1LXFC

Structure of the regulatory n-domain of human cardiac troponin c in complex with human cardiac troponin-i(147-163) and bepridil
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES
publication title Structure of the regulatory N-domain of human cardiac troponin C in complex with human cardiac troponin I147-163 and bepridil.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein, protein binding
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1lxfC00
2G9BA 1KK7Y 1IJ6A 2ZNEA 1TN4A 3SG3A 4XJKA 5D7FA 2I94A 4JQ0D 3VROA 2JNXA 1K95A 4GBAA 2JT8A 4BY4A 5I8NA 2OTGB 2HPSA 2ZRTA 1VRKA 1YRTB 3DVKA 1B9AA 3OB2B 1PVAA 3CR2A 1DF0B 4U8DA 5AEQA 1FF1A 1F4QA 1JWDA 1QASA 1BR4B 1EG3A 4JWQA 1NYAA 4MRXA 2JT3A 3GK4X 3HCMA 2F3ZA 3EVRA 1U5IA 1J1EA 4ORCB 4QJ4B 5AANA 1JSAA 3VRNA 1EG4A 1IG5A 1WDCB 2M3WA 1N2DA 1MWNA 3EKJA 2LNKA 4MSPA 5CSNA 1PRWA 2K0JA 1QLKA 1M45A 2BBNA 5HKZA 2K61A 3OP0A 1Y1XA 2Q4UA 1FBVA 5CSFA 1QIWA 1NX1A 1RTP1 5PALA 1AHRA 3ZWHA 5IBWA 4DIRA 4NDCA 1BG1A 3D0YB 5AFPA 4YGCB 1F70A 1B4CA 1OE9B 3CZTX 1V1GA 2G2BA 4MN0A 1CDPA 1H8BA 1K2HA 3E3RA 3I5IC 2ZRSA 4A4CA 2CNPA 3CR5X 1K9PA 2SASA 1PSRA 4HRHA 3OHMB 2LAPA 1OQPA 4GFTA 1QTXA 2JPTA 1KFUL 4NDBA 2LM5A 1ZACA 3AAKA 3TUYC 1JBAA 1S1EA 2M97A 4YGEB 1KK8B 3OB1B 1BU3A 2LC5A 2D8NA 1TNPA 3ZNIA 3JTDC 3OX6A 5J3XA 1RROA 3BQ3A 1WY9A 5AXIA 3SIBA 1JFJA 2LCPA 1NSHA 2NCPA 1MHOA 3O78A 4C0JA 1ZFSA 5I2OA 2LP3A 1R6PA 3PLFB 2A4JA 2CT9A 1LINA 3EKHA 2M7LA 1MF8B 1K8UA 2AAOA 2GV5A 5CSIA 1WRLA 2M8UA 5KSZA 4MZJA 1KWOC 2F2PA 1EXRA 2JTTA 3FS7A 1SR6B 3CR4X 4YBHB 1UP5A 1UWOA 3TZ1A 1GQMA 2PSRA 4DRWA 4MLWA 3CLNA 2JRFA 1SCMB 5ER4X 3TS5C 3IF7A 2JQ6A 4I5LB 3PN7C 1SW8A 1WLZA 1XA5A 4I5NB 2LV7A 2EC6C 5FYXA 1M39A 3IQQA 1GGZA 3KHEA 3RLZA 3O2PA 2MA2A 1MXEA 1ZMZA 2CBLA 3PFVA 5KU1A 1YRUB 2LUXA 2M49B 1NCXA 1PSBA 1KSOA 2Y1NA 5TNCA 2CTNA 4AQJA 1AP4A 2PVBA 2O60A 3EVVA 1XO5A 4I5KA 4DCKA 2L5XB 1MQ1A 2HF5A 3O6BA 2FOTA 2K7OA 3NXAA 4YGBB 2KI4B 1PVBA 1DGVA 3A4UB 3IQOA 2KDHA 3CWGA 1RWYA 4F0ZB 3EK7A 4PHMA 3D10A 3F45A 1X02A 1K9UA 2JZIA 3OX5A 3I5GC 1FW4A 1ZUZA 2NLNA 1FPWA 2BCAA 3BUMB 3LL8B 2SCPA 2P6BB 1AUIB 2MJWB 1Y1UA 2M1UA 1ALVA 2KNEA 2KI6D 1DJWA 3LLEA 1J7QA 2RGIA 1IQ5A 1IRJA 1SYMA 1KFXS 2PASA 1E8AA 1NPQA 2OS8C 2KAYA 2LUCA 1DVIA 5BPJA 1BMOA 3CTNA 4A4BA 1G4YR 1ZOTB 1UHIA 1N65A 1EL4A 4CPVA 1KSMA 2LMTA 4IL1A 5KTYA 2LLSA 2JU0A 2QPTA 1OZOA 2OTGC 3BXKA 1F71A 3ICBA 1CLMA 2JWWA 1PALA 2Q91A 1XYDA 4GGFA 3MSEB 3DF0A 3EK8A 3WXAA 2KAXA 5ER5A 2M9GA 3TDIA 3PATA 1BT6A 4N5XA 1CKKA 1KK7Z 3DVJA 2LLUA 2MRDA 4PE0A 1LVCD 2IS9A 3KO0A 4PE7A 1LA0A 3SG4A 2O5GA 1TNQA 1WDCC 2MAZA 3CGAA 1SL7A 3M0WA 4OVNF 4WQ2A 3WNXB 1QLSA 3JVTC 3VRRA 2JC2A 1XK4C 2L98A 1NX3A 1QX7A 3LK1A 4C0LA 2PALA 1J1DA 1QXPA 4M2OA 2L0PA 1KQMB 2PRUA 5HLVA 1B8CA 3NSKA 4MBEA 2LVVA 1K94A 4XJKB 1K90D 1OMRA 1WLMA 1DJYA 3BUNB 1ODBA 1L2OB 1DGUA 3KPXA 2JULA 2JOJA 4MZLA 3AKAA 4PE4A 3VRQA 1CFFA 1HT9A 1TCOB 2LVJA 1TNXA 2I18A 2ZNDA 1OSAA 3I5FB 4E68A 1A2XA 3NSOA 4GGFC 1OZSA 5I2QA 1UUSA 2Y5IA 3SG7A 1NUBA 1AJ4A 2GGMA 1U5IB 1R2UA 2H2KA 1S5GY 1TNWA 1DJZA 1AK8A 1KK8C 1ALWA 1J7PA 1TOPA 1UHHA 2M29A 4PHJA 2I7AA 3VGOA 5B8IB 1MR8A 4P5OE 1L7ZA 1TIZA 1XVJA 2KFGA 3DVMA 2B1UA 3FWCA 4MVFA 3SG2A 2BL0B 2MLEC 2L51A 1S6JA 3O4YA 2EHBA 1MXLC 4P2YB 4NQGA 1KCYA 1K9KA 1QX5B 3AAJA 4YRUA 2KAVA 1YVHA 2LLTA 3I5HB 2KSPA 2LP2A 1BODA 1QX2A 2NZ0A 1QIVA 1B7TY 1CFDA 1JC2A 1RK9A 3SG6A 1IWQA 1CDMA 1SCMC 1XFWO 2BCXA 4I5JA 4TNCA 1SBJA 1A4PA 2M1KB 1NIWA 1SK6D 2MLFC 4M2QA 4CLNA 1C7WA 1QVIY 2K7BA 2KBMA 4YGDB 1M46A 2WNDA 1QATA 2LHLA 2MBXA 1BR1B 1DF0A 1S36A 2EGDA 2R2IA 3PALA 2K8MB 2ISDA 2KGBC 2LMVA 4ETOA 1JF0A 3K21A 1YUTA 4ORAB 4PHNA 2CXJA 4MEWA 1J7OA 1B47A 1K93D 2ZN9A 1W7IB 5G08A 2NXQA 1LXFC 1WRKA 3AKBA 5HKWA 2LVIA 1HQVA 5GQQC 1CTRA 3NSLA 3RM1A 3H4SE 2BKIB 3DVEA 2I2RE 1XK4A 2KI4C 2BKHB 2KGRA 4PCWA 4PE1A 3SIAA 1FI6A 1G33A 2KFFA 4DUQA 3BUXB 5CPVA 2K2AA 4MRYA 1KFUS 3PSRA 2Y4QA 4OKHA 4CIDA 4HRGA 1BLQA 1F55A 3D0YA 1KQVA 1PULA 1YURA 1LKJA 1SL9A 4L9MA 3TDUA 2LANA 1OMVA 1XFVO 4ICBA 4OCIA 1BJFA 2DOQA 1SL8A 2NCOA 2OS8B 2WORA 3FWBA 1DTLA 3BOWB 1YR5A 2KOTA 4D1EA 1B8LA 2LVKA 1NCYA 2MHHA 2Y1MA 5DKQA 1B8RA 4Q04A 5D69A 2M7NA 2LMUA 2WCEA 4ORBB 2F8PA 2JXCA 2WCBA 1S6IA 1BOCA 3KF9A 1IQ3A 1QS7A 2K2FA 1DJGA 2KBIA 1NP8A 2JNFA 4HREE 4CFRA 5DKRA 4YI8A 1S6CA 1SNLA 1XFUO 3HX4A 1A75B 4PDZA 1QV1A 2BE6A 3FIAA 4ZCVA 1Y0VH 3SJSA 2HETA 1RECA 2BBMA 2ZN8A 2KQ6A 2F33A 1DT7B 1CLBA 1FI5A 1N0YA 3JVTB 5HLOA 1DMOA 1AJ5A 4WRIA 1YX8A 3BUWB 1M31A 1XFYO 1OMDA 3I5IB 4YGAA 4BY5A 2FJUB 1NCZA 2TN4A 4R1EA 1SCVA 1RFJA 1A29A 4AOMA 1JF2A 3PM8A 4CFQA 2F2OA 2ZKMX 4ZCUA 4DS7A 4N1GA 1M63B 4NDDA 1KQMC 4WQ3A 1SMGA 3QRXA 3TUYB 1DJHA 1SKTA 2M0RA 2BECA 1IJ5A 1L2OC 2KFHA 3C1VA 1JFKA 1DJIA 1YX7A 2AMIA 1TCFA 4GAOA 1V1FA 4UPGA 4FQOA 1CDNA 2QACA 2AUCA 2WCFA 1XFZO 1MUXA 3DF0B 3GOFA 3I5FC 1XFXO 3JTDB 2E30A 2FCEA 1KFXL 3VRPA 1UHKA 2V53A 2BCBA 1B1GA 1NWDA 4GNKB 4AQIA 4OV2A 4HSZA 3WHUB 3TDZA 2KYCA 5HKYA 3A8RA 1S3PA 1KWOB 3BUOB 1TRFA 1PK0D 4USLA 1D1OA 5I2LA 2H61A 1Y6WA 1A03A 2GGZA 4M2PA 2K7DA 2LHIA 3CS1A 1SR6C 2VRGA 1H4BA 2BL0C 1CMGA 1EH2A 3KEVA 4C0KA 2FCDA 1GGWA 3LCPC 1UURA 2L50A 5JOLA 1QJTA 1TTXA 3SG5A 3TS5B 1S5GZ 3PN7B 3LK0A 1K96A 2HQ8A 2ZFDA 3NSIA 1G8IA 2E6WA 2EC6B 3DD4A 4QJ3B 1CFPA 3EK4A 3EVUA 1IH0A 1F54A 2PMYA 3I5HC 1GJYA 2LE9B 5HYDA 4GPLB 4N1FA 1CDLA 2KQYA 1UHJA 5K89A 1S26D 1F8HA 3BYAA 2WOSA 1C7VA 1YUUA 3GK1A 1J7RA 1Q80A 1CNPA 1Y1AA 4OR9B 2KHNA 5DKNA 2KYFA 1IGVA 1AVSA 4QJ5B 5JJGA 2L2EA 3BOWA 3GK2A 2OPOA 1JUOA 1DJXA 2F3YA 2K7CA 4XYNA 4FTGA 1CMFA 1W7JB 1IKUA 1CLLA 1SRAA 1B7TZ 2H61C 1LA3A 2HQWA 1F4OA 5F6TA 1J55A 1RJVA 2COLB 1CM4A 4GUKA 3I5GB 1CFCA 2CCMA 4MZKA 1YUSA 1WRZA 1EJ3A 1NX0A 1YTZC 1NX2A 1BF5A 2L4IA 1CB1A 4GGNA 2BE4A 2KI6C 2JXLA 4JPZB 1C07A 4PALA 4YI9A 1QVIZ 1YVLA 1SPYA 1A75A 2WC8A 3WHTB 5AERA 5CSJA 4PHKA 1SY9A 2JTZA 2JT0A 1QV0A 1CM1A 1UHNA 2L4HA 1OOJA
