A 1BR4B 3KPXA 4MN0A 3WHTB 3ZWHA 2K0JA 5KU1A 3RLZA 1IGVA 3CYZA 3D78A 5FI7A 1V1FA 1W7IB 1ZMZA 2A4JA 2JT0A 1S3PA 3GOFA 4IL1A 5PALA 2V53A 1BT6A 2QPTA 4PE4A 1TNWA 2I94A 2KAVA 4PE1A 1K8UA 1AK8A 3BUNB 4QJ5B 1XFRA 2WNDA 2EGDA 1XFVO 1B1GA 1QASA 2LUCA 1CFCA 3NXAA 4I5KA 1DJZA 2ZFDA 2YGUA 1IH0A 4HSZA 1J55A 2QACA 1R6PA 2WCBA 3FE8A 4INXA 1C7WA 1XFYO 3OHMB 2Y1NA 4GGFC 3MSEB 1F54A 3CDNA 1RJVA 1EG3A 3K1EA 1B7TZ 1ZFSA 1AUIB 2K61A 3SG6A 1W7JB 3SJSA 1YR5A 1Y1XA 3GK2A 2KHNA 5HKYA 4BY4A 1AJ4A 1AVSA 1M63B 4YBHB 1NSHA 1LS8A 3SS3A 4M2PA 3S0GA 1YVLA 2WC8A 1B8LA 2KSPA 1TOPA 1DELA 3OX5A 1YRUB 1OE9B 1XK4A 4XJKB 2ISDA 3EK8A 1QATA 4PALA 1NX1A 1YUSA 1OOHA 2GV5A 1OZSA 1S26D 4YGBB 2CNPA 2M9GA 2M49B 4YGAA 1DGVA 5I94A 1W9ZA 1DMOA 3EK7A 3CWGA 1SPYA 1CMFA 2JQ6A 4MRXA 4N1GA 1RROA 1GGWA 1QWVA 1WDCB 1K96A 5F6TA 1PVAA 2NCOA 4MSPA 3VROA 1Z2CB 3D74A 2BBNA 4ORAB 5AFPA 1NCXA 3E3RA 3A4UB 1UWOA 3QRXA 1TNXA 4DUQA 2KFFA 5K89A 2JNFA 1F55A 3TS5B 3K21A 1RTP1 3DVEA 1JBAA 3CR4X 2O60A 1IWQA 3SS5A 1DQEA 2H61A 2KI4B 2M1KB 3BUXB 2PYQA 1WRKA 2JT8A 3UO9A 1VRKA 4OVNF 1NYAA 1BR1B 5DKRA 2LLSA 1QLSA 1OOFA 1KK8C 1JFJA 1BF5A 1BU3A 1MF8B 2QEVA 5D69A 1KWOB 1TWOA 4P5OE 1DJHA 3HCMA 3PFVA 4PE7A 1R2UA 1L2OB 2FOTA 2JWWA 1WLMA 1F71A 1J1DA 3BOWB 1QIWA 1NWDA 1UHJA 2PQLA 4OCIA 2LP3A 2JULA 1NPQA 2PVBA 2JNXA 3O2PA 1IJ5A 3DYEA 5FI6A 1S36A 3FWCA 2HPSA 1DJGA 3KF9A 1NX0A 3EVUA 1YVHA 2JT3A 1XK4C 4JD9A 1MXLC 4GUKA 1TCFA 2MLEC 4GGNA 1B8CA 3PLFB 4PT1A 2ZNEA 5JOLA 3VRQA 1T14A 4AQIA 1DJWA 1QX7A 3KO0A 3NGVA 5ER4X 1N2DA 1MHOA 3KHEA 2LHIA 1YUUA 2BKHB 1U5IA 3I5IB 1F4QA 1LA0A 5GQQC 2PMYA 1KFXL 1A4PA 4WQ3A 4ETOA 3R1OA 3DVJA 3SG7A 3NHIA 2H8VA 3NHTA 4TNCA 3HX4A 2ERBA 1CLMA 2KI6D 1K9UA 3CZ1A 2LAPA 1EH2A 1EXRA 3B87A 4BY5A 3AAKA 3BOWA 1RK9A 2M0RA 1NIWA 1K95A 1Y0VH 2F2PA 3I5HC 3R72A 1UHNA 1UUSA 1A75B 3V2LA 1BJFA 2LM5A 3O4XA 3QMEA 2OS8C 3SG4A 1OMVA 2K7BA 1JF0A 2LHLA 3FWBA 2LUXA 4NQGA 1KCYA 2KLDA 1N65A 1SK6D 5HKZA 1L7ZA
chains in the Genus database with same CATH topology
1MWNA 1CLBA 1FBVA 2E6WA 1YURA 2MHHA 3AAJA 1KQVA 4N5XA 4CFRA 1AP4A 2FCEA 3EKJA 4HREE 4PE0A 2KQ6A 3BUOB 1OZOA 1QTXA 3DD4A 5AXIA 2LE9B 4JPZB 4WRIA 2F3YA 2FCDA 3EVVA 2LC5A 1WRLA 4C0LA 1CTRA 1SL9A 3I5FB 1M39A 2JRFA 2K7DA 4GPLB 2Y5IA 1FI5A 2AAOA 1DTLA 2D8NA 3TUYB 2KBIA 2OPOA 1UURA 2SCPA 2R2IA 4YGDB 2M7LA 2KNEA 5JJGA 3I5GB 3CLNA 1A75A 1MUXA 1TN4A 3CR2A 3CR5X 3LCPC 4ICBA 1CM4A 1PSBA 4CFQA 5HKWA 4DCKA 2BL0C 3TDZA 2KOTA 3JVTC 5HYDA 2HETA 3ICBA 2LMTA 3D10A 4MZJA 2L4IA 4ZCVA 5HLOA 4CIDA 2KQYA 1UHIA 5DKNA 3BYAA 1OMDA 1SMGA 3LK0A 1PULA 1G33A 1GJYA 1CKKA 1SCVA 3EK4A 1UHKA 1DF0B 3PALA 3PN7C 1KFUL 1S5GY 4YI8A 5G08A 3WXAA 1SCMC 2L2EA 3VRPA 2B1UA 2GGMA 4E68A 2EC6C 2JU0A 1FW4A 1IKUA 1AHRA 3O6BA 1PALA 3VRRA 1EL4A 2L5XB 1IQ5A 1Y1UA 2NCPA 2JZIA 2ZRSA 3O78A 4WQ2A 3LLEA 5AEQA 1IJ6A 3F45A 1LKJA 1FF1A 1H8BA 1SR6C 1MR8A 2K8MB 1KFXS 3IQQA 2HF5A 3KEVA 2BCXA 2JOJA 1SL7A 1KQMC 2MLFC 3PATA 2LVIA 2BE4A 4CPVA 1LXFC 1LVCD 1XA5A 2NXQA 2MBXA 1CDLA 2K7CA 1ZOTB 5CPVA 1F8HA 2EHBA 1J1EA 1IQ3A 2GGZA 2KBMA 3CS1A 3SG3A 1CFDA 2BBMA 4XJKA 2KFGA 5B8IB 4F0ZB 3VGOA 5AERA 1A29A 1QIVA 1QLKA 1RWYA 4DS7A 2BE6A 2G9BA 1DVIA 1CFFA 4JQ0D 4A4BA 1J7QA 1XFUO 2M29A 2HQWA 3BUMB 3BXKA 1DJYA 2LCPA 2ZKMX 2Q4UA 2Y1MA 1YUTA 3NSOA 4PHMA 1BG1A 4I5NB 2BKIB 1KSOA 2M1UA 1TTXA 4MZKA 3WNXB 3VRNA 5KSZA 4CLNA 2L50A 2LVKA 2LANA 4NDCA 1K94A 2G2BA 1SKTA 2KDHA 5D7FA 2KGBC 4MVFA 1XVJA 2E30A 3I5GC 3TDUA 1JSAA 4AOMA 4PHKA 3LK1A 3FIAA 5CSNA 2L98A 2K7OA 1CDMA 4AQJA 3OX6A 1J7PA 3JTDB 4M2QA 1TNQA 5FYXA 1S1EA 4FTGA 2WCEA 2F3ZA 1M46A 3PM8A 1QV1A 1XFZO 2AMIA 4MBEA 1F4OA 1B8RA 1KFUS 2WOSA 2WCFA 1ALVA 2PASA 3SIBA 3GK1A 1SBJA 2CCMA 4PDZA 1XYDA 2NLNA 1NX2A 2LVVA 4YI9A 4MZLA 2Y4QA 2BECA 1RECA 3DF0B 4MRYA 2WORA 1SNLA 1KK7Y 4C0KA 4NDBA 2F8PA 4YGEB 2CTNA 1S6CA 2NZ0A 4FQOA 3BQ3A 2H61C 4GAOA 4P2YB 4M2OA 1SW8A 2DOQA 1J7RA 4R1EA 3CTNA 4GBAA 2JPTA 4XYNA 1DT7B 1CB1A 2L4HA 1NCZA 5I2LA 3D0YB 4QJ3B 4DRWA 5I2OA 1V1GA 2HQ8A 4UPGA 4MLWA 5IBWA 2LVJA 2PRUA 1FI6A 2I2RE 1EG4A 1M31A 1WDCC 2JXLA 5I8NA 3SG5A 3PSRA 3ZNIA 1AJ5A 3EVRA 4I5LB 1CDPA 1UP5A 2K2AA 1ZACA 1CMGA 1C7VA 1KK8B 2O5GA 1PRWA 3TS5C 