1LXFC

Structure of the regulatory n-domain of human cardiac troponin c in complex with human cardiac troponin-i(147-163) and bepridil
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein, protein binding
molecule keywords TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES
publication title Structure of the regulatory N-domain of human cardiac troponin C in complex with human cardiac troponin I147-163 and bepridil.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1lxfC00
5CSJA 1QV1A 1CTRA 1DGVA 1NCZA 1SBJA 1ZFSA 1DJZA 3JTDC 5HKZA 5DKRA 1YURA 3NSOA 2JNFA 1CLBA 4F0ZB 3NSLA 2KAXA 2HQ8A 3O6BA 1PULA 1YRUB 1NX1A 2K2AA 5G08A 2LLSA 2EHBA 1H4BA 5I2QA 1B4CA 4M2QA 1BG1A 2NCPA 1BODA 1QJTA 4UPGA 1S36A 1UURA 2JNXA 1CM1A 1DGUA 3TUYC 2M49B 1DF0A 2M3WA 2KBMA 3VRQA 1OMRA 1JFJA 2O5GA 3BQ3A 1GGZA 1K9UA 1SK6D 2Y4QA 3EVRA 2BE4A 4L9MA 1IJ5A 1GJYA 2ZN9A 1QXPA 4YI9A 4MLWA 1J55A 1WLZA 2KYFA 2LMVA 2K0JA 1NWDA 3I5GC 1OE9B 2GGZA 3CR4X 1QX2A 1KQVA 3O4YA 2EC6B 3TDUA 5K89A 1YVLA 1LA0A 1CDPA 3RLZA 1B8LA 2MHHA 2NXQA 1Y1XA 3IQQA 1PSBA 3LK1A 4HREE 3EK4A 1SCMB 3BUNB 4GPLB 5I8NA 2BCXA 1W7IB 2CXJA 3O2PA 1J7RA 3IQOA 1CFDA 1A2XA 1ZOTB 2LCPA 3LCPC 5D69A 1A75B 3E3RA 4GGFC 4GNKB 4YGEB 1TN4A 2BBNA 4USLA 3MSEB 2L4IA 1YUUA 1K95A 4GAOA 1B8RA 2EGDA 5FYXA 1M31A 1Y6WA 1C7VA 2MLEC 2JU0A 1F8HA 1KWOC 1IQ3A 1RROA 2I2RE 2LVJA 2OTGB 3HX4A 4JWQA 3AAKA 4E68A 3EVVA 1DJYA 2IS9A 2KGRA 1NX2A 2ISDA 5DKQA 2LVVA 3LLEA 1B47A 4DIRA 3HCMA 1DJHA 1OOJA 2DOQA 1A03A 1JWDA 2VRGA 5AXIA 2D8NA 2OS8B 1S1EA 1UHKA 3PN7B 4FTGA 4C0KA 1S6IA 5CSFA 1LKJA 2M97A 3K21A 2F8PA 3CZTX 2SASA 3BUXB 4MN0A 2PALA 3WXAA 3JVTC 1QVIZ 3WHTB 2BCAA 3KPXA 4AQJA 3TZ1A 2B1UA 2E6WA 1NP8A 2MBXA 2WC8A 1BJFA 2K7CA 1QTXA 1LXFC 2K7OA 1EH2A 2KI6D 4BY5A 2JQ6A 3CR5X 2RGIA 2L51A 5HYDA 1CM4A 5F6TA 5KSZA 2ZRSA 2WORA 1MR8A 4YI8A 1MQ1A 4D1EA 1DF0B 3SG4A 1QATA 1XFXO 1A75A 4A4CA 1CB1A 1PK0D 1DJIA 2NCOA 3BOWA 2F2PA 4HSZA 1UHNA 2ZN8A 2Q4UA 3LL8B 1DJXA 1XFVO 4QJ4B 1J1DA 2WCBA 3SG5A 3GOFA 4WQ2A 2CCMA 4PE0A 4DCKA 3AKBA 3BXKA 2M8UA 2WCFA 4I5KA 1TIZA 1QLSA 2JXCA 3PFVA 1KFXS 2MJWB 3KO0A 1CLMA 1DTLA 3VRNA 4PE4A 1QIVA 1CDNA 1IH0A 4I5JA 2JRFA 4PE7A 5JJGA 1JBAA 1S5GZ 1Y0VH 2KFHA 1M39A 1F70A 2LUXA 1SKTA 1J7QA 1JF2A 1V1GA 3KF9A 5DKNA 4R1EA 2WNDA 2AMIA 5D7FA 2F2OA 2BCBA 2KBIA 1RTP1 3WHUB 3AKAA 1ODBA 1IQ5A 2LV7A 1CKKA 4OKHA 3OB2B 1JSAA 3PALA 1WRLA 1QVIY 1BF5A 3PM8A 4P2YB 2EC6C 1UUSA 2MA2A 3GK2A 4PHNA 4C0LA 1FF1A 1SMGA 3CWGA 1AJ4A 2KSPA 1SW8A 1OQPA 1SY9A 1SCMC 1QS7A 4I5LB 3TDIA 1DJWA 1MWNA 4A4BA 1K2HA 4YBHB 1SL9A 4MRYA 1IJ6A 1M46A 2KI4B 3TDZA 4CPVA 4PHJA 1TCFA 1TRFA 1F4OA 3DVJA 2QACA 3PSRA 3D10A 4JQ0D 1M63B 1PRWA 2F3ZA 4OCIA 5CSNA 3VGOA 1PSRA 2OTGC 1YVHA 3QRXA 1AJ5A 3DVMA 2L5XB 5HLVA 5BPJA 1DJGA 4YGDB 2F3YA 2KGBC 4MBEA 5J3XA 3KHEA 4CFRA 2JC2A 2KAVA 1S6JA 1K94A 2JTZA 4MZJA 2LE9B 3NSKA 1WDCB 1SCVA 2PRUA 2JWWA 1S5GY 1EXRA 1UWOA 4YGAA 5HKWA 1KK8C 2Y1MA 3PN7C 4CFQA 3H4SE 2L2EA 1YUSA 5HKYA 5KU1A 2G2BA 4NDBA 1IKUA 1GQMA 1K9PA 1WLMA 3BOWB 3CR2A 3I5HB 2LHLA 4OVNF 3GK4X 2LLUA 1XFYO 3RM1A 4WQ3A 1QX7A 4AOMA 3BUOB 1YTZC 3OX6A 2WOSA 2KFFA 1JFKA 3SG7A 2KHNA 1LINA 4ZCVA 1PVAA 3SG3A 1PVBA 1U5IB 3VRRA 2L98A 2KDHA 1YUTA 2A4JA 2R2IA 3EKJA 3OB1B 5I2LA 5CPVA 1ZMZA 3SG2A 2BBMA 1HQVA 2M7LA 5ER5A 2M9GA 4DS7A 1ALVA 4DUQA 4JPZB 1JUOA 3VRPA 1FI5A 2ZNEA 4XJKB 2LUCA 2L4HA 3IF7A 3DF0A 4C0JA 4WRIA 2LMUA 1CFFA 4N1GA 1B7TY 2FCDA 2LC5A 4PDZA 1KQMB 1BOCA 2I7AA 2K2FA 1GGWA 1TOPA 3FS7A 3FWCA 5AANA 1OMVA 1R6PA 4MSPA 4I5NB 1S3PA 1BR4B 2FJUB 1YRTB 2M7NA 1CMGA 1FBVA 1QX5B 2P6BB 1SRAA 1MXEA 1X02A 2I18A 1WY9A 1AP4A 2GV5A 3EK8A 1KK7Y 1DT7B 1EL4A 2BL0B 2ZKMX 1N2DA 3D0YB 1KFUS 2CT9A 1LA3A 1DMOA 2JZIA 1L2OB 1OZOA 1SR6B 2TN4A 4XYNA 1AK8A 3BYAA 2JT0A 2Y1NA 2JXLA 4TNCA 2AAOA 1RWYA 3BUWB 1J7PA 1RK9A 1OSAA 1UHHA 4YRUA 1AVSA 1U5IA 4NQGA 1CMFA 1SL8A 1RFJA 2LVIA 3I5IB 2ZFDA 2KAYA 4NDCA 2KI4C 4PHMA 1PALA 2V53A 1FW4A 1NCXA 2WCEA 4CLNA 4ZCUA 1EG4A 1G8IA 1SYMA 2L50A 1G4YR 1H8BA 3C1VA 4XJKA 1FPWA 2E30A 4QJ3B 3O78A 2MLFC 1QLKA 1TNQA 3M0WA 2G9BA 1V1FA 1S26D 2LP3A 2JOJA 4PCWA 1KFXL 1CFCA 1D1OA 1OMDA 3I5FB 1WDCC 2KOTA 1MF8B 2LP2A 2K61A 1WRKA 1BT6A 4GGFA 2JULA 2F33A 1JF0A 2GGMA 1BU3A 1K8UA 5PALA 1TTXA 2KI6C 2KQ6A 1OZSA 1NPQA 2NZ0A 4OR9B 2ZNDA 3D0YA 3I5HC 3ZNIA 1XFWO 2Y5IA 1L7ZA 3F45A 3PLFB 1ALWA 1B9AA 1E8AA 1NX0A 3FWBA 3TS5B 2KNEA 1NX3A 1AUIB 2HF5A 3DF0B 4Q04A 1B7TZ 1XYDA 2SCPA 1C7WA 2H2KA 1IRJA 1NSHA 1K96A 1SNLA 2FCEA 1XO5A 1RJVA 2LNKA 3DVKA 4N1FA 5CSIA 3WNXB 5KTYA 4MRXA 1YX7A 2HPSA 2QPTA 1AHRA 2LLTA 3NSIA 4ETOA 4HRHA 4AQIA 2L0PA 2PSRA 4M2OA 2MAZA 3EKHA 4FQOA 1F4QA 1SPYA 4ORAB 2LVKA 1XK4A 2HETA 3DD4A 4MVFA 5IBWA 2OS8C 2OPOA 1CFPA 5I2OA 1R2UA 1C07A 3JTDB 2PVBA 3GK1A 1KK7Z 3ICBA 1KSOA 2JT3A 1Y1AA 3A4UB 3SG6A 3OX5A 1XFZO 1J7OA 1CDLA 3DVEA 3KEVA 1QV0A 1HT9A 2LAPA 1G33A 1EJ3A 4M2PA 1KQMC 5AFPA 1BLQA 3OP0A 5AERA 2BECA 4GUKA 1M45A 1K9KA 1TCOB 1TNXA 2JPTA 1N0YA 3CS1A 4IL1A 4PE1A 3TUYB 1A4PA 4OV2A 1K90D 3PATA 4N5XA 1Q80A 3BUMB 2AUCA 1RECA 4DRWA 1B1GA 1BR1B 1CDMA 1TNWA 1W7JB 2KFGA 2BL0C 4PHKA 2PMYA 1MHOA 1UP5A 3AAJA 4MZKA 5TNCA 1IWQA 2O60A 1FI6A 1F71A 1IGVA 2FOTA 1L2OC 1SR6C 4U8DA 5GQQC 1IG5A 3I5GB 1CNPA 2CBLA 4ORBB 2M0RA 2K7DA 4GGNA 1UHJA 1YR5A 2H61A 2CTNA 2LM5A 4NDDA 1QIWA 1Y1UA 4ICBA 1NIWA 5JOLA 1N65A 3EVUA 3I5IC 2BE6A 4BY4A 2ZRTA 1KK8B 1XK4C 1XFUO 4MEWA 2JTTA 3NXAA 1EG3A 1UHIA 1ZUZA 4PALA 3A8RA 2LHIA 1MXLC 1XVJA 1DVIA 2CNPA 3FIAA 3SIBA 2BKHB 5HLOA 2COLB 2M1UA 1KWOB 1K93D 1KCYA 1NUBA 2M1KB 3CTNA 1B8CA 2I94A 4YGBB 1LVCD 3LK0A 1XA5A 1J1EA 1KSMA 4HRGA 1A29A 3CLNA 1NCYA 2BKIB 3OHMB 1YX8A 1QASA 3I5FC 1CLLA 1BMOA 4P5OE 2KYCA 5AEQA 1SL7A 2LANA 1NYAA 1JC2A 2K8MB 1TNPA 2M29A 2PASA 4GFTA 2NLNA 5B8IB 2KQYA 1S6CA 2JT8A 3JVTB 3ZWHA 2LMTA 3TS5C 1KFUL 3CGAA 1VRKA 3SIAA 1MUXA 2MRDA 4QJ5B 2K7BA 3VROA 4ORCB 1ZACA 2H61C 1WRZA 4CIDA 3SJSA 4MZLA 1F55A 2HQWA 3EK7A 4YGCB 2Q91A 5ER4X 1F54A 4GBAA
