3N7HA

Crystal structure of odorant binding protein 1 from anopheles gambiae (agamobp1) with deet (n,n-diethyl-meta-toluamide) and peg
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anopheles gambiae odorant binding protein crystal complex with the synthetic repellent DEET: implications for structure-based design of novel mosquito repellents.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
molecule keywords Odorant binding protein
total genus 44
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3n7hA01
1TWOA 1OOIX 3D76A 3CZ2A 1OW4A 1XFRA 2P71A 2QEHA 2WC6A 3FE8A 2KPHA 2JPOA 3L4LA 4INXA 3V2LA 3D73A 2QDIA 1QWVA 2QEVA 3L47A 3BJHA 3RZSA 3DY9A 3S0FA 1OOGA 1OOHA 4OZDA 3CZ1A 3D74A 3S0GA 3B87A 4FQTA 2WC5A 3S0EA 1T14A 2L2CA 3FE6A 4INWA 1GM0A 3R72A 1OOFA 1C3YA 4JD9A 3B7AA 3B88A 2P70A 5EL2A 2FJYA 1TUJA 3NHTA 3NHIA 3R1VA 3R1PA 1ORGA 1DQEA 5DICA 3B6XA 3CDNA 1C3ZA 2WCMA 3Q8IA 3S0DA 3CYZA 3DXLA 3BFHA 3D75A 2QEOA 3BFBA 3R1OA 2GTEA 2QEBA 3B86A 3BFAA 3FE9A 3QMEA 3DYEA 3PJIA 3D78A 3D77A 2PQLA 3OGNA 3K1EA 3N7HA 3S0BA 2WCLA 3CABA 3DZTA 2H8VA 3NGVA 2WCKA 2WCHA 2WCJA 3VB1A 1LS8A 3L4AA 3CZ0A 2ERBA 3S0AA 1P28A 4F7FA 4PT1A
chains in the Genus database with same CATH superfamily
2BNXA 1G4YR 1SCMB 2M1UA 5CPVA 2HQ8A 4XJKB 1S6CA 1SYMA 4I5LB 1JFKA 1KFXS 5TNCA 2P71A 1S6JA 2K7OA 1CFFA 1WDCB 1LA3A 1XO5A 3DF0B 3OX5A 4MLWA 1F71A 3VRRA 3PM2A 1TN4A 4YBHB 3SS4A 5FI7A 1KQMC 2M8UA 2NCPA 3D73A 1LINA 1HQVA 1SSEB 2QDIA 5G08A 1QJTA 2PYQA 1RROA 3BJHA 1TNPA 3IQQA 4PALA 1QS7A 2I94A 1OOGA 1JFJA 1B4CA 3KF9A 1OOHA 1QV0A 3TZ1A 3O4XA 4HRHA 3S0GA 1XFUO 2KI4B 3B87A 2LCPA 5JJGA 1UHJA 4FQTA 1SBJA 4NDBA 2CNPA 1FF1A 2O60A 1CDPA 1MF8B 1R2UA 1XFYO 3AAJA 1IJ6A 1QLSA 1F4QA 1ZFSA 1AJ4A 2JOJA 1Y1XA 4GUKA 2KAYA 1NIWA 1H8BA 3BUNB 1AP4A 1XVJA 4YGAA 3VROA 1B7TY 1T14A 2GGMA 2WCBA 1EG4A 5D7FA 1M46A 3VGOA 1ZMZA 1CKKA 4PE0A 1M45A 3CGAA 4KYNA 4PE1A 5JOLA 1F54A 1K96A 1GM0A 2BL0C 5AEQA 3JTDB 1OOFA 3TDZA 4UPGA 2KLEA 3BUWB 2FJUB 1QASA 1B8RA 3B7AA 5AXIA 2L50A 2B1UA 1IQ3A 5HKYA 3SG4A 4GGNA 4GGFC 4R1EA 3EKJA 1MWNA 3OBVA 3NHTA 2BECA 5FI6A 1TRFA 3A8RA 4WQ3A 1U5IA 2M3WA 3DVKA 1NSHA 1DQEA 1KQMB 1SY9A 1UHHA 2OS8B 3DXLA 1WLZA 1BT6A 2WORA 3D0YB 1EL4A 1DEKA 1QX2A 1BODA 2SASA 4CFQA 5ER4X 4PHMA 1JF2A 2K2FA 1CFPA 2LLUA 2BCBA 3A4UB 3KHEA 5AFPA 3R1OA 1SPYA 2GTEA 2QEBA 2Y1MA 3BUOB 3RM1A 3I5HB 3BFAA 2AUCA 1BLQA 4PCWA 2ZNDA 4WRIA 4DCKA 2MLFC 2ZN8A 1EXRA 1A75A 3H4SE 1UHKA 