1D1OA 1K93D 3NSKA 4C0JA 3OP0A 1CM1A 1BLQA 1G4YR 1N0YA 2FJUB 4QJ4B 2KI4C 5BPJA 2OTGB 2ZN8A 1YX8A 1YRTB 1QX2A 1HQVA 2LV7A 5J3XA 2SASA 2F2OA 2L51A 2F33A 3BUWB 1QX5B 3D0YA 1TIZA 2JXCA 4ORCB 5CSIA 1S5GZ 1XO5A 2JC2A 1K90D 1KWOC 2IS9A 4PCWA 1YTZC 1L2OC 4DIRA 1CLLA 1PSRA 1IRJA 1UHHA 1QJTA 1GGZA 3TDIA 1B47A 2P6BB 2ZRTA 2PSRA 3EKHA 1NUBA 2KAYA 4USLA 1IG5A 2H2KA 2I7AA 1A2XA 1WRZA 1B7TY 5ER5A 2Q91A 4PHJA 2JTTA 2CBLA 1Y6WA 1MXEA 1PK0D 2KI6C 1S6JA 1BOCA 3I5HB 2M7NA 3CGAA 1CFPA 1TNPA 3A8RA 3JTDC 2OS8B 2VRGA 4Q04A 2COLB 1BMOA 3I5IC 1DF0A 3TZ1A 1Q80A 1QXPA 1JF2A 1QV0A 1CDNA 2LNKA 1SL8A 1E8AA 5CSFA 4HRHA 1J7OA 3DVMA 5TNCA 1G8IA 1OMRA 5I2QA 5KTYA 3AKBA 5DKQA 4U8DA 4JWQA 2BCBA 4ZCUA 1JWDA 1K9PA 1PVBA 1JFKA 3NSLA 1B9AA 1SRAA 2PALA 3OB1B 2I18A 4I5JA 3M0WA 1M45A 3C1VA 1KSMA 2LP2A 1WY9A 1RFJA 2BL0B 3JVTB 1JUOA 1WLZA 2K2FA 1TRFA 2M97A 2MJWB 3I5FC 4YRUA 2KFHA 3TUYC 3CZTX 1B4CA 3LL8B 1JC2A 4OR9B 1NP8A 2M8UA 1F70A 1S6IA 1U5IB 1QVIY 1YX7A 3PN7B 1QVIZ 2LMVA 1H4BA 3RM1A 1ZUZA 2MA2A 3FS7A 2BCAA 1SCMB 3SG2A 3IF7A 1NCYA 2AUCA 2LLTA 1LA3A 1NX3A 2EC6B 3SIAA 1DGUA 5CSJA 4A4CA 1DJIA 1QS7A 2JTZA 2KYFA 1XFXO 2OTGC 1OSAA 3AKAA 3GK4X 4GFTA 1K2HA 3WHUB 1HT9A 2ZNDA 4D1EA 2LMUA 1CNPA 4HRGA 4GGFA 1OQPA 1EJ3A 2KGRA 2TN4A 2ZN9A 5HLVA 4NDDA 1SR6B 1KK7Z 4N1FA 3H4SE 1MQ1A 1DJXA 4L9MA 1BODA 3IQOA 1K9KA 1SY9A 1GQMA 4YGCB 1KQMB 1X02A 2LLUA 5AANA 4ORBB 2KYCA 3OB2B 4OV2A 4PHNA 3NSIA 1FPWA 2MAZA 2L0PA 1ALWA 2MRDA 4MEWA 3O4YA 4OKHA 1Y1AA 2CXJA 4GNKB 1A03A 2KAXA 1TCOB 1SYMA 1ODBA 3DVKA 1LINA 2M3WA 2RGIA 3DF0A 1OOJA 1XFWO 2CT9A 1C07A 1BR4B 3KPXA 4MN0A 3WHTB 3ZWHA 2K0JA 5KU1A 3RLZA 1IGVA 1V1FA 1W7IB 1ZMZA 2A4JA 2JT0A 1S3PA 3GOFA 4IL1A 5PALA 2V53A 1BT6A 2QPTA 4PE4A 1TNWA 2I94A 2KAVA 4PE1A 1K8UA 1AK8A 3BUNB 4QJ5B 2WNDA 2EGDA 1XFVO 1B1GA 1QASA 2LUCA 1CFCA 3NXAA 4I5KA 1DJZA 2ZFDA 1IH0A 4HSZA 1J55A 2QACA 1R6PA 2WCBA 1C7WA 1XFYO 3OHMB 2Y1NA 4GGFC 3MSEB 1F54A 1RJVA 1EG3A 1B7TZ 1ZFSA 1AUIB 2K61A 3SG6A 1W7JB 3SJSA 1YR5A 1Y1XA 3GK2A 2KHNA 5HKYA 4BY4A 1AJ4A 1AVSA 1M63B 4YBHB 1NSHA 4M2PA 1YVLA 2WC8A 1B8LA 2KSPA 1TOPA 3OX5A 1YRUB 1OE9B 1XK4A 4XJKB 2ISDA 3EK8A 1QATA 4PALA 1NX1A 1YUSA 2GV5A 1OZSA 1S26D 4YGBB 2CNPA 2M9GA 2M49B 4YGAA 1DGVA 1DMOA 3EK7A 3CWGA 1SPYA 1CMFA 2JQ6A 4MRXA 4N1GA 1RROA 1GGWA 1WDCB 1K96A 5F6TA 1PVAA 2NCOA 4MSPA 3VROA 2BBNA 4ORAB 5AFPA 1NCXA 3E3RA 3A4UB 1UWOA 3QRXA 1TNXA 4DUQA 2KFFA 5K89A 2JNFA 1F55A 3TS5B 3K21A 1RTP1 3DVEA 1JBAA 3CR4X 2O60A 1IWQA 2H61A 2KI4B 2M1KB 3BUXB 1WRKA 2JT8A 1VRKA 4OVNF 1NYAA 1BR1B 5DKRA 2LLSA 1QLSA 1KK8C 1JFJA 1BF5A 1BU3A 1MF8B 5D69A 1KWOB 4P5OE 1DJHA 3HCMA 3PFVA 4PE7A 1R2UA 1L2OB 2FOTA 2JWWA 1WLMA 1F71A 1J1DA 3BOWB 1QIWA 1NWDA 1UHJA 4OCIA 2LP3A 2JULA 1NPQA 2PVBA 2JNXA 3O2PA 1IJ5A 1S36A 3FWCA 2HPSA 1DJGA 3KF9A 1NX0A 3EVUA 1YVHA 2JT3A 1XK4C 1MXLC 4GUKA 1TCFA 2MLEC 4GGNA 1B8CA 3PLFB 2ZNEA 5JOLA 3VRQA 4AQIA 1DJWA 1QX7A 3KO0A 5ER4X 1N2DA 1MHOA 3KHEA 2LHIA 1YUUA 2BKHB 1U5IA 3I5IB 1F4QA 1LA0A 5GQQC 2PMYA 1KFXL 1A4PA 4WQ3A 4ETOA 3DVJA 3SG7A 4TNCA 3HX4A 1CLMA 2KI6D 1K9UA 2LAPA 1EH2A 1EXRA 4BY5A 3AAKA 3BOWA 1RK9A 2M0RA 1NIWA 1K95A 1Y0VH 2F2PA 3I5HC 1UHNA 1UUSA 1A75B 1BJFA 2LM5A 2OS8C 3SG4A 1OMVA 2K7BA 1JF0A 2LHLA 3FWBA 2LUXA 4NQGA 1KCYA 1N65A 1SK6D 5HKZA 1L7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWN A;  1CLB A;  1FBV A;  2E6W A;  1YUR A;  2MHH A;  3AAJ A;  1KQV A;  4N5X A;  4CFR A;  1AP4 A;  2FCE A;  3EKJ A;  4HRE E;  4PE0 A;  2KQ6 A;  3BUO B;  1OZO A;  1QTX A;  3DD4 A;  5AXI A;  2LE9 B;  4JPZ B;  4WRI A;  2F3Y A;  2FCD A;  3EVV A;  2LC5 A;  1WRL A;  4C0L A;  1CTR A;  1SL9 A;  3I5F B;  1M39 A;  2JRF A;  2K7D A;  4GPL B;  2Y5I A;  1FI5 A;  2AAO A;  1DTL A;  2D8N A;  3TUY B;  2KBI A;  2OPO A;  1UUR A;  2SCP A;  2R2I A;  4YGD B;  2M7L A;  2KNE A;  5JJG A;  3I5G B;  3CLN A;  1A75 A;  1MUX A;  1TN4 A;  3CR2 A;  3CR5 X;  3LCP C;  4ICB A;  1CM4 A;  1PSB A;  4CFQ A;  5HKW A;  4DCK A;  2BL0 C;  3TDZ A;  2KOT A;  3JVT C;  5HYD A;  2HET A;  3ICB A;  2LMT A;  3D10 A;  4MZJ A;  2L4I A;  4ZCV A;  5HLO A;  4CID A;  2KQY A;  1UHI A;  5DKN A;  3BYA A;  1OMD A;  1SMG A;  3LK0 A;  1PUL A;  1G33 