chains in the Genus database with same CATH superfamily
2G9BA 1KK7Y 1IJ6A 1XFRA 2ZNEA 1TN4A 3SG3A 4XJKA 4JKTA 3CABA 5D7FA 2I94A 4JQ0D 3SS5A 3VROA 2JNXA 1K95A 4GBAA 2GTEA 2JT8A 4BY4A 5I8NA 2OTGB 2HPSA 2ZRTA 1VRKA 1YRTB 3DVKA 1B9AA 3OB2B 1PVAA 3CR2A 1DF0B 4U8DA 2BAPA 5AEQA 1FF1A 1F4QA 1JWDA 1QASA 1BR4B 1EG3A 4JWQA 1NYAA 4MRXA 5D3OA 2JT3A 2WC5A 3GK4X 3HCMA 2F3ZA 3EVRA 3V2LA 1U5IA 1J1EA 4ORCB 4QJ4B 5AANA 1JSAA 3VRNA 1EG4A 1IG5A 1WDCB 2M3WA 1OOGA 1N2DA 1MWNA 3EKJA 2LNKA 4MSPA 5CSNA 1PRWA 2K0JA 1QLKA 1M45A 2BBNA 5HKZA 3UNWA 2K61A 3OP0A 1Y1XA 2Q4UA 1FBVA 5CSFA 3R1PA 1QIWA 1NX1A 1RTP1 5PALA 1AHRA 3ZWHA 5IBWA 4DIRA 4NDCA 1BG1A 3BFBA 3D0YB 5AFPA 4YGCB 1F70A 1B4CA 1OE9B 2H8VA 3CZTX 1V1GA 2G2BA 4MN0A 1CDPA 1H8BA 3EG5B 3E3RA 3I5IC 5FI7A 1K2HA 2ZRSA 4A4CA 2CNPA 3CR5X 1K9PA 2SASA 1PSRA 4HRHA 2K60A 3OHMB 2LAPA 1OQPA 4GFTA 1QTXA 3S0AA 2JPTA 1KFUL 3D78A 4NDBA 2LM5A 1ZACA 3AAKA 2QEBA 3TUYC 1JBAA 2QDIA 1S1EA 1OOIX 2M97A 4YGEB 1KK8B 2L5YA 3OB1B 1BU3A 1DQEA 2LC5A 2D8NA 1TNPA 3D73A 1DELA 3ZNIA 3JTDC 3OX6A 5J3XA 1RROA 3BQ3A 1WY9A 5AXIA 3SIBA 1JFJA 2LCPA 3B86A 1NSHA 2NCPA 1MHOA 3O78A 4C0JA 1ZFSA 5I2OA 2KLEA 2LP3A 1R6PA 3PLFB 2A4JA 2CT9A 1LINA 3EKHA 2M7LA 1MF8B 1K8UA 2AAOA 2GV5A 5CSIA 3S0FA 1WRLA 2M8UA 5KSZA 4MZJA 1KWOC 2F2PA 1EXRA 2JTTA 3FS7A 1SR6B 3CR4X 4YBHB 1UP5A 1UWOA 3TZ1A 1GQMA 2PSRA 4DRWA 3IVTA 4MLWA 3CLNA 2JRFA 1SCMB 5ER4X 3TS5C 3IF7A 2JQ6A 4I5LB 3PN7C 1SW8A 1WLZA 1XA5A 4I5NB 2LV7A 2EC6C 5FYXA 1M39A 3IQQA 1GGZA 3KHEA 3RLZA 3O2PA 2PQLA 3QMEA 2MA2A 1MXEA 1ZMZA 3FE8A 3PM2A 2CBLA 3PFVA 5KU1A 2JPOA 1YRUB 2LUXA 2M49B 1NCXA 1PSBA 1KSOA 2Y1NA 5TNCA 2CTNA 4AQJA 1AP4A 3NGVA 2PVBA 3NHTA 2O60A 3EVVA 1XO5A 4I5KA 4DCKA 2L5XB 1MQ1A 2HF5A 3O6BA 2FOTA 2K7OA 3NXAA 5EL2A 4YGBB 2KI4B 1PVBA 1DGVA 3A4UB 3DY9A 3IQOA 2KDHA 4INWA 3CWGA 3K1EA 1RWYA 4F0ZB 3CZ1A 3EK7A 4PHMA 3D76A 3D10A 3F45A 1X02A 1K9UA 2JZIA 3OX5A 3I5GC 1FW4A 1ZUZA 2NLNA 1FPWA 2BCAA 2WCMA 3BUMB 3LL8B 2SCPA 2P6BB 1AUIB 2MJWB 3FE9A 1Y1UA 2M1UA 1ALVA 2KNEA 2KI6D 1DJWA 3LLEA 5FI2A 2RGIA 1J7QA 1IQ5A 1IRJA 1SYMA 1KFXS 2PASA 1E8AA 1NPQA 2WCKA 2OS8C 2KAYA 2LUCA 1DVIA 5BPJA 1BMOA 3CTNA 4A4BA 1G4YR 1ZOTB 1ORGA 1UHIA 3OGNA 1N65A 1EL4A 3S0EA 1KSMA 4CPVA 2LMTA 4IL1A 5KTYA 2KPHA 2LLSA 2JU0A 2QPTA 1OZOA 2OTGC 3BXKA 1F71A 3ICBA 1CLMA 2JWWA 1PALA 2Q91A 5HL1A 1XYDA 4GGFA 1GM0A 3MSEB 3OBVA 3DF0A 3CZ2A 3EK8A 3S0GA 3WXAA 2KAXA 5ER5A 2M9GA 3TDIA 3PATA 1BT6A 3R1OA 4N5XA 1CKKA 5DICA 1KK7Z 3B6XA 3DVJA 2LLUA 2MRDA 4PE0A 1LVCD 2IS9A 3KO0A 4PE7A 1LA0A 3SG4A 2O5GA 1TNQA 1WDCC 1QWVA 2MAZA 1SL7A 1SSEB 3CGAA 3M0WA 4OVNF 4OZDA 1QLSA 3JVTC 4WQ2A 3WNXB 3VRRA 2JC2A 1XK4C 2L98A 1NX3A 1QX7A 3LK1A 4C0LA 2PALA 1J1DA 3CZ0A 1P28A 1QXPA 4M2OA 2L0PA 1KQMB 2KLDA 2PRUA 5HLVA 2QEVA 1B8CA 3FE6A 3NSKA 2LVVA 1K94A 4MBEA 2P70A 4XJKB 1K90D 1OMRA 1WLMA 1DJYA 3BUNB 1ODBA 1TUZA 1L2OB 1DGUA 3KPXA 2JULA 2JOJA 4KYNA 3AKAA 4MZLA 4PE4A 5FI6A 1HT9A 1TCOB 2P71A 3VRQA 2LVJA 1TNXA 2I18A 2ZNDA 1OSAA 2PYQA 1C3YA 3I5FB 4E68A 1A2XA 3NSOA 4GGFC 3S0BA 1OZSA 3L4LA 5I2QA 1UUSA 2Y5IA 3DZTA 3SG7A 1NUBA 1AJ4A 2GGMA 1U5IB 1R2UA 2QEHA 2H2KA 1S5GY 1TNWA 1DJZA 1AK8A 2WCHA 3D77A 1KK8C 1ALWA 1J7PA 1Z4HA 1TOPA 1UHHA 2M29A 4PHJA 2I7AA 3VGOA 5B8IB 1MR8A 4P5OE 3N7HA 1L7ZA 1TIZA 1XVJA 2KFGA 3DVMA 2B1UA 3FWCA 4MVFA 3SG2A 2BL0B 2MLEC 1CFFA 2L51A 1S6JA 3O4YA 3UO9A 2EHBA 1MXLC 4P2YB 4NQGA 1KCYA 1K9KA 3SS4A 1QX5B 3AAJA 4YRUA 2KAVA 1YVHA 2LLTA 3I5HB 2KSPA 2LP2A 1BODA 1QX2A 2NZ0A 1QIVA 1C3ZA 1B7TY 3DYEA 1CFDA 1JC2A 1RK9A 1W9ZA 3SG6A 1IWQA 1CDMA 1SCMC 3R72A 1XFWO 2BCXA 4I5JA 4TNCA 1SBJA 1A4PA 2M1KB 1NIWA 1SK6D 2MLFC 1TWOA 4M2QA 4CLNA 1C7WA 1QVIY 3R1VA 2K7BA 4IJ7A 2KBMA 4YGDB 1M46A 2WNDA 1QATA 1OOHA 2LHLA 2MBXA 1BR1B 1DF0A 1S36A 2EGDA 2R2IA 3PALA 2K8MB 2ISDA 2KGBC 2LMVA 4ETOA 1JF0A 3K21A 1YUTA 4ORAB 4PHNA 2CXJA 4MEWA 1J7OA 1B47A 1K93D 2ZN9A 1W7IB 5G08A 2NXQA 1LXFC 1WRKA 3AKBA 5HKWA 2LVIA 1HQVA 5GQQC 1CTRA 3NSLA 3RM1A 3H4SE 2BKIB 3DVEA 2I2RE 1XK4A 2KI4C 2BKHB 1DEKA 2KGRA 4PCWA 4PE1A 3SIAA 1FI6A 1G33A 2KFFA 4DUQA 3BUXB 5CPVA 2K2AA 4MRYA 1KFUS 3PSRA 2Y4QA 3RZSA 4OKHA 4CIDA 4HRGA 4PT1A 1BLQA 1F55A 3D0YA 1KQVA 1PULA 2YGUA 1YURA 1LKJA 1SL9A 4L9MA 3TDUA 2LANA 1OMVA 1XFVO 4ICBA 4OCIA 1BJFA 2DOQA 1SL8A 2NCOA 2OS8B 2WORA 3FWBA 1DTLA 3BOWB 1LS8A 1YR5A 2KOTA 4D1EA 1B8LA 2LVKA 1NCYA 2MHHA 2Y1MA 3Q8IA 5DKQA 1B8RA 4Q04A 5D69A 2M7NA 5I94A 2LMUA 2WCEA 4ORBB 2F8PA 2JXCA 2WCBA 1S6IA 1BOCA 3KF9A 1IQ3A 1QS7A 2K2FA 1DJGA 2KBIA 2WCJA 1NP8A 2JNFA 4HREE 4CFRA 5DKRA 4YI8A 1S6CA 1SNLA 1XFUO 3HX4A 1A75B 3BJHA 1QV1A 2BE6A 2ERBA 3FIAA 3L47A 4PDZA 1Y0VH 4ZCVA 4F7FA 3SJSA 2HETA 1RECA 2BBMA 2ZN8A 3BFHA 2KQ6A 2F33A 2WCLA 1DT7B 1CLBA 1FI5A 1N0YA 3JVTB 5HLOA 1DMOA 1AJ5A 4WRIA 3NHIA 1YX8A 3BUWB 1M31A 1XFYO 1OMDA 3I5IB 4YGAA 4BY5A 2WC6A 2FJUB 1NCZA 2TN4A 4R1EA 1SCVA 1RFJA 1A29A 4AOMA 1JF2A 3D75A 3PM8A 3DXLA 2F2OA 2ZKMX 3CDNA 4CFQA 4ZCUA 4DS7A 1T14A 4N1GA 1M63B 4NDDA 1KQMC 4WQ3A 1SMGA 3QRXA 3B87A 3B7AA 3TUYB 1DJHA 2BNXA 