chains in the Genus database with same CATH superfamily
5CSJA 1QV1A 1CTRA 1DGVA 1NCZA 1SBJA 1ZFSA 1DJZA 3JTDC 5HKZA 3D75A 5DKRA 1YURA 3DZTA 3NSOA 2JNFA 1CLBA 4F0ZB 3NSLA 2KAXA 2HQ8A 3O6BA 4INXA 1PULA 1YRUB 1NX1A 2K2AA 5G08A 2LLSA 2EHBA 1H4BA 5I2QA 1B4CA 4M2QA 1BG1A 2NCPA 1BODA 1QJTA 4UPGA 3V2LA 3QMEA 1S36A 1UURA 3R72A 2JNXA 1CM1A 1DGUA 3TUYC 2M49B 2QEBA 1DF0A 4PT1A 5D3OA 2M3WA 2KBMA 3VRQA 1OMRA 1JFJA 2O5GA 3BQ3A 3R1VA 1GGZA 1K9UA 1SK6D 2QEOA 2Y4QA 3EVRA 2BE4A 2FJYA 4L9MA 1IJ5A 1GJYA 2ZN9A 1QXPA 4YI9A 4MLWA 1J55A 1WLZA 2KYFA 2LMVA 2K0JA 1NWDA 3I5GC 5I94A 1OE9B 2GGZA 3CR4X 1W9ZA 3L4AA 1QX2A 1KQVA 3O4YA 2EC6B 3TDUA 5K89A 1YVLA 1LA0A 1CDPA 3RLZA 1B8LA 2MHHA 2NXQA 1Y1XA 3IQQA 3D74A 1PSBA 3LK1A 4HREE 3EK4A 1SCMB 3BUNB 4GPLB 3SS5A 2BCXA 1W7IB 2CXJA 5I8NA 3O2PA 1J7RA 3IQOA 1CFDA 1A2XA 1ZOTB 2LCPA 3LCPC 5D69A 1A75B 3E3RA 4GGFC 4GNKB 4YGEB 1TN4A 2BBNA 4IJ7A 4USLA 2WCJA 3MSEB 2L4IA 1YUUA 1K95A 4GAOA 1B8RA 2EGDA 5FYXA 1M31A 1Y6WA 1DQEA 2MLEC 2JU0A 1C7VA 1KWOC 1F8HA 1IQ3A 1RROA 3O4XA 2I2RE 2LVJA 2OTGB 3HX4A 1OOIX 4JWQA 3AAKA 4E68A 3EVVA 1DJYA 2IS9A 2KGRA 1NX2A 2ISDA 5DKQA 2LVVA 3R1OA 3LLEA 1B47A 4DIRA 3HCMA 1DJHA 1OOJA 2KPHA 2DOQA 2L2CA 1A03A 2VRGA 1JWDA 2QEHA 2D8NA 5AXIA 2OS8B 1S1EA 1UHKA 3PN7B 4FTGA 4C0KA 1S6IA 2PYQA 5CSFA 1LKJA 2M97A 3K21A 2F8PA 3CZTX 2SASA 3BUXB 4MN0A 2PALA 3PM2A 3WXAA 3JVTC 1QVIZ 3WHTB 2BCAA 3KPXA 4AQJA 3TZ1A 2B1UA 3BFHA 2E6WA 1NP8A 2MBXA 2WCMA 3K1EA 2WC8A 3FE6A 1BJFA 1LS8A 3S0DA 2K7CA 1QTXA 1LXFC 2K7OA 1EH2A 2KI6D 4BY5A 2JQ6A 3CR5X 2RGIA 2L51A 5HYDA 1CM4A 5F6TA 5KSZA 2ZRSA 2WORA 3L47A 1MR8A 4YI8A 1MQ1A 4D1EA 1DF0B 3EG5B 3SG4A 1QATA 1XFXO 1A75A 4A4CA 1CB1A 1PK0D 1DJIA 2NCOA 3BOWA 2F2PA 4HSZA 1UHNA 2ZN8A 1SSEB 2Q4UA 3LL8B 1DJXA 1XFVO 4QJ4B 1J1DA 2WCBA 3D73A 3SG5A 3GOFA 3B87A 4WQ2A 2CCMA 2ERBA 4PE0A 4DCKA 3AKBA 3FE8A 3BXKA 2M8UA 2WCFA 4I5KA 1TIZA 1QLSA 2JXCA 1DEKA 1OOGA 3PFVA 1KFXS 2MJWB 3KO0A 1CLMA 1DTLA 3VRNA 4PE4A 1QIVA 3DXLA 1CDNA 3L4LA 1IH0A 4I5JA 2JRFA 4PE7A 5JJGA 1JBAA 1S5GZ 1Y0VH 2KFHA 1M39A 1F70A 2LUXA 1SKTA 1J7QA 1JF2A 1V1GA 3KF9A 5DKNA 4R1EA 2WNDA 2AMIA 2P71A 2F2OA 5D7FA 2BCBA 2KBIA 1RTP1 3WHUB 3B86A 3AKAA 3VB1A 1ODBA 3S0AA 1IQ5A 2LV7A 1CKKA 3B6XA 4OKHA 3OB2B 1JSAA 3PALA 1WRLA 1QVIY 1P28A 3CDNA 1BF5A 3PM8A 5DICA 4P2YB 2EC6C 1UUSA 2MA2A 3GK2A 4PHNA 4C0LA 1FF1A 1SMGA 3CWGA 1AJ4A 2KSPA 1SW8A 1OQPA 1SY9A 1SCMC 1QS7A 4I5LB 3TDIA 1DJWA 1MWNA 3UO9A 4A4BA 1K2HA 4YBHB 1SL9A 4MRYA 1IJ6A 1M46A 2KI4B 3TDZA 4CPVA 4PHJA 1TCFA 1TRFA 1F4OA 3DVJA 2QACA 3PSRA 3D10A 4JQ0D 3RZSA 1M63B 1PRWA 2F3ZA 4OCIA 5CSNA 3VGOA 1PSRA 2YGUA 5FI7A 2OTGC 1YVHA 3QRXA 1AJ5A 3DVMA 2L5XB 2PQLA 5HLVA 5BPJA 1DJGA 4YGDB 2F3YA 2KGBC 4MBEA 5J3XA 3KHEA 4CFRA 2JC2A 2KAVA 3FE9A 1S6JA 1K94A 5FI2A 2JTZA 4MZJA 2LE9B 3NSKA 1WDCB 1SCVA 2PRUA 2JWWA 1S5GY 1EXRA 1UWOA 2BNXA 4YGAA 5HKWA 1KK8C 2Y1MA 3PN7C 4CFQA 3H4SE 2L2EA 1YUSA 5HKYA 5KU1A 2G2BA 4NDBA 1IKUA 4JKTA 1GQMA 1K9PA 1WLMA 3BOWB 3CR2A 3I5HB 2LHLA 4OVNF 3GK4X 2LLUA 1XFYO 3RM1A 4WQ3A 1QX7A 4AOMA 3BUOB 1YTZC 3UNWA 3OX6A 2WOSA 2KFFA 1TUZA 1JFKA 3SG7A 2KHNA 1LINA 4ZCVA 1PVAA 3SG3A 1PVBA 1U5IB 3VRRA 2L98A 2KDHA 1YUTA 2A4JA 2R2IA 3CZ2A 2WCKA 3EKJA 3OB1B 1DC1A 5I2LA 5CPVA 1ZMZA 1ORGA 3SG2A 2BBMA 1HQVA 2M7LA 5ER5A 2M9GA 4DS7A 2WC6A 3CZ1A 1ALVA 4DUQA 4JPZB 1JUOA 3VRPA 1FI5A 2ZNEA 4XJKB 3NGVA 2LUCA 2L4HA 3IF7A 3DF0A 4INWA 4C0JA 4WRIA 2K60A 2LMUA 1CFFA 4N1GA 1B7TY 2FCDA 2LC5A 1OOHA 4PDZA 1KQMB 1BOCA 2I7AA 2K2FA 1GGWA 1DELA 1TOPA 3FS7A 3FWCA 5AANA 1OMVA 1R6PA 4MSPA 4I5NB 1S3PA 1BR4B 3DY9A 2FJUB 3SS3A 1YRTB 2M7NA 1CMGA 1FBVA 1QX5B 2P6BB 1SRAA 1MXEA 1X02A 2I18A 1WY9A 1AP4A 2GV5A 3EK8A 1KK7Y 1DT7B 1EL4A 2BL0B 2ZKMX 1N2DA 3D0YB 3B88A 1C3YA 1KFUS 2CT9A 1LA3A 1DMOA 2JZIA 1L2OB 1OZOA 1SR6B 2TN4A 4XYNA 1AK8A 3BYAA 2JT0A 2Y1NA 2JXLA 4TNCA 2AAOA 1RWYA 3BUWB 5FI6A 1J7PA 3OGNA 1RK9A 4JD9A 1OSAA 1UHHA 4YRUA 1AVSA 1U5IA 4NQGA 1T14A 1CMFA 3PJIA 3S0EA 1SL8A 1RFJA 3B7AA 2LVIA 3I5IB 2ZFDA 2KAYA 4NDCA 4FQTA 2KLEA 2KI4C 4PHMA 1PALA 2V53A 1FW4A 1NCXA 2WCEA 1TUJA 4CLNA 3S0FA 2L5YA 3CYZA 4ZCUA 1EG4A 1G8IA 1SYMA 2L50A 1G4YR 3R1PA 5HL1A 3Q8IA 2H8VA 1H8BA 2QDIA 3C1VA 4XJKA 1FPWA 1Z4HA 2E30A 4QJ3B 3O78A 3BJHA 2MLFC 1QLKA 1TNQA 3M0WA 2G9BA 1V1FA 1S26D 2LP3A 2JOJA 3D77A 1KFXL 4PCWA 1CFCA 1OMDA 1D1OA 3I5FB 1WDCC 2KOTA 1MF8B 2LP2A 3DYEA 3D76A 2K61A 1WRKA 1BT6A 4GGFA 2JULA 2WC5A 2F33A 1JF0A 2GGMA 1BU3A 1K8UA 5PALA 1TTXA 2KI6C 2KQ6A 1OZSA 1NPQA 2NZ0A 4OR9B 2ZNDA 1OOFA 3D0YA 3I5HC 3ZNIA 1XFWO 2Y5IA 1L7ZA 3F45A 3PLFB 1ALWA 1B9AA 1E8AA 1NX0A 2GTEA 3FWBA 3TS5B 2JPOA 1TWOA 2KNEA 1NX3A 1AUIB 3N7HA 2HF5A 3DF0B 3D78A 4Q04A 1B7TZ 1XYDA 2SCPA 1C7WA 2H2KA 1IRJA 1NSHA 1K96A 1SNLA 2FCEA 1XO5A 1RJVA 2LNKA 3DVKA 4N1FA 4KYNA 5CSIA 3WNXB 4MRXA 1YX7A 2HPSA 2QPTA 1AHRA 2LLTA 3NSIA 4ETOA 4HRHA 4AQIA 2L0PA 2PSRA 4M2OA 2MAZA 3EKHA 4FQOA 1F4QA 1SPYA 4ORAB 2LVKA 1XK4A 2HETA 3DD4A 4MVFA 5IBWA 2OS8C 2OPOA 1CFPA 5I2OA 1R2UA 1C07A 3JTDB 2PVBA 3CABA 