A;  1GJY A;  1CKK A;  1SCV A;  3EK4 A;  1UHK A;  1DF0 B;  3PAL A;  3PN7 C;  1KFU L;  1S5G Y;  4YI8 A;  5G08 A;  3WXA A;  1SCM C;  2L2E A;  3VRP A;  2B1U A;  2GGM A;  4E68 A;  2EC6 C;  2JU0 A;  1FW4 A;  1IKU A;  1AHR A;  3O6B A;  1PAL A;  3VRR A;  1EL4 A;  2L5X B;  1IQ5 A;  1Y1U A;  2NCP A;  2JZI A;  2ZRS A;  3O78 A;  4WQ2 A;  3LLE A;  5AEQ A;  1IJ6 A;  3F45 A;  1LKJ A;  1FF1 A;  1H8B A;  1SR6 C;  1MR8 A;  2K8M B;  1KFX S;  3IQQ A;  2HF5 A;  3KEV A;  2BCX A;  2JOJ A;  1SL7 A;  1KQM C;  2MLF C;  3PAT A;  2LVI A;  2BE4 A;  4CPV A;  1LXF C;  1LVC D;  1XA5 A;  2NXQ A;  2MBX A;  1CDL A;  2K7C A;  1ZOT B;  5CPV A;  1F8H A;  2EHB A;  1J1E A;  1IQ3 A;  2GGZ A;  2KBM A;  3CS1 A;  3SG3 A;  1CFD A;  2BBM A;  4XJK A;  2KFG A;  5B8I B;  4F0Z B;  3VGO A;  5AER A;  1A29 A;  1QIV A;  1QLK A;  1RWY A;  4DS7 A;  2BE6 A;  2G9B A;  1DVI A;  1CFF A;  4JQ0 D;  4A4B A;  1J7Q A;  1XFU O;  2M29 A;  2HQW A;  3BUM B;  3BXK A;  1DJY A;  2LCP A;  2ZKM X;  2Q4U A;  2Y1M A;  1YUT A;  3NSO A;  4PHM A;  1BG1 A;  4I5N B;  2BKI B;  1KSO A;  2M1U A;  1TTX A;  4MZK A;  3WNX B;  3VRN A;  5KSZ A;  4CLN A;  2L50 A;  2LVK A;  2LAN A;  4NDC A;  1K94 A;  2G2B A;  1SKT A;  2KDH A;  5D7F A;  2KGB C;  4MVF A;  1XVJ A;  2E30 A;  3I5G C;  3TDU A;  1JSA A;  4AOM A;  4PHK A;  3LK1 A;  3FIA A;  5CSN A;  2L98 A;  2K7O A;  1CDM A;  4AQJ A;  3OX6 A;  1J7P A;  3JTD B;  4M2Q A;  1TNQ A;  5FYX A;  1S1E A;  4FTG A;  2WCE A;  2F3Z A;  1M46 A;  3PM8 A;  1QV1 A;  1XFZ O;  2AMI A;  4MBE A;  1F4O A;  1B8R A;  1KFU S;  2WOS A;  2WCF A;  1ALV A;  2PAS A;  3SIB A;  3GK1 A;  1SBJ A;  2CCM A;  4PDZ A;  1XYD A;  2NLN A;  1NX2 A;  2LVV A;  4YI9 A;  4MZL A;  2Y4Q A;  2BEC A;  1REC A;  3DF0 B;  4MRY A;  2WOR A;  1SNL A;  1KK7 Y;  4C0K A;  4NDB A;  2F8P A;  4YGE B;  2CTN A;  1S6C A;  2NZ0 A;  4FQO A;  3BQ3 A;  2H61 C;  4GAO A;  4P2Y B;  4M2O A;  1SW8 A;  2DOQ A;  1J7R A;  4R1E A;  3CTN A;  4GBA A;  2JPT A;  4XYN A;  1DT7 B;  1CB1 A;  2L4H A;  1NCZ A;  5I2L A;  3D0Y B;  4QJ3 B;  4DRW A;  5I2O A;  1V1G A;  2HQ8 A;  4UPG A;  4MLW A;  5IBW A;  2LVJ A;  2PRU A;  1FI6 A;  2I2R E;  1EG4 A;  1M31 A;  1WDC C;  2JXL A;  5I8N A;  3SG5 A;  3PSR A;  3ZNI A;  1AJ5 A;  3EVR A;  4I5L B;  1CDP A;  1UP5 A;  2K2A A;  1ZAC A;  1CMG A;  1C7V A;  1KK8 B;  2O5G A;  1PRW A;  3TS5 C;  1D1O A;  1K93 D;  3NSK A;  4C0J A;  3OP0 A;  1CM1 A;  1BLQ A;  1G4Y R;  1N0Y A;  2FJU B;  4QJ4 B;  2KI4 C;  5BPJ A;  2OTG B;  2ZN8 A;  1YX8 A;  1YRT B;  1QX2 A;  1HQV A;  2LV7 A;  5J3X A;  2SAS A;  2F2O A;  2L51 A;  2F33 A;  3BUW B;  1QX5 B;  3D0Y A;  1TIZ A;  2JXC A;  4ORC B;  5CSI A;  1S5G Z;  1XO5 A;  2JC2 A;  1K90 D;  1KWO C;  2IS9 A;  4PCW A;  1YTZ C;  1L2O C;  4DIR A;  1CLL A;  1PSR A;  1IRJ A;  1UHH A;  1QJT A;  1GGZ A;  3TDI A;  1B47 A;  2P6B B;  2ZRT A;  2PSR A;  3EKH A;  1NUB A;  2KAY A;  4USL A;  1IG5 A;  2H2K A;  2I7A A;  1A2X A;  1WRZ A;  1B7T Y;  5ER5 A;  2Q91 A;  4PHJ A;  2JTT A;  2CBL A;  1Y6W A;  1MXE A;  1PK0 D;  2KI6 C;  1S6J A;  1BOC A;  3I5H B;  2M7N A;  3CGA A;  1CFP A;  1TNP A;  3A8R A;  3JTD C;  2OS8 B;  2VRG A;  4Q04 A;  2COL B;  1BMO A;  3I5I C;  1DF0 A;  3TZ1 A;  1Q80 A;  1QXP A;  1JF2 A;  1QV0 A;  1CDN A;  2LNK A;  1SL8 A;  1E8A A;  5CSF A;  4HRH A;  1J7O A;  3DVM A;  5TNC A;  1G8I A;  1OMR A;  5I2Q A;  5KTY A;  3AKB A;  5DKQ A;  4U8D A;  4JWQ A;  2BCB A;  4ZCU A;  1JWD A;  1K9P A;  1PVB A;  1JFK A;  3NSL A;  1B9A A;  1SRA A;  2PAL A;  3OB1 B;  2I18 A;  4I5J A;  3M0W A;  1M45 A;  3C1V A;  1KSM A;  2LP2 A;  1WY9 A;  1RFJ A;  2BL0 B;  3JVT B;  1JUO A;  1WLZ A;  2K2F A;  1TRF A;  2M97 A;  2MJW B;  3I5F C;  4YRU A;  2KFH A;  3TUY C;  3CZT X;  1B4C A;  3LL8 B;  1JC2 A;  4OR9 B;  1NP8 A;  2M8U A;  1F70 A;  1S6I A;  1U5I B;  1QVI Y;  1YX7 A;  3PN7 B;  1QVI Z;  2LMV A;  1H4B A;  3RM1 A;  1ZUZ A;  2MA2 A;  3FS7 A;  2BCA A;  1SCM B;  3SG2 A;  3IF7 A;  1NCY A;  2AUC A;  2LLT A;  1LA3 A;  1NX3 A;  2EC6 B;  3SIA A;  1DGU A;  5CSJ A;  4A4C A;  1DJI A;  1QS7 A;  2JTZ A;  2KYF A;  1XFX O;  2OTG C;  1OSA A;  3AKA A;  3GK4 X;  4GFT A;  1K2H A;  3WHU B;  