1SKTA 2FJYA 2BECA 1IJ5A 1L2OC 2KFHA 2M0RA 3C1VA 3D74A 1JFKA 1DJIA 1YX7A 2AMIA 1TCFA 4GAOA 3SS3A 1V1FA 4UPGA 4FQOA 1CDNA 2QACA 2AUCA 2WCFA 1XFZO 1MUXA 3DF0B 3GOFA 3I5FC 1XFXO 3JTDB 1TUJA 2E30A 2FCEA 1KFXL 1OW4A 3VRPA 1UHKA 2V53A 3O4XA 2BCBA 1B1GA 1NWDA 4GNKB 4AQIA 1IIOA 4OV2A 4HSZA 3WHUB 3TDZA 2KYCA 3L4AA 5HKYA 3A8RA 1S3PA 1KWOB 4INXA 3BUOB 1TRFA 1PK0D 4USLA 1D1OA 5I2LA 2H61A 1Y6WA 1A03A 2GGZA 4M2PA 2K7DA 2LHIA 3CS1A 1SR6C 2VRGA 1H4BA 2BL0C 1OOFA 1CMGA 1EH2A 3KEVA 4C0KA 2FCDA 3VB1A 3LCPC 1GGWA 1UURA 2L50A 5JOLA 1QJTA 1TTXA 3SG5A 3TS5B 1S5GZ 3PN7B 3LK0A 1K96A 2HQ8A 2ZFDA 3NSIA 1G8IA 2E6WA 2EC6B 3DD4A 4JD9A 4QJ3B 1CFPA 3EK4A 3EVUA 1IH0A 1F54A 2PMYA 3I5HC 1GJYA 2LE9B 5HYDA 4GPLB 4N1FA 1CDLA 2QEOA 2KQYA 1UHJA 5K89A 1S26D 1F8HA 3BYAA 2WOSA 1C7VA 1YUUA 3GK1A 1J7RA 1Q80A 1CNPA 1Y1AA 4OR9B 2KHNA 5DKNA 2KYFA 1IGVA 1AVSA 4QJ5B 5JJGA 3PJIA 2L2EA 3BOWA 3GK2A 2OPOA 1JUOA 1DJXA 2F3YA 2K7CA 3CYZA 4FTGA 4XYNA 1CMFA 1W7JB 1IKUA 1CLLA 1SRAA 1B7TZ 2H61C 1LA3A 2HQWA 1F4OA 5F6TA 1J55A 1RJVA 2COLB 1CM4A 4GUKA 3I5GB 3B88A 2CCMA 4MZKA 1CFCA 2L2CA 1YUSA 1WRZA 1EJ3A 1NX0A 1YTZC 1NX2A 1BF5A 2L4IA 1CB1A 4GGNA 2BE4A 2KI6C 1Z2CB 2JXLA 4JPZB 1C07A 4PALA 4YI9A 1QVIZ 1YVLA 4FQTA 1SPYA 1A75A 3BFAA 2WC8A 1DC1A 3S0DA 3WHTB 5AERA 5CSJA 4PHKA 1SY9A 2JTZA 2JT0A 1QV0A 1CM1A 1UHNA 2L4HA 1OOJA
chains in the Genus database with same CATH topology
2G9BA 1KK7Y 1IJ6A 2ZNEA 1TN4A 3SG3A 4XJKA 5D7FA 2I94A 4JQ0D 3VROA 2JNXA 1K95A 4GBAA 2JT8A 4BY4A 5I8NA 2OTGB 2HPSA 2ZRTA 1VRKA 1YRTB 3DVKA 1B9AA 3OB2B 1PVAA 3CR2A 1DF0B 4U8DA 5AEQA 1FF1A 1F4QA 1JWDA 1QASA 1BR4B 1EG3A 4JWQA 1NYAA 4MRXA 2JT3A 3GK4X 3HCMA 2F3ZA 3EVRA 1U5IA 1J1EA 4ORCB 4QJ4B 5AANA 1JSAA 3VRNA 1EG4A 1IG5A 1WDCB 2M3WA 1N2DA 1MWNA 3EKJA 2LNKA 4MSPA 5CSNA 1PRWA 2K0JA 1QLKA 1M45A 2BBNA 5HKZA 2K61A 3OP0A 1Y1XA 2Q4UA 1FBVA 5CSFA 1QIWA 1NX1A 1RTP1 5PALA 1AHRA 3ZWHA 5IBWA 4DIRA 4NDCA 1BG1A 3D0YB 5AFPA 4YGCB 1F70A 1B4CA 1OE9B 3CZTX 1V1GA 2G2BA 4MN0A 1CDPA 1H8BA 1K2HA 3E3RA 3I5IC 2ZRSA 4A4CA 2CNPA 3CR5X 1K9PA 2SASA 1PSRA 4HRHA 3OHMB 2LAPA 1OQPA 4GFTA 1QTXA 2JPTA 1KFUL 4NDBA 2LM5A 1ZACA 3AAKA 3TUYC 1JBAA 1S1EA 2M97A 4YGEB 1KK8B 3OB1B 1BU3A 2LC5A 2D8NA 1TNPA 3ZNIA 3JTDC 3OX6A 5J3XA 1RROA 3BQ3A 1WY9A 5AXIA 3SIBA 1JFJA 2LCPA 1NSHA 2NCPA 1MHOA 3O78A 4C0JA 1ZFSA 5I2OA 2LP3A 1R6PA 3PLFB 2A4JA 2CT9A 1LINA 3EKHA 2M7LA 1MF8B 1K8UA 2AAOA 2GV5A 5CSIA 1WRLA 2M8UA 5KSZA 4MZJA 1KWOC 2F2PA 1EXRA 2JTTA 3FS7A 1SR6B 3CR4X 4YBHB 1UP5A 1UWOA 3TZ1A 1GQMA 2PSRA 4DRWA 4MLWA 3CLNA 2JRFA 1SCMB 5ER4X 3TS5C 3IF7A 2JQ6A 4I5LB 3PN7C 1SW8A 1WLZA 1XA5A 4I5NB 2LV7A 2EC6C 5FYXA 1M39A 3IQQA 1GGZA 3KHEA 3RLZA 3O2PA 2MA2A 1MXEA 1ZMZA 2CBLA 3PFVA 5KU1A 1YRUB 2LUXA 2M49B 1NCXA 1PSBA 1KSOA 2Y1NA 5TNCA 2CTNA 4AQJA 1AP4A 2PVBA 2O60A 3EVVA 1XO5A 4I5KA 4DCKA 2L5XB 1MQ1A 2HF5A 3O6BA 2FOTA 2K7OA 3NXAA 4YGBB 2KI4B 1PVBA 1DGVA 3A4UB 3IQOA 2KDHA 3CWGA 1RWYA 4F0ZB 3EK7A 4PHMA 3D10A 3F45A 1X02A 1K9UA 2JZIA 3OX5A 3I5GC 1FW4A 1ZUZA 2NLNA 1FPWA 2BCAA 3BUMB 3LL8B 2SCPA 2P6BB 1AUIB 2MJWB 1Y1UA 2M1UA 1ALVA 2KNEA 2KI6D 1DJWA 3LLEA 1J7QA 2RGIA 1IQ5A 1IRJA 1SYMA 1KFXS 2PASA 1E8AA 1NPQA 2OS8C 2KAYA 2LUCA 1DVIA 5BPJA 1BMOA 3CTNA 4A4BA 1G4YR 1ZOTB 1UHIA 1N65A 1EL4A 4CPVA 1KSMA 2LMTA 4IL1A 5KTYA 2LLSA 2JU0A 2QPTA 1OZOA 2OTGC 3BXKA 1F71A 3ICBA 1CLMA 2JWWA 1PALA 2Q91A 1XYDA 4GGFA 3MSEB 3DF0A 3EK8A 3WXAA 2KAXA 5ER5A 2M9GA 3TDIA 3PATA 1BT6A 4N5XA 1CKKA 1KK7Z 3DVJA 2LLUA 2MRDA 4PE0A 1LVCD 2IS9A 3KO0A 4PE7A 1LA0A 3SG4A 2O5GA 1TNQA 1WDCC 2MAZA 3CGAA 1SL7A 3M0WA 4OVNF 4WQ2A 3WNXB 1QLSA 3JVTC 3VRRA 2JC2A 1XK4C 2L98A 1NX3A 1QX7A 3LK1A 4C0LA 2PALA 1J1DA 1QXPA 4M2OA 2L0PA 1KQMB 2PRUA 5HLVA 1B8CA 3NSKA 4MBEA 2LVVA 1K94A 4XJKB 1K90D 1OMRA 1WLMA 1DJYA 3BUNB 1ODBA 1L2OB 1DGUA 3KPXA 2JULA 2JOJA 4MZLA 3AKAA 4PE4A 3VRQA 1CFFA 1HT9A 1TCOB 2LVJA 1TNXA 2I18A 2ZNDA 1OSAA 3I5FB 4E68A 1A2XA 3NSOA 4GGFC 1OZSA 5I2QA 1UUSA 2Y5IA 3SG7A 1NUBA 1AJ4A 2GGMA 1U5IB 1R2UA 2H2KA 1S5GY 1TNWA 1DJZA 1AK8A 1KK8C 1ALWA 1J7PA 1TOPA 1UHHA 2M29A 4PHJA 2I7AA 3VGOA 5B8IB 1MR8A 4P5OE 1L7ZA 1TIZA 1XVJA 2KFGA 3DVMA 2B1UA 3FWCA 4MVFA 3SG2A 2BL0B 2MLEC 2L51A 1S6JA 3O4YA 2EHBA 1MXLC 4P2YB 4NQGA 1KCYA 1K9KA 1QX5B 3AAJA 4YRUA 2KAVA 1YVHA 2LLTA 3I5HB 2KSPA 2LP2A 1BODA 1QX2A 2NZ0A 1QIVA 1B7TY 1CFDA 1JC2A 1RK9A 3SG6A 1IWQA 1CDMA 1SCMC 1XFWO 2BCXA 4I5JA 4TNCA 1SBJA 1A4PA 2M1KB 1NIWA 1SK6D 2MLFC 4M2QA 4CLNA 1C7WA 1QVIY 2K7BA 2KBMA 4YGDB 1M46A 2WNDA 1QATA 2LHLA 2MBXA 1BR1B 1DF0A 1S36A 2EGDA 2R2IA 3PALA 2K8MB 2ISDA 2KGBC 2LMVA 4ETOA 1JF0A 3K21A 1YUTA 4ORAB 4PHNA 2CXJA 4MEWA 1J7OA 1B47A 1K93D 2ZN9A 1W7IB 5G08A 2NXQA 1LXFC 1WRKA 3AKBA 5HKWA 2LVIA 1HQVA 5GQQC 1CTRA 3NSLA 3RM1A 3H4SE 2BKIB 3DVEA 2I2RE 1XK4A 2KI4C 2BKHB 2KGRA 4PCWA 4PE1A 3SIAA 1FI6A 1G33A 2KFFA 4DUQA 3BUXB 5CPVA 2K2AA 4MRYA 1KFUS 3PSRA 2Y4QA 4OKHA 4CIDA 4HRGA 1BLQA 1F55A 3D0YA 1KQVA 1PULA 1YURA 1LKJA 1SL9A 4L9MA 3TDUA 2LANA 1OMVA 1XFVO 4ICBA 4OCIA 1BJFA 2DOQA 1SL8A 2NCOA 2OS8B 2WORA 3FWBA 1DTLA 3BOWB 1YR5A 2KOTA 4D1EA 1B8LA 2LVKA 1NCYA 2MHHA 2Y1MA 5DKQA 1B8RA 4Q04A 5D69A 2M7NA 2LMUA 2WCEA 4ORBB 2F8PA 2JXCA 2WCBA 1S6IA 1BOCA 3KF9A 1IQ3A 1QS7A 2K2FA 1DJGA 2KBIA 1NP8A 2JNFA 4HREE 4CFRA 5DKRA 4YI8A 1S6CA 1SNLA 1XFUO 3HX4A 1A75B 4PDZA 1QV1A 2BE6A 3FIAA 4ZCVA 1Y0VH 3SJSA 2HETA 1RECA 2BBMA 2ZN8A 2KQ6A 2F33A 1DT7B 1CLBA 1FI5A 1N0YA 3JVTB 5HLOA 1DMOA 1AJ5A 4WRIA 1YX8A 3BUWB 1M31A 1XFYO 1OMDA 3I5IB 4YGAA 