1B7TZ 4GNKB 1BU3A 3DYEA 3EK4A 4DUQA 1XFXO 1CNPA 2D8NA 2K7DA 3D77A 2LAPA 1SMGA 3C1VA 2HPSA 4TNCA 3WXAA 4PE4A 5FYXA 4DS7A 1SL9A 1KK7Y 2JU0A 1MR8A 2WCLA 5BPJA 2K8MB 2OTGC 1JWDA 1LS8A 1K9UA 1NCXA 3L4AA 1OOJA 4MZLA 2QACA 4BY4A 3SIBA 2M7LA 3BUXB 1NX0A 1KSOA 1Z2CB 2GGZA 3CLNA 1M31A 1IJ5A 2F3ZA 3I5IB 2JT8A 3CTNA 2NZ0A 3I5GB 4QJ4B 1UHIA 2E6WA 3SG3A 1B1GA 1KQVA 1A2XA 1XFRA 1DTLA 2JZIA 2QEHA 3I5FB 1CFDA 1N2DA 2LUXA 2R2IA 2PSRA 3TS5C 4YI8A 4INXA 1RK9A 4AOMA 1PRWA 2BKHB 2MHHA 3DVJA 3GK1A 3WHTB 3CR4X 4ZCUA 1UURA 2MJWB 1W9ZA 1QWVA 2QEVA 5I2LA 3LL8B 2F33A 1DJZA 3DY9A 1EJ3A 2KGBC 1BF5A 2BBMA 2LANA 1DF0B 5I2OA 2KBMA 1V1GA 4JKTA 3CZ1A 2BL0B 2GV5A 1F55A 1KSMA 1M39A 3DD4A 2M0RA 1JUOA 3TDUA 2H61C 1KWOB 1ZUZA 1NPQA 1IGVA 4NDDA 1IIOA 4I5JA 3O6BA 1S3PA 4P5OE 1A75B 3FIAA 3SG2A 1Y0VH 2OS8C 4ORAB 2WOSA 1NYAA 2PRUA 4M2QA 1TTXA 3SIAA 2JNFA 5F6TA 3SG5A 1BR1B 3ZNIA 1DMOA 2WCEA 1YVHA 1AVSA 1J55A 4MZJA 2KFHA 5D3OA 5AANA 1C7VA 1NCZA 1IQ5A 2BKIB 4FTGA 1GJYA 3B88A 2FCEA 1CTRA 1QIVA 5EL2A 3I5FC 1K95A 2K2AA 2KQ6A 1YVLA 2KYFA 3KPXA 4YGEB 3NHIA 5DKQA 2MLEC 1DELA 1OMVA 1G33A 4JQ0D 1UUSA 2KLDA 1XFWO 1XK4A 2LVJA 2WCMA 1Z4HA 4N1GA 3S0DA 3CYZA 3D75A 3PALA 3VRNA 1YRUB 1QX7A 3PM8A 1D1OA 3K21A 3O2PA 3BOWA 1S26D 2CXJA 2KOTA 1E8AA 2OPOA 3LK0A 3WNXB 1A03A 4NQGA 4MRXA 4CIDA 3LLEA 2ZFDA 2ZNEA 5J3XA 1JC2A 2JXCA 3HX4A 3B86A 4C0LA 2KI6D 4MVFA 1AJ5A 3GK4X 1CDLA 3PN7C 5B8IB 1SK6D 1OZSA 2KBIA 3OHMB 1RFJA 1OMRA 4E68A 3FE9A 1WRKA 2JWWA 1KCYA 2M29A 1YX8A 2M1KB 2KNEA 1K93D 3QMEA 4ZCVA 2M97A 2ZRTA 3I5IC 3F45A 3SG7A 1KFUL 2F2PA 2VRGA 2LE9B 4ORBB 1FBVA 1F4OA 1OSAA 3I5GC 4P2YB 2CBLA 2NXQA 2F2OA 3OP0A 3M0WA 4HSZA 4QJ3B 5DKNA 4XYNA 1IH0A 4DRWA 1TNQA 1YUTA 3DZTA 2LV7A 3LCPC 3JVTB 3CR2A 1KK8B 1SL8A 1SW8A 1NWDA 3S0AA 1B47A 2SCPA 3PATA 1P28A 1MHOA 1WLMA 2DOQA 4F7FA 1X02A 4A4BA 2JRFA 1QV1A 1SR6B 1N0YA 2LLSA 4CPVA 4GFTA 4Q04A 1J1DA 2JNXA 1DJGA 5D69A 3ZWHA 4WQ2A 1CMGA 2EC6B 3D76A 4GPLB 1YRTB 3QRXA 1L2OB 1K8UA 2WC6A 3FE8A 1DF0A 3OB1B 2JPOA 1LVCD 1QXPA 4PHKA 2QPTA 1A29A 1DJYA 2AAOA 2G9BA 2KGRA 1RECA 4PE7A 1HT9A 1F70A 1IWQA 2LMVA 2L4IA 4GAOA 1AUIB 4IL1A 3L47A 1QATA 1EH2A 1DGUA 2MBXA 3S0FA 2FCDA 1SRAA 1CB1A 1QVIY 3GOFA 1QLKA 3EVUA 4YGBB 4M2PA 2KQYA 3IQOA 1CFCA 1SNLA 5GQQC 1C07A 1FI5A 1N65A 2KHNA 3TUYC 3BYAA 2JC2A 2LMUA 3DVEA 4YI9A 3NSOA 2ZRSA 1TOPA 2L51A 4C0KA 1DVIA 5HLVA 2JXLA 4ORCB 2KSPA 1KFUS 1LXFC 2JT3A 2LMTA 1GQMA 2LNKA 1MQ1A 1R6PA 2MRDA 2BBNA 3R72A 1SR6C 1NP8A 3AAKA 