3N7HA

Crystal structure of odorant binding protein 1 from anopheles gambiae (agamobp1) with deet (n,n-diethyl-meta-toluamide) and peg
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant binding protein
publication title Anopheles gambiae odorant binding protein crystal complex with the synthetic repellent DEET: implications for structure-based design of novel mosquito repellents.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 44
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3n7hA01
3NHIA 2QEBA 3CYZA 3Q8IA 2PQLA 1XFRA 3B87A 1OW4A 3FE6A 3S0BA 3FE8A 3CZ2A 1ORGA 3S0AA 3R72A 5DICA 3K1EA 3B7AA 3QMEA 2ERBA 3DZTA 3VB1A 3S0GA 1GM0A 2JPOA 3R1OA 2QEHA 3BFHA 4FQTA 4INXA 3DYEA 1TWOA 3BJHA 3CDNA 2GTEA 3B88A 2QDIA 2WCLA 3CABA 3D78A 1QWVA 3R1VA 3D77A 1OOFA 3N7HA 3R1PA 4OZDA 2WCMA 2H8VA 3S0DA 3RZSA 1C3ZA 1TUJA 2KPHA 2QEVA 3D75A 3B6XA 3D76A 3B86A 3DXLA 2WCKA 1OOGA 3OGNA 2WCHA 5EL2A 1C3YA 2L2CA 3BFBA 3CZ1A 3CZ0A 3PJIA 3V2LA 3NHTA 2FJYA 1P28A 4INWA 4JD9A 4F7FA 3S0FA 2P71A 3FE9A 3S0EA 3D73A 3L4LA 3NGVA 1DQEA 2P70A 1OOHA 1OOIX 3BFAA 2QEOA 3DY9A 3D74A 3L47A 2WC6A 1T14A 2WC5A 4PT1A 2WCJA 1LS8A 3L4AA
chains in the Genus database with same CATH superfamily
4JPZB 1J7QA 2LE9B 3Q8IA 5FI6A 4AQJA 3NSIA 5AEQA 2LHLA 1GQMA 2JRFA 4NDCA 4NQGA 5D7FA 1B7TZ 1DVIA 1SR6B 1FPWA 3FWCA 3HX4A 1F4QA 3OB2B 1UP5A 1DJHA 3NSLA 3B7AA 3LLEA 2ERBA 4I5LB 1QX5B 5F6TA 2B1UA 2JXLA 1Y1AA 1ZACA 2LAPA 1AJ4A 2LUCA 1XFXO 2K2AA 3I5IC 3BFHA 3GK2A 4P2YB 2LUXA 3KF9A 1QATA 4ICBA 2EC6C 4A4BA 1A2XA 3DYEA 4OVNF 4CFQA 4AOMA 2V53A 2ZKMX 2K60A 4FQOA 3PM8A 3AAJA 1SRAA 5B8IB 1QJTA 3D78A 3BXKA 1JUOA 2H61C 2WNDA 1SSEB 2NZ0A 1H4BA 1U5IB 2LVIA 4YGDB 1OOFA 5HYDA 1YVHA 2ISDA 2DOQA 3DVJA 2JZIA 2M3WA 1IQ5A 2ZFDA 3MSEB 2JXCA 2E30A 4GAOA 2ZN8A 1EH2A 1G8IA 2H8VA 2LMTA 4YI9A 1C3ZA 2FCEA 5CSFA 1SNLA 2JT8A 1TUJA 3SJSA 3BQ3A 2M1KB 1CFCA 2PYQA 2GV5A 3CR5X 1OOGA 4N1GA 4NDDA 2JTZA 2F3YA 3CZTX 3VROA 4D1EA 2COLB 4OKHA 1TNPA 2KFHA 3KPXA 1IG5A 1OMDA 4CLNA 3VRRA 3VRQA 1KQMC 1DJWA 3DF0B 1CKKA 1C3YA 3CGAA 2L5XB 1J7OA 4MRYA 5FI7A 1WRKA 3OP0A 2HPSA 3PJIA 1MQ1A 1EJ3A 3HCMA 3I5FB 2WCBA 1YUSA 4M2OA 4YGCB 4IL1A 2EHBA 2LCPA 1SL9A 1LXFC 4INWA 2CNPA 1YTZC 2WORA 5HLVA 1CLMA 1RROA 1S6CA 2O60A 4F7FA 1JBAA 2VRGA 2BCXA 4FTGA 2KLDA 2P71A 3PN7B 3FE9A 1LA3A 3S0EA 1OMVA 1M31A 1J7RA 1UURA 3A4UB 2F2OA 1DQEA 2I94A 1B9AA 4IJ7A 1MXLC 4PE7A 1ZOTB 2LV7A 1CDMA 1TTXA 5HL1A 1N65A 2P70A 4XJKA 1CLBA 