4BY5A 2FJUB 1NCZA 2TN4A 4R1EA 1SCVA 1RFJA 1A29A 4AOMA 1JF2A 3PM8A 4CFQA 2F2OA 2ZKMX 4ZCUA 4DS7A 4N1GA 1M63B 4NDDA 1KQMC 4WQ3A 1SMGA 3QRXA 3TUYB 1DJHA 1SKTA 2M0RA 2BECA 1IJ5A 1L2OC 2KFHA 3C1VA 1JFKA 1DJIA 1YX7A 2AMIA 1TCFA 4GAOA 1V1FA 4UPGA 4FQOA 1CDNA 2QACA 2AUCA 2WCFA 1XFZO 1MUXA 3DF0B 3GOFA 3I5FC 1XFXO 3JTDB 2E30A 2FCEA 1KFXL 3VRPA 1UHKA 2V53A 2BCBA 1B1GA 1NWDA 4GNKB 4AQIA 4OV2A 4HSZA 3WHUB 3TDZA 2KYCA 5HKYA 3A8RA 1S3PA 1KWOB 3BUOB 1TRFA 1PK0D 4USLA 1D1OA 5I2LA 2H61A 1Y6WA 1A03A 2GGZA 4M2PA 2K7DA 2LHIA 3CS1A 1SR6C 2VRGA 1H4BA 2BL0C 1CMGA 1EH2A 3KEVA 4C0KA 2FCDA 1GGWA 3LCPC 1UURA 2L50A 5JOLA 1QJTA 1TTXA 3SG5A 3TS5B 1S5GZ 3PN7B 3LK0A 1K96A 2HQ8A 2ZFDA 3NSIA 1G8IA 2E6WA 2EC6B 3DD4A 4QJ3B 1CFPA 3EK4A 3EVUA 1IH0A 1F54A 2PMYA 3I5HC 1GJYA 2LE9B 5HYDA 4GPLB 4N1FA 1CDLA 2KQYA 1UHJA 5K89A 1S26D 1F8HA 3BYAA 2WOSA 1C7VA 1YUUA 3GK1A 1J7RA 1Q80A 1CNPA 1Y1AA 4OR9B 2KHNA 5DKNA 2KYFA 1IGVA 1AVSA 4QJ5B 5JJGA 2L2EA 3BOWA 3GK2A 2OPOA 1JUOA 1DJXA 2F3YA 2K7CA 4XYNA 4FTGA 1CMFA 1W7JB 1IKUA 1CLLA 1SRAA 1B7TZ 2H61C 1LA3A 2HQWA 1F4OA 5F6TA 1J55A 1RJVA 2COLB 1CM4A 4GUKA 3I5GB 1CFCA 2CCMA 4MZKA 1YUSA 1WRZA 1EJ3A 1NX0A 1YTZC 1NX2A 1BF5A 2L4IA 1CB1A 4GGNA 2BE4A 2KI6C 2JXLA 4JPZB 1C07A 4PALA 4YI9A 1QVIZ 1YVLA 1SPYA 1A75A 2WC8A 3WHTB 5AERA 5CSJA 4PHKA 1SY9A 2JTZA 2JT0A 1QV0A 1CM1A 1UHNA 2L4HA 1OOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G9B A;  1KK7 Y;  1IJ6 A;  2ZNE A;  1TN4 A;  3SG3 A;  4XJK A;  5D7F A;  2I94 A;  4JQ0 D;  3VRO A;  2JNX A;  1K95 A;  4GBA A;  2JT8 A;  4BY4 A;  5I8N A;  2OTG B;  2HPS A;  2ZRT A;  1VRK A;  1YRT B;  3DVK A;  1B9A A;  3OB2 B;  1PVA A;  3CR2 A;  1DF0 B;  4U8D A;  5AEQ A;  1FF1 A;  1F4Q A;  1JWD A;  1QAS A;  1BR4 B;  1EG3 A;  4JWQ A;  1NYA A;  4MRX A;  2JT3 A;  3GK4 X;  3HCM A;  2F3Z A;  3EVR A;  1U5I A;  1J1E A;  4ORC B;  4QJ4 B;  5AAN A;  1JSA A;  3VRN A;  1EG4 A;  1IG5 A;  1WDC B;  2M3W A;  1N2D A;  1MWN A;  3EKJ A;  2LNK A;  4MSP A;  5CSN A;  1PRW A;  2K0J A;  1QLK A;  1M45 A;  2BBN A;  5HKZ A;  2K61 A;  3OP0 A;  1Y1X A;  2Q4U A;  1FBV A;  5CSF A;  1QIW A;  1NX1 A;  1RTP 1;  5PAL A;  1AHR A;  3ZWH A;  5IBW A;  4DIR A;  4NDC A;  1BG1 A;  3D0Y B;  5AFP A;  4YGC B;  1F70 A;  1B4C A;  1OE9 B;  3CZT X;  1V1G A;  2G2B A;  4MN0 A;  1CDP A;  1H8B A;  1K2H A;  3E3R A;  3I5I C;  2ZRS A;  4A4C A;  2CNP A;  3CR5 X;  1K9P A;  2SAS A;  1PSR A;  4HRH A;  3OHM B;  2LAP A;  1OQP A;  4GFT A;  1QTX A;  2JPT A;  1KFU L;  4NDB A;  2LM5 A;  1ZAC A;  3AAK A;  3TUY C;  1JBA A;  1S1E A;  2M97 A;  4YGE B;  1KK8 B;  3OB1 B;  1BU3 A;  2LC5 A;  2D8N A;  1TNP A;  3ZNI A;  3JTD C;  3OX6 A;  5J3X A;  1RRO A;  3BQ3 A;  1WY9 A;  5AXI A;  3SIB A;  1JFJ A;  2LCP A;  1NSH A;  2NCP A;  1MHO A;  3O78 A;  4C0J A;  1ZFS A;  5I2O A;  2LP3 A;  1R6P A;  3PLF B;  2A4J A;  2CT9 A;  1LIN A;  3EKH A;  2M7L A;  1MF8 B;  1K8U A;  2AAO A;  2GV5 A;  5CSI A;  1WRL A;  2M8U A;  5KSZ A;  4MZJ A;  1KWO C;  2F2P A;  1EXR A;  2JTT A;  3FS7 A;  1SR6 B;  3CR4 X;  4YBH B;  1UP5 A;  1UWO A;  3TZ1 A;  1GQM A;  2PSR A;  4DRW A;  4MLW A;  3CLN A;  2JRF A;  1SCM B;  5ER4 X;  3TS5 C;  3IF7 A;  2JQ6 A;  4I5L B;  3PN7 C;  1SW8 A;  1WLZ A;  1XA5 A;  4I5N B;  2LV7 A;  2EC6 C;  5FYX A;  1M39 A;  3IQQ A;  1GGZ A;  3KHE A;  3RLZ A;  3O2P A;  2MA2 A;  1MXE A;  1ZMZ A;  2CBL A;  3PFV A;  5KU1 A;  1YRU B;  2LUX A;  2M49 B;  1NCX A;  1PSB A;  1KSO A;  2Y1N A;  5TNC A;  2CTN A;  4AQJ A;  1AP4 A;  2PVB A;  2O60 A;  3EVV A;  1XO5 A;  4I5K A;  4DCK A;  2L5X B;  1MQ1 A;  2HF5 A;  3O6B A;  2FOT A;  2K7O A;  3NXA A;  4YGB B;  2KI4 B;  1PVB A;  1DGV A;  3A4U B;  3IQO A;  2KDH A;  3CWG A;  1RWY A;  4F0Z B;  3EK7 A;  4PHM A;  3D10 A;  3F45 A;  1X02 A;  1K9U A;  2JZI A;  3OX5 A;  3I5G C;  1FW4 A;  1ZUZ A;  2NLN A;  1FPW A;  2BCA A;  3BUM B;  3LL8 B;  2SCP A;  2P6B B;  1AUI B;  2MJW B;  1Y1U A;  2M1U A;  1ALV A;  2KNE A;  2KI6 D;  1DJW A;  3LLE A;  1J7Q A;  2RGI A;  1IQ5 A;  1IRJ A;  1SYM A;  1KFX S;  2PAS A;  1E8A A;  1NPQ A;  2OS8 C;  2KAY A;  2LUC A;  1DVI A;  5BPJ A;  1BMO A;  3CTN A;  4A4B A;  1G4Y R;  1ZOT B;  1UHI A;  1N65 A;  1EL4 A;  4CPV A;  1KSM A;  2LMT A;  4IL1 A;  5KTY A;  2LLS A;  2JU0 A;  2QPT A;  1OZO A;  2OTG C;  3BXK A;  1F71 A;  3ICB A;  1CLM A;  2JWW A;  1PAL A;  2Q91 A;  1XYD A;  4GGF A;  3MSE B;  3DF0 A;  3EK8 A;  3WXA A;  2KAX A;  5ER5 A;  2M9G A;  3TDI A;  3PAT A;  1BT6 A;  4N5X A;  1CKK A;  1KK7 Z;  3DVJ A;  2LLU A;  2MRD A;  4PE0 A;  1LVC D;  2IS9 A;  3KO0 A;  4PE7 A;  1LA0 A;  3SG4 A;  2O5G A;  1TNQ A;  1WDC C;  2MAZ A;  3CGA A;  1SL7 A;  3M0W A;  4OVN F;  4WQ2 A;  3WNX B;  1QLS A;  3JVT C;  3VRR A;  2JC2 A;  1XK4 C;  2L98 A;  1NX3 A;  1QX7 A;  3LK1 A;  4C0L A;  2PAL A;  1J1D A;  1QXP A;  4M2O A;  2L0P A;  1KQM B;  2PRU A;  5HLV A;  1B8C A;  3NSK A;  4MBE A;  2LVV A;  1K94 A;  4XJK B;  1K90 D;  1OMR A;  1WLM A;  1DJY A;  3BUN B;  1ODB A;  1L2O B;  1DGU A;  3KPX A;  2JUL A;  2JOJ A;  4MZL A;  3AKA A;  4PE4 A;  3VRQ A;  1CFF A;  1HT9 A;  1TCO B;  2LVJ A;  1TNX A;  2I18 A;  2ZND A;  1OSA A;  3I5F B;  4E68 A;  1A2X A;  3NSO A;  4GGF C;  1OZS A;  5I2Q A;  1UUS A;  2Y5I A;  3SG7 A;  1NUB A;  1AJ4 A;  2GGM A;  1U5I B;  1R2U A;  2H2K A;  1S5G Y;  1TNW A;  1DJZ A;  1AK8 A;  1KK8 C;  1ALW A;  1J7P A;  1TOP A;  1UHH A;  2M29 A;  4PHJ A;  2I7A A;  3VGO A;  5B8I B;  1MR8 A;  4P5O E;  1L7Z A;  1TIZ A;  1XVJ A;  2KFG A;  3DVM A;  2B1U A;  3FWC A;  4MVF A;  3SG2 A;  2BL0 B;  2MLE C;  2L51 A;  1S6J A;  3O4Y A;  2EHB A;  1MXL C;  4P2Y B;  4NQG A;  1KCY A;  1K9K A;  1QX5 B;  3AAJ A;  4YRU A;  2KAV A;  1YVH A;  2LLT A;  3I5H B;  2KSP A;  2LP2 A;  1BOD A;  1QX2 A;  2NZ0 A;  1QIV A;  1B7T Y;  1CFD A;  1JC2 A;  1RK9 A;  3SG6 A;  1IWQ A;  1CDM A;  1SCM C;  1XFW O;  2BCX A;  4I5J A;  4TNC A;  1SBJ A;  1A4P A;  2M1K B;  1NIW A;  1SK6 D;  2MLF C;  4M2Q A;  4CLN A;  1C7W A;  1QVI Y;  2K7B A;  2KBM A;  4YGD B;  1M46 A;  2WND A;  1QAT A;  2LHL A;  2MBX A;  1BR1 B;  1DF0 A;  1S36 A;  2EGD A;  2R2I A;  3PAL A;  2K8M B;  2ISD A;  2KGB C;  2LMV A;  4ETO A;  1JF0 A;  3K21 A;  1YUT A;  4ORA B;  4PHN A;  2CXJ A;  4MEW A;  1J7O A;  1B47 A;  1K93 D;  2ZN9 A;  1W7I B;  5G08 A;  2NXQ A;  1LXF C;  1WRK A;  3AKB A;  5HKW A;  2LVI A;  1HQV A;  5GQQ C;  1CTR A;  3NSL A;  3RM1 A;  3H4S E;  2BKI B;  3DVE A;  2I2R E;  1XK4 A;  2KI4 C;  2BKH B;  2KGR A;  4PCW A;  4PE1 A;  3SIA A;  1FI6 A;  1G33 A;  2KFF A;  4DUQ A;  3BUX B;  5CPV A;  2K2A A;  4MRY A;  1KFU S;  3PSR A;  2Y4Q A;  4OKH A;  4CID A;  4HRG A;  1BLQ A;  1F55 A;  3D0Y A;  1KQV A;  1PUL A;  1YUR A;  1LKJ A;  1SL9 A;  4L9M A;  3TDU A;  2LAN A;  1OMV A;  1XFV O;  4ICB A;  4OCI A;  1BJF A;  2DOQ A;  1SL8 A;  2NCO A;  2OS8 B;  2WOR A;  3FWB A;  1DTL A;  3BOW B;  1YR5 A;  2KOT A;  4D1E A;  1B8L A;  2LVK A;  1NCY A;  2MHH A;  2Y1M A;  5DKQ A;  1B8R A;  4Q04 A;  5D69 A;  2M7N A;  2LMU A;  2WCE A;  4ORB B;  2F8P A;  2JXC A;  2WCB A;  1S6I A;  1BOC A;  3KF9 A;  1IQ3 A;  1QS7 A;  2K2F A;  1DJG A;  2KBI A;  1NP8 A;  2JNF A;  4HRE E;  4CFR A;  5DKR A;  4YI8 A;  1S6C A;  1SNL A;  1XFU O;  3HX4 A;  1A75 B;  4PDZ A;  1QV1 A;  2BE6 A;  3FIA A;  4ZCV A;  1Y0V H;  3SJS A;  2HET A;  1REC A;  2BBM A;  2ZN8 A;  2KQ6 A;  2F33 A;  1DT7 B;  1CLB A;  1FI5 A;  1N0Y A;  3JVT B;  5HLO A;  1DMO A;  1AJ5 A;  4WRI A;  1YX8 A;  3BUW B;  1M31 A;  1XFY O;  1OMD A;  3I5I B;  4YGA A;  4BY5 A;  2FJU B;  1NCZ A;  2TN4 A;  4R1E A;  1SCV A;  1RFJ A;  1A29 A;  4AOM A;  1JF2 A;  3PM8 A;  4CFQ A;  2F2O A;  2ZKM X;  4ZCU A;  4DS7 A;  4N1G A;  1M63 B;  4NDD A;  1KQM C;  4WQ3 A;  1SMG A;  3QRX A;  3TUY B;  1DJH A;  1SKT A;  2M0R A;  2BEC A;  1IJ5 A;  1L2O C;  2KFH A;  3C1V A;  1JFK A;  1DJI A;  1YX7 A;  2AMI A;  1TCF A;  4GAO A;  1V1F A;  4UPG A;  4FQO A;  1CDN A;  2QAC A;  2AUC A;  2WCF A;  1XFZ O;  1MUX A;  3DF0 B;  3GOF A;  3I5F C;  1XFX O;  3JTD B;  2E30 A;  2FCE A;  1KFX L;  3VRP A;  1UHK A;  2V53 A;  2BCB A;  1B1G A;  1NWD A;  4GNK B;  4AQI A;  4OV2 A;  4HSZ A;  3WHU B;  3TDZ A;  2KYC A;  5HKY A;  3A8R A;  1S3P A;  1KWO B;  3BUO B;  1TRF A;  1PK0 D;  4USL A;  1D1O A;  5I2L A;  2H61 A;  1Y6W A;  1A03 A;  2GGZ A;  4M2P A;  2K7D A;  2LHI A;  3CS1 A;  1SR6 C;  2VRG A;  1H4B A;  2BL0 C;  1CMG A;  1EH2 A;  3KEV A;  4C0K A;  2FCD A;  1GGW A;  3LCP C;  1UUR A;  2L50 A;  5JOL A;  1QJT A;  1TTX A;  3SG5 A;  3TS5 B;  1S5G Z;  3PN7 B;  3LK0 A;  1K96 A;  2HQ8 A;  2ZFD A;  3NSI A;  1G8I A;  2E6W A;  2EC6 B;  3DD4 A;  4QJ3 B;  1CFP A;  3EK4 A;  3EVU A;  1IH0 A;  1F54 A;  2PMY A;  3I5H C;  1GJY A;  2LE9 B;  5HYD A;  4GPL B;  4N1F A;  1CDL A;  2KQY A;  1UHJ A;  5K89 A;  1S26 D;  1F8H A;  3BYA A;  2WOS A;  1C7V A;  1YUU A;  3GK1 A;  1J7R A;  1Q80 A;  1CNP A;  1Y1A A;  4OR9 B;  2KHN A;  5DKN A;  2KYF A;  1IGV A;  1AVS A;  4QJ5 B;  5JJG A;  2L2E A;  3BOW A;  3GK2 A;  2OPO A;  1JUO A;  1DJX A;  2F3Y A;  2K7C A;  4XYN A;  4FTG A;  1CMF A;  1W7J B;  1IKU A;  1CLL A;  1SRA A;  1B7T Z;  2H61 C;  1LA3 A;  2HQW A;  1F4O A;  5F6T A;  1J55 A;  1RJV A;  2COL B;  1CM4 A;  4GUK A;  3I5G B;  1CFC A;  2CCM A;  4MZK A;  1YUS A;  1WRZ A;  1EJ3 A;  1NX0 A;  1YTZ C;  1NX2 A;  1BF5 A;  2L4I A;  1CB1 A;  4GGN A;  2BE4 A;  2KI6 C;  2JXL A;  4JPZ B;  1C07 A;  4PAL A;  4YI9 A;  1QVI Z;  1YVL A;  1SPY A;  1A75 A;  2WC8 A;  3WHT B;  5AER A;  5CSJ A;  4PHK A;  1SY9 A;  2JTZ A;  2JT0 A;  1QV0 A;  1CM1 A;  1UHN A;  2L4H A;  1OOJ A; 
#chains in the Genus database with same CATH topology
 2G9B A;  1KK7 Y;  1IJ6 A;  1XFR A;  2ZNE A;  1TN4 A;  3SG3 A;  4XJK A;  4JKT A;  3CAB A;  5D7F A;  2I94 A;  4JQ0 D;  3SS5 A;  3VRO A;  2JNX A;  1K95 A;  4GBA A;  2GTE A;  2JT8 A;  4BY4 A;  5I8N A;  2OTG B;  2HPS A;  2ZRT A;  1VRK A;  1YRT B;  3DVK A;  1B9A A;  3OB2 B;  1PVA A;  3CR2 A;  1DF0 B;  4U8D A;  2BAP A;  5AEQ A;  1FF1 A;  1F4Q A;  1JWD A;  1QAS A;  1BR4 B;  1EG3 A;  4JWQ A;  1NYA A;  4MRX A;  5D3O A;  2JT3 A;  2WC5 A;  3GK4 X;  3HCM A;  2F3Z A;  3EVR A;  3V2L A;  1U5I A;  1J1E A;  4ORC B;  4QJ4 B;  5AAN A;  1JSA A;  3VRN A;  1EG4 A;  1IG5 A;  1WDC B;  2M3W A;  1OOG A;  1N2D A;  1MWN A;  3EKJ A;  2LNK A;  4MSP A;  5CSN A;  1PRW A;  2K0J A;  1QLK A;  1M45 A;  2BBN A;  5HKZ A;  3UNW A;  2K61 A;  3OP0 A;  1Y1X A;  2Q4U A;  1FBV A;  5CSF A;  3R1P A;  1QIW A;  1NX1 A;  1RTP 1;  5PAL A;  1AHR A;  3ZWH A;  5IBW A;  4DIR A;  4NDC A;  1BG1 A;  3BFB A;  3D0Y B;  5AFP A;  4YGC B;  1F70 A;  1B4C A;  1OE9 B;  2H8V A;  3CZT X;  1V1G A;  2G2B A;  4MN0 A;  1CDP A;  1H8B A;  3EG5 B;  3E3R A;  3I5I C;  5FI7 A;  1K2H A;  2ZRS A;  4A4C A;  2CNP A;  3CR5 X;  1K9P A;  2SAS A;  1PSR A;  4HRH A;  2K60 A;  3OHM B;  2LAP A;  1OQP A;  4GFT A;  1QTX A;  3S0A A;  2JPT A;  1KFU L;  3D78 A;  4NDB A;  2LM5 A;  1ZAC A;  3AAK A;  2QEB