1HT9 A;  2ZND A;  4D1E A;  2LMU A;  1CNP A;  4HRG A;  4GGF A;  1OQP A;  1EJ3 A;  2KGR A;  2TN4 A;  2ZN9 A;  5HLV A;  4NDD A;  1SR6 B;  1KK7 Z;  4N1F A;  3H4S E;  1MQ1 A;  1DJX A;  4L9M A;  1BOD A;  3IQO A;  1K9K A;  1SY9 A;  1GQM A;  4YGC B;  1KQM B;  1X02 A;  2LLU A;  5AAN A;  4ORB B;  2KYC A;  3OB2 B;  4OV2 A;  4PHN A;  3NSI A;  1FPW A;  2MAZ A;  2L0P A;  1ALW A;  2MRD A;  4MEW A;  3O4Y A;  4OKH A;  1Y1A A;  2CXJ A;  4GNK B;  1A03 A;  2KAX A;  1TCO B;  1SYM A;  1ODB A;  3DVK A;  1LIN A;  2M3W A;  2RGI A;  3DF0 A;  1OOJ A;  1XFW O;  2CT9 A;  1C07 A;  1BR4 B;  3KPX A;  4MN0 A;  3WHT B;  3ZWH A;  2K0J A;  5KU1 A;  3RLZ A;  1IGV A;  1V1F A;  1W7I B;  1ZMZ A;  2A4J A;  2JT0 A;  1S3P A;  3GOF A;  4IL1 A;  5PAL A;  2V53 A;  1BT6 A;  2QPT A;  4PE4 A;  1TNW A;  2I94 A;  2KAV A;  4PE1 A;  1K8U A;  1AK8 A;  3BUN B;  4QJ5 B;  2WND A;  2EGD A;  1XFV O;  1B1G A;  1QAS A;  2LUC A;  1CFC A;  3NXA A;  4I5K A;  1DJZ A;  2ZFD A;  1IH0 A;  4HSZ A;  1J55 A;  2QAC A;  1R6P A;  2WCB A;  1C7W A;  1XFY O;  3OHM B;  2Y1N A;  4GGF C;  3MSE B;  1F54 A;  1RJV A;  1EG3 A;  1B7T Z;  1ZFS A;  1AUI B;  2K61 A;  3SG6 A;  1W7J B;  3SJS A;  1YR5 A;  1Y1X A;  3GK2 A;  2KHN A;  5HKY A;  4BY4 A;  1AJ4 A;  1AVS A;  1M63 B;  4YBH B;  1NSH A;  4M2P A;  1YVL A;  2WC8 A;  1B8L A;  2KSP A;  1TOP A;  3OX5 A;  1YRU B;  1OE9 B;  1XK4 A;  4XJK B;  2ISD A;  3EK8 A;  1QAT A;  4PAL A;  1NX1 A;  1YUS A;  2GV5 A;  1OZS A;  1S26 D;  4YGB B;  2CNP A;  2M9G A;  2M49 B;  4YGA A;  1DGV A;  1DMO A;  3EK7 A;  3CWG A;  1SPY A;  1CMF A;  2JQ6 A;  4MRX A;  4N1G A;  1RRO A;  1GGW A;  1WDC B;  1K96 A;  5F6T A;  1PVA A;  2NCO A;  4MSP A;  3VRO A;  2BBN A;  4ORA B;  5AFP A;  1NCX A;  3E3R A;  3A4U B;  1UWO A;  3QRX A;  1TNX A;  4DUQ A;  2KFF A;  5K89 A;  2JNF A;  1F55 A;  3TS5 B;  3K21 A;  1RTP 1;  3DVE A;  1JBA A;  3CR4 X;  2O60 A;  1IWQ A;  2H61 A;  2KI4 B;  2M1K B;  3BUX B;  1WRK A;  2JT8 A;  1VRK A;  4OVN F;  1NYA A;  1BR1 B;  5DKR A;  2LLS A;  1QLS A;  1KK8 C;  1JFJ A;  1BF5 A;  1BU3 A;  1MF8 B;  5D69 A;  1KWO B;  4P5O E;  1DJH A;  3HCM A;  3PFV A;  4PE7 A;  1R2U A;  1L2O B;  2FOT A;  2JWW A;  1WLM A;  1F71 A;  1J1D A;  3BOW B;  1QIW A;  1NWD A;  1UHJ A;  4OCI A;  2LP3 A;  2JUL A;  1NPQ A;  2PVB A;  2JNX A;  3O2P A;  1IJ5 A;  1S36 A;  3FWC A;  2HPS A;  1DJG A;  3KF9 A;  1NX0 A;  3EVU A;  1YVH A;  2JT3 A;  1XK4 C;  1MXL C;  4GUK A;  1TCF A;  2MLE C;  4GGN A;  1B8C A;  3PLF B;  2ZNE A;  5JOL A;  3VRQ A;  4AQI A;  1DJW A;  1QX7 A;  3KO0 A;  5ER4 X;  1N2D A;  1MHO A;  3KHE A;  2LHI A;  1YUU A;  2BKH B;  1U5I A;  3I5I B;  1F4Q A;  1LA0 A;  5GQQ C;  2PMY A;  1KFX L;  1A4P A;  4WQ3 A;  4ETO A;  3DVJ A;  3SG7 A;  4TNC A;  3HX4 A;  1CLM A;  2KI6 D;  1K9U A;  2LAP A;  1EH2 A;  1EXR A;  4BY5 A;  3AAK A;  3BOW A;  1RK9 A;  2M0R A;  1NIW A;  1K95 A;  1Y0V H;  2F2P A;  3I5H C;  1UHN A;  1UUS A;  1A75 B;  1BJF A;  2LM5 A;  2OS8 C;  3SG4 A;  1OMV A;  2K7B A;  1JF0 A;  2LHL A;  3FWB A;  2LUX A;  4NQG A;  1KCY A;  1N65 A;  1SK6 D;  5HKZ A;  1L7Z A; 
#chains in the Genus database with same CATH topology
 1MWN A;  1CLB A;  1FBV A;  2E6W A;  1YUR A;  2MHH A;  3AAJ A;  1KQV A;  4N5X A;  4CFR A;  1AP4 A;  2FCE A;  3EKJ A;  4HRE E;  4PE0 A;  2KQ6 A;  3BUO B;  3D75 A;  1OZO A;  1QTX A;  3DD4 A;  5AXI A;  2LE9 B;  4JPZ B;  4WRI A;  2F3Y A;  2FCD A;  3EVV A;  2LC5 A;  3EG5 B;  1WRL A;  4C0L A;  1CTR A;  1SL9 A;  3I5F B;  1M39 A;  2JRF A;  2K7D A;  4GPL B;  2Y5I A;  1FI5 A;  2AAO A;  1DTL A;  2D8N A;  3TUY B;  2KBI A;  2OPO A;  1UUR A;  2SCP A;  2R2I A;  4YGD B;  2M7L A;  2KNE A;  5JJG A;  1ORG A;  3VB1 A;  3I5G B;  3CLN A;  1A75 A;  1MUX A;  1TN4 A;  3CR2 A;  3CR5 X;  3LCP C;  4ICB A;  1CM4 A;  1PSB A;  4CFQ A;  5HKW A;  4DCK A;  2BL0 C;  3TDZ A;  2KOT A;  3IVT A;  3JVT C;  5HYD A;  2HET A;  3ICB A;  2LMT A;  3D10 A;  4MZJ A;  2L4I A;  4ZCV A;  5HLO A;  4CID A;  2KQY A;  1UHI A;  5DKN A;  3BYA A;  1OMD A;  1SMG A;  3LK0 A;  1PUL A;  1G33 A;  1GJY A;  1CKK A;  1SCV A;  3EK4 A;  1UHK A;  1DF0 B;  3PAL A;  3PN7 C;  1KFU L;  1S5G Y;  4YI8 