3CR4X 2L50A 4ZCUA 1Y0VH 1J1EA 2I7AA 3WNXB 1JF2A 1BMOA 2ZNDA 2D8NA 3O4YA 3WXAA 3DY9A 2I18A 2JPTA 3FS7A 1OOJA 1Z4HA 2L4IA 3L47A 2KAVA 3IQQA 3KEVA 4NDBA 1DJGA 2LLUA 5FI2A 2WC5A 3OHMB 3SG4A 1ZUZA 2K7BA 3ZNIA 4HRGA 1FBVA 2OTGB 3I5GB 3VGOA 1M39A 2LVKA 1DJIA 2EC6B 1AK8A 5IBWA 1F70A 2PQLA 4MZKA 4DRWA 1ALWA 1MUXA 3D0YB 4ORAB 1KK8B 4MBEA 4MZJA 3DVMA 1LVCD 2JT0A 1JF0A 1XFVO 2BL0C 1UWOA 2JC2A 4Q04A 2PMYA 3TZ1A 3VB1A 3DZTA 1TOPA 4WQ3A 1DMOA 5I2QA 5GQQC 2BKHB 2P6BB 2H61A 2KQ6A 1OZOA 3EKJA 5I94A 1KCYA 2KFGA 1DJYA 5AANA 5KSZA 4DUQA 1IH0A 1PVAA 2QEHA 1MXEA 3PM2A 4PDZA 3ZWHA 3WHTB 1SPYA 1J55A 4I5KA 1CLLA 1BJFA 3JVTC 5KU1A 1TCFA 3TUYB 1V1FA 1XK4A 2MA2A 2AAOA 3B88A 1DT7B 2TN4A 2JNXA 1G33A 1OMRA 3NSKA 2NCOA 3R1VA 2K0JA 2WCEA 4M2PA 4MEWA 3SG6A 4AQIA 1NX0A 2KAXA 3GK1A 3SIAA 1RTP1 1ZMZA 3UNWA 5I2OA 1TNXA 3PLFB 3CTNA 2WCMA 1EG3A 1FF1A 4HREE 2K61A 1PSBA 3RZSA 1TNWA 3TS5C 1CFPA 3VRNA 1L2OB 1SL7A 1B8LA 4USLA 2KI4C 1MWNA 1QTXA 3JTDC 4YBHB 2FOTA 1Y1XA 2K7OA 2KHNA 1VRKA 2QEVA 4M2QA 4I5NB 1X02A 1A75A 2WCKA 3PFVA 1DTLA 3DVEA 1AP4A 1IGVA 2LHIA 2WCHA 2Y1MA 1PK0D 2PALA 4KYNA 3DD4A 1NIWA 4PE4A 1W9ZA 5HKZA 1ZFSA 4GGNA 1YRUB 2JULA 1BODA 1JWDA 1WRZA 2AUCA 3O78A 1CM4A 1YX8A 2L2CA 1TIZA 3BFBA 3CZ1A 2KGBC 3F45A 1CMGA 2HETA 2EGDA 1IKUA 2O5GA 1A4PA 1B8CA 2PVBA 4MZLA 4PE0A 2GGZA 4YI8A 4C0JA 4DCKA 1S3PA 3BUWB 4MSPA 1ODBA 3SS5A 3V2LA 1BU3A 1XO5A 4YRUA 2FJYA 1K8UA 4BY5A 5KTYA 2M97A 1XK4C 2CXJA 1SBJA 3NXAA 1NWDA 4GFTA 4OR9B 3RM1A 3VRPA 1PULA 1IJ5A 1KWOC 2BE6A 1SY9A 4QJ3B 5CSIA 3NSOA 2BBNA 2MHHA 2Y4QA 1TCOB 1EL4A 2IS9A 2NCPA 3D73A 1XFZO 1J1DA 3NGVA 5DKRA 2L51A 5ER5A 4PE1A 1FI5A 3LCPC 5K89A 1FI6A 2KOTA 3ICBA 1CDNA 4MLWA 3QRXA 2FCDA 3IQOA 3TDIA 1JSAA 1S6IA 1YUUA 1WDCC 5ER4X 4E68A 2G2BA 2OS8C 4P5OE 4YGBB 2KGRA 3I5HC 3D74A 2JOJA 2LP2A 2BL0B 2KBMA 4QJ5B 4HSZA 2M7LA 1UHIA 2KLEA 2M1UA 1F4OA 3OX6A 1OZSA 1DF0A 2F3ZA 4PT1A 5G08A 3SG2A 2CTNA 5I2LA 4DIRA 4HRHA 1YX7A 4YGEB 4XJKB 2K8MB 3CYZA 1RWYA 1SR6C 2L2EA 1XFRA 3OX5A 1DGUA 3GOFA 3E3RA 3PATA 3B87A 3KO0A 2RGIA 2LMUA 2R2IA 3DF0A 3FE8A 1CFFA 2F8PA 3CZ2A 1UHHA 1ORGA 2HF5A 4U8DA 3S0AA 3SS3A 3R72A 1CTRA 1XFUO 5DICA 2JQ6A 1SMGA 2JTTA 2ZNEA 3EK8A 3QMEA 3O6BA 3BUXB 3S0GA 1QV0A 2KQYA 1GM0A 1D1OA 2LP3A 1PRWA 3CS1A 1TRFA 4UPGA 2LLTA 3TDUA 2KI4B 3SG5A 3BUNB 4GPLB 3JTDB 1NP8A 3I5IB 2L4HA 5I8NA 5HLOA 1AJ5A 1E8AA 2K2FA 2GTEA 3SG3A 1CNPA 1UUSA 2KYFA 2WC8A 4TNCA 2QDIA 2LM5A 1F8HA 2JWWA 2L5YA 3AAKA 2KBIA 1Y1UA 1UHNA 