A;  3TUY C;  1JBA A;  2QDI A;  1S1E A;  1OOI X;  2M97 A;  4YGE B;  1KK8 B;  2L5Y A;  3OB1 B;  1BU3 A;  1DQE A;  2LC5 A;  2D8N A;  1TNP A;  3D73 A;  1DEL A;  3ZNI A;  3JTD C;  3OX6 A;  5J3X A;  1RRO A;  3BQ3 A;  1WY9 A;  5AXI A;  3SIB A;  1JFJ A;  2LCP A;  3B86 A;  1NSH A;  2NCP A;  1MHO A;  3O78 A;  4C0J A;  1ZFS A;  5I2O A;  2KLE A;  2LP3 A;  1R6P A;  3PLF B;  2A4J A;  2CT9 A;  1LIN A;  3EKH A;  2M7L A;  1MF8 B;  1K8U A;  2AAO A;  2GV5 A;  5CSI A;  3S0F A;  1WRL A;  2M8U A;  5KSZ A;  4MZJ A;  1KWO C;  2F2P A;  1EXR A;  2JTT A;  3FS7 A;  1SR6 B;  3CR4 X;  4YBH B;  1UP5 A;  1UWO A;  3TZ1 A;  1GQM A;  2PSR A;  4DRW A;  3IVT A;  4MLW A;  3CLN A;  2JRF A;  1SCM B;  5ER4 X;  3TS5 C;  3IF7 A;  2JQ6 A;  4I5L B;  3PN7 C;  1SW8 A;  1WLZ A;  1XA5 A;  4I5N B;  2LV7 A;  2EC6 C;  5FYX A;  1M39 A;  3IQQ A;  1GGZ A;  3KHE A;  3RLZ A;  3O2P A;  2PQL A;  3QME A;  2MA2 A;  1MXE A;  1ZMZ A;  3FE8 A;  3PM2 A;  2CBL A;  3PFV A;  5KU1 A;  2JPO A;  1YRU B;  2LUX A;  2M49 B;  1NCX A;  1PSB A;  1KSO A;  2Y1N A;  5TNC A;  2CTN A;  4AQJ A;  1AP4 A;  3NGV A;  2PVB A;  3NHT A;  2O60 A;  3EVV A;  1XO5 A;  4I5K A;  4DCK A;  2L5X B;  1MQ1 A;  2HF5 A;  3O6B A;  2FOT A;  2K7O A;  3NXA A;  5EL2 A;  4YGB B;  2KI4 B;  1PVB A;  1DGV A;  3A4U B;  3DY9 A;  3IQO A;  2KDH A;  4INW A;  3CWG A;  3K1E A;  1RWY A;  4F0Z B;  3CZ1 A;  3EK7 A;  4PHM A;  3D76 A;  3D10 A;  3F45 A;  1X02 A;  1K9U A;  2JZI A;  3OX5 A;  3I5G C;  1FW4 A;  1ZUZ A;  2NLN A;  1FPW A;  2BCA A;  2WCM A;  3BUM B;  3LL8 B;  2SCP A;  2P6B B;  1AUI B;  2MJW B;  3FE9 A;  1Y1U A;  2M1U A;  1ALV A;  2KNE A;  2KI6 D;  1DJW A;  3LLE A;  5FI2 A;  2RGI A;  1J7Q A;  1IQ5 A;  1IRJ A;  1SYM A;  1KFX S;  2PAS A;  1E8A A;  1NPQ A;  2WCK A;  2OS8 C;  2KAY A;  2LUC A;  1DVI A;  5BPJ A;  1BMO A;  3CTN A;  4A4B A;  1G4Y R;  1ZOT B;  1ORG A;  1UHI A;  3OGN A;  1N65 A;  1EL4 A;  3S0E A;  1KSM A;  4CPV A;  2LMT A;  4IL1 A;  5KTY A;  2KPH A;  2LLS A;  2JU0 A;  2QPT A;  1OZO A;  2OTG C;  3BXK A;  1F71 A;  3ICB A;  1CLM A;  2JWW A;  1PAL A;  2Q91 A;  5HL1 A;  1XYD A;  4GGF A;  1GM0 A;  3MSE B;  3OBV A;  3DF0 A;  3CZ2 A;  3EK8 A;  3S0G A;  3WXA A;  2KAX A;  5ER5 A;  2M9G A;  3TDI A;  3PAT A;  1BT6 A;  3R1O A;  4N5X A;  1CKK A;  5DIC A;  1KK7 Z;  3B6X A;  3DVJ A;  2LLU A;  2MRD A;  4PE0 A;  1LVC D;  2IS9 A;  3KO0 A;  4PE7 A;  1LA0 A;  3SG4 A;  2O5G A;  1TNQ A;  1WDC C;  1QWV A;  2MAZ A;  1SL7 A;  1SSE B;  3CGA A;  3M0W A;  4OVN F;  4OZD A;  1QLS A;  3JVT C;  4WQ2 A;  3WNX B;  3VRR A;  2JC2 A;  1XK4 C;  2L98 A;  1NX3 A;  1QX7 A;  3LK1 A;  4C0L A;  2PAL A;  1J1D A;  3CZ0 A;  1P28 A;  1QXP A;  4M2O A;  2L0P A;  1KQM B;  2KLD A;  2PRU A;  5HLV A;  2QEV A;  1B8C A;  3FE6 A;  3NSK A;  2LVV A;  1K94 A;  4MBE A;  2P70 A;  4XJK B;  1K90 D;  1OMR A;  1WLM A;  1DJY A;  3BUN B;  1ODB A;  1TUZ A;  1L2O B;  1DGU A;  3KPX A;  2JUL A;  2JOJ A;  4KYN A;  3AKA A;  4MZL A;  4PE4 A;  5FI6 A;  1HT9 A;  1TCO B;  2P71 A;  3VRQ A;  2LVJ A;  1TNX A;  2I18 A;  2ZND A;  1OSA A;  2PYQ A;  1C3Y A;  3I5F B;  4E68 A;  1A2X A;  3NSO A;  4GGF C;  3S0B A;  1OZS A;  3L4L A;  5I2Q A;  1UUS A;  2Y5I A;  3DZT A;  3SG7 A;  1NUB A;  1AJ4 A;  2GGM A;  1U5I B;  1R2U A;  2QEH A;  2H2K A;  1S5G Y;  1TNW A;  1DJZ A;  1AK8 A;  2WCH A;  3D77 A;  1KK8 C;  1ALW A;  1J7P A;  1Z4H A;  1TOP A;  1UHH A;  2M29 A;  4PHJ A;  2I7A A;  3VGO A;  5B8I B;  1MR8 A;  4P5O E;  3N7H A;  1L7Z A;  1TIZ A;  1XVJ A;  2KFG A;  3DVM A;  2B1U A;  3FWC A;  4MVF A;  3SG2 A;  2BL0 B;  2MLE C;  1CFF A;  2L51 A;  1S6J A;  3O4Y A;  3UO9 A;  2EHB A;  1MXL C;  4P2Y B;  4NQG A;  1KCY A;  1K9K A;  3SS4 A;  1QX5 B;  3AAJ A;  4YRU A;  2KAV A;  1YVH A;  2LLT A;  3I5H B;  2KSP A;  2LP2 A;  1BOD A;  1QX2 A;  2NZ0 A;  1QIV A;  1C3Z A;  1B7T Y;  3DYE A;  1CFD A;  1JC2 A;  1RK9 A;  1W9Z A;  3SG6 A;  1IWQ A;  1CDM A;  1SCM C;  3R72 A;  1XFW O;  2BCX A;  4I5J A;  4TNC A;  1SBJ A;  1A4P A;  2M1K B;  1NIW A;  1SK6 D;  2MLF C;  1TWO A;  4M2Q A;  4CLN A;  1C7W A;  1QVI Y;  3R1V A;  2K7B A;  4IJ7 A;  2KBM A;  4YGD B;  1M46 A;  2WND A;  1QAT A;  1OOH A;  2LHL A;  2MBX A;  1BR1 B;  1DF0 A;  1S36 A;  2EGD A;  2R2I A;  3PAL A;  2K8M B;  2ISD A;  2KGB C;  2LMV A;  4ETO A;  1JF0 A;  3K21 A;  1YUT A;  4ORA B;  4PHN A;  2CXJ A;  4MEW A;  1J7O A;  1B47 A;  1K93 D;  2ZN9 A;  1W7I B;  5G08 A;  2NXQ A;  1LXF C;  1WRK A;  3AKB A;  5HKW A;  2LVI A;  1HQV A;  5GQQ C;  1CTR A;  3NSL A;  3RM1 A;  3H4S E;  2BKI B;  3DVE A;  2I2R E;  1XK4 A;  2KI4 C;  2BKH B;  1DEK A;  2KGR A;  4PCW A;  4PE1 A;  3SIA A;  1FI6 A;  1G33 A;  2KFF A;  4DUQ A;  3BUX B;  5CPV A;  2K2A A;  4MRY A;  1KFU S;  3PSR A;  2Y4Q A;  3RZS A;  4OKH A;  4CID A;  4HRG A;  4PT1 A;  1BLQ A;  1F55 A;  3D0Y A;  1KQV A;  1PUL A;  2YGU A;  1YUR A;  1LKJ A;  1SL9 A;  4L9M A;  3TDU A;  2LAN A;  1OMV A;  1XFV O;  4ICB A;  4OCI A;  1BJF A;  2DOQ A;  1SL8 A;  2NCO A;  2OS8 B;  2WOR A;  3FWB A;  1DTL A;  3BOW B;  1LS8 A;  1YR5 A;  2KOT A;  4D1E A;  1B8L A;  2LVK A;  1NCY A;  2MHH A;  2Y1M A;  3Q8I A;  5DKQ A;  1B8R A;  4Q04 A;  5D69 A;  2M7N A;  5I94 A;  2LMU A;  2WCE A;  4ORB B;  2F8P A;  2JXC A;  2WCB A;  1S6I A;  1BOC A;  3KF9 A;  1IQ3 A;  1QS7 A;  2K2F A;  1DJG A;  2KBI A;  2WCJ A;  1NP8 A;  2JNF A;  4HRE E;  4CFR A;  5DKR A;  4YI8 A;  1S6C A;  1SNL A;  1XFU O;  3HX4 A;  1A75 B;  3BJH A;  1QV1 