A;  5G08 A;  3WXA A;  1IIO A;  1SCM C;  2L2E A;  3VRP A;  2B1U A;  2GGM A;  4E68 A;  2EC6 C;  2JU0 A;  1FW4 A;  1IKU A;  1AHR A;  3O6B A;  1PAL A;  3VRR A;  1EL4 A;  2L5X B;  1IQ5 A;  1Y1U A;  2WCJ A;  2NCP A;  2JZI A;  2ZRS A;  3O78 A;  4WQ2 A;  3LLE A;  5AEQ A;  1IJ6 A;  3F45 A;  3CAB A;  1LKJ A;  1FF1 A;  1H8B A;  1SR6 C;  1MR8 A;  2K8M B;  2L5Y A;  1KFX S;  3IQQ A;  3SS4 A;  2HF5 A;  3KEV A;  2BCX A;  2JOJ A;  1SL7 A;  1KQM C;  2MLF C;  3PAT A;  2LVI A;  2BE4 A;  4CPV A;  1LXF C;  1LVC D;  1XA5 A;  2NXQ A;  2MBX A;  1CDL A;  2K7C A;  1ZOT B;  5CPV A;  1F8H A;  2EHB A;  1J1E A;  1IQ3 A;  2GGZ A;  2KBM A;  3CS1 A;  3SG3 A;  1CFD A;  5EL2 A;  2BBM A;  4XJK A;  2KFG A;  1C3Z A;  4F0Z B;  3VGO A;  5B8I B;  5AER A;  1A29 A;  1QIV A;  1QLK A;  1RWY A;  4DS7 A;  2BE6 A;  2G9B A;  4GFT A;  1DVI A;  5D3O A;  1CFF A;  4JQ0 D;  4A4B A;  1J7Q A;  1XFU O;  2M29 A;  2HQW A;  3BUM B;  3BXK A;  1DJY A;  2LCP A;  3B86 A;  2ZKM X;  1C3Y A;  2Q4U A;  2Y1M A;  1YUT A;  3RZS A;  3NSO A;  4PHM A;  1BG1 A;  4I5N B;  3S0F A;  2BKI B;  1KSO A;  2M1U A;  1TTX A;  3Q8I A;  4MZK A;  3WNX B;  3VRN A;  5KSZ A;  3N7H A;  4CLN A;  2L50 A;  2LVK A;  2LAN A;  4NDC A;  1K94 A;  2G2B A;  1SKT A;  2KDH A;  5D7F A;  2KGB C;  3B6X A;  4MVF A;  3B7A A;  1XVJ A;  1OOI X;  2E30 A;  3I5G C;  3TDU A;  1JSA A;  4AOM A;  4PHK A;  3LK1 A;  3FIA A;  5CSN A;  2L98 A;  1OOG A;  1CDM A;  2K7O A;  4AQJ A;  3OX6 A;  1J7P A;  3JTD B;  4M2Q A;  2QEB A;  1TNQ A;  2QEH A;  2QEO A;  5FYX A;  1S1E A;  4FTG A;  2WCE A;  2F3Z A;  2WCM A;  1M46 A;  2K60 A;  1QV1 A;  1XFZ O;  2AMI A;  3PM8 A;  5DIC A;  4MBE A;  1F4O A;  1B8R A;  1KFU S;  3DZT A;  2WOS A;  2WCF A;  1ALV A;  2PAS A;  3B88 A;  2GTE A;  1SBJ A;  2CCM A;  3GK1 A;  3SIB A;  4PDZ A;  1XYD A;  2NLN A;  1NX2 A;  2LVV A;  4YI9 A;  4MZL A;  2Y4Q A;  2BEC A;  1REC A;  2WCL A;  3DF0 B;  4MRY A;  2WOR A;  1SNL A;  1KK7 Y;  2BAP A;  2WCH A;  1DEK A;  4C0K A;  4NDB A;  2F8P A;  4YGE B;  2CTN A;  1S6C A;  2NZ0 A;  4FQO A;  3BQ3 A;  2H61 C;  4GAO A;  4P2Y B;  1DC1 A;  4M2O A;  1SW8 A;  2DOQ A;  1J7R A;  4R1E A;  3CTN A;  4GBA A;  2JPT A;  4XYN A;  1DT7 B;  1CB1 A;  2L4H A;  1NCZ A;  5I2L A;  3S0A A;  3D0Y B;  4JKT A;  4QJ3 B;  4DRW A;  1V1G A;  5I2O A;  2HQ8 A;  2WC5 A;  4MLW A;  4UPG A;  5IBW A;  2LVJ A;  2PRU A;  1FI6 A;  2I2R E;  3OGN A;  1EG4 A;  1M31 A;  1WDC C;  2JXL A;  5I8N A;  3SG5 A;  3L4L A;  3PSR A;  3ZNI A;  2L2C A;  1AJ5 A;  3EVR A;  4I5L B;  2QDI A;  1CDP A;  1UP5 A;  2K2A A;  1ZAC A;  1CMG A;  1C7V A;  1KK8 B;  2O5G A;  1PRW A;  2P71 A;  3TS5 C;  1D1O A;  1K93 D;  3NSK A;  5HL1 A;  4C0J A;  3OP0 A;  1CM1 A;  1BLQ A;  1SSE B;  1G4Y R;  1N0Y A;  2FJU B;  4QJ4 B;  2KI4 C;  2WCK A;  5BPJ A;  2OTG B;  2ZN8 A;  1YX8 A;  1YRT B;  1QX2 A;  1HQV A;  2LV7 A;  5J3X A;  3PJI A;  2SAS A;  2F2O A;  2L51 A;  2F33 A;  3BUW B;  1QX5 B;  3D0Y A;  5FI2 A;  1TIZ A;  2JXC A;  4ORC B;  4F7F A;  5CSI A;  1S5G Z;  1XO5 A;  2JC2 A;  1K90 D;  1KWO C;  2IS9 A;  4PCW A;  1YTZ C;  3BFA A;  1L2O C;  4KYN A;  4DIR A;  1CLL A;  1PSR A;  1IRJ A;  1UHH A;  1QJT A;  1GGZ A;  3TDI A;  1B47 A;  2P6B B;  2ZRT A;  2PSR A;  3EKH A;  1NUB A;  2KAY A;  4USL A;  1IG5 A;  2H2K A;  2I7A A;  1A2X A;  1WRZ A;  1B7T Y;  5ER5 A;  2Q91 A;  4PHJ A;  2JTT A;  2CBL A;  1Y6W A;  4FQT A;  2KPH A;  1MXE A;  1PK0 D;  2KI6 C;  1S6J A;  1BOC A;  3I5H B;  2M7N A;  2JPO A;  3CGA A;  3FE9 A;  1CFP A;  1TNP A;  3A8R A;  2BNX A;  3JTD C;  2OS8 B;  2VRG A;  4Q04 A;  2COL B;  1BMO A;  3I5I C;  1DF0 A;  3TZ1 A;  3S0B A;  1Q80 A;  1QXP A;  2KLE A;  1JF2 A;  3S0E A;  1QV0 A;  1CDN A;  3L47 A;  2LNK A;  1SL8 A;  1E8A A;  5CSF A;  4HRH A;  1J7O A;  3DVM A;  5TNC A;  1G8I A;  1OMR A;  5I2Q A;  5KTY A;  3AKB A;  5DKQ A;  4U8D A;  4JWQ A;  2BCB A;  1TUJ A;  1P28 A;  3OBV A;  3R1P A;  4ZCU A;  1JWD A;  1K9P A;  1PVB A;  1JFK A;  3NSL A;  1B9A A;  1SRA A;  2PAL A;  3OB1 B;  2I18 A;  4I5J A;  3M0W A;  1M45 A;  3C1V A;  3PM2 A;  1KSM A;  2LP2 A;  1WY9 A;  1RFJ A;  2BL0 B;  3JVT B;  1JUO A;  1WLZ A;  2K2F A;  1TRF A;  