2NCOA 3EKHA 1SCMC 1SKTA 1LKJA 2F8PA 1TNWA 2BCXA 2OTGB 1B8LA 2EGDA 2I18A 3NSKA 1BJFA 1DJIA 1K94A 2L4HA 3PSRA 4CLNA 1FI6A 1YUUA 5HKWA 3FWCA 1QVIZ 2BAPA 2K60A 3BXKA 3DVMA 1XFVO 1ORGA 1NX2A 1WRLA 2K61A 1Y1UA 4IJ7A 3CDNA 1FPWA 2K0JA 3HCMA 2L98A 3BFHA 3EK8A 1QTXA 2JQ6A 1TUZA 3O78A 2CCMA 1RJVA 2Q4UA 1AK8A 3CS1A 5CSJA 1CDMA 3CWGA 3TS5B 3CR5X 2KI4C 1Q80A 1OMDA 2HETA 1K2HA 1ALVA 1NX3A 4PHNA 1IRJA 1S5GZ 5KTYA 1AHRA 1XYDA 5DKRA 2HQWA 2LP2A 2L0PA 3OX6A 3WHUB 1Y6WA 1KK8C 1WRZA 3VRQA 3TUYB 1PK0D 2COLB 1C7WA 4QJ5B 5I8NA 1BR4B 4OR9B 5I94A 2MA2A 2Y1NA 1LA0A 2LHIA 2CTNA 3PJIA 2BE4A 3D78A 2L5YA 3EVVA 5I2QA 1TNXA 2LHLA 5ER5A 2P6BB 1TCFA 2JULA 4ICBA 5FI2A 3OGNA 2LVIA 1MXEA 4PHJA 2LLTA 2ISDA 4A4CA 3E3RA 3CABA 1B9AA 3AKBA 3PN7B 3NGVA 2L2EA 2WCKA 1EG3A 3EVRA 5CSFA 3VB1A 1DC1A 2ERBA 1ALWA 1W7JB 3MSEB 1A4PA 2KFGA 1J7QA 4L9MA 1DJHA 3PLFB 1BOCA 5K89A 1S1EA 1JSAA 1WY9A 3BQ3A 2NLNA 1F8HA 1MUXA 1PVBA 1TWOA 4YGCB 1UHNA 5PALA 1OOIX 2M49B 1XA5A 2LP3A 1VRKA 1PSRA 4N1FA 3CZ2A 3KEVA 1OW4A 4OV2A 4XJKA 4D1EA 3SS5A 1FW4A 4BY5A 3BOWB 2KPHA 1JF0A 3JVTC 1SCVA 3L4LA 3DF0A 3IVTA 1G8IA 2AMIA 3ICBA 1YR5A 5HYDA 2FOTA 2BCAA 2RGIA 3I5HC 4I5KA 3BUMB 3TDIA 2HF5A 3V2LA 1J7RA 4MEWA 2KDHA 4PDZA 2I7AA 3EG5B 5CSIA 4AQIA 3RZSA 1NUBA 2JPTA 4JPZB 1UWOA 4M2OA 2PALA 4ETOA 1XFZO 2KYCA 1J7PA 4OZDA 2KFFA 1U5IB 2JT0A 2BE6A 3D74A 1L2OC 1DJWA 1MXLC 2Q91A 4YGDB 4C0JA 2WNDA 4HRGA 2CT9A 4CFRA 2F3YA 2K7CA 5HL1A 4U8DA 2I2RE 1ZACA 4GBAA 2M9GA 1OZOA 1PULA 4NDCA 1M63B 3UNWA 2H61A 1OQPA 2JTTA 2WC5A 2KI6C 3S0EA 4I5NB 2L2CA 1ZOTB 3FE6A 2Y4QA 1QX5B 4MBEA 5AERA 2LVVA 2E30A 3D10A 1CMFA 3AKAA 4OCIA 1J1EA 1UP5A 1V1FA 3GK2A 4INWA 1TCOB 2LM5A 1GGZA 1RWYA 2EHBA 1C3YA 2WCFA 3EK7A 2YGUA 4JD9A 4AQJA 1CLLA 2IS9A 2K7BA 2ZKMX 1IKUA 1JBAA 2M7NA 1K9KA 1W7IB 4JWQA 4N5XA 1BMOA 2P70A 4GGFA 2O5GA 4YRUA 2LVKA 2FJYA 1TUJA 2G2BA 3R1VA 2H2KA 1NX1A 4MZKA 3R1PA 1KK7Z 2KAXA 2LC5A 5DICA 3B6XA 1C3ZA 3IF7A 4USLA 1Y1AA 3Q8IA 1PSBA 5CSNA 3VRPA 3D0YA 2EC6C 1CLBA 1TIZA 2A4JA 3CZTX 3JTDC 3PFVA 1QIWA 2QEOA 2PVBA 1S5GY 3SG6A 1WDCC 1NCYA 3BFBA 3RLZA 5HLOA 4OVNF 2V53A 1ODBA 4MN0A 3FS7A 3UO9A 1CM1A 1YX7A 2Y5IA 3NXAA 4HREE 3FWBA 2KAVA 1KWOC 1CDNA 1H4BA 3SS3A 1SL7A 2PASA 2ZN9A 1KFXL 1CM4A 5KSZA 4OKHA 4MSPA 2MAZA 2WC8A 1PVAA 1XK4C 1GGWA 1K9PA 3LK1A 1YTZC 1BG1A 2TN4A 4DIRA 5IBWA 1YURA 3O4YA 2PQLA 1CLMA 1K90D 1DJXA 1RTP1 5KU1A 3NSIA 1DT7B 3KO0A 1J7OA 3K1EA 3N7HA 1YUSA 3S0BA 1PALA 2JTZA 4MRYA 1S36A 2H8VA 1DGVA 4FQOA 2WCHA 2WCJA 2LUCA 3OB2B 1IG5A 3CZ0A 1S6IA 1L7ZA 2L5XB 2PMYA 3NSLA 5HKZA 1OE9B 4PT1A 4F0ZB 3SJSA 1B8CA
chains in the Genus database with same CATH topology
1TWOA 1OOIX 3D76A 3CZ2A 1OW4A 1XFRA 2P71A 2QEHA 2WC6A 3FE8A 2KPHA 2JPOA 3L4LA 4INXA 3V2LA 3D73A 2QDIA 1QWVA 2QEVA 3L47A 3BJHA 3RZSA 3DY9A 3S0FA 1OOGA 1OOHA 4OZDA 3CZ1A 3D74A 3S0GA 3B87A 4FQTA 2WC5A 3S0EA 1T14A 2L2CA 3FE6A 4INWA 1GM0A 3R72A 1OOFA 1C3YA 4JD9A 3B7AA 3B88A 2P70A 5EL2A 2FJYA 1TUJA 3NHTA 3NHIA 3R1VA 3R1PA 1ORGA 1DQEA 5DICA 3B6XA 3CDNA 1C3ZA 2WCMA 3Q8IA 3S0DA 3CYZA 3DXLA 3BFHA 3D75A 2QEOA 3BFBA 3R1OA 2GTEA 2QEBA 3B86A 3BFAA 3FE9A 3QMEA 3DYEA 3PJIA 3D78A 3D77A 2PQLA 3OGNA 3K1EA 3N7HA 3S0BA 2WCLA 3CABA 3DZTA 2H8VA 3NGVA 2WCKA 2WCHA 2WCJA 3VB1A 1LS8A 3L4AA 3CZ0A 2ERBA 3S0AA 1P28A 4F7FA 4PT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWO A;  1OOI X;  3D76 A;  3CZ2 A;  1OW4 A;  1XFR A;  2P71 A;  2QEH A;  2WC6 A;  3FE8 A;  2KPH A;  2JPO A;  3L4L A;  4INX A;  3V2L A;  3D73 A;  2QDI A;  1QWV A;  2QEV A;  3L47 A;  3BJH A;  3RZS A;  3DY9 A;  3S0F A;  1OOG A;  1OOH A;  4OZD A;  3CZ1 A;  3D74 A;  3S0G A;  3B87 A;  4FQT A;  2WC5 A;  3S0E A;  1T14 A;  2L2C A;  3FE6 A;  4INW A;  1GM0 A;  3R72 A;  1OOF A;  1C3Y A;  4JD9 A;  3B7A A;  3B88 A;  2P70 A;  5EL2 A;  2FJY A;  1TUJ A;  3NHT A;  3NHI A;  3R1V A;  3R1P A;  1ORG A;  1DQE A;  5DIC A;  3B6X A;  3CDN A;  1C3Z A;  2WCM A;  3Q8I A;  3S0D A;  3CYZ A;  3DXL A;  3BFH A;  3D75 A;  2QEO A;  3BFB A;  3R1O A;  2GTE A;  2QEB A;  3B86 A;  3BFA A;  3FE9 A;  3QME A;  3DYE A;  3PJI A;  3D78 A;  3D77 A;  2PQL A;  3OGN A;  3K1E A;  3N7H A;  3S0B A;  2WCL A;  3CAB A;  3DZT A;  2H8V A;  3NGV A;  2WCK A;  2WCH A;  2WCJ A;  3VB1 A;  1LS8 A;  3L4A A;  3CZ0 A;  2ERB A;  3S0A A;  1P28 A;  4F7F A;  4PT1 A; 
#chains in the Genus database with same CATH topology
 2BNX A;  1G4Y R;  1SCM B;  2M1U A;  5CPV A;  2HQ8 A;  4XJK B;  1S6C A;  1SYM A;  4I5L B;  1JFK A;  1KFX S;  5TNC A;  2P71 A;  1S6J A;  2K7O A;  1CFF A;  1WDC B;  1LA3 A;  1XO5 A;  3DF0 B;  3OX5 A;  4MLW A;  1F71 A;  3VRR A;  3PM2 A;  1TN4 A;  4YBH B;  3SS4 A;  5FI7 A;  1KQM C;  2M8U A;  2NCP A;  3D73 A;  1LIN A;  1HQV A;  1SSE B;  2QDI A;  5G08 A;  1QJT A;  2PYQ A;  1RRO A;  3BJH A;  1TNP A;  3IQQ A;  4PAL A;  1QS7 A;  2I94 A;  1OOG A;  1JFJ A;  1B4C A;  3KF9 A;  1OOH A;  1QV0 A;  3TZ1 A;  3O4X A;  4HRH A;  3S0G A;  1XFU O;  2KI4 B;  3B87 A;  2LCP A;  