1XA5A 3CABA 1YURA 3UO9A 3IF7A 3N7HA 5HKYA 1WRLA 2KDHA 4PHKA 2M9GA 5CSNA 3M0WA 4MN0A 4CFRA 1IIOA 2KI6D 5BPJA 2M8UA 3C1VA 3EK7A 1R6PA 2KPHA 2Q91A 1GJYA 2BKIB 2MLEC 3B6XA 3EK4A 3D76A 1BF5A 3B86A 4WQ2A 5CPVA 3BYAA 3OGNA 2SASA 2BNXA 1QASA 1NCXA 3AKAA 1PSRA 4XYNA 2LVVA 1YUTA 4GGFC 2FJUB 1PALA 5EL2A 3WHUB 3AKBA 2ZN9A 2F2PA 4A4CA 3OBVA 2M7NA 3I5FC 1J7PA 2CT9A 3H4SE 1KQMB 3BOWA 5FYXA 1V1GA 1OQPA 2JNFA 1QX2A 1B8RA 1KFUS 1SW8A 1BOCA 3NHTA 2LC5A 1P28A 1QLKA 5TNCA 1QV1A 2MJWB 1A75B 4JWQA 2E6WA 3S0FA 3OB1B 1K90D 3RLZA 1S1EA 4WRIA 1KQVA 1CM1A 3K21A 5JJGA 1TNQA 1S26D 4GUKA 1KFXS 1GGZA 3EG5B 4C0LA 3LK1A 2LVJA 2KAYA 2MAZA 3D10A 1K93D 1HT9A 1OOHA 1TN4A 1NUBA 1OOIX 2QPTA 3EKHA 3LK0A 2I2RE 4ORBB 4C0KA 5HKWA 2NLNA 1CDPA 4OV2A 5D3OA 1IQ3A 1MF8B 3EVVA 2NXQA 3TDZA 1QVIY 4OCIA 2BECA 2AMIA 2WC6A 2MRDA 1A29A 3CLNA 4ORCB 2BCBA 2K7DA 4PHNA 2OTGC 5AXIA 1M45A 1K9KA 1Y6WA 2BCAA 2M29A 3I5GC 1KK7Z 1YRTB 4BY4A 1TUZA 1MHOA 2WCFA 2GGMA 2BAPA 1XVJA 2KYCA 1DELA 5CSJA 1GGWA 3NHIA 2QEBA 2Y5IA 1BR1B 2A4JA 2CBLA 1KK8C 2KNEA 1R2UA 2LANA 2ZRTA 4R1EA 1RECA 1OW4A 3CR2A 3FE6A 5DKQA 3S0BA 1DJZA 4ZCVA 2Q4UA 1NX3A 1RK9A 4MVFA 1K95A 1S6JA 4CIDA 1NYAA 3K1EA 1U5IA 1S5GY 1K9PA 1SCMC 1N2DA 3SIBA 1DF0B 1NCZA 3PALA 1EG4A 1QX7A 1S36A 2MBXA 3SS4A 2ZRSA 2F33A 2JPOA 3LL8B 3R1OA 4GNKB 1BR4B 1SCVA 1ALVA 1W7JB 1NX1A 2K7CA 3TUYC 1QVIZ 4FQTA 4N5XA 1IJ6A 4INXA 1XYDA 1OE9B 1SYMA 1TWOA 2JU0A 1K96A 4N1FA 2KI6C 3BJHA 1WLZA 3CDNA 2KSPA 2SCPA 2H2KA 1B47A 3JVTB 1W7IB 1C7WA 2LLSA 3EVUA 1KSOA 2WCLA 1UHKA 4DS7A 1QWVA 2BE4A 3IVTA 5D69A 3D77A 4L9MA 1LKJA 2YGUA 4MRXA 1QLSA 4GGFA 2JT3A 1L2OC 3R1PA 4OZDA 2HQ8A 4ETOA 4PCWA 3A8RA 3S0DA 3EVRA 2L0PA 1S5GZ 1NPQA 3BUOB 1AHRA 3D75A 2M49B 2MLFC 3PSRA 2PRUA 2WOSA 4PHJA 3TS5B 1DC1A 1A03A 1RFJA 3DXLA 1L7ZA 1QS7A 3FWBA 1CB1A 2M0RA 4JKTA 1B1GA 1Z2CB 1F71A 1QXPA 1DGVA 2LNKA 1JFJA 1K94A 1FW4A 1M46A 2PASA 3BUMB 1AUIB 5JOLA 4CPVA 2CCMA 1IWQA 1SL8A 5AFPA 1MR8A 3CZ0A 4PALA 1K9UA 1LA0A 1QIVA 1PVBA 4YGAA 1UHJA 1DEKA 1G4YR 3FIAA 2HQWA 1CMFA 1BLQA 1JFKA 2G9BA 2L98A 2PSRA 3GK4X 1DJXA 1HQVA 2Y1NA 1KFUL 4JD9A 1F55A 3O2PA 1H8BA 1C7VA 4F0ZB 5DKNA 3KHEA 1K2HA 1LINA 1B7TY 1AVSA 1KWOB 3L4LA 3O4XA 1M63B 4I5JA 1F54A 1IRJA 1NCYA 1JC2A 1NSHA 1Q80A 1YVLA 2LMVA 2BBMA 1SK6D 1BG1A 1QIWA 4QJ4B 3BOWB 3DVKA 1WLMA 1C07A 4GBAA 4PHMA 1KFXL 1XFWO 1BT6A 3BFAA 1XFYO 3D0YA 2QACA 2QEOA 1N0YA 2OPOA 1WDCB 1NX2A 3SG7A 2OS8B 2KFFA 1CDLA 1KK7Y 1SCMB 1WY9A 3I5HB 3CWGA 5PALA 3PN7C 4JQ0D 1B4CA 1T14A 1KSMA 2WCJA 5J3XA 1LS8A 1CFDA 1YR5A 5AERA 1SKTA 1RJVA 3L4AA 1OSAA 1EXRA