2P70 A;  2M97 A;  2MJW B;  3I5F C;  4YRU A;  2KFH A;  3TUY C;  1Z4H A;  2FJY A;  3CZT X;  1TUZ A;  1B4C A;  3LL8 B;  4IJ7 A;  4OR9 B;  1JC2 A;  1NP8 A;  2M8U A;  1F70 A;  1S6I A;  1U5I B;  1QVI Y;  1YX7 A;  2WC6 A;  3PN7 B;  1QVI Z;  2LMV A;  1H4B A;  3RM1 A;  1ZUZ A;  2MA2 A;  3FS7 A;  2BCA A;  1SCM B;  3SG2 A;  3IF7 A;  1NCY A;  2AUC A;  2LLT A;  1LA3 A;  1NX3 A;  2EC6 B;  3BFB A;  3SIA A;  1DGU A;  5CSJ A;  4A4C A;  1DJI A;  1QS7 A;  2JTZ A;  2KYF A;  1XFX O;  2OTG C;  1OSA A;  3AKA A;  3DXL A;  3GK4 X;  1K2H A;  3R1V A;  3WHU B;  1HT9 A;  4INW A;  2ZND A;  4D1E A;  2LMU A;  1CNP A;  4HRG A;  4GGF A;  1OQP A;  1EJ3 A;  2KGR A;  1OW4 A;  2TN4 A;  2ZN9 A;  5HLV A;  4NDD A;  1SR6 B;  1KK7 Z;  3L4A A;  3H4S E;  4N1F A;  3S0D A;  1MQ1 A;  1DJX A;  3CZ2 A;  4L9M A;  1BOD A;  3FE6 A;  3IQO A;  1K9K A;  1SY9 A;  1GQM A;  3D77 A;  1KQM B;  1X02 A;  2LLU A;  3D73 A;  4YGC B;  5AAN A;  4ORB B;  3BJH A;  2KYC A;  3OB2 B;  4OV2 A;  4PHN A;  3NSI A;  1FPW A;  2MAZ A;  1GM0 A;  2L0P A;  1ALW A;  2MRD A;  3BFH A;  4MEW A;  3CZ0 A;  3O4Y A;  4OKH A;  1Y1A A;  2CXJ A;  4GNK B;  3D76 A;  1A03 A;  3DY9 A;  2KAX A;  3UNW A;  1TCO B;  1SYM A;  1ODB A;  3DVK A;  1LIN A;  2M3W A;  2RGI A;  4OZD A;  3DF0 A;  1OOJ A;  1XFW O;  2CT9 A;  1C07 A;  1BR4 B;  3KPX A;  4MN0 A;  3WHT B;  3ZWH A;  2K0J A;  5KU1 A;  3RLZ A;  1IGV A;  3CYZ A;  3D78 A;  5FI7 A;  1V1F A;  1W7I B;  1ZMZ A;  2A4J A;  2JT0 A;  1S3P A;  3GOF A;  4IL1 A;  5PAL A;  2V53 A;  1BT6 A;  2QPT A;  4PE4 A;  1TNW A;  2I94 A;  2KAV A;  4PE1 A;  1K8U A;  1AK8 A;  3BUN B;  4QJ5 B;  1XFR A;  2WND A;  2EGD A;  1XFV O;  1B1G A;  1QAS A;  2LUC A;  1CFC A;  3NXA A;  4I5K A;  1DJZ A;  2ZFD A;  2YGU A;  1IH0 A;  4HSZ A;  1J55 A;  2QAC A;  1R6P A;  2WCB A;  3FE8 A;  4INX A;  1C7W A;  1XFY O;  3OHM B;  2Y1N A;  4GGF C;  3MSE B;  1F54 A;  3CDN A;  1RJV A;  1EG3 A;  3K1E A;  1B7T Z;  1ZFS A;  1AUI B;  2K61 A;  3SG6 A;  1W7J B;  3SJS A;  1YR5 A;  1Y1X A;  3GK2 A;  2KHN A;  5HKY A;  4BY4 A;  1AJ4 A;  1AVS A;  1M63 B;  4YBH B;  1NSH A;  1LS8 A;  3SS3 A;  4M2P A;  3S0G A;  1YVL A;  2WC8 A;  1B8L A;  2KSP A;  1TOP A;  1DEL A;  3OX5 A;  1YRU B;  1OE9 B;  1XK4 A;  4XJK B;  2ISD A;  3EK8 A;  1QAT A;  4PAL A;  1NX1 A;  1YUS A;  1OOH A;  2GV5 A;  1OZS A;  1S26 D;  4YGB B;  2CNP A;  2M9G A;  2M49 B;  4YGA A;  1DGV A;  5I94 A;  1W9Z A;  1DMO A;  3EK7 A;  3CWG A;  1SPY A;  1CMF A;  2JQ6 A;  4MRX A;  4N1G A;  1RRO A;  1GGW A;  1QWV A;  1WDC B;  1K96 A;  5F6T A;  1PVA A;  2NCO A;  4MSP A;  3VRO A;  1Z2C B;  3D74 A;  2BBN A;  4ORA B;  5AFP A;  1NCX A;  3E3R A;  3A4U B;  1UWO A;  3QRX A;  1TNX A;  4DUQ A;  2KFF A;  5K89 A;  2JNF A;  1F55 A;  3TS5 B;  3K21 A;  1RTP 1;  3DVE A;  1JBA A;  3CR4 X;  2O60 A;  1IWQ A;  3SS5 A;  1DQE A;  2H61 A;  2KI4 B;  2M1K B;  3BUX B;  2PYQ A;  1WRK A;  2JT8 A;  3UO9 A;  1VRK A;  4OVN F;  1NYA A;  1BR1 B;  5DKR A;  2LLS A;  1QLS A;  1OOF A;  1KK8 C;  1JFJ A;  1BF5 A;  1BU3 A;  1MF8 B;  2QEV A;  5D69 A;  1KWO B;  1TWO A;  4P5O E;  1DJH A;  3HCM A;  3PFV A;  4PE7 A;  1R2U A;  1L2O B;  2FOT A;  2JWW A;  1WLM A;  1F71 A;  1J1D A;  3BOW B;  1QIW A;  1NWD A;  1UHJ A;  2PQL A;  4OCI A;  2LP3 A;  2JUL A;  1NPQ A;  2PVB A;  2JNX A;  3O2P A;  1IJ5 A;  3DYE A;  5FI6 A;  1S36 A;  3FWC A;  2HPS A;  1DJG A;  3KF9 A;  1NX0 A;  3EVU A;  1YVH A;  2JT3 A;  1XK4 C;  4JD9 A;  1MXL C;  4GUK A;  1TCF A;  2MLE C;  4GGN A;  1B8C A;  3PLF B;  4PT1 A;  2ZNE A;  5JOL A;  3VRQ A;  1T14 A;  4AQI A;  1DJW A;  1QX7 A;  3KO0 A;  3NGV A;  5ER4 X;  1N2D A;  1MHO A;  3KHE A;  2LHI A;  1YUU A;  2BKH B;  1U5I A;  3I5I B;  1F4Q A;  1LA0 A;  5GQQ C;  2PMY A;  1KFX L;  1A4P A;  4WQ3 A;  4ETO A;  3R1O A;  3DVJ A;  3SG7 A;  3NHI A;  2H8V A;  3NHT A;  4TNC A;  3HX4 A;  2ERB A;  1CLM A;  2KI6 D;  1K9U A;  3CZ1 A;  2LAP A;  1EH2 A;  1EXR A;  3B87 A;  4BY5 A;  3AAK A;  3BOW A;  1RK9 A;  2M0R A;  1NIW A;  1K95 A;  1Y0V H;  2F2P A;  3I5H C;  3R72 A;  1UHN A;  1UUS A;  1A75 B;  3V2L A;  1BJF A;  2LM5 A;  3O4X A;  3QME A;  2OS8 C;  3SG4 A;  1OMV A;  2K7B A;  1JF0 A;  2LHL A;  3FWB A;  2LUX A;  4NQG A;  1KCY A;  2KLD A;  1N65 A;  1SK6 D;  5HKZ A;  1L7Z A; 