A;  2BE6 A;  2ERB A;  3FIA A;  3L47 A;  4PDZ A;  1Y0V H;  4ZCV A;  4F7F A;  3SJS A;  2HET A;  1REC A;  2BBM A;  2ZN8 A;  3BFH A;  2KQ6 A;  2F33 A;  2WCL A;  1DT7 B;  1CLB A;  1FI5 A;  1N0Y A;  3JVT B;  5HLO A;  1DMO A;  1AJ5 A;  4WRI A;  3NHI A;  1YX8 A;  3BUW B;  1M31 A;  1XFY O;  1OMD A;  3I5I B;  4YGA A;  4BY5 A;  2WC6 A;  2FJU B;  1NCZ A;  2TN4 A;  4R1E A;  1SCV A;  1RFJ A;  1A29 A;  4AOM A;  1JF2 A;  3D75 A;  3PM8 A;  3DXL A;  2F2O A;  2ZKM X;  3CDN A;  4CFQ A;  4ZCU A;  4DS7 A;  1T14 A;  4N1G A;  1M63 B;  4NDD A;  1KQM C;  4WQ3 A;  1SMG A;  3QRX A;  3B87 A;  3B7A A;  3TUY B;  1DJH A;  2BNX A;  1SKT A;  2FJY A;  2BEC A;  1IJ5 A;  1L2O C;  2KFH A;  2M0R A;  3C1V A;  3D74 A;  1JFK A;  1DJI A;  1YX7 A;  2AMI A;  1TCF A;  4GAO A;  3SS3 A;  1V1F A;  4UPG A;  4FQO A;  1CDN A;  2QAC A;  2AUC A;  2WCF A;  1XFZ O;  1MUX A;  3DF0 B;  3GOF A;  3I5F C;  1XFX O;  3JTD B;  1TUJ A;  2E30 A;  2FCE A;  1KFX L;  1OW4 A;  3VRP A;  1UHK A;  2V53 A;  3O4X A;  2BCB A;  1B1G A;  1NWD A;  4GNK B;  4AQI A;  1IIO A;  4OV2 A;  4HSZ A;  3WHU B;  3TDZ A;  2KYC A;  3L4A A;  5HKY A;  3A8R A;  1S3P A;  1KWO B;  4INX A;  3BUO B;  1TRF A;  1PK0 D;  4USL A;  1D1O A;  5I2L A;  2H61 A;  1Y6W A;  1A03 A;  2GGZ A;  4M2P A;  2K7D A;  2LHI A;  3CS1 A;  1SR6 C;  2VRG A;  1H4B A;  2BL0 C;  1OOF A;  1CMG A;  1EH2 A;  3KEV A;  4C0K A;  2FCD A;  3VB1 A;  3LCP C;  1GGW A;  1UUR A;  2L50 A;  5JOL A;  1QJT A;  1TTX A;  3SG5 A;  3TS5 B;  1S5G Z;  3PN7 B;  3LK0 A;  1K96 A;  2HQ8 A;  2ZFD A;  3NSI A;  1G8I A;  2E6W A;  2EC6 B;  3DD4 A;  4JD9 A;  4QJ3 B;  1CFP A;  3EK4 A;  3EVU A;  1IH0 A;  1F54 A;  2PMY A;  3I5H C;  1GJY A;  2LE9 B;  5HYD A;  4GPL B;  4N1F A;  1CDL A;  2QEO A;  2KQY A;  1UHJ A;  5K89 A;  1S26 D;  1F8H A;  3BYA A;  2WOS A;  1C7V A;  1YUU A;  3GK1 A;  1J7R A;  1Q80 A;  1CNP A;  1Y1A A;  4OR9 B;  2KHN A;  5DKN A;  2KYF A;  1IGV A;  1AVS A;  4QJ5 B;  5JJG A;  3PJI A;  2L2E A;  3BOW A;  3GK2 A;  2OPO A;  1JUO A;  1DJX A;  2F3Y A;  2K7C A;  3CYZ A;  4FTG A;  4XYN A;  1CMF A;  1W7J B;  1IKU A;  1CLL A;  1SRA A;  1B7T Z;  2H61 C;  1LA3 A;  2HQW A;  1F4O A;  5F6T A;  1J55 A;  1RJV A;  2COL B;  1CM4 A;  4GUK A;  3I5G B;  3B88 A;  2CCM A;  4MZK A;  1CFC A;  2L2C A;  1YUS A;  1WRZ A;  1EJ3 A;  1NX0 A;  1YTZ C;  1NX2 A;  1BF5 A;  2L4I A;  1CB1 A;  4GGN A;  2BE4 A;  2KI6 C;  1Z2C B;  2JXL A;  4JPZ B;  1C07 A;  4PAL A;  4YI9 A;  1QVI Z;  1YVL A;  4FQT A;  1SPY A;  1A75 A;  3BFA A;  2WC8 A;  1DC1 A;  3S0D A;  3WHT B;  5AER A;  5CSJ A;  4PHK A;  1SY9 A;  2JTZ A;  2JT0 A;  1QV0 A;  1CM1 A;  1UHN A;  2L4H A;  1OOJ A; 
#chains in the Genus database with same CATH homology
 2G9B A;  1KK7 Y;  1IJ6 A;  2ZNE A;  1TN4 A;  3SG3 A;  4XJK A;  5D7F A;  2I94 A;  4JQ0 D;  3VRO A;  2JNX A;  1K95 A;  4GBA A;  2JT8 A;  4BY4 A;  5I8N A;  2OTG B;  2HPS A;  2ZRT A;  1VRK A;  1YRT B;  3DVK A;  1B9A A;  3OB2 B;  1PVA A;  3CR2 A;  1DF0 B;  4U8D A;  5AEQ A;  1FF1 A;  1F4Q A;  1JWD A;  1QAS A;  1BR4 B;  1EG3 A;  4JWQ A;  1NYA A;  4MRX A;  2JT3 A;  3GK4 X;  3HCM A;  2F3Z A;  3EVR A;  1U5I A;  1J1E A;  4ORC B;  4QJ4 B;  5AAN A;  1JSA A;  3VRN A;  1EG4 A;  1IG5 A;  1WDC B;  2M3W A;  1N2D A;  1MWN A;  3EKJ A;  2LNK A;  4MSP A;  5CSN A;  1PRW A;  2K0J A;  1QLK A;  1M45 A;  2BBN A;  5HKZ A;  2K61 A;  3OP0 A;  1Y1X A;  2Q4U A;  1FBV A;  5CSF A;  1QIW A;  1NX1 A;  1RTP 1;  5PAL A;  1AHR A;  3ZWH A;  5IBW A;  4DIR A;  4NDC A;  1BG1 A;  3D0Y B;  5AFP A;  4YGC B;  1F70 A;  1B4C A;  1OE9 B;  3CZT X;  1V1G A;  2G2B A;  4MN0 A;  1CDP A;  1H8B A;  1K2H A;  3E3R A;  3I5I C;  2ZRS A;  4A4C A;  2CNP A;  3CR5 X;  1K9P A;  2SAS A;  1PSR A;  4HRH A;  3OHM B;  2LAP A;  1OQP A;  4GFT A;  1QTX A;  2JPT A;  1KFU L;  4NDB A;  2LM5 A;  1ZAC A;  3AAK A;  3TUY C;  1JBA A;  1S1E A;  2M97 A;  4YGE B;  1KK8 B;  3OB1 B;  1BU3 A;  2LC5 A;  2D8N A;  1TNP A;  3ZNI A;  3JTD C;  3OX6 A;  5J3X A;  1RRO A;  3BQ3 A;  1WY9 A;  5AXI A;  3SIB A;  1JFJ A;  2LCP A;  1NSH A;  2NCP A;  1MHO A;  3O78 A;  4C0J A;  1ZFS A;  5I2O A;  2LP3 A;  1R6P A;  3PLF B;  2A4J A;  2CT9 A;  1LIN A;  3EKH A;  2M7L A;  1MF8 B;  1K8U A;  2AAO A;  2GV5 A;  5CSI A;  1WRL A;  2M8U A;  5KSZ A;  4MZJ A;  1KWO C;  2F2P A;  1EXR A;  2JTT A;  3FS7 A;  1SR6 B;  3CR4 X;  4YBH B;  1UP5 A;  1UWO A;  3TZ1 A;  1GQM A;  2PSR A;  4DRW A;  4MLW A;  3CLN A;  2JRF A;  1SCM B;  5ER4 X;  3TS5 C;  3IF7 A;  2JQ6 A;  4I5L B;  3PN7 C;  1SW8 A;  1WLZ A;  1XA5 A;  4I5N B;  2LV7 A;  2EC6 C;  5FYX A;  1M39 A;  3IQQ A;  1GGZ A;  3KHE A;  3RLZ A;  3O2P A;  2MA2 A;  1MXE A;  1ZMZ A;  2CBL A;  3PFV A;  5KU1 A;  1YRU B;  2LUX A;  2M49 B;  1NCX A;  1PSB A;  1KSO A;  2Y1N A;  5TNC A;  2CTN A;  4AQJ A;  1AP4 A;  2PVB A;  2O60 A;  3EVV A;  1XO5 A;  4I5K A;  4DCK A;  2L5X B;  1MQ1 A;  2HF5 A;  3O6B A;  2FOT A;  2K7O A;  3NXA A;  4YGB B;  2KI4 B;  1PVB A;  1DGV A;  3A4U B;  3IQO A;  2KDH A;  3CWG A;  1RWY A;  4F0Z B;  3EK7 A;  4PHM A;  3D10 A;  3F45 A;  1X02 A;  1K9U A;  2JZI A;  3OX5 A;  3I5G C;  1FW4 A;  1ZUZ A;  2NLN A;  1FPW A;  2BCA A;  3BUM B;  3LL8 B;  2SCP A;  2P6B B;  1AUI B;  2MJW B;  1Y1U A;  2M1U A;  1ALV A;  2KNE A;  2KI6 D;  1DJW A;  3LLE A;  1J7Q A;  2RGI A;  1IQ5 A;  1IRJ A;  1SYM A;  1KFX S;  2PAS A;  1E8A A;  1NPQ A;  2OS8 C;  2KAY A;  2LUC A;  1DVI A;  5BPJ A;  1BMO A;  3CTN A;  4A4B A;  1G4Y