chains in the Genus database with same CATH topology
3NHIA 2QEBA 3CYZA 3Q8IA 2PQLA 1XFRA 3B87A 1OW4A 3FE6A 3S0BA 3FE8A 3CZ2A 1ORGA 3S0AA 3R72A 5DICA 3K1EA 3B7AA 3QMEA 2ERBA 3DZTA 3VB1A 3S0GA 1GM0A 2JPOA 3R1OA 2QEHA 3BFHA 4FQTA 4INXA 3DYEA 1TWOA 3BJHA 3CDNA 2GTEA 3B88A 2QDIA 2WCLA 3CABA 3D78A 1QWVA 3R1VA 3D77A 1OOFA 3N7HA 3R1PA 4OZDA 2WCMA 2H8VA 3S0DA 3RZSA 1C3ZA 1TUJA 2KPHA 2QEVA 3D75A 3B6XA 3D76A 3B86A 3DXLA 2WCKA 1OOGA 3OGNA 2WCHA 5EL2A 1C3YA 2L2CA 3BFBA 3CZ1A 3CZ0A 3PJIA 3V2LA 3NHTA 2FJYA 1P28A 4INWA 4JD9A 4F7FA 3S0FA 2P71A 3FE9A 3S0EA 3D73A 3L4LA 3NGVA 1DQEA 2P70A 1OOHA 1OOIX 3BFAA 2QEOA 3DY9A 3D74A 3L47A 2WC6A 1T14A 2WC5A 4PT1A 2WCJA 1LS8A 3L4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHI A;  2QEB A;  3CYZ A;  3Q8I A;  2PQL A;  1XFR A;  3B87 A;  1OW4 A;  3FE6 A;  3S0B A;  3FE8 A;  3CZ2 A;  1ORG A;  3S0A A;  3R72 A;  5DIC A;  3K1E A;  3B7A A;  3QME A;  2ERB A;  3DZT A;  3VB1 A;  3S0G A;  1GM0 A;  2JPO A;  3R1O A;  2QEH A;  3BFH A;  4FQT A;  4INX A;  3DYE A;  1TWO A;  3BJH A;  3CDN A;  2GTE A;  3B88 A;  2QDI A;  2WCL A;  3CAB A;  3D78 A;  1QWV A;  3R1V A;  3D77 A;  1OOF A;  3N7H A;  3R1P A;  4OZD A;  2WCM A;  2H8V A;  3S0D A;  3RZS A;  1C3Z A;  1TUJ A;  2KPH A;  2QEV A;  3D75 A;  3B6X A;  3D76 A;  3B86 A;  3DXL A;  2WCK A;  1OOG A;  3OGN A;  2WCH A;  5EL2 A;  1C3Y A;  2L2C A;  3BFB A;  3CZ1 A;  3CZ0 A;  3PJI A;  3V2L A;  3NHT A;  2FJY A;  1P28 A;  4INW A;  4JD9 A;  4F7F A;  3S0F A;  2P71 A;  3FE9 A;  3S0E A;  3D73 A;  3L4L A;  3NGV A;  1DQE A;  2P70 A;  1OOH A;  1OOI X;  3BFA A;  2QEO A;  3DY9 A;  3D74 A;  3L47 A;  2WC6 A;  1T14 A;  2WC5 A;  4PT1 A;  2WCJ A;  1LS8 A;  3L4A A; 
#chains in the Genus database with same CATH topology
 4JPZ B;  1J7Q A;  2LE9 B;  3Q8I A;  5FI6 A;  4AQJ A;  3NSI A;  5AEQ A;  2LHL A;  1GQM A;  2JRF A;  4NDC A;  4NQG A;  5D7F A;  1B7T Z;  1DVI A;  1SR6 B;  1FPW A;  3FWC A;  3HX4 A;  1F4Q A;  3OB2 B;  1UP5 A;  1DJH A;  3NSL A;  3B7A A;  3LLE A;  2ERB A;  4I5L B;  1QX5 B;  5F6T A;  2B1U A;  2JXL A;  1Y1A A;  1ZAC A;  2LAP A;  1AJ4 A;  2LUC A;  1XFX O;  2K2A A;  3I5I C;  3BFH A;  3GK2 A;  4P2Y B;  2LUX A;  3KF9 A;  1QAT A;  4ICB A;  2EC6 C;  4A4B A;  1A2X A;  3DYE A;  4OVN F;  4CFQ A;  4AOM A;  2V53 A;  2ZKM X;  2K60 A;  4FQO A;  3PM8 A;  3AAJ A;  1SRA A;  5B8I B;  1QJT A;  3D78 A;  3BXK A;  1JUO A;  2H61 C;  2WND A;  1SSE B;  2NZ0 A;  1H4B A;  1U5I B;  2LVI A;  4YGD B;  1OOF A;  5HYD A;  1YVH A;  2ISD A;  2DOQ A;  3DVJ A;  2JZI A;  2M3W A;  1IQ5 A;  2ZFD A;  3MSE B;  2JXC A;  2E30 A;  4GAO A;  2ZN8 A;  1EH2 A;  1G8I A;  2H8V A;  2LMT A;  4YI9 A;  1C3Z A;  2FCE A;  5CSF A;  1SNL A;  2JT8 A;  1TUJ A;  3SJS A;  3BQ3 A;  2M1K B;  1CFC A;  2PYQ A;  2GV5 A;  3CR5 X;  1OOG A;  4N1G A;  4NDD A;  2JTZ A;  2F3Y A;  3CZT X;  3VRO A;  4D1E A;  2COL B;  4OKH A;  1TNP A;  2KFH A;  3KPX A;  1IG5 A;  1OMD A;  4CLN A;  3VRR A;  3VRQ A;  1KQM C;  1DJW A;  3DF0 B;  1CKK A;  1C3Y A;  3CGA A;  2L5X B;  1J7O A;  4MRY A;  5FI7 A;  1WRK A;  3OP0 A;  2HPS A;  3PJI A;  1MQ1 A;  1EJ3 A;  3HCM A;  3I5F B;  2WCB A;  1YUS A;  4M2O A;  4YGC B;  4IL1 A;  2EHB A;  2LCP A;  1SL9 A;  1LXF C;  4INW A;  2CNP A;  1YTZ C;  2WOR A;  5HLV A;  1CLM A;  1RRO A;  1S6C A;  2O60 A;  4F7F A;  1JBA A;  2VRG A;  2BCX A;  4FTG A;  2KLD A;  2P71 A;  3PN7 B;  3FE9 A;  1LA3 A;  3S0E A;  1OMV A;  1M31 A;  1J7R A;  1UUR A;  3A4U B;  2F2O A;  1DQE A;  2I94 A;  1B9A A;  4IJ7 A;  1MXL C;  4PE7 A;  1ZOT B;  2LV7 A;  1CDM A;  1TTX A;  5HL1 A;  1N65 A;  2P70 A;  4XJK A;  1CLB A;  3CR4 X;  2L50 A;  4ZCU A;  1Y0V H;  1J1E A;  2I7A A;  3WNX B;  1JF2 A;  1BMO A;  2ZND A;  2D8N A;  3O4Y A;  3WXA A;  3DY9 A;  2I18 A;  2JPT A;  3FS7 A;  1OOJ A;  1Z4H A;  2L4I A;  3L47 A;  2KAV A;  3IQQ A;  3KEV A;  4NDB A;  1DJG A;  2LLU A;  5FI2 A;  2WC5 A;  3OHM B;  3SG4 A;  1ZUZ A;  2K7B A;  3ZNI A;  4HRG A;  1FBV A;  2OTG B;  3I5G B;  3VGO A;  1M39 A;  2LVK A;  1DJI A;  2EC6 B;  1AK8 A;  5IBW A;  1F70 A;  2PQL A;  4MZK A;  4DRW A;  1ALW A;  1MUX A;  3D0Y B;  4ORA B;  1KK8 B;  4MBE A;  4MZJ A;  3DVM A;  1LVC D;  2JT0 A;  1JF0 A;  1XFV O;  2BL0 C;  1UWO A;  2JC2 A;  4Q04 A;  2PMY A;  3TZ1 A;  3VB1 A;  3DZT A;  1TOP A;  4WQ3 A;  1DMO A;  5I2Q A;  5GQQ C;  2BKH B;  2P6B B;  2H61 A;  2KQ6 A;  1OZO A;  3EKJ A;  5I94 A;  1KCY A;  2KFG A;  1DJY A;  5AAN A;  5KSZ A;  4DUQ A;  1IH0 A;  1PVA A;  2QEH A;  1MXE A;  3PM2 A;  4PDZ A;  3ZWH A;  3WHT B;  1SPY A;  1J55 A;  4I5K A;  1CLL A;  1BJF A;  3JVT C;  5KU1 A;  1TCF A;  3TUY B;  1V1F A;  1XK4 A;  2MA2 A;  2AAO A;  3B88 A;  1DT7 B;  2TN4 A;  2JNX A;  1G33 A;  1OMR A;  3NSK A;  2NCO A;  3R1V A;  2K0J A;  2WCE A;  4M2P A;  4MEW A;  3SG6 A;  4AQI A;  1NX0 A;  2KAX A;  3GK1 A;  3SIA A;  1RTP 1;  