1QWVA 3GK1A 1KK7Z 3ICBA 3SS4A 1KSOA 2JT3A 1Y1AA 3A4UB 3SG6A 3OX5A 1XFZO 1J7OA 3IVTA 3BFBA 1CDLA 3DVEA 3KEVA 1QV0A 1HT9A 2LAPA 1G33A 1EJ3A 4M2PA 1KQMC 5AFPA 1BLQA 3OP0A 5AERA 2BECA 4GUKA 1M45A 1K9KA 1TCOB 1TNXA 2JPTA 1N0YA 3CS1A 2WCHA 4GBAA 4IL1A 4PE1A 3TUYB 1A4PA 4OV2A 1K90D 3PATA 4N5XA 3S0BA 1Q80A 3BUMB 2AUCA 1RECA 4DRWA 3NHTA 1B1GA 1BR1B 1CDMA 1TNWA 1W7JB 2KFGA 2BL0C 4PHKA 2PMYA 1MHOA 1UP5A 3AAJA 4MZKA 5TNCA 1IWQA 2O60A 1FI6A 1F71A 1IGVA 2FOTA 1L2OC 1SR6C 4U8DA 5GQQC 1IG5A 5EL2A 3I5GB 1CNPA 2CBLA 4ORBB 2M0RA 2K7DA 4GGNA 1UHJA 1YR5A 2H61A 2CTNA 2LM5A 4NDDA 1QIWA 2BAPA 1Y1UA 4ICBA 1NIWA 5JOLA 1N65A 3EVUA 1XFRA 2BE6A 3I5IC 4BY4A 2ZRTA 5KTYA 1KK8B 1GM0A 1XK4C 1XFUO 4MEWA 2JTTA 3NXAA 1EG3A 1UHIA 1ZUZA 1C3ZA 3A8RA 3OBVA 2LHIA 1MXLC 4PALA 1XVJA 1DVIA 2CNPA 3FIAA 4OZDA 3SIBA 2BKHB 5HLOA 2COLB 2M1UA 2KLDA 1KWOB 1K93D 1KCYA 1NUBA 2M1KB 3CTNA 1B8CA 2I94A 2QEVA 1LVCD 3LK0A 1XA5A 4YGBB 1J1EA 1KSMA 4HRGA 1A29A 3CLNA 1NCYA 2BKIB 3OHMB 1YX8A 1QASA 3I5FC 1CLLA 1BMOA 4P5OE 2P70A 2KYCA 5AEQA 1SL7A 3CZ0A 2LANA 3NHIA 1NYAA 1Z2CB 2K8MB 1TNPA 2M29A 2PASA 1JC2A 3BFAA 4GFTA 2NLNA 5B8IB 2KQYA 1S6CA 2JT8A 3JVTB 3ZWHA 2LMTA 3TS5C 1KFUL 3CGAA 1VRKA 3SIAA 1MUXA 2MRDA 4QJ5B 2K7BA 3VROA 4ORCB 3S0GA 1ZACA 2H61C 1WRZA 4CIDA 3SJSA 1IIOA 2WCLA 4MZLA 1F55A 2HQWA 3EK7A 4YGCB 2Q91A 5ER4X 1F54A 1OW4A 4F7FA
chains in the Genus database with same CATH topology
5CSJA 1QV1A 1CTRA 1DGVA 1NCZA 1SBJA 1ZFSA 1DJZA 3JTDC 5HKZA 5DKRA 1YURA 3NSOA 2JNFA 1CLBA 4F0ZB 3NSLA 2KAXA 2HQ8A 3O6BA 1PULA 1YRUB 1NX1A 2K2AA 5G08A 2LLSA 2EHBA 1H4BA 5I2QA 1B4CA 4M2QA 1BG1A 2NCPA 1BODA 1QJTA 4UPGA 1S36A 1UURA 2JNXA 1CM1A 1DGUA 3TUYC 2M49B 1DF0A 2M3WA 2KBMA 3VRQA 1OMRA 1JFJA 2O5GA 3BQ3A 1GGZA 1K9UA 1SK6D 2Y4QA 3EVRA 2BE4A 4L9MA 1IJ5A 1GJYA 2ZN9A 1QXPA 4YI9A 4MLWA 1J55A 1WLZA 2KYFA 2LMVA 2K0JA 1NWDA 3I5GC 1OE9B 2GGZA 3CR4X 1QX2A 1KQVA 3O4YA 2EC6B 3TDUA 5K89A 1YVLA 1LA0A 1CDPA 3RLZA 1B8LA 2MHHA 2NXQA 1Y1XA 3IQQA 1PSBA 3LK1A 4HREE 3EK4A 1SCMB 3BUNB 4GPLB 5I8NA 2BCXA 1W7IB 2CXJA 3O2PA 1J7RA 3IQOA 1CFDA 1A2XA 1ZOTB 2LCPA 3LCPC 5D69A 1A75B 3E3RA 4GGFC 4GNKB 4YGEB 1TN4A 2BBNA 4USLA 3MSEB 2L4IA 1YUUA 1K95A 4GAOA 1B8RA 2EGDA 5FYXA 1M31A 1Y6WA 1C7VA 2MLEC 2JU0A 1F8HA 1KWOC 1IQ3A 1RROA 2I2RE 2LVJA 2OTGB 3HX4A 4JWQA 3AAKA 4E68A 3EVVA 1DJYA 2IS9A 2KGRA 1NX2A 2ISDA 5DKQA 2LVVA 3LLEA 1B47A 4DIRA 3HCMA 1DJHA 1OOJA 2DOQA 1A03A 1JWDA 2VRGA 5AXIA 2D8NA 2OS8B 1S1EA 1UHKA 3PN7B 4FTGA 4C0KA 1S6IA 5CSFA 1LKJA 2M97A 3K21A 2F8PA 3CZTX 2SASA 3BUXB 4MN0A 2PALA 3WXAA 3JVTC 1QVIZ 3WHTB 2BCAA 3KPXA 4AQJA 3TZ1A 2B1UA 2E6WA 1NP8A 2MBXA 2WC8A 1BJFA 2K7CA 1QTXA 1LXFC 2K7OA 1EH2A 2KI6D 4BY5A 2JQ6A 3CR5X 2RGIA 2L51A 5HYDA 1CM4A 5F6TA 5KSZA 2ZRSA 2WORA 1MR8A 4YI8A 1MQ1A 4D1EA 1DF0B 3SG4A 1QATA 1XFXO 1A75A 4A4CA 1CB1A 1PK0D 1DJIA 2NCOA 3BOWA 2F2PA 4HSZA 1UHNA 2ZN8A 2Q4UA 3LL8B 1DJXA 1XFVO 4QJ4B 1J1DA 2WCBA 3SG5A 3GOFA 4WQ2A 2CCMA 4PE0A 4DCKA 3AKBA 3BXKA 2M8UA 2WCFA 4I5KA 1TIZA 1QLSA 2JXCA 3PFVA 1KFXS 2MJWB 3KO0A 1CLMA 1DTLA 3VRNA 4PE4A 1QIVA 1CDNA 1IH0A 4I5JA 2JRFA 4PE7A 5JJGA 1JBAA 1S5GZ 1Y0VH 2KFHA 1M39A 1F70A 2LUXA 1SKTA 1J7QA 1JF2A 1V1GA 3KF9A 5DKNA 4R1EA 2WNDA 2AMIA 5D7FA 2F2OA 2BCBA 2KBIA 1RTP1 3WHUB 3AKAA 1ODBA 1IQ5A 2LV7A 1CKKA 4OKHA 3OB2B 1JSAA 3PALA 1WRLA 1QVIY 1BF5A 3PM8A 4P2YB 2EC6C 1UUSA 2MA2A 3GK2A 4PHNA 4C0LA 1FF1A 1SMGA 3CWGA 1AJ4A 2KSPA 1SW8A 1OQPA 1SY9A 1SCMC 1QS7A 4I5LB 3TDIA 1DJWA 1MWNA 4A4BA 1K2HA 4YBHB 1SL9A 4MRYA 1IJ6A 1M46A 2KI4B 3TDZA 4CPVA 4PHJA 1TCFA 1TRFA 1F4OA 3DVJA 2QACA 3PSRA 3D10A 4JQ0D 1M63B 1PRWA 2F3ZA 4OCIA 5CSNA 3VGOA 1PSRA 2OTGC 1YVHA 3QRXA 1AJ5A 3DVMA 2L5XB 5HLVA 5BPJA 1DJGA 4YGDB 2F3YA 2KGBC 4MBEA 5J3XA 3KHEA 4CFRA 2JC2A 2KAVA 1S6JA 1K94A 2JTZA 4MZJA 2LE9B 3NSKA 1WDCB 1SCVA 2PRUA 2JWWA 1S5GY 1EXRA 1UWOA 4YGAA 5HKWA 1KK8C 2Y1MA 3PN7C 4CFQA 3H4SE 2L2EA 1YUSA 5HKYA 5KU1A 2G2BA 4NDBA 1IKUA 1GQMA 1K9PA 1WLMA 3BOWB 3CR2A 3I5HB 2LHLA 4OVNF 3GK4X 2LLUA 1XFYO 3RM1A 4WQ3A 1QX7A 4AOMA 3BUOB 1YTZC 3OX6A 2WOSA 2KFFA 1JFKA 3SG7A 2KHNA 1LINA 4ZCVA 1PVAA 3SG3A 1PVBA 1U5IB 3VRRA 2L98A 2KDHA 1YUTA 2A4JA 2R2IA 3EKJA 3OB1B 5I2LA 5CPVA 1ZMZA 3SG2A 2BBMA 1HQVA 2M7LA 5ER5A 2M9GA 4DS7A 1ALVA 4DUQA 4JPZB 1JUOA 3VRPA 1FI5A 2ZNEA 4XJKB 2LUCA 2L4HA 3IF7A 3DF0A 4C0JA 4WRIA 2LMUA 1CFFA 4N1GA 1B7TY 2FCDA 2LC5A 4PDZA 1KQMB 1BOCA 2I7AA 2K2FA 1GGWA 1TOPA 3FS7A 3FWCA 5AANA 1OMVA 1R6PA 4MSPA 4I5NB 1S3PA 1BR4B 2FJUB 1YRTB 2M7NA 1CMGA 1FBVA 1QX5B 2P6BB 1SRAA 1MXEA 1X02A 2I18A 1WY9A 1AP4A 2GV5A 3EK8A 1KK7Y 1DT7B 1EL4A 2BL0B 2ZKMX 1N2DA 3D0YB 1KFUS 2CT9A 1LA3A 1DMOA 2JZIA 1L2OB 1OZOA 1SR6B 2TN4A 4XYNA 1AK8A 3BYAA 2JT0A 2Y1NA 2JXLA 4TNCA 2AAOA 1RWYA 3BUWB 1J7PA 1RK9A 1OSAA 1UHHA 4YRUA 1AVSA 1U5IA 4NQGA 1CMFA 1SL8A 1RFJA 2LVIA 3I5IB 2ZFDA 2KAYA 4NDCA 2KI4C 4PHMA 1PALA 2V53A 1FW4A 1NCXA 2WCEA 4CLNA 4ZCUA 1EG4A 1G8IA 1SYMA 2L50A 1G4YR 1H8BA 3C1VA 4XJKA 1FPWA 2E30A 4QJ3B 3O78A 2MLFC 1QLKA 1TNQA 3M0WA 2G9BA 1V1FA 1S26D 2LP3A 2JOJA 4PCWA 1KFXL 1CFCA 1D1OA 1OMDA 3I5FB 1WDCC 2KOTA 1MF8B 2LP2A 2K61A 1WRKA 1BT6A 4GGFA 2JULA 2F33A 1JF0A 2GGMA 1BU3A 1K8UA 5PALA 1TTXA 2KI6C 2KQ6A 1OZSA 1NPQA 2NZ0A 4OR9B 2ZNDA 3D0YA 3I5HC 3ZNIA 1XFWO 2Y5IA 1L7ZA 3F45A 3PLFB 1ALWA 1B9AA 1E8AA 1NX0A 3FWBA 3TS5B 2KNEA 1NX3A 1AUIB 2HF5A 3DF0B 4Q04A 1B7TZ 1XYDA 2SCPA 1C7WA 2H2KA 1IRJA 1NSHA 1K96A 1SNLA 2FCEA 1XO5A 1RJVA 2LNKA 3DVKA 4N1FA 5CSIA 3WNXB 5KTYA 4MRXA 1YX7A 2HPSA 2QPTA 