#chains in the Genus database with same CATH homology
 1MWN A;  1CLB A;  1FBV A;  2E6W A;  1YUR A;  2MHH A;  3AAJ A;  1KQV A;  4N5X A;  4CFR A;  1AP4 A;  2FCE A;  3EKJ A;  4HRE E;  4PE0 A;  2KQ6 A;  3BUO B;  1OZO A;  1QTX A;  3DD4 A;  5AXI A;  2LE9 B;  4JPZ B;  4WRI A;  2F3Y A;  2FCD A;  3EVV A;  2LC5 A;  1WRL A;  4C0L A;  1CTR A;  1SL9 A;  3I5F B;  1M39 A;  2JRF A;  2K7D A;  4GPL B;  2Y5I A;  1FI5 A;  2AAO A;  1DTL A;  2D8N A;  3TUY B;  2KBI A;  2OPO A;  1UUR A;  2SCP A;  2R2I A;  4YGD B;  2M7L A;  2KNE A;  5JJG A;  3I5G B;  3CLN A;  1A75 A;  1MUX A;  1TN4 A;  3CR2 A;  3CR5 X;  3LCP C;  4ICB A;  1CM4 A;  1PSB A;  4CFQ A;  5HKW A;  4DCK A;  2BL0 C;  3TDZ A;  2KOT A;  3JVT C;  5HYD A;  2HET A;  3ICB A;  2LMT A;  3D10 A;  4MZJ A;  2L4I A;  4ZCV A;  5HLO A;  4CID A;  2KQY A;  1UHI A;  5DKN A;  3BYA A;  1OMD A;  1SMG A;  3LK0 A;  1PUL A;  1G33 A;  1GJY A;  1CKK A;  1SCV A;  3EK4 A;  1UHK A;  1DF0 B;  3PAL A;  3PN7 C;  1KFU L;  1S5G Y;  4YI8 A;  5G08 A;  3WXA A;  1SCM C;  2L2E A;  3VRP A;  2B1U A;  2GGM A;  4E68 A;  2EC6 C;  2JU0 A;  1FW4 A;  1IKU A;  1AHR A;  3O6B A;  1PAL A;  3VRR A;  1EL4 A;  2L5X B;  1IQ5 A;  1Y1U A;  2NCP A;  2JZI A;  2ZRS A;  3O78 A;  4WQ2 A;  3LLE A;  5AEQ A;  1IJ6 A;  3F45 A;  1LKJ A;  1FF1 A;  1H8B A;  1SR6 C;  1MR8 A;  2K8M B;  1KFX S;  3IQQ A;  2HF5 A;  3KEV A;  2BCX A;  2JOJ A;  1SL7 A;  1KQM C;  2MLF C;  3PAT A;  2LVI A;  2BE4 A;  4CPV A;  1LXF C;  1LVC D;  1XA5 A;  2NXQ A;  2MBX A;  1CDL A;  2K7C A;  1ZOT B;  5CPV A;  1F8H A;  2EHB A;  1J1E A;  1IQ3 A;  2GGZ A;  2KBM A;  3CS1 A;  3SG3 A;  1CFD A;  2BBM A;  4XJK A;  2KFG A;  5B8I B;  4F0Z B;  3VGO A;  5AER A;  1A29 A;  1QIV A;  1QLK A;  1RWY A;  4DS7 A;  2BE6 A;  2G9B A;  1DVI A;  1CFF A;  4JQ0 D;  4A4B A;  1J7Q A;  1XFU O;  2M29 A;  2HQW A;  3BUM B;  3BXK A;  1DJY A;  2LCP A;  2ZKM X;  2Q4U A;  2Y1M A;  1YUT A;  3NSO A;  4PHM A;  1BG1 A;  4I5N B;  2BKI B;  1KSO A;  2M1U A;  1TTX A;  4MZK A;  3WNX B;  3VRN A;  5KSZ A;  4CLN A;  2L50 A;  2LVK A;  2LAN A;  4NDC A;  1K94 A;  2G2B A;  1SKT A;  2KDH A;  5D7F A;  2KGB C;  4MVF A;  1XVJ A;  2E30 A;  3I5G C;  3TDU A;  1JSA A;  4AOM A;  4PHK A;  3LK1 A;  3FIA A;  5CSN A;  2L98 A;  2K7O A;  1CDM A;  4AQJ A;  3OX6 A;  1J7P A;  3JTD B;  4M2Q A;  1TNQ A;  5FYX A;  1S1E A;  4FTG A;  2WCE A;  2F3Z A;  1M46 A;  3PM8 A;  1QV1 A;  1XFZ O;  2AMI A;  4MBE A;  1F4O A;  1B8R A;  1KFU S;  2WOS A;  2WCF A;  1ALV A;  2PAS A;  3SIB A;  3GK1 A;  1SBJ A;  2CCM A;  4PDZ A;  1XYD A;  2NLN A;  1NX2 A;  2LVV A;  4YI9 A;  4MZL A;  2Y4Q A;  2BEC A;  1REC A;  3DF0 B;  4MRY A;  2WOR A;  1SNL A;  1KK7 Y;  4C0K A;  4NDB A;  2F8P A;  4YGE B;  2CTN A;  1S6C A;  2NZ0 A;  4FQO A;  3BQ3 A;  2H61 C;  4GAO A;  4P2Y B;  4M2O A;  1SW8 A;  2DOQ A;  1J7R A;  4R1E A;  3CTN A;  4GBA A;  2JPT A;  4XYN A;  1DT7 B;  1CB1 A;  2L4H A;  1NCZ A;  5I2L A;  3D0Y B;  4QJ3 B;  4DRW A;  5I2O A;  1V1G A;  2HQ8 A;  4UPG A;  4MLW A;  5IBW A;  2LVJ A;  2PRU A;  1FI6 A;  2I2R E;  1EG4 A;  1M31 A;  1WDC C;  2JXL A;  5I8N A;  3SG5 A;  3PSR A;  3ZNI A;  1AJ5 A;  3EVR A;  4I5L B;  1CDP A;  1UP5 A;  2K2A A;  1ZAC A;  1CMG A;  1C7V A;  1KK8 B;  2O5G A;  1PRW A;  3TS5 C;  1D1O A;  1K93 D;  3NSK A;  4C0J A;  3OP0 A;  1CM1 A;  1BLQ A;  1G4Y R;  1N0Y A;  2FJU B;  4QJ4 B;  2KI4 C;  5BPJ A;  2OTG B;  2ZN8 A;  1YX8 A;  1YRT B;  1QX2 A;  1HQV A;  2LV7 A;  5J3X A;  2SAS A;  2F2O A;  2L51 A;  2F33 A;  3BUW B;  1QX5 B;  3D0Y A;  1TIZ A;  2JXC A;  4ORC B;  5CSI A;  1S5G Z;  1XO5 A;  2JC2 A;  1K90 D;  1KWO C;  2IS9 A;  4PCW A;  1YTZ C;  1L2O C;  4DIR A;  1CLL A;  1PSR A;  1IRJ A;  1UHH A;  1QJT A;  1GGZ A;  3TDI A;  1B47 A;  2P6B B;  2ZRT A;  2PSR A;  3EKH A;  1NUB A;  2KAY A;  4USL A;  1IG5 A;  2H2K A;  2I7A A;  1A2X A;  1WRZ A;  1B7T Y;  5ER5 A;  2Q91 A;  4PHJ A;  2JTT A;  2CBL A;  1Y6W A;  1MXE A;  1PK0 D;  2KI6 C;  1S6J A;  1BOC A;  3I5H B;  2M7N A;  3CGA A;  1CFP A;  1TNP A;  3A8R A;  3JTD C;  2OS8 B;  2VRG A;  