1ZMZ A;  3UNW A;  5I2O A;  1TNX A;  3PLF B;  3CTN A;  2WCM A;  1EG3 A;  1FF1 A;  4HRE E;  2K61 A;  1PSB A;  3RZS A;  1TNW A;  3TS5 C;  1CFP A;  3VRN A;  1L2O B;  1SL7 A;  1B8L A;  4USL A;  2KI4 C;  1MWN A;  1QTX A;  3JTD C;  4YBH B;  2FOT A;  1Y1X A;  2K7O A;  2KHN A;  1VRK A;  2QEV A;  4M2Q A;  4I5N B;  1X02 A;  1A75 A;  2WCK A;  3PFV A;  1DTL A;  3DVE A;  1AP4 A;  1IGV A;  2LHI A;  2WCH A;  2Y1M A;  1PK0 D;  2PAL A;  4KYN A;  3DD4 A;  1NIW A;  4PE4 A;  1W9Z A;  5HKZ A;  1ZFS A;  4GGN A;  1YRU B;  2JUL A;  1BOD A;  1JWD A;  1WRZ A;  2AUC A;  3O78 A;  1CM4 A;  1YX8 A;  2L2C A;  1TIZ A;  3BFB A;  3CZ1 A;  2KGB C;  3F45 A;  1CMG A;  2HET A;  2EGD A;  1IKU A;  2O5G A;  1A4P A;  1B8C A;  2PVB A;  4MZL A;  4PE0 A;  2GGZ A;  4YI8 A;  4C0J A;  4DCK A;  1S3P A;  3BUW B;  4MSP A;  1ODB A;  3SS5 A;  3V2L A;  1BU3 A;  1XO5 A;  4YRU A;  2FJY A;  1K8U A;  4BY5 A;  5KTY A;  2M97 A;  1XK4 C;  2CXJ A;  1SBJ A;  3NXA A;  1NWD A;  4GFT A;  4OR9 B;  3RM1 A;  3VRP A;  1PUL A;  1IJ5 A;  1KWO C;  2BE6 A;  1SY9 A;  4QJ3 B;  5CSI A;  3NSO A;  2BBN A;  2MHH A;  2Y4Q A;  1TCO B;  1EL4 A;  2IS9 A;  2NCP A;  3D73 A;  1XFZ O;  1J1D A;  3NGV A;  5DKR A;  2L51 A;  5ER5 A;  4PE1 A;  1FI5 A;  3LCP C;  5K89 A;  1FI6 A;  2KOT A;  3ICB A;  1CDN A;  4MLW A;  3QRX A;  2FCD A;  3IQO A;  3TDI A;  1JSA A;  1S6I A;  1YUU A;  1WDC C;  5ER4 X;  4E68 A;  2G2B A;  2OS8 C;  4P5O E;  4YGB B;  2KGR A;  3I5H C;  3D74 A;  2JOJ A;  2LP2 A;  2BL0 B;  2KBM A;  4QJ5 B;  4HSZ A;  2M7L A;  1UHI A;  2KLE A;  2M1U A;  1F4O A;  3OX6 A;  1OZS A;  1DF0 A;  2F3Z A;  4PT1 A;  5G08 A;  3SG2 A;  2CTN A;  5I2L A;  4DIR A;  4HRH A;  1YX7 A;  4YGE B;  4XJK B;  2K8M B;  3CYZ A;  1RWY A;  1SR6 C;  2L2E A;  1XFR A;  3OX5 A;  1DGU A;  3GOF A;  3E3R A;  3PAT A;  3B87 A;  3KO0 A;  2RGI A;  2LMU A;  2R2I A;  3DF0 A;  3FE8 A;  1CFF A;  2F8P A;  3CZ2 A;  1UHH A;  1ORG A;  2HF5 A;  4U8D A;  3S0A A;  3SS3 A;  3R72 A;  1CTR A;  1XFU O;  5DIC A;  2JQ6 A;  1SMG A;  2JTT A;  2ZNE A;  3EK8 A;  3QME A;  3O6B A;  3BUX B;  3S0G A;  1QV0 A;  2KQY A;  1GM0 A;  1D1O A;  2LP3 A;  1PRW A;  3CS1 A;  1TRF A;  4UPG A;  2LLT A;  3TDU A;  2KI4 B;  3SG5 A;  3BUN B;  4GPL B;  3JTD B;  1NP8 A;  3I5I B;  2L4H A;  5I8N A;  5HLO A;  1AJ5 A;  1E8A A;  2K2F A;  2GTE A;  3SG3 A;  1CNP A;  1UUS A;  2KYF A;  2WC8 A;  4TNC A;  2QDI A;  2LM5 A;  1F8H A;  2JWW A;  2L5Y A;  3AAK A;  2KBI A;  1Y1U A;  