R;  1ZOT B;  1UHI A;  1N65 A;  1EL4 A;  4CPV A;  1KSM A;  2LMT A;  4IL1 A;  5KTY A;  2LLS A;  2JU0 A;  2QPT A;  1OZO A;  2OTG C;  3BXK A;  1F71 A;  3ICB A;  1CLM A;  2JWW A;  1PAL A;  2Q91 A;  1XYD A;  4GGF A;  3MSE B;  3DF0 A;  3EK8 A;  3WXA A;  2KAX A;  5ER5 A;  2M9G A;  3TDI A;  3PAT A;  1BT6 A;  4N5X A;  1CKK A;  1KK7 Z;  3DVJ A;  2LLU A;  2MRD A;  4PE0 A;  1LVC D;  2IS9 A;  3KO0 A;  4PE7 A;  1LA0 A;  3SG4 A;  2O5G A;  1TNQ A;  1WDC C;  2MAZ A;  3CGA A;  1SL7 A;  3M0W A;  4OVN F;  4WQ2 A;  3WNX B;  1QLS A;  3JVT C;  3VRR A;  2JC2 A;  1XK4 C;  2L98 A;  1NX3 A;  1QX7 A;  3LK1 A;  4C0L A;  2PAL A;  1J1D A;  1QXP A;  4M2O A;  2L0P A;  1KQM B;  2PRU A;  5HLV A;  1B8C A;  3NSK A;  4MBE A;  2LVV A;  1K94 A;  4XJK B;  1K90 D;  1OMR A;  1WLM A;  1DJY A;  3BUN B;  1ODB A;  1L2O B;  1DGU A;  3KPX A;  2JUL A;  2JOJ A;  4MZL A;  3AKA A;  4PE4 A;  3VRQ A;  1CFF A;  1HT9 A;  1TCO B;  2LVJ A;  1TNX A;  2I18 A;  2ZND A;  1OSA A;  3I5F B;  4E68 A;  1A2X A;  3NSO A;  4GGF C;  1OZS A;  5I2Q A;  1UUS A;  2Y5I A;  3SG7 A;  1NUB A;  1AJ4 A;  2GGM A;  1U5I B;  1R2U A;  2H2K A;  1S5G Y;  1TNW A;  1DJZ A;  1AK8 A;  1KK8 C;  1ALW A;  1J7P A;  1TOP A;  1UHH A;  2M29 A;  4PHJ A;  2I7A A;  3VGO A;  5B8I B;  1MR8 A;  4P5O E;  1L7Z A;  1TIZ A;  1XVJ A;  2KFG A;  3DVM A;  2B1U A;  3FWC A;  4MVF A;  3SG2 A;  2BL0 B;  2MLE C;  2L51 A;  1S6J A;  3O4Y A;  2EHB A;  1MXL C;  4P2Y B;  4NQG A;  1KCY A;  1K9K A;  1QX5 B;  3AAJ A;  4YRU A;  2KAV A;  1YVH A;  2LLT A;  3I5H B;  2KSP A;  2LP2 A;  1BOD A;  1QX2 A;  2NZ0 A;  1QIV A;  1B7T Y;  1CFD A;  1JC2 A;  1RK9 A;  3SG6 A;  1IWQ A;  1CDM A;  1SCM C;  1XFW O;  2BCX A;  4I5J A;  4TNC A;  1SBJ A;  1A4P A;  2M1K B;  1NIW A;  1SK6 D;  2MLF C;  4M2Q A;  4CLN A;  1C7W A;  1QVI Y;  2K7B A;  2KBM A;  4YGD B;  1M46 A;  2WND A;  1QAT A;  2LHL A;  2MBX A;  1BR1 B;  1DF0 A;  1S36 A;  2EGD A;  2R2I A;  3PAL A;  2K8M B;  2ISD A;  2KGB C;  2LMV A;  4ETO A;  1JF0 A;  3K21 A;  1YUT A;  4ORA B;  4PHN A;  2CXJ A;  4MEW A;  1J7O A;  1B47 A;  1K93 D;  2ZN9 A;  1W7I B;  5G08 A;  2NXQ A;  1LXF C;  1WRK A;  3AKB A;  5HKW A;  2LVI A;  1HQV A;  5GQQ C;  1CTR A;  3NSL A;  3RM1 A;  3H4S E;  2BKI B;  3DVE A;  2I2R E;  1XK4 A;  2KI4 C;  2BKH B;  2KGR A;  4PCW A;  4PE1 A;  3SIA A;  1FI6 A;  1G33 A;  2KFF A;  4DUQ A;  3BUX B;  5CPV A;  2K2A A;  4MRY A;  1KFU S;  3PSR A;  2Y4Q A;  4OKH A;  4CID A;  4HRG A;  1BLQ A;  1F55 A;  3D0Y A;  1KQV A;  1PUL A;  1YUR A;  1LKJ A;  1SL9 A;  4L9M A;  3TDU A;  2LAN A;  1OMV A;  1XFV O;  4ICB A;  4OCI A;  1BJF A;  2DOQ A;  1SL8 A;  2NCO A;  2OS8 B;  2WOR A;  3FWB A;  1DTL A;  3BOW B;  1YR5 A;  2KOT A;  4D1E A;  1B8L A;  2LVK A;  1NCY A;  2MHH A;  2Y1M A;  5DKQ A;  1B8R A;  4Q04 A;  5D69 A;  2M7N A;  2LMU A;  2WCE A;  4ORB B;  2F8P A;  2JXC A;  2WCB A;  1S6I A;  1BOC A;  3KF9 A;  1IQ3 A;  1QS7 A;  2K2F A;  1DJG A;  2KBI A;  1NP8 A;  2JNF A;  4HRE E;  4CFR A;  5DKR A;  4YI8 A;  1S6C A;  1SNL A;  1XFU O;  3HX4 A;  1A75 B;  4PDZ A;  1QV1 A;  2BE6 A;  3FIA A;  4ZCV A;  1Y0V H;  3SJS A;  2HET A;  1REC A;  2BBM A;  2ZN8 A;  2KQ6 A;  2F33 A;  1DT7 B;  1CLB A;  1FI5 A;  1N0Y A;  3JVT B;  5HLO A;  1DMO A;  1AJ5 A;  4WRI A;  1YX8 A;  3BUW B;  1M31 A;  1XFY O;  1OMD A;  3I5I B;  4YGA A;  4BY5 A;  2FJU B;  1NCZ A;  2TN4 A;  4R1E A;  1SCV A;  1RFJ A;  1A29 A;  4AOM A;  1JF2 A;  3PM8 A;  4CFQ A;  2F2O A;  2ZKM X;  4ZCU A;  4DS7 A;  4N1G A;  1M63 B;  4NDD A;  1KQM C;  4WQ3 A;  1SMG A;  3QRX A;  3TUY B;  1DJH A;  1SKT A;  2M0R A;  2BEC A;  1IJ5 A;  1L2O C;  2KFH A;  3C1V A;  1JFK A;  1DJI A;  1YX7 A;  2AMI A;  1TCF A;  4GAO A;  1V1F A;  4UPG A;  4FQO A;  1CDN A;  2QAC A;  2AUC A;  2WCF A;  1XFZ O;  1MUX A;  3DF0 B;  3GOF A;  3I5F C;  1XFX O;  3JTD B;  2E30 A;  2FCE A;  1KFX L;  3VRP A;  1UHK A;  2V53 A;  2BCB A;  1B1G A;  1NWD A;  4GNK B;  4AQI A;  4OV2 A;  4HSZ A;  3WHU B;  3TDZ A;  2KYC A;  5HKY A;  3A8R A;  1S3P A;  1KWO B;  3BUO B;  1TRF A;  1PK0 D;  4USL A;  1D1O A;  5I2L A;  2H61 A;  1Y6W A;  1A03 A;  2GGZ A;  4M2P A;  2K7D A;  2LHI A;  3CS1 A;  1SR6 C;  2VRG A;  1H4B A;  2BL0 C;  1CMG A;  1EH2 A;  3KEV A;  4C0K A;  2FCD A;  1GGW A;  3LCP C;  1UUR A;  2L50 A;  5JOL A;  1QJT A;  1TTX A;  3SG5 A;  3TS5 B;  1S5G Z;  3PN7 B;  3LK0 A;  1K96 A;  2HQ8 A;  2ZFD A;  3NSI A;  1G8I A;  2E6W A;  2EC6 B;  3DD4 A;  4QJ3 B;  1CFP A;  3EK4 A;  3EVU A;  1IH0 A;  1F54 A;  2PMY A;  3I5H C;  1GJY A;  2LE9 B;  5HYD A;  4GPL B;  4N1F A;  1CDL A;  2KQY A;  1UHJ A;  5K89 A;  1S26 D;  1F8H A;  3BYA A;  2WOS A;  1C7V A;  1YUU A;  3GK1 A;  1J7R A;  1Q80 A;  1CNP A;  1Y1A A;  4OR9 B;  2KHN A;  5DKN A;  2KYF A;  1IGV A;  1AVS A;  4QJ5 B;  5JJG A;  2L2E A;  3BOW A;  3GK2 A;  2OPO A;  1JUO A;  1DJX A;  2F3Y A;  2K7C A;  4XYN A;  4FTG A;  1CMF A;  1W7J B;  1IKU A;  1CLL A;  1SRA A;  1B7T Z;  2H61 C;  1LA3 A;  2HQW A;  1F4O A;  5F6T A;  1J55 A;  1RJV A;  2COL B;  1CM4 A;  4GUK A;  3I5G B;  1CFC A;  2CCM A;  4MZK A;  1YUS A;  1WRZ A;  1EJ3 A;  1NX0 A;  1YTZ C;  1NX2 A;  1BF5 A;  2L4I A;  1CB1 A;  4GGN A;  2BE4 A;  2KI6 C;  2JXL A;  4JPZ B;  1C07 A;  4PAL A;  4YI9 A;  1QVI Z;  1YVL A;  1SPY A;  1A75 A;  2WC8 A;  3WHT B;  5AER A;  5CSJ A;  4PHK A;  1SY9 A;  2JTZ A;  2JT0 A;  1QV0 A;  1CM1 A;  1UHN A;  2L4H A;  1OOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...