1AHRA 2LLTA 3NSIA 4ETOA 4HRHA 4AQIA 2L0PA 2PSRA 4M2OA 2MAZA 3EKHA 4FQOA 1F4QA 1SPYA 4ORAB 2LVKA 1XK4A 2HETA 3DD4A 4MVFA 5IBWA 2OS8C 2OPOA 1CFPA 5I2OA 1R2UA 1C07A 3JTDB 2PVBA 3GK1A 1KK7Z 3ICBA 1KSOA 2JT3A 1Y1AA 3A4UB 3SG6A 3OX5A 1XFZO 1J7OA 1CDLA 3DVEA 3KEVA 1QV0A 1HT9A 2LAPA 1G33A 1EJ3A 4M2PA 1KQMC 5AFPA 1BLQA 3OP0A 5AERA 2BECA 4GUKA 1M45A 1K9KA 1TCOB 1TNXA 2JPTA 1N0YA 3CS1A 4IL1A 4PE1A 3TUYB 1A4PA 4OV2A 1K90D 3PATA 4N5XA 1Q80A 3BUMB 2AUCA 1RECA 4DRWA 1B1GA 1BR1B 1CDMA 1TNWA 1W7JB 2KFGA 2BL0C 4PHKA 2PMYA 1MHOA 1UP5A 3AAJA 4MZKA 5TNCA 1IWQA 2O60A 1FI6A 1F71A 1IGVA 2FOTA 1L2OC 1SR6C 4U8DA 5GQQC 1IG5A 3I5GB 1CNPA 2CBLA 4ORBB 2M0RA 2K7DA 4GGNA 1UHJA 1YR5A 2H61A 2CTNA 2LM5A 4NDDA 1QIWA 1Y1UA 4ICBA 1NIWA 5JOLA 1N65A 3EVUA 3I5IC 2BE6A 4BY4A 2ZRTA 1KK8B 1XK4C 1XFUO 4MEWA 2JTTA 3NXAA 1EG3A 1UHIA 1ZUZA 4PALA 3A8RA 2LHIA 1MXLC 1XVJA 1DVIA 2CNPA 3FIAA 3SIBA 2BKHB 5HLOA 2COLB 2M1UA 1KWOB 1K93D 1KCYA 1NUBA 2M1KB 3CTNA 1B8CA 2I94A 4YGBB 1LVCD 3LK0A 1XA5A 1J1EA 1KSMA 4HRGA 1A29A 3CLNA 1NCYA 2BKIB 3OHMB 1YX8A 1QASA 3I5FC 1CLLA 1BMOA 4P5OE 2KYCA 5AEQA 1SL7A 2LANA 1NYAA 1JC2A 2K8MB 1TNPA 2M29A 2PASA 4GFTA 2NLNA 5B8IB 2KQYA 1S6CA 2JT8A 3JVTB 3ZWHA 2LMTA 3TS5C 1KFUL 3CGAA 1VRKA 3SIAA 1MUXA 2MRDA 4QJ5B 2K7BA 3VROA 4ORCB 1ZACA 2H61C 1WRZA 4CIDA 3SJSA 4MZLA 1F55A 2HQWA 3EK7A 4YGCB 2Q91A 5ER4X 1F54A 4GBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSJ A;  1QV1 A;  1CTR A;  1DGV A;  1NCZ A;  1SBJ A;  1ZFS A;  1DJZ A;  3JTD C;  5HKZ A;  5DKR A;  1YUR A;  3NSO A;  2JNF A;  1CLB A;  4F0Z B;  3NSL A;  2KAX A;  2HQ8 A;  3O6B A;  1PUL A;  1YRU B;  1NX1 A;  2K2A A;  5G08 A;  2LLS A;  2EHB A;  1H4B A;  5I2Q A;  1B4C A;  4M2Q A;  1BG1 A;  2NCP A;  1BOD A;  1QJT A;  4UPG A;  1S36 A;  1UUR A;  2JNX A;  1CM1 A;  1DGU A;  3TUY C;  2M49 B;  1DF0 A;  2M3W A;  2KBM A;  3VRQ A;  1OMR A;  1JFJ A;  2O5G A;  3BQ3 A;  1GGZ A;  1K9U A;  1SK6 D;  2Y4Q A;  3EVR A;  2BE4 A;  4L9M A;  1IJ5 A;  1GJY A;  2ZN9 A;  1QXP A;  4YI9 A;  4MLW A;  1J55 A;  1WLZ A;  2KYF A;  2LMV A;  2K0J A;  1NWD A;  3I5G C;  1OE9 B;  2GGZ A;  3CR4 X;  1QX2 A;  1KQV A;  3O4Y A;  2EC6 B;  3TDU A;  5K89 A;  1YVL A;  1LA0 A;  1CDP A;  3RLZ A;  1B8L A;  2MHH A;  2NXQ A;  1Y1X A;  3IQQ A;  1PSB A;  3LK1 A;  4HRE E;  3EK4 A;  1SCM B;  3BUN B;  4GPL B;  5I8N A;  2BCX A;  1W7I B;  2CXJ A;  3O2P A;  1J7R A;  3IQO A;  1CFD A;  1A2X A;  1ZOT B;  2LCP A;  3LCP C;  5D69 A;  1A75 B;  3E3R A;  4GGF C;  4GNK B;  4YGE B;  1TN4 A;  2BBN A;  4USL A;  3MSE B;  2L4I A;  1YUU A;  1K95 A;  4GAO A;  1B8R A;  2EGD A;  5FYX A;  1M31 A;  1Y6W A;  1C7V A;  2MLE C;  2JU0 A;  1F8H A;  1KWO C;  1IQ3 A;  1RRO A;  2I2R E;  2LVJ A;  2OTG B;  3HX4 A;  4JWQ A;  3AAK A;  4E68 A;  3EVV A;  1DJY A;  2IS9 A;  2KGR A;  1NX2 A;  2ISD A;  5DKQ A;  2LVV A;  3LLE A;  1B47 A;  4DIR A;  3HCM A;  1DJH A;  1OOJ A;  2DOQ A;  1A03 A;  1JWD A;  2VRG A;  5AXI A;  2D8N A;  2OS8 B;  1S1E A;  1UHK A;  3PN7 B;  4FTG A;  4C0K A;  1S6I A;  5CSF A;  1LKJ A;  2M97 A;  3K21 A;  2F8P A;  3CZT X;  2SAS A;  3BUX B;  4MN0 A;  2PAL A;  3WXA A;  3JVT C;  1QVI Z;  3WHT B;  2BCA A;  3KPX A;  4AQJ A;  3TZ1 A;  2B1U A;  2E6W A;  1NP8 A;  2MBX A;  2WC8 A;  1BJF A;  2K7C A;  1QTX A;  1LXF C;  2K7O A;  1EH2 A;  2KI6 D;  4BY5 A;  2JQ6 A;  3CR5 X;  2RGI A;  2L51 A;  5HYD A;  1CM4 A;  5F6T A;  5KSZ A;  2ZRS A;  2WOR A;  1MR8 A;  4YI8 A;  1MQ1 A;  4D1E A;  1DF0 B;  3SG4 A;  1QAT A;  1XFX O;  1A75 A;  4A4C A;  1CB1 A;  1PK0 D;  1DJI A;  2NCO A;  3BOW A;  2F2P A;  4HSZ A;  1UHN A;  2ZN8 A;  2Q4U A;  3LL8 B;  1DJX A;  1XFV O;  4QJ4 B;  1J1D A;  2WCB A;  3SG5 A;  3GOF A;  4WQ2 A;  2CCM A;  4PE0 A;  4DCK A;  3AKB A;  3BXK A;  2M8U A;  2WCF A;  4I5K A;  1TIZ A;  1QLS A;  2JXC A;  3PFV A;  1KFX S;  2MJW B;  3KO0 A;  1CLM A;  1DTL A;  3VRN A;  4PE4 A;  1QIV A;  1CDN A;  1IH0 A;  4I5J A;  2JRF A;  4PE7 A;  5JJG A;  1JBA A;  1S5G Z;  1Y0V H;  2KFH A;  1M39 A;  1F70 A;  2LUX A;  1SKT A;  1J7Q A;  1JF2 A;  1V1G A;  3KF9 A;  5DKN A;  4R1E A;  2WND A;  2AMI A;  5D7F A;  2F2O A;  2BCB A;  2KBI A;  1RTP 1;  3WHU B;  3AKA A;  1ODB A;  1IQ5 A;  2LV7 A;  1CKK A;  4OKH A;  3OB2 B;  1JSA A;  3PAL A;  1WRL A;  1QVI Y;  1BF5 A;  3PM8 A;  4P2Y B;  2EC6 C;  1UUS A;  2MA2 A;  3GK2 A;  4PHN A;  4C0L A;  1FF1 A;  1SMG A;  3CWG A;  1AJ4 A;  2KSP A;  1SW8 A;  1OQP A;  1SY9 A;  1SCM C;  1QS7 A;  4I5L B;  3TDI A;  1DJW A;  1MWN A;  4A4B A;  1K2H A;  4YBH B;  1SL9 A;  4MRY A;  1IJ6 A;  1M46 A;  2KI4 B;  3TDZ A;  4CPV A;  4PHJ A;  1TCF A;  1TRF A;  1F4O A;  3DVJ A;  2QAC A;  3PSR A;  3D10 A;  4JQ0 D;  1M63 B;  1PRW A;  2F3Z A;  4OCI A;  5CSN A;  3VGO A;  1PSR A;  2OTG C;  1YVH A;  3QRX A;  1AJ5 A;  3DVM A;  2L5X B;  5HLV A;  5BPJ A;  1DJG A;  4YGD B;  2F3Y A;  2KGB C;  4MBE A;  5J3X A;  3KHE A;  4CFR A;  2JC2 A;  2KAV A;  1S6J A;  1K94 A;  2JTZ A;  4MZJ A;  2LE9 B;  3NSK A;  1WDC B;  1SCV A;  2PRU A;  2JWW A;  1S5G Y;  1EXR A;  1UWO A;  4YGA A;  5HKW A;  1KK8 C;  2Y1M A;  3PN7 C;  4CFQ A;  3H4S E;  2L2E A;  1YUS A;  5HKY A;  5KU1 A;  2G2B A;  4NDB A;  1IKU A;  1GQM A;  1K9P A;  1WLM A;  3BOW B;  3CR2 A;  3I5H B;  2LHL A;  4OVN F;  3GK4 X;  2LLU A;  1XFY O;  3RM1 A;  4WQ3 A;  1QX7 A;  4AOM A;  3BUO B;  1YTZ C;  3OX6 A;  2WOS A;  2KFF A;  1JFK A;  3SG7 A;  2KHN A;  1LIN A;  4ZCV A;  1PVA A;  3SG3 A;  1PVB A;  1U5I B;  3VRR