1UHN A;  1XA5 A;  3CAB A;  1YUR A;  3UO9 A;  3IF7 A;  3N7H A;  5HKY A;  1WRL A;  2KDH A;  4PHK A;  2M9G A;  5CSN A;  3M0W A;  4MN0 A;  4CFR A;  1IIO A;  2KI6 D;  5BPJ A;  2M8U A;  3C1V A;  3EK7 A;  1R6P A;  2KPH A;  2Q91 A;  1GJY A;  2BKI B;  2MLE C;  3B6X A;  3EK4 A;  3D76 A;  1BF5 A;  3B86 A;  4WQ2 A;  5CPV A;  3BYA A;  3OGN A;  2SAS A;  2BNX A;  1QAS A;  1NCX A;  3AKA A;  1PSR A;  4XYN A;  2LVV A;  1YUT A;  4GGF C;  2FJU B;  1PAL A;  5EL2 A;  3WHU B;  3AKB A;  2ZN9 A;  2F2P A;  4A4C A;  3OBV A;  2M7N A;  3I5F C;  1J7P A;  2CT9 A;  3H4S E;  1KQM B;  3BOW A;  5FYX A;  1V1G A;  1OQP A;  2JNF A;  1QX2 A;  1B8R A;  1KFU S;  1SW8 A;  1BOC A;  3NHT A;  2LC5 A;  1P28 A;  1QLK A;  5TNC A;  1QV1 A;  2MJW B;  1A75 B;  4JWQ A;  2E6W A;  3S0F A;  3OB1 B;  1K90 D;  3RLZ A;  1S1E A;  4WRI A;  1KQV A;  1CM1 A;  3K21 A;  5JJG A;  1TNQ A;  1S26 D;  4GUK A;  1KFX S;  1GGZ A;  3EG5 B;  4C0L A;  3LK1 A;  2LVJ A;  2KAY A;  2MAZ A;  3D10 A;  1K93 D;  1HT9 A;  1OOH A;  1TN4 A;  1NUB A;  1OOI X;  2QPT A;  3EKH A;  3LK0 A;  2I2R E;  4ORB B;  4C0K A;  5HKW A;  2NLN A;  1CDP A;  4OV2 A;  5D3O A;  1IQ3 A;  1MF8 B;  3EVV A;  2NXQ A;  3TDZ A;  1QVI Y;  4OCI A;  2BEC A;  2AMI A;  2WC6 A;  2MRD A;  1A29 A;  3CLN A;  4ORC B;  2BCB A;  2K7D A;  4PHN A;  2OTG C;  5AXI A;  1M45 A;  1K9K A;  1Y6W A;  2BCA A;  2M29 A;  3I5G C;  1KK7 Z;  1YRT B;  4BY4 A;  1TUZ A;  1MHO A;  2WCF A;  2GGM A;  2BAP A;  1XVJ A;  2KYC A;  1DEL A;  5CSJ A;  1GGW A;  3NHI A;  2QEB A;  2Y5I A;  1BR1 B;  2A4J A;  2CBL A;  1KK8 C;  2KNE A;  1R2U A;  2LAN A;  2ZRT A;  4R1E A;  1REC A;  1OW4 A;  3CR2 A;  3FE6 A;  5DKQ A;  3S0B A;  1DJZ A;  4ZCV A;  2Q4U A;  1NX3 A;  1RK9 A;  4MVF A;  1K95 A;  1S6J A;  4CID A;  1NYA A;  3K1E A;  1U5I A;  1S5G Y;  1K9P A;  1SCM C;  1N2D A;  3SIB A;  1DF0 B;  1NCZ A;  3PAL A;  1EG4 A;  1QX7 A;  1S36 A;  2MBX A;  3SS4 A;  2ZRS A;  2F33 A;  2JPO A;  3LL8 B;  3R1O A;  4GNK B;  1BR4 B;  1SCV A;  1ALV A;  1W7J B;  1NX1 A;  2K7C A;  3TUY C;  1QVI Z;  4FQT A;  4N5X A;  1IJ6 A;  4INX A;  1XYD A;  1OE9 B;  1SYM A;  1TWO A;  2JU0 A;  1K96 A;  4N1F A;  2KI6 C;  3BJH A;  1WLZ A;  3CDN A;  2KSP A;  2SCP A;  2H2K A;  1B47 A;  3JVT B;  1W7I B;  1C7W A;  2LLS A;  3EVU A;  1KSO A;  2WCL A;  1UHK A;  4DS7 A;  1QWV A;  2BE4 A;  3IVT A;  5D69 A;  3D77 A;  4L9M A;  1LKJ A;  2YGU A;  4MRX A;  1QLS A;  4GGF A;  2JT3 A;  1L2O C;  3R1P A;  4OZD