5JJG A;  1UHJ A;  4FQT A;  1SBJ A;  4NDB A;  2CNP A;  1FF1 A;  2O60 A;  1CDP A;  1MF8 B;  1R2U A;  1XFY O;  3AAJ A;  1IJ6 A;  1QLS A;  1F4Q A;  1ZFS A;  1AJ4 A;  2JOJ A;  1Y1X A;  4GUK A;  2KAY A;  1NIW A;  1H8B A;  3BUN B;  1AP4 A;  1XVJ A;  4YGA A;  3VRO A;  1B7T Y;  1T14 A;  2GGM A;  2WCB A;  1EG4 A;  5D7F A;  1M46 A;  3VGO A;  1ZMZ A;  1CKK A;  4PE0 A;  1M45 A;  3CGA A;  4KYN A;  4PE1 A;  5JOL A;  1F54 A;  1K96 A;  1GM0 A;  2BL0 C;  5AEQ A;  3JTD B;  1OOF A;  3TDZ A;  4UPG A;  2KLE A;  3BUW B;  2FJU B;  1QAS A;  1B8R A;  3B7A A;  5AXI A;  2L50 A;  2B1U A;  1IQ3 A;  5HKY A;  3SG4 A;  4GGN A;  4GGF C;  4R1E A;  3EKJ A;  1MWN A;  3OBV A;  3NHT A;  2BEC A;  5FI6 A;  1TRF A;  3A8R A;  4WQ3 A;  1U5I A;  2M3W A;  3DVK A;  1NSH A;  1DQE A;  1KQM B;  1SY9 A;  1UHH A;  2OS8 B;  3DXL A;  1WLZ A;  1BT6 A;  2WOR A;  3D0Y B;  1EL4 A;  1DEK A;  1QX2 A;  1BOD A;  2SAS A;  4CFQ A;  5ER4 X;  4PHM A;  1JF2 A;  2K2F A;  1CFP A;  2LLU A;  2BCB A;  3A4U B;  3KHE A;  5AFP A;  3R1O A;  1SPY A;  2GTE A;  2QEB A;  2Y1M A;  3BUO B;  3RM1 A;  3I5H B;  3BFA A;  2AUC A;  1BLQ A;  4PCW A;  2ZND A;  4WRI A;  4DCK A;  2MLF C;  2ZN8 A;  1EXR A;  1A75 A;  3H4S E;  1UHK A;  1B7T Z;  4GNK B;  1BU3 A;  3DYE A;  3EK4 A;  4DUQ A;  1XFX O;  1CNP A;  2D8N A;  2K7D A;  3D77 A;  2LAP A;  1SMG A;  3C1V A;  2HPS A;  4TNC A;  3WXA A;  4PE4 A;  5FYX A;  4DS7 A;  1SL9 A;  1KK7 Y;  2JU0 A;  1MR8 A;  2WCL A;  5BPJ A;  2K8M B;  2OTG C;  1JWD A;  1LS8 A;  1K9U A;  1NCX A;  3L4A A;  1OOJ A;  4MZL A;  2QAC A;  4BY4 A;  3SIB A;  2M7L A;  3BUX B;  1NX0 A;  1KSO A;  1Z2C B;  2GGZ A;  3CLN A;  1M31 A;  1IJ5 A;  2F3Z A;  3I5I B;  2JT8 A;  3CTN A;  2NZ0 A;  3I5G B;  4QJ4 B;  1UHI A;  2E6W A;  3SG3 A;  1B1G A;  1KQV A;  1A2X A;  1XFR A;  1DTL A;  2JZI A;  2QEH A;  3I5F B;  1CFD A;  1N2D A;  2LUX A;  2R2I A;  2PSR A;  3TS5 C;  4YI8 A;  4INX A;  1RK9 A;  4AOM A;  1PRW A;  2BKH B;  2MHH A;  3DVJ A;  3GK1 A;  3WHT B;  3CR4 X;  4ZCU A;  1UUR A;  2MJW B;  1W9Z A;  1QWV A;  2QEV A;  5I2L A;  3LL8 B;  2F33 A;  1DJZ A;  3DY9 A;  1EJ3 A;  2KGB C;  1BF5 A;  2BBM A;  2LAN A;  1DF0 B;  5I2O A;  2KBM A;  1V1G A;  4JKT A;  3CZ1 A;  2BL0 B;  2GV5 A;  1F55 A;  1KSM A;  1M39 A;  3DD4 A;  2M0R A;  1JUO A;  3TDU A;  2H61 C;  1KWO B;  1ZUZ A;  1NPQ A;  1IGV A;  4NDD A;  1IIO A;  4I5J A;  3O6B A;  1S3P A;  4P5O E;  1A75 B;  3FIA A;  3SG2 A;  1Y0V H;  2OS8 C;  4ORA B;  