A;  2L98 A;  2KDH A;  1YUT A;  2A4J A;  2R2I A;  3EKJ A;  3OB1 B;  5I2L A;  5CPV A;  1ZMZ A;  3SG2 A;  2BBM A;  1HQV A;  2M7L A;  5ER5 A;  2M9G A;  4DS7 A;  1ALV A;  4DUQ A;  4JPZ B;  1JUO A;  3VRP A;  1FI5 A;  2ZNE A;  4XJK B;  2LUC A;  2L4H A;  3IF7 A;  3DF0 A;  4C0J A;  4WRI A;  2LMU A;  1CFF A;  4N1G A;  1B7T Y;  2FCD A;  2LC5 A;  4PDZ A;  1KQM B;  1BOC A;  2I7A A;  2K2F A;  1GGW A;  1TOP A;  3FS7 A;  3FWC A;  5AAN A;  1OMV A;  1R6P A;  4MSP A;  4I5N B;  1S3P A;  1BR4 B;  2FJU B;  1YRT B;  2M7N A;  1CMG A;  1FBV A;  1QX5 B;  2P6B B;  1SRA A;  1MXE A;  1X02 A;  2I18 A;  1WY9 A;  1AP4 A;  2GV5 A;  3EK8 A;  1KK7 Y;  1DT7 B;  1EL4 A;  2BL0 B;  2ZKM X;  1N2D A;  3D0Y B;  1KFU S;  2CT9 A;  1LA3 A;  1DMO A;  2JZI A;  1L2O B;  1OZO A;  1SR6 B;  2TN4 A;  4XYN A;  1AK8 A;  3BYA A;  2JT0 A;  2Y1N A;  2JXL A;  4TNC A;  2AAO A;  1RWY A;  3BUW B;  1J7P A;  1RK9 A;  1OSA A;  1UHH A;  4YRU A;  1AVS A;  1U5I A;  4NQG A;  1CMF A;  1SL8 A;  1RFJ A;  2LVI A;  3I5I B;  2ZFD A;  2KAY A;  4NDC A;  2KI4 C;  4PHM A;  1PAL A;  2V53 A;  1FW4 A;  1NCX A;  2WCE A;  4CLN A;  4ZCU A;  1EG4 A;  1G8I A;  1SYM A;  2L50 A;  1G4Y R;  1H8B A;  3C1V A;  4XJK A;  1FPW A;  2E30 A;  4QJ3 B;  3O78 A;  2MLF C;  1QLK A;  1TNQ A;  3M0W A;  2G9B A;  1V1F A;  1S26 D;  2LP3 A;  2JOJ A;  4PCW A;  1KFX L;  1CFC A;  1D1O A;  1OMD A;  3I5F B;  1WDC C;  2KOT A;  1MF8 B;  2LP2 A;  2K61 A;  1WRK A;  1BT6 A;  4GGF A;  2JUL A;  2F33 A;  1JF0 A;  2GGM A;  1BU3 A;  1K8U A;  5PAL A;  1TTX A;  2KI6 C;  2KQ6 A;  1OZS A;  1NPQ A;  2NZ0 A;  4OR9 B;  2ZND A;  3D0Y A;  3I5H C;  3ZNI A;  1XFW O;  2Y5I A;  1L7Z A;  3F45 A;  3PLF B;  1ALW A;  1B9A A;  1E8A A;  1NX0 A;  3FWB A;  3TS5 B;  2KNE A;  1NX3 A;  1AUI B;  2HF5 A;  3DF0 B;  4Q04 A;  1B7T Z;  1XYD A;  2SCP A;  1C7W A;  2H2K A;  1IRJ A;  1NSH A;  1K96 A;  1SNL A;  2FCE A;  1XO5 A;  1RJV A;  2LNK A;  3DVK A;  4N1F A;  5CSI A;  3WNX B;  5KTY A;  4MRX A;  1YX7 A;  2HPS A;  2QPT A;  1AHR A;  2LLT A;  3NSI A;  4ETO A;  4HRH A;  4AQI A;  2L0P A;  2PSR A;  4M2O A;  2MAZ A;  3EKH A;  4FQO A;  1F4Q A;  1SPY A;  4ORA B;  2LVK A;  1XK4 A;  2HET A;  3DD4 A;  4MVF A;  5IBW A;  2OS8 C;  2OPO A;  1CFP A;  5I2O A;  1R2U A;  1C07 A;  3JTD B;  2PVB A;  3GK1 A;  1KK7 Z;  3ICB A;  1KSO A;  2JT3 A;  1Y1A A;  3A4U B;  3SG6 A;  3OX5 A;  1XFZ O;  1J7O A;  1CDL A;  3DVE A;  3KEV A;  1QV0 A;  1HT9 A;  2LAP A;  1G33 A;  1EJ3 A;  4M2P A;  1KQM C;  5AFP A;  1BLQ A;  3OP0 A;  5AER A;  2BEC A;  4GUK A;  1M45 A;  1K9K A;  1TCO B;  1TNX A;  2JPT A;  1N0Y A;  3CS1 A;  4IL1 A;  4PE1 A;  3TUY B;  1A4P A;  4OV2 A;  1K90 D;  3PAT A;  4N5X A;  1Q80 A;  3BUM B;  2AUC A;  1REC A;  4DRW A;  1B1G A;  1BR1 B;  1CDM A;  1TNW A;  1W7J B;  2KFG A;  2BL0 C;  4PHK A;  2PMY A;  1MHO A;  1UP5 A;  3AAJ A;  4MZK A;  5TNC A;  1IWQ A;  2O60 A;  1FI6 A;  1F71 A;  1IGV A;  2FOT A;  1L2O C;  1SR6 C;  4U8D A;  5GQQ C;  1IG5 A;  3I5G B;  1CNP A;  2CBL A;  4ORB B;  2M0R A;  2K7D A;  4GGN A;  1UHJ A;  1YR5 A;  2H61 A;  2CTN A;  2LM5 A;  4NDD A;  1QIW A;  1Y1U A;  4ICB A;  1NIW A;  5JOL A;  1N65 A;  3EVU A;  3I5I C;  2BE6 A;  4BY4 A;  2ZRT A;  1KK8 B;  1XK4 C;  1XFU O;  4MEW A;  2JTT A;  3NXA A;  1EG3 A;  1UHI A;  1ZUZ A;  4PAL A;  3A8R A;  2LHI A;  1MXL C;  1XVJ A;  1DVI A;  2CNP A;  3FIA A;  3SIB A;  2BKH B;  5HLO A;  2COL B;  2M1U A;  1KWO B;  1K93 D;  1KCY A;  1NUB A;  2M1K B;  3CTN A;  1B8C A;  2I94 A;  4YGB B;  1LVC D;  3LK0 A;  1XA5 A;  1J1E A;  1KSM A;  4HRG A;  1A29 A;  3CLN A;  1NCY A;  2BKI B;  3OHM B;  1YX8 A;  1QAS A;  3I5F C;  1CLL A;  1BMO A;  4P5O E;  2KYC A;  5AEQ A;  1SL7 A;  2LAN A;  1NYA A;  1JC2 A;  2K8M B;  1TNP A;  2M29 A;  2PAS A;  4GFT A;  2NLN A;  5B8I B;  2KQY A;  1S6C A;  2JT8 A;  3JVT B;  3ZWH A;  2LMT A;  3TS5 C;  1KFU L;  3CGA A;  1VRK A;  3SIA A;  1MUX A;  2MRD A;  4QJ5 B;  2K7B A;  3VRO A;  4ORC B;  1ZAC A;  2H61 C;  1WRZ A;  4CID A;  3SJS A;  4MZL A;  1F55 A;  2HQW A;  3EK7 A;  4YGC B;  2Q91 A;  5ER4 X;  1F54 A;  4GBA A; 
#chains in the Genus database with same CATH topology
 5CSJ A;  1QV1 A;  1CTR A;  1DGV A;  1NCZ A;  1SBJ A;  1ZFS A;  1DJZ A;  3JTD C;  5HKZ A;  3D75 A;  5DKR A;  1YUR A;  3DZT A;  3NSO A;  2JNF A;  1CLB A;  4F0Z B;  3NSL A;  2KAX A;  2HQ8 A;  3O6B A;  4INX A;  1PUL A;  1YRU B;  1NX1 A;  2K2A A;  5G08 A;  2LLS A;  2EHB A;  1H4B A;  5I2Q A;  1B4C A;  4M2Q A;  1BG1 A;  2NCP A;  1BOD A;  1QJT A;  4UPG A;  3V2L A;  3QME A;  1S36 A;  1UUR A;  3R72 A;  2JNX A;  1CM1 A;  1DGU A;  3TUY C;  2M49 B;  2QEB A;  1DF0 A;  4PT1 A;  5D3O A;  2M3W A;  2KBM A;  3VRQ A;  1OMR A;  1JFJ A;  2O5G A;  3BQ3 A;  3R1V A;  1GGZ A;  1K9U A;  1SK6 D;  2QEO A;  2Y4Q A;  3EVR A;  2BE4 A;  2FJY A;  4L9M A;  1IJ5 A;  1GJY A;  2ZN9 A;  1QXP A;  4YI9 A;  4MLW A;  1J55 A;  1WLZ A;  2KYF A;  2LMV A;  2K0J A;  1NWD A;  3I5G C;  5I94 A;  1OE9 B;  2GGZ A;  3CR4 X;  1W9Z A;  3L4A A;  1QX2 A;  1KQV A;  3O4Y A;  2EC6 B;  3TDU A;  5K89 A;  1YVL A;  1LA0 A;  1CDP A;  3RLZ A;  1B8L A;  2MHH A;  2NXQ A;  1Y1X A;  3IQQ A;  3D74 A;  1PSB A;  3LK1 A;  4HRE E;  3EK4 A;  1SCM B;  3BUN B;  4GPL B;  3SS5 A;  2BCX A;  1W7I B;  2CXJ A;  5I8N A;  3O2P A;  1J7R A;  3IQO A;  1CFD A;  1A2X A;  1ZOT B;  2LCP A;  3LCP C;  5D69 A;  1A75 B;  3E3R A;  4GGF C;  4GNK B;  4YGE B;  1TN4 A;  2BBN A;  4IJ7 A;  4USL A;  2WCJ A;  3MSE B;  2L4I A;  1YUU A;  1K95 A;  4GAO A;  1B8R A;  2EGD A;  5FYX A;  1M31 A;  1Y6W A;  1DQE A;  2MLE C;  2JU0 A;  1C7V A;  1KWO C;  1F8H A;  1IQ3 A;  1RRO A;  3O4X A;  2I2R E;  2LVJ A;  2OTG B;  3HX4 A;  1OOI X;  4JWQ A;  3AAK A;  4E68 A;  3EVV A;  1DJY A;  2IS9 A;  2KGR A;  1NX2 A;  2ISD A;  5DKQ A;  2LVV A;  3R1O A;  3LLE A;  1B47 A;  4DIR A;  3HCM A;  1DJH A;  1OOJ A;  2KPH A;  2DOQ A;  2L2C A;  1A03 A;  2VRG A;  1JWD A;  2QEH A;  2D8N A;  5AXI A;  2OS8 B;  1S1E A;  1UHK A;  3PN7 B;  4FTG A;  4C0K A;  1S6I A;  2PYQ A;  5CSF A;  1LKJ A;  2M97 A;  3K21 A;  2F8P A;  3CZT X;  2SAS A;  3BUX B;  4MN0 A;  2PAL A;  3PM2 A;  3WXA A;  3JVT C;  1QVI Z;  3WHT B;  2BCA A;  3KPX A;  4AQJ A;  3TZ1 A;  2B1U A;  3BFH A;  2E6W A;  1NP8 A;  2MBX A;  2WCM A;  3K1E A;  2WC8 A;  3FE6 A;  1BJF A;  1LS8 A;  3S0D A;  2K7C A;  1QTX A;  1LXF C;  2K7O A;  1EH2 A;  2KI6 D;  4BY5 A;  2JQ6 A;  3CR5 X;  2RGI A;  2L51 A;  5HYD A;  1CM4 A;  5F6T A;  5KSZ A;  2ZRS A;  2WOR A;  3L47 A;  1MR8 A;  4YI8 A;  1MQ1 A;  4D1E A;  1DF0 B;  3EG5 B;  3SG4 A;  1QAT A;  1XFX O;  1A75 A;  4A4C A;  1CB1 A;  1PK0 D;  1DJI A;  2NCO A;  3BOW A;  2F2P A;  4HSZ A;  1UHN A;  2ZN8 A;  1SSE B;  2Q4U A;  3LL8 B;  1DJX A;  1XFV O;  4QJ4 B;  1J1D A;  2WCB A;  3D73 A;  3SG5 A;  3GOF A;  3B87 A;  4WQ2 A;  2CCM A;  2ERB A;  4PE0 A;  4DCK A;  3AKB A;  3FE8 A;  3BXK A;  2M8U A;  2WCF A;  4I5K A;  1TIZ A;  1QLS A;  2JXC A;  1DEK A;  1OOG A;  3PFV A;  1KFX S;  2MJW B;  3KO0 A;  1CLM A;  1DTL A;  3VRN A;  4PE4 A;  1QIV A;  3DXL A;  1CDN A;  3L4L A;  1IH0 A;  4I5J A;  2JRF A;  4PE7 A;  5JJG A;  1JBA A;  1S5G Z;  1Y0V H;  2KFH A;  1M39 A;  1F70 A;  2LUX A;  1SKT A;  1J7Q A;  1JF2 A;  1V1G A;  3KF9 A;  5DKN A;  4R1E A;  2WND A;  2AMI A;  2P71 A;  2F2O A;  5D7F A;  2BCB A;  2KBI A;  1RTP 1;  3WHU B;  3B86 A;  3AKA A;  3VB1 A;  1ODB A;  3S0A A;  1IQ5 A;  2LV7 A;  1CKK A;  3B6X A;  4OKH A;  3OB2 B;  1JSA A;  3PAL A;  1WRL A;  1QVI Y;  1P28 A;  3CDN A;  1BF5 A;  3PM8 A;  5DIC A;  4P2Y B;  2EC6 C;  1UUS A;  2MA2 A;  3GK2 A;  4PHN A;  4C0L A;  1FF1 A;  1SMG A;  3CWG A;  1AJ4 A;  2KSP A;  1SW8 A;  1OQP A;  1SY9 A;  1SCM C;  1QS7 A;  4I5L B;  3TDI A;  1DJW A;  1MWN A;  3UO9 A;  4A4B A;  1K2H A;  4YBH B;  1SL9 A;  4MRY A;  1IJ6 A;  1M46 A;  2KI4 B;  3TDZ A;  4CPV A;  4PHJ A;  1TCF A;  1TRF A;  1F4O A;  3DVJ A;  2QAC A;  3PSR A;  3D10 A;  4JQ0 D;  3RZS A;  1M63 B;  1PRW A;  2F3Z A;  4OCI A;  5CSN A;  3VGO A;  1PSR A;  2YGU A;  5FI7 A;  2OTG C;  1YVH A;  3QRX A;  1AJ5 A;  3DVM A;  2L5X B;  2PQL A;  5HLV A;  5BPJ A;  1DJG A;  4YGD B;  2F3Y A;  2KGB C;  4MBE A;  5J3X A;  3KHE A;  4CFR A;  2JC2 A;  2KAV A;  3FE9 A;  1S6J A;  1K94 A;  5FI2 A;  2JTZ A;  4MZJ A;  2LE9 B;  3NSK A;  1WDC B;  1SCV A;  2PRU A;  2JWW A;  1S5G Y;  1EXR A;  1UWO A;  2BNX A;  4YGA A;  5HKW A;  1KK8 C;  2Y1M A;  3PN7 C;  4CFQ A;  3H4S E;  2L2E A;  1YUS A;  5HKY A;  5KU1 A;  2G2B A;  4NDB A;  1IKU A;  4JKT A;  1GQM A;  1K9P A;  1WLM A;  3BOW B;  3CR2 A;  3I5H B;  2LHL A;  4OVN F;  3GK4 X;  2LLU A;  1XFY O;  3RM1 A;  4WQ3 A;  1QX7 A;  4AOM A;  3BUO B;  1YTZ C;  3UNW A;  3OX6 A;  2WOS A;  2KFF A;  1TUZ A;  1JFK A;  3SG7 A;  2KHN A;  1LIN A;  4ZCV A;  1PVA A;  3SG3 A;  1PVB A;  1U5I B;  3VRR A;  2L98 A;  2KDH A;  1YUT A;  2A4J A;  2R2I A;  3CZ2 A;  2WCK A;  3EKJ A;  3OB1 B;  1DC1 A;  5I2L A;  5CPV A;  1ZMZ A;  1ORG A;  3SG2 A;  2BBM A;  1HQV A;  2M7L A;  5ER5 A;  2M9G A;  4DS7 A;  2WC6 A;  3CZ1 A;  1ALV A;  4DUQ A;  4JPZ B;  1JUO A;  3VRP A;  1FI5 A;  2ZNE A;  4XJK B;  3NGV A;  2LUC A;  2L4H A;  3IF7 A;  3DF0 A;  4INW A;  4C0J A;  4WRI A;  2K60 A;  2LMU A;  1CFF A;  4N1G A;  1B7T Y;  2FCD A;  2LC5 A;  1OOH A;  4PDZ A;  1KQM B;  1BOC A;  2I7A A;  2K2F A;  1GGW A;  1DEL A;  1TOP A;  3FS7 A;  3FWC A;  5AAN A;  1OMV A;  1R6P A;  4MSP A;  4I5N B;  1S3P A;  1BR4 B;  3DY9 A;  2FJU B;  3SS3 A;  1YRT B;  2M7N A;  1CMG A;  1FBV A;  1QX5 B;  2P6B B;  1SRA A;  1MXE A;  1X02 A;  2I18 A;  1WY9 A;  1AP4 A;  2GV5 A;  3EK8 A;  1KK7 Y;  1DT7 B;  1EL4 A;  2BL0 B;  2ZKM X;  1N2D A;  3D0Y B;  3B88 A;  1C3Y A;  1KFU S;  2CT9 A;  1LA3 A;  1DMO A;  2JZI A;  1L2O B;  1OZO A;  1SR6 B;  2TN4 A;  4XYN A;  1AK8 A;  3BYA A;  2JT0 A;  2Y1N A;  2JXL A;  4TNC A;  2AAO A;  1RWY A;  3BUW B;  5FI6 A;  1J7P A;  3OGN A;  1RK9 A;  4JD9 A;  1OSA A;  1UHH A;  4YRU A;  1AVS A;  1U5I A;  4NQG A;  1T14 A;  1CMF A;  3PJI A;  3S0E A;  1SL8 A;  1RFJ A;  3B7A A;  2LVI A;  3I5I B;  2ZFD A;  2KAY A;  4NDC A;  4FQT A;  2KLE A;  2KI4 C;  4PHM A;  1PAL A;  2V53 A;  1FW4 A;  1NCX A;  2WCE A;  1TUJ A;  4CLN A;  3S0F A;  2L5Y A;  3CYZ A;  4ZCU A;  1EG4 A;  1G8I A;  1SYM A;  2L50 A;  1G4Y R;  3R1P A;  5HL1 A;  3Q8I A;  2H8V A;  1H8B A;  2QDI A;  3C1V A;  4XJK A;  1FPW A;  1Z4H A;  2E30 A;  4QJ3 B;  3O78 A;  3BJH A;  2MLF C;  1QLK A;  1TNQ A;  3M0W A;  2G9B A;  1V1F A;  1S26 D;  2LP3 A;  2JOJ A;  3D77 A;  1KFX L;  4PCW A;  1CFC A;  1OMD A;  1D1O A;  3I5F B;  1WDC C;  2KOT A;  1MF8 B;  2LP2 A;  3DYE A;  3D76 A;  2K61 A;  1WRK A;  1BT6 A;  4GGF A;  2JUL A;  2WC5 A;  2F33 A;  1JF0 A;  2GGM A;  1BU3 A;  1K8U A;  5PAL A;  1TTX A;  2KI6 C;  2KQ6 A;  1OZS A;  1NPQ A;  2NZ0 A;  4OR9 B;  2ZND A;  1OOF A;  3D0Y A;  3I5H C;  3ZNI A;  1XFW O;  2Y5I A;  1L7Z A;  3F45 A;  3PLF B;  1ALW A;  1B9A A;  1E8A A;  1NX0 A;  