4Q04 A;  2COL B;  1BMO A;  3I5I C;  1DF0 A;  3TZ1 A;  1Q80 A;  1QXP A;  1JF2 A;  1QV0 A;  1CDN A;  2LNK A;  1SL8 A;  1E8A A;  5CSF A;  4HRH A;  1J7O A;  3DVM A;  5TNC A;  1G8I A;  1OMR A;  5I2Q A;  5KTY A;  3AKB A;  5DKQ A;  4U8D A;  4JWQ A;  2BCB A;  4ZCU A;  1JWD A;  1K9P A;  1PVB A;  1JFK A;  3NSL A;  1B9A A;  1SRA A;  2PAL A;  3OB1 B;  2I18 A;  4I5J A;  3M0W A;  1M45 A;  3C1V A;  1KSM A;  2LP2 A;  1WY9 A;  1RFJ A;  2BL0 B;  3JVT B;  1JUO A;  1WLZ A;  2K2F A;  1TRF A;  2M97 A;  2MJW B;  3I5F C;  4YRU A;  2KFH A;  3TUY C;  3CZT X;  1B4C A;  3LL8 B;  1JC2 A;  4OR9 B;  1NP8 A;  2M8U A;  1F70 A;  1S6I A;  1U5I B;  1QVI Y;  1YX7 A;  3PN7 B;  1QVI Z;  2LMV A;  1H4B A;  3RM1 A;  1ZUZ A;  2MA2 A;  3FS7 A;  2BCA A;  1SCM B;  3SG2 A;  3IF7 A;  1NCY A;  2AUC A;  2LLT A;  1LA3 A;  1NX3 A;  2EC6 B;  3SIA A;  1DGU A;  5CSJ A;  4A4C A;  1DJI A;  1QS7 A;  2JTZ A;  2KYF A;  1XFX O;  2OTG C;  1OSA A;  3AKA A;  3GK4 X;  4GFT A;  1K2H A;  3WHU B;  1HT9 A;  2ZND A;  4D1E A;  2LMU A;  1CNP A;  4HRG A;  4GGF A;  1OQP A;  1EJ3 A;  2KGR A;  2TN4 A;  2ZN9 A;  5HLV A;  4NDD A;  1SR6 B;  1KK7 Z;  4N1F A;  3H4S E;  1MQ1 A;  1DJX A;  4L9M A;  1BOD A;  3IQO A;  1K9K A;  1SY9 A;  1GQM A;  4YGC B;  1KQM B;  1X02 A;  2LLU A;  5AAN A;  4ORB B;  2KYC A;  3OB2 B;  4OV2 A;  4PHN A;  3NSI A;  1FPW A;  2MAZ A;  2L0P A;  1ALW A;  2MRD A;  4MEW A;  3O4Y A;  4OKH A;  1Y1A A;  2CXJ A;  4GNK B;  1A03 A;  2KAX A;  1TCO B;  1SYM A;  1ODB A;  3DVK A;  1LIN A;  2M3W A;  2RGI A;  3DF0 A;  1OOJ A;  1XFW O;  2CT9 A;  1C07 A;  1BR4 B;  3KPX A;  4MN0 A;  3WHT B;  3ZWH A;  2K0J A;  5KU1 A;  3RLZ A;  1IGV A;  1V1F A;  1W7I B;  1ZMZ A;  2A4J A;  2JT0 A;  1S3P A;  3GOF A;  4IL1 A;  5PAL A;  2V53 A;  1BT6 A;  2QPT A;  4PE4 A;  1TNW A;  2I94 A;  2KAV A;  4PE1 A;  1K8U A;  1AK8 A;  3BUN B;  4QJ5 B;  2WND A;  2EGD A;  1XFV O;  1B1G A;  1QAS A;  2LUC A;  1CFC A;  3NXA A;  4I5K A;  1DJZ A;  2ZFD A;  1IH0 A;  4HSZ A;  1J55 A;  2QAC A;  1R6P A;  2WCB A;  1C7W A;  1XFY O;  3OHM B;  2Y1N A;  4GGF C;  3MSE B;  1F54 A;  1RJV A;  1EG3 A;  1B7T Z;  1ZFS A;  1AUI B;  2K61 A;  3SG6 A;  1W7J B;  3SJS A;  1YR5 A;  1Y1X A;  3GK2 A;  2KHN A;  5HKY A;  4BY4 A;  1AJ4 A;  1AVS A;  1M63 B;  4YBH B;  1NSH A;  4M2P A;  1YVL A;  2WC8 A;  1B8L A;  2KSP A;  1TOP A;  3OX5 A;  1YRU B;  1OE9 B;  1XK4 A;  4XJK B;  2ISD A;  3EK8 A;  1QAT A;  4PAL A;  1NX1 A;  1YUS A;  2GV5 A;  1OZS A;  1S26 D;  4YGB B;  2CNP A;  2M9G A;  2M49 B;  4YGA A;  1DGV A;  1DMO A;  3EK7 A;  3CWG A;  1SPY A;  1CMF A;  2JQ6 A;  4MRX A;  4N1G A;  1RRO A;  1GGW A;  1WDC B;  1K96 A;  5F6T A;  1PVA A;  2NCO A;  4MSP A;  3VRO A;  2BBN A;  4ORA B;  5AFP A;  1NCX A;  3E3R A;  3A4U B;  1UWO A;  3QRX A;  1TNX A;  4DUQ A;  2KFF A;  5K89 A;  2JNF A;  1F55 A;  3TS5 B;  3K21 A;  1RTP 1;  3DVE A;  1JBA A;  3CR4 X;  2O60 A;  1IWQ A;  2H61 A;  2KI4 B;  2M1K B;  3BUX B;  1WRK A;  2JT8 A;  1VRK A;  4OVN F;  1NYA A;  1BR1 B;  5DKR A;  2LLS A;  1QLS A;  1KK8 C;  1JFJ A;  1BF5 A;  1BU3 A;  1MF8 B;  5D69 A;  1KWO B;  4P5O E;  1DJH A;  3HCM A;  3PFV A;  4PE7 A;  1R2U A;  1L2O B;  2FOT A;  2JWW A;  1WLM A;  1F71 A;  1J1D A;  3BOW B;  1QIW A;  1NWD A;  1UHJ A;  4OCI A;  2LP3 A;  2JUL A;  1NPQ A;  2PVB A;  2JNX A;  3O2P A;  1IJ5 A;  1S36 A;  3FWC A;  2HPS A;  1DJG A;  3KF9 A;  1NX0 A;  3EVU A;  1YVH A;  2JT3 A;  1XK4 C;  1MXL C;  4GUK A;  1TCF A;  2MLE C;  4GGN A;  1B8C A;  3PLF B;  2ZNE A;  5JOL A;  3VRQ A;  4AQI A;  1DJW A;  1QX7 A;  3KO0 A;  5ER4 X;  1N2D A;  1MHO A;  3KHE A;  2LHI A;  1YUU A;  2BKH B;  1U5I A;  3I5I B;  1F4Q A;  1LA0 A;  5GQQ C;  2PMY A;  1KFX L;  1A4P A;  4WQ3 A;  4ETO A;  3DVJ A;  3SG7 A;  4TNC A;  3HX4 A;  1CLM A;  2KI6 D;  1K9U A;  2LAP A;  1EH2 A;  1EXR A;  4BY5 A;  3AAK A;  3BOW A;  1RK9 A;  2M0R A;  1NIW A;  1K95 A;  1Y0V H;  2F2P A;  3I5H C;  1UHN A;  1UUS A;  1A75 B;  1BJF A;  2LM5 A;  2OS8 C;  3SG4 A;  1OMV A;  2K7B A;  1JF0 A;  2LHL A;  3FWB A;  2LUX A;  4NQG A;  1KCY A;  1N65 A;  1SK6 D;  5HKZ A;  1L7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...