2WOS A;  1NYA A;  2PRU A;  4M2Q A;  1TTX A;  3SIA A;  2JNF A;  5F6T A;  3SG5 A;  1BR1 B;  3ZNI A;  1DMO A;  2WCE A;  1YVH A;  1AVS A;  1J55 A;  4MZJ A;  2KFH A;  5D3O A;  5AAN A;  1C7V A;  1NCZ A;  1IQ5 A;  2BKI B;  4FTG A;  1GJY A;  3B88 A;  2FCE A;  1CTR A;  1QIV A;  5EL2 A;  3I5F C;  1K95 A;  2K2A A;  2KQ6 A;  1YVL A;  2KYF A;  3KPX A;  4YGE B;  3NHI A;  5DKQ A;  2MLE C;  1DEL A;  1OMV A;  1G33 A;  4JQ0 D;  1UUS A;  2KLD A;  1XFW O;  1XK4 A;  2LVJ A;  2WCM A;  1Z4H A;  4N1G A;  3S0D A;  3CYZ A;  3D75 A;  3PAL A;  3VRN A;  1YRU B;  1QX7 A;  3PM8 A;  1D1O A;  3K21 A;  3O2P A;  3BOW A;  1S26 D;  2CXJ A;  2KOT A;  1E8A A;  2OPO A;  3LK0 A;  3WNX B;  1A03 A;  4NQG A;  4MRX A;  4CID A;  3LLE A;  2ZFD A;  2ZNE A;  5J3X A;  1JC2 A;  2JXC A;  3HX4 A;  3B86 A;  4C0L A;  2KI6 D;  4MVF A;  1AJ5 A;  3GK4 X;  1CDL A;  3PN7 C;  5B8I B;  1SK6 D;  1OZS A;  2KBI A;  3OHM B;  1RFJ A;  1OMR A;  4E68 A;  3FE9 A;  1WRK A;  2JWW A;  1KCY A;  2M29 A;  1YX8 A;  2M1K B;  2KNE A;  1K93 D;  3QME A;  4ZCV A;  2M97 A;  2ZRT A;  3I5I C;  3F45 A;  3SG7 A;  1KFU L;  2F2P A;  2VRG A;  2LE9 B;  4ORB B;  1FBV A;  1F4O A;  1OSA A;  3I5G C;  4P2Y B;  2CBL A;  2NXQ A;  2F2O A;  3OP0 A;  3M0W A;  4HSZ A;  4QJ3 B;  5DKN A;  4XYN A;  1IH0 A;  4DRW A;  1TNQ A;  1YUT A;  3DZT A;  2LV7 A;  3LCP C;  3JVT B;  3CR2 A;  1KK8 B;  1SL8 A;  1SW8 A;  1NWD A;  3S0A A;  1B47 A;  2SCP A;  3PAT A;  1P28 A;  1MHO A;  1WLM A;  2DOQ A;  4F7F A;  1X02 A;  4A4B A;  2JRF A;  1QV1 A;  1SR6 B;  1N0Y A;  2LLS A;  4CPV A;  4GFT A;  4Q04 A;  1J1D A;  2JNX A;  1DJG A;  5D69 A;  3ZWH A;  4WQ2 A;  1CMG A;  2EC6 B;  3D76 A;  4GPL B;  1YRT B;  3QRX A;  1L2O B;  1K8U A;  2WC6 A;  3FE8 A;  1DF0 A;  3OB1 B;  2JPO A;  1LVC D;  1QXP A;  4PHK A;  2QPT A;  1A29 A;  1DJY A;  2AAO A;  2G9B A;  2KGR A;  1REC A;  4PE7 A;  1HT9 A;  1F70 A;  1IWQ A;  2LMV A;  2L4I A;  4GAO A;  1AUI B;  4IL1 A;  3L47 A;  1QAT A;  1EH2 A;  1DGU A;  2MBX A;  3S0F A;  2FCD A;  1SRA A;  1CB1 A;  1QVI Y;  3GOF A;  1QLK A;  3EVU A;  4YGB B;  4M2P A;  2KQY A;  3IQO A;  1CFC A;  1SNL A;  5GQQ C;  1C07 A;  1FI5 A;  1N65 A;  2KHN A;  3TUY C;  3BYA A;  2JC2 A;  2LMU A;  3DVE A;  4YI9 A;  3NSO A;  2ZRS A;  1TOP A;  2L51 A;  4C0K A;  1DVI A;  5HLV A;  2JXL A;  4ORC B;  2KSP A;  1KFU S;  1LXF C;  2JT3 A;  2LMT A;  1GQM A;  2LNK A;  1MQ1 A;  1R6P A;  2MRD A;  2BBN A;  3R72 A;  1SR6 C;  1NP8 A;  3AAK A;  2NCO