2GTE A;  3FWB A;  3TS5 B;  2JPO A;  1TWO A;  2KNE A;  1NX3 A;  1AUI B;  3N7H A;  2HF5 A;  3DF0 B;  3D78 A;  4Q04 A;  1B7T Z;  1XYD A;  2SCP A;  1C7W A;  2H2K A;  1IRJ A;  1NSH A;  1K96 A;  1SNL A;  2FCE A;  1XO5 A;  1RJV A;  2LNK A;  3DVK A;  4N1F A;  4KYN A;  5CSI A;  3WNX B;  4MRX A;  1YX7 A;  2HPS A;  2QPT A;  1AHR A;  2LLT A;  3NSI A;  4ETO A;  4HRH A;  4AQI A;  2L0P A;  2PSR A;  4M2O A;  2MAZ A;  3EKH A;  4FQO A;  1F4Q A;  1SPY A;  4ORA B;  2LVK A;  1XK4 A;  2HET A;  3DD4 A;  4MVF A;  5IBW A;  2OS8 C;  2OPO A;  1CFP A;  5I2O A;  1R2U A;  1C07 A;  3JTD B;  2PVB A;  3CAB A;  1QWV A;  3GK1 A;  1KK7 Z;  3ICB A;  3SS4 A;  1KSO A;  2JT3 A;  1Y1A A;  3A4U B;  3SG6 A;  3OX5 A;  1XFZ O;  1J7O A;  3IVT A;  3BFB A;  1CDL A;  3DVE A;  3KEV A;  1QV0 A;  1HT9 A;  2LAP A;  1G33 A;  1EJ3 A;  4M2P A;  1KQM C;  5AFP A;  1BLQ A;  3OP0 A;  5AER A;  2BEC A;  4GUK A;  1M45 A;  1K9K A;  1TCO B;  1TNX A;  2JPT A;  1N0Y A;  3CS1 A;  2WCH A;  4GBA A;  4IL1 A;  4PE1 A;  3TUY B;  1A4P A;  4OV2 A;  1K90 D;  3PAT A;  4N5X A;  3S0B A;  1Q80 A;  3BUM B;  2AUC A;  1REC A;  4DRW A;  3NHT A;  1B1G A;  1BR1 B;  1CDM A;  1TNW A;  1W7J B;  2KFG A;  2BL0 C;  4PHK A;  2PMY A;  1MHO A;  1UP5 A;  3AAJ A;  4MZK A;  5TNC A;  1IWQ A;  2O60 A;  1FI6 A;  1F71 A;  1IGV A;  2FOT A;  1L2O C;  1SR6 C;  4U8D A;  5GQQ C;  1IG5 A;  5EL2 A;  3I5G B;  1CNP A;  2CBL A;  4ORB B;  2M0R A;  2K7D A;  4GGN A;  1UHJ A;  1YR5 A;  2H61 A;  2CTN A;  2LM5 A;  4NDD A;  1QIW A;  2BAP A;  1Y1U A;  4ICB A;  1NIW A;  5JOL A;  1N65 A;  3EVU A;  1XFR A;  2BE6 A;  3I5I C;  4BY4 A;  2ZRT A;  5KTY A;  1KK8 B;  1GM0 A;  1XK4 C;  1XFU O;  4MEW A;  2JTT A;  3NXA A;  1EG3 A;  1UHI A;  1ZUZ A;  1C3Z A;  3A8R A;  3OBV A;  2LHI A;  1MXL C;  4PAL A;  1XVJ A;  1DVI A;  2CNP A;  3FIA A;  4OZD A;  3SIB A;  2BKH B;  5HLO A;  2COL B;  2M1U A;  2KLD A;  1KWO B;  1K93 D;  1KCY A;  1NUB A;  2M1K B;  3CTN A;  1B8C A;  2I94 A;  2QEV A;  1LVC D;  3LK0 A;  1XA5 A;  4YGB B;  1J1E A;  1KSM A;  4HRG A;  1A29 A;  3CLN A;  1NCY A;  2BKI B;  3OHM B;  1YX8 A;  1QAS A;  3I5F C;  1CLL A;  1BMO A;  4P5O E;  2P70 A;  2KYC A;  5AEQ A;  1SL7 A;  3CZ0 A;  2LAN A;  3NHI A;  1NYA A;  1Z2C B;  2K8M B;  1TNP A;  2M29 A;  2PAS A;  1JC2 A;  3BFA A;  4GFT A;  2NLN A;  5B8I B;  2KQY A;  1S6C A;  2JT8 A;  3JVT B;  3ZWH A;  2LMT A;  3TS5 C;  1KFU L;  3CGA A;  1VRK A;  3SIA A;  1MUX A;  2MRD A;  4QJ5 B;  2K7B A;  3VRO A;  4ORC B;  3S0G A;  1ZAC A;  2H61 C;  1WRZ A;  4CID A;  3SJS A;  1IIO A;  2WCL A;  4MZL A;  1F55 A;  2HQW A;  3EK7 A;  4YGC B;  2Q91 A;  5ER4 X;  1F54 A;  1OW4 A;  4F7F A; 
#chains in the Genus database with same CATH homology
 5CSJ A;  1QV1 A;  1CTR A;  1DGV A;  1NCZ A;  1SBJ A;  1ZFS A;  1DJZ A;  3JTD C;  5HKZ A;  5DKR A;  1YUR A;  3NSO A;  2JNF A;  1CLB A;  4F0Z B;  3NSL A;  2KAX A;  2HQ8 A;  3O6B A;  1PUL A;  1YRU B;  1NX1 A;  2K2A A;  5G08 A;  2LLS A;  2EHB A;  1H4B A;  5I2Q A;  1B4C A;  4M2Q A;  1BG1 A;  2NCP A;  1BOD A;  1QJT A;  4UPG A;  1S36 A;  1UUR A;  2JNX A;  1CM1 A;  1DGU A;  3TUY C;  2M49 B;  1DF0 A;  2M3W A;  2KBM A;  3VRQ A;  1OMR A;  1JFJ A;  2O5G A;  3BQ3 A;  1GGZ A;  1K9U A;  1SK6 D;  2Y4Q A;  3EVR A;  2BE4 A;  4L9M A;  1IJ5 A;  1GJY A;  2ZN9 A;  1QXP A;  4YI9 A;  4MLW A;  1J55 A;  1WLZ A;  2KYF A;  2LMV A;  2K0J A;  1NWD A;  3I5G C;  1OE9 B;  2GGZ A;  3CR4 X;  1QX2 A;  1KQV A;  3O4Y A;  2EC6 B;  3TDU A;  5K89 A;  1YVL A;  1LA0 A;  1CDP A;  3RLZ A;  1B8L A;  2MHH A;  2NXQ A;  1Y1X A;  3IQQ A;  1PSB A;  3LK1 A;  4HRE E;  3EK4 A;  1SCM B;  3BUN B;  4GPL B;  5I8N A;  2BCX A;  1W7I B;  2CXJ A;  3O2P A;  1J7R A;  3IQO A;  1CFD A;  1A2X A;  1ZOT B;  2LCP A;  3LCP C;  5D69 A;  1A75 B;  3E3R A;  4GGF C;  4GNK B;  4YGE B;  1TN4 A;  2BBN A;  4USL A;  3MSE B;  2L4I A;  1YUU A;  1K95 A;  4GAO A;  1B8R A;  2EGD A;  5FYX A;  1M31 A;  1Y6W A;  1C7V A;  2MLE C;  2JU0 A;  1F8H A;  1KWO C;  1IQ3 A;  1RRO A;  2I2R E;  2LVJ A;  2OTG B;  3HX4 A;  4JWQ A;  3AAK A;  4E68 A;  3EVV A;  1DJY A;  2IS9 A;  2KGR A;  1NX2 A;  2ISD A;  5DKQ A;  2LVV A;  3LLE A;  1B47 A;  4DIR A;  3HCM A;  1DJH A;  1OOJ A;  2DOQ A;  1A03 A;  1JWD A;  2VRG A;  5AXI A;  2D8N A;  2OS8 B;  1S1E A;  1UHK A;  3PN7 B;  4FTG A;  4C0K A;  1S6I A;  5CSF A;  1LKJ A;  2M97 A;  3K21 A;  2F8P A;  3CZT X;  2SAS A;  3BUX B;  4MN0 A;  2PAL A;  3WXA A;  3JVT C;  1QVI Z;  3WHT B;  2BCA A;  3KPX A;  4AQJ A;  3TZ1 A;  2B1U A;  2E6W A;  1NP8 A;  2MBX A;  2WC8 A;  1BJF A;  2K7C A;  1QTX A;  1LXF C;  2K7O A;  1EH2 A;  2KI6 D;  4BY5 A;  2JQ6 A;  3CR5 X;  2RGI A;  2L51 A;  5HYD A;  1CM4 A;  5F6T A;  5KSZ A;  2ZRS A;  2WOR A;  1MR8 A;  4YI8 A;  1MQ1 A;  4D1E A;  1DF0 B;  3SG4 A;  1QAT A;  1XFX O;  1A75 A;  4A4C A;  1CB1 A;  1PK0 D;  1DJI A;  2NCO A;  3BOW A;  2F2P A;  4HSZ A;  1UHN A;  2ZN8 A;  2Q4U A;  3LL8 B;  1DJX A;  1XFV O;  4QJ4 B;  1J1D A;  2WCB A;  3SG5 A;  3GOF A;  4WQ2 A;  2CCM A;  4PE0 A;  4DCK A;  3AKB A;  3BXK A;  2M8U A;  2WCF A;  4I5K A;  1TIZ A;  1QLS A;  2JXC A;  3PFV A;  1KFX S;  2MJW B;  3KO0 A;  1CLM A;  1DTL A;  3VRN A;  4PE4 A;  1QIV A;  1CDN A;  1IH0 A;  4I5J A;  2JRF A;  4PE7 A;  5JJG A;  1JBA A;  1S5G Z;  1Y0V H;  2KFH A;  1M39 A;  1F70 A;  2LUX A;  1SKT A;  1J7Q A;  1JF2 A;  1V1G A;  3KF9 A;  5DKN A;  4R1E A;  2WND A;  2AMI A;  5D7F A;  2F2O A;  2BCB A;  2KBI A;  