A;  2HQ8 A;  4ETO A;  4PCW A;  3A8R A;  3S0D A;  3EVR A;  2L0P A;  1S5G Z;  1NPQ A;  3BUO B;  1AHR A;  3D75 A;  2M49 B;  2MLF C;  3PSR A;  2PRU A;  2WOS A;  4PHJ A;  3TS5 B;  1DC1 A;  1A03 A;  1RFJ A;  3DXL A;  1L7Z A;  1QS7 A;  3FWB A;  1CB1 A;  2M0R A;  4JKT A;  1B1G A;  1Z2C B;  1F71 A;  1QXP A;  1DGV A;  2LNK A;  1JFJ A;  1K94 A;  1FW4 A;  1M46 A;  2PAS A;  3BUM B;  1AUI B;  5JOL A;  4CPV A;  2CCM A;  1IWQ A;  1SL8 A;  5AFP A;  1MR8 A;  3CZ0 A;  4PAL A;  1K9U A;  1LA0 A;  1QIV A;  1PVB A;  4YGA A;  1UHJ A;  1DEK A;  1G4Y R;  3FIA A;  2HQW A;  1CMF A;  1BLQ A;  1JFK A;  2G9B A;  2L98 A;  2PSR A;  3GK4 X;  1DJX A;  1HQV A;  2Y1N A;  1KFU L;  4JD9 A;  1F55 A;  3O2P A;  1H8B A;  1C7V A;  4F0Z B;  5DKN A;  3KHE A;  1K2H A;  1LIN A;  1B7T Y;  1AVS A;  1KWO B;  3L4L A;  3O4X A;  1M63 B;  4I5J A;  1F54 A;  1IRJ A;  1NCY A;  1JC2 A;  1NSH A;  1Q80 A;  1YVL A;  2LMV A;  2BBM A;  1SK6 D;  1BG1 A;  1QIW A;  4QJ4 B;  3BOW B;  3DVK A;  1WLM A;  1C07 A;  4GBA A;  4PHM A;  1KFX L;  1XFW O;  1BT6 A;  3BFA A;  1XFY O;  3D0Y A;  2QAC A;  2QEO A;  1N0Y A;  2OPO A;  1WDC B;  1NX2 A;  3SG7 A;  2OS8 B;  2KFF A;  1CDL A;  1KK7 Y;  1SCM B;  1WY9 A;  3I5H B;  3CWG A;  5PAL A;  3PN7 C;  4JQ0 D;  1B4C A;  1T14 A;  1KSM A;  2WCJ A;  5J3X A;  1LS8 A;  1CFD A;  1YR5 A;  5AER A;  1SKT A;  1RJV A;  3L4A A;  1OSA A;  1EXR A; 
#chains in the Genus database with same CATH homology
 3NHI A;  2QEB A;  3CYZ A;  3Q8I A;  2PQL A;  1XFR A;  3B87 A;  1OW4 A;  3FE6 A;  3S0B A;  3FE8 A;  3CZ2 A;  1ORG A;  3S0A A;  3R72 A;  5DIC A;  3K1E A;  3B7A A;  3QME A;  2ERB A;  3DZT A;  3VB1 A;  3S0G A;  1GM0 A;  2JPO A;  3R1O A;  2QEH A;  3BFH A;  4FQT A;  4INX A;  3DYE A;  1TWO A;  3BJH A;  3CDN A;  2GTE A;  3B88 A;  2QDI A;  2WCL A;  3CAB A;  3D78 A;  1QWV A;  3R1V A;  3D77 A;  1OOF A;  3N7H A;  3R1P A;  4OZD A;  2WCM A;  2H8V A;  3S0D A;  3RZS A;  1C3Z A;  1TUJ A;  2KPH A;  2QEV A;  3D75 A;  3B6X A;  3D76 A;  3B86 A;  3DXL A;  2WCK A;  1OOG A;  3OGN A;  2WCH A;  5EL2 A;  1C3Y A;  2L2C A;  3BFB A;  3CZ1 A;  3CZ0 A;  3PJI A;  3V2L A;  3NHT A;  2FJY A;  1P28 A;  4INW A;  4JD9 A;  4F7F A;  3S0F A;  2P71 A;  3FE9 A;  3S0E A;  3D73 A;  3L4L A;  3NGV A;  1DQE A;  2P70 A;  1OOH A;  1OOI X;  3BFA A;  2QEO A;  3DY9 A;  3D74 A;  3L47 A;  2WC6 A;  1T14 A;  2WC5 A;  4PT1 A;  2WCJ A;  1LS8 A;  3L4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...