A;  3EKH A;  1SCM C;  1SKT A;  1LKJ A;  2F8P A;  1TNW A;  2BCX A;  2OTG B;  1B8L A;  2EGD A;  2I18 A;  3NSK A;  1BJF A;  1DJI A;  1K94 A;  2L4H A;  3PSR A;  4CLN A;  1FI6 A;  1YUU A;  5HKW A;  3FWC A;  1QVI Z;  2BAP A;  2K60 A;  3BXK A;  3DVM A;  1XFV O;  1ORG A;  1NX2 A;  1WRL A;  2K61 A;  1Y1U A;  4IJ7 A;  3CDN A;  1FPW A;  2K0J A;  3HCM A;  2L98 A;  3BFH A;  3EK8 A;  1QTX A;  2JQ6 A;  1TUZ A;  3O78 A;  2CCM A;  1RJV A;  2Q4U A;  1AK8 A;  3CS1 A;  5CSJ A;  1CDM A;  3CWG A;  3TS5 B;  3CR5 X;  2KI4 C;  1Q80 A;  1OMD A;  2HET A;  1K2H A;  1ALV A;  1NX3 A;  4PHN A;  1IRJ A;  1S5G Z;  5KTY A;  1AHR A;  1XYD A;  5DKR A;  2HQW A;  2LP2 A;  2L0P A;  3OX6 A;  3WHU B;  1Y6W A;  1KK8 C;  1WRZ A;  3VRQ A;  3TUY B;  1PK0 D;  2COL B;  1C7W A;  4QJ5 B;  5I8N A;  1BR4 B;  4OR9 B;  5I94 A;  2MA2 A;  2Y1N A;  1LA0 A;  2LHI A;  2CTN A;  3PJI A;  2BE4 A;  3D78 A;  2L5Y A;  3EVV A;  5I2Q A;  1TNX A;  2LHL A;  5ER5 A;  2P6B B;  1TCF A;  2JUL A;  4ICB A;  5FI2 A;  3OGN A;  2LVI A;  1MXE A;  4PHJ A;  2LLT A;  2ISD A;  4A4C A;  3E3R A;  3CAB A;  1B9A A;  3AKB A;  3PN7 B;  3NGV A;  2L2E A;  2WCK A;  1EG3 A;  3EVR A;  5CSF A;  3VB1 A;  1DC1 A;  2ERB A;  1ALW A;  1W7J B;  3MSE B;  1A4P A;  2KFG A;  1J7Q A;  4L9M A;  1DJH A;  3PLF B;  1BOC A;  5K89 A;  1S1E A;  1JSA A;  1WY9 A;  3BQ3 A;  2NLN A;  1F8H A;  1MUX A;  1PVB A;  1TWO A;  4YGC B;  1UHN A;  5PAL A;  1OOI X;  2M49 B;  1XA5 A;  2LP3 A;  1VRK A;  1PSR A;  4N1F A;  3CZ2 A;  3KEV A;  1OW4 A;  4OV2 A;  4XJK A;  4D1E A;  3SS5 A;  1FW4 A;  4BY5 A;  3BOW B;  2KPH A;  1JF0 A;  3JVT C;  1SCV A;  3L4L A;  3DF0 A;  3IVT A;  1G8I A;  2AMI A;  3ICB A;  1YR5 A;  5HYD A;  2FOT A;  2BCA A;  2RGI A;  3I5H C;  4I5K A;  3BUM B;  3TDI A;  2HF5 A;  3V2L A;  1J7R A;  4MEW A;  2KDH A;  4PDZ A;  2I7A A;  3EG5 B;  5CSI A;  4AQI A;  3RZS A;  1NUB A;  2JPT A;  4JPZ B;  1UWO A;  4M2O A;  2PAL A;  4ETO A;  1XFZ O;  2KYC A;  1J7P A;  4OZD A;  2KFF A;  1U5I B;  2JT0 A;  2BE6 A;  3D74 A;  1L2O C;  1DJW A;  1MXL C;  2Q91 A;  4YGD B;  4C0J A;  2WND A;  4HRG A;  2CT9 A;  4CFR A;  2F3Y A;  2K7C A;  5HL1 A;  4U8D A;  2I2R E;  1ZAC A;  4GBA A;  2M9G A;  1OZO A;  1PUL A;  4NDC A;  1M63 B;  3UNW A;  2H61 A;  1OQP A;  2JTT A;  2WC5 A;  2KI6 C;  3S0E A;  4I5N B;  2L2C A;  1ZOT B;  3FE6 A;  2Y4Q A;  1QX5 B;  4MBE A;  5AER A;  2LVV A;  2E30 A;  3D10 A;  1CMF A;  3AKA A;  4OCI A;  1J1E A;  1UP5 A;  1V1F