1RTP 1;  3WHU B;  3AKA A;  1ODB A;  1IQ5 A;  2LV7 A;  1CKK A;  4OKH A;  3OB2 B;  1JSA A;  3PAL A;  1WRL A;  1QVI Y;  1BF5 A;  3PM8 A;  4P2Y B;  2EC6 C;  1UUS A;  2MA2 A;  3GK2 A;  4PHN A;  4C0L A;  1FF1 A;  1SMG A;  3CWG A;  1AJ4 A;  2KSP A;  1SW8 A;  1OQP A;  1SY9 A;  1SCM C;  1QS7 A;  4I5L B;  3TDI A;  1DJW A;  1MWN A;  4A4B A;  1K2H A;  4YBH B;  1SL9 A;  4MRY A;  1IJ6 A;  1M46 A;  2KI4 B;  3TDZ A;  4CPV A;  4PHJ A;  1TCF A;  1TRF A;  1F4O A;  3DVJ A;  2QAC A;  3PSR A;  3D10 A;  4JQ0 D;  1M63 B;  1PRW A;  2F3Z A;  4OCI A;  5CSN A;  3VGO A;  1PSR A;  2OTG C;  1YVH A;  3QRX A;  1AJ5 A;  3DVM A;  2L5X B;  5HLV A;  5BPJ A;  1DJG A;  4YGD B;  2F3Y A;  2KGB C;  4MBE A;  5J3X A;  3KHE A;  4CFR A;  2JC2 A;  2KAV A;  1S6J A;  1K94 A;  2JTZ A;  4MZJ A;  2LE9 B;  3NSK A;  1WDC B;  1SCV A;  2PRU A;  2JWW A;  1S5G Y;  1EXR A;  1UWO A;  4YGA A;  5HKW A;  1KK8 C;  2Y1M A;  3PN7 C;  4CFQ A;  3H4S E;  2L2E A;  1YUS A;  5HKY A;  5KU1 A;  2G2B A;  4NDB A;  1IKU A;  1GQM A;  1K9P A;  1WLM A;  3BOW B;  3CR2 A;  3I5H B;  2LHL A;  4OVN F;  3GK4 X;  2LLU A;  1XFY O;  3RM1 A;  4WQ3 A;  1QX7 A;  4AOM A;  3BUO B;  1YTZ C;  3OX6 A;  2WOS A;  2KFF A;  1JFK A;  3SG7 A;  2KHN A;  1LIN A;  4ZCV A;  1PVA A;  3SG3 A;  1PVB A;  1U5I B;  3VRR A;  2L98 A;  2KDH A;  1YUT A;  2A4J A;  2R2I A;  3EKJ A;  3OB1 B;  5I2L A;  5CPV A;  1ZMZ A;  3SG2 A;  2BBM A;  1HQV A;  2M7L A;  5ER5 A;  2M9G A;  4DS7 A;  1ALV A;  4DUQ A;  4JPZ B;  1JUO A;  3VRP A;  1FI5 A;  2ZNE A;  4XJK B;  2LUC A;  2L4H A;  3IF7 A;  3DF0 A;  4C0J A;  4WRI A;  2LMU A;  1CFF A;  4N1G A;  1B7T Y;  2FCD A;  2LC5 A;  4PDZ A;  1KQM B;  1BOC A;  2I7A A;  2K2F A;  1GGW A;  1TOP A;  3FS7 A;  3FWC A;  5AAN A;  1OMV A;  1R6P A;  4MSP A;  4I5N B;  1S3P A;  1BR4 B;  2FJU B;  1YRT B;  2M7N A;  1CMG A;  1FBV A;  1QX5 B;  2P6B B;  1SRA A;  1MXE A;  1X02 A;  2I18 A;  1WY9 A;  1AP4 A;  2GV5 A;  3EK8 A;  1KK7 Y;  1DT7 B;  1EL4 A;  2BL0 B;  2ZKM X;  1N2D A;  3D0Y B;  1KFU S;  2CT9 A;  1LA3 A;  1DMO A;  2JZI A;  1L2O B;  1OZO A;  1SR6 B;  2TN4 A;  4XYN A;  1AK8 A;  3BYA A;  2JT0 A;  2Y1N A;  2JXL A;  4TNC A;  2AAO A;  1RWY A;  3BUW B;  1J7P A;  1RK9 A;  1OSA A;  1UHH A;  4YRU A;  1AVS A;  1U5I A;  4NQG A;  1CMF A;  1SL8 A;  1RFJ A;  2LVI A;  3I5I B;  2ZFD A;  2KAY A;  4NDC A;  2KI4 C;  4PHM A;  1PAL A;  2V53 A;  1FW4 A;  1NCX A;  2WCE A;  4CLN A;  4ZCU A;  1EG4 A;  1G8I A;  1SYM A;  2L50 A;  1G4Y R;  1H8B A;  3C1V A;  4XJK A;  1FPW A;  2E30 A;  4QJ3 B;  3O78 A;  2MLF C;  1QLK A;  1TNQ A;  3M0W A;  2G9B A;  1V1F A;  1S26 D;  2LP3 A;  2JOJ A;  4PCW A;  1KFX L;  1CFC A;  1D1O A;  1OMD A;  3I5F B;  1WDC C;  2KOT A;  1MF8 B;  2LP2 A;  2K61 A;  1WRK A;  1BT6 A;  4GGF A;  2JUL A;  2F33 A;  1JF0 A;  2GGM A;  1BU3 A;  1K8U A;  5PAL A;  1TTX A;  2KI6 C;  2KQ6 A;  1OZS A;  1NPQ A;  2NZ0 A;  4OR9 B;  2ZND A;  3D0Y A;  3I5H C;  3ZNI A;  1XFW O;  2Y5I A;  1L7Z A;  3F45 A;  3PLF B;  1ALW A;  1B9A A;  1E8A A;  1NX0 A;  3FWB A;  3TS5 B;  2KNE A;  1NX3 A;  1AUI B;  2HF5 A;  3DF0 B;  4Q04 A;  1B7T Z;  1XYD A;  2SCP A;  1C7W A;  2H2K A;  1IRJ A;  1NSH A;  1K96 A;  1SNL A;  2FCE A;  1XO5 A;  1RJV A;  2LNK A;  3DVK A;  4N1F A;  5CSI A;  3WNX B;  5KTY A;  4MRX A;  1YX7 A;  2HPS A;  2QPT A;  1AHR A;  2LLT A;  3NSI A;  4ETO A;  4HRH A;  4AQI A;  2L0P A;  2PSR A;  4M2O A;  2MAZ A;  3EKH A;  4FQO A;  1F4Q A;  1SPY A;  4ORA B;  2LVK A;  1XK4 A;  2HET A;  3DD4 A;  4MVF A;  5IBW A;  2OS8 C;  2OPO A;  1CFP A;  5I2O A;  1R2U A;  1C07 A;  3JTD B;  2PVB A;  3GK1 A;  1KK7 Z;  3ICB A;  1KSO A;  2JT3 A;  1Y1A A;  3A4U B;  3SG6 A;  3OX5 A;  1XFZ O;  1J7O A;  1CDL A;  3DVE A;  3KEV A;  1QV0 A;  1HT9 A;  2LAP A;  1G33 A;  1EJ3 A;  4M2P A;  1KQM C;  5AFP A;  1BLQ A;  3OP0 A;  5AER A;  2BEC A;  4GUK A;  1M45 A;  1K9K A;  1TCO B;  1TNX A;  2JPT A;  1N0Y A;  3CS1 A;  4IL1 A;  4PE1 A;  3TUY B;  1A4P A;  4OV2 A;  1K90 D;  3PAT A;  4N5X A;  1Q80 A;  3BUM B;  2AUC A;  1REC A;  4DRW A;  1B1G A;  1BR1 B;  1CDM A;  1TNW A;  1W7J B;  2KFG A;  2BL0 C;  4PHK A;  2PMY A;  1MHO A;  1UP5 A;  3AAJ A;  4MZK A;  5TNC A;  1IWQ A;  2O60 A;  1FI6 A;  1F71 A;  1IGV A;  2FOT A;  1L2O C;  1SR6 C;  4U8D A;  5GQQ C;  1IG5 A;  3I5G B;  1CNP A;  2CBL A;  4ORB B;  2M0R A;  2K7D A;  4GGN A;  1UHJ A;  1YR5 A;  2H61 A;  2CTN A;  2LM5 A;  4NDD A;  1QIW A;  1Y1U A;  4ICB A;  1NIW A;  5JOL A;  1N65 A;  3EVU A;  3I5I C;  2BE6 A;  4BY4 A;  2ZRT A;  1KK8 B;  1XK4 C;  1XFU O;  4MEW A;  2JTT A;  3NXA A;  1EG3 A;  1UHI A;  1ZUZ A;  4PAL A;  3A8R A;  2LHI A;  1MXL C;  1XVJ A;  1DVI A;  2CNP A;  3FIA A;  3SIB A;  2BKH B;  5HLO A;  2COL B;  2M1U A;  1KWO B;  1K93 D;  1KCY A;  1NUB A;  2M1K B;  3CTN A;  1B8C A;  2I94 A;  4YGB B;  1LVC D;  3LK0 A;  1XA5 A;  1J1E A;  1KSM A;  4HRG A;  1A29 A;  3CLN A;  1NCY A;  2BKI B;  3OHM B;  1YX8 A;  1QAS A;  3I5F C;  1CLL A;  1BMO A;  4P5O E;  2KYC A;  5AEQ A;  1SL7 A;  2LAN A;  1NYA A;  1JC2 A;  2K8M B;  1TNP A;  2M29 A;  2PAS A;  4GFT A;  2NLN A;  5B8I B;  2KQY A;  1S6C A;  2JT8 A;  3JVT B;  3ZWH A;  2LMT A;  3TS5 C;  1KFU L;  3CGA A;  1VRK A;  3SIA A;  1MUX A;  2MRD A;  4QJ5 B;  2K7B A;  3VRO A;  4ORC B;  1ZAC A;  2H61 C;  1WRZ A;  4CID A;  3SJS A;  4MZL A;  1F55 A;  2HQW A;  3EK7 A;  4YGC B;  2Q91 A;  5ER4 X;  1F54 A;  4GBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...