A;  3GK2 A;  4INW A;  1TCO B;  2LM5 A;  1GGZ A;  1RWY A;  2EHB A;  1C3Y A;  2WCF A;  3EK7 A;  2YGU A;  4JD9 A;  4AQJ A;  1CLL A;  2IS9 A;  2K7B A;  2ZKM X;  1IKU A;  1JBA A;  2M7N A;  1K9K A;  1W7I B;  4JWQ A;  4N5X A;  1BMO A;  2P70 A;  4GGF A;  2O5G A;  4YRU A;  2LVK A;  2FJY A;  1TUJ A;  2G2B A;  3R1V A;  2H2K A;  1NX1 A;  4MZK A;  3R1P A;  1KK7 Z;  2KAX A;  2LC5 A;  5DIC A;  3B6X A;  1C3Z A;  3IF7 A;  4USL A;  1Y1A A;  3Q8I A;  1PSB A;  5CSN A;  3VRP A;  3D0Y A;  2EC6 C;  1CLB A;  1TIZ A;  2A4J A;  3CZT X;  3JTD C;  3PFV A;  1QIW A;  2QEO A;  2PVB A;  1S5G Y;  3SG6 A;  1WDC C;  1NCY A;  3BFB A;  3RLZ A;  5HLO A;  4OVN F;  2V53 A;  1ODB A;  4MN0 A;  3FS7 A;  3UO9 A;  1CM1 A;  1YX7 A;  2Y5I A;  3NXA A;  4HRE E;  3FWB A;  2KAV A;  1KWO C;  1CDN A;  1H4B A;  3SS3 A;  1SL7 A;  2PAS A;  2ZN9 A;  1KFX L;  1CM4 A;  5KSZ A;  4OKH A;  4MSP A;  2MAZ A;  2WC8 A;  1PVA A;  1XK4 C;  1GGW A;  1K9P A;  3LK1 A;  1YTZ C;  1BG1 A;  2TN4 A;  4DIR A;  5IBW A;  1YUR A;  3O4Y A;  2PQL A;  1CLM A;  1K90 D;  1DJX A;  1RTP 1;  5KU1 A;  3NSI A;  1DT7 B;  3KO0 A;  1J7O A;  3K1E A;  3N7H A;  1YUS A;  3S0B A;  1PAL A;  2JTZ A;  4MRY A;  1S36 A;  2H8V A;  1DGV A;  4FQO A;  2WCH A;  2WCJ A;  2LUC A;  3OB2 B;  1IG5 A;  3CZ0 A;  1S6I A;  1L7Z A;  2L5X B;  2PMY A;  3NSL A;  5HKZ A;  1OE9 B;  4PT1 A;  4F0Z B;  3SJS A;  1B8C A; 
#chains in the Genus database with same CATH homology
 1TWO A;  1OOI X;  3D76 A;  3CZ2 A;  1OW4 A;  1XFR A;  2P71 A;  2QEH A;  2WC6 A;  3FE8 A;  2KPH A;  2JPO A;  3L4L A;  4INX A;  3V2L A;  3D73 A;  2QDI A;  1QWV A;  2QEV A;  3L47 A;  3BJH A;  3RZS A;  3DY9 A;  3S0F A;  1OOG A;  1OOH A;  4OZD A;  3CZ1 A;  3D74 A;  3S0G A;  3B87 A;  4FQT A;  2WC5 A;  3S0E A;  1T14 A;  2L2C A;  3FE6 A;  4INW A;  1GM0 A;  3R72 A;  1OOF A;  1C3Y A;  4JD9 A;  3B7A A;  3B88 A;  2P70 A;  5EL2 A;  2FJY A;  1TUJ A;  3NHT A;  3NHI A;  3R1V A;  3R1P A;  1ORG A;  1DQE A;  5DIC A;  3B6X A;  3CDN A;  1C3Z A;  2WCM A;  3Q8I A;  3S0D A;  3CYZ A;  3DXL A;  3BFH A;  3D75 A;  2QEO A;  3BFB A;  3R1O A;  2GTE A;  2QEB A;  3B86 A;  3BFA A;  3FE9 A;  3QME A;  3DYE A;  3PJI A;  3D78 A;  3D77 A;  2PQL A;  3OGN A;  3K1E A;  3N7H A;  3S0B A;  2WCL A;  3CAB A;  3DZT A;  2H8V A;  3NGV A;  2WCK A;  2WCH A;  2WCJ A;  3VB1 A;  1LS8 A;  3L4A A;  3CZ0 A;  2ERB A;  3S0A A;  1P28 A;  4F7F A;  4PT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...