3N7HA

Crystal structure of odorant binding protein 1 from anopheles gambiae (agamobp1) with deet (n,n-diethyl-meta-toluamide) and peg
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein
publication title Anopheles gambiae odorant binding protein crystal complex with the synthetic repellent DEET: implications for structure-based design of novel mosquito repellents.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 44
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3n7hA01
3FE8A 3DYEA 3S0DA 2H8VA 3B7AA 2QDIA 1C3YA 1TWOA 3CZ1A 2WCKA 2P71A 2WCMA 3S0BA 3VB1A 3NHTA 3Q8IA 3L47A 4JD9A 2PQLA 3D75A 2WCLA 3B88A 3PJIA 3CZ0A 2FJYA 5EL2A 3OGNA 3BFHA 1T14A 3D74A 3V2LA 3D73A 1ORGA 3BFBA 1LS8A 3N7HA 3NHIA 5DICA 2WCJA 1TUJA 1OW4A 3CYZA 2QEVA 3R72A 2WC6A 3B6XA 3S0AA 3D76A 3S0FA 3K1EA 2P70A 1OOIX 3CABA 2QEBA 1QWVA 2L2CA 1OOFA 2GTEA 1XFRA 4INWA 2KPHA 2QEOA 2WCHA 3S0EA 2JPOA 3B87A 4F7FA 3R1PA 3CDNA 3DXLA 3S0GA 3FE9A 3D77A 4OZDA 3B86A 1OOHA 3NGVA 2QEHA 3L4AA 3DZTA 3RZSA 3BJHA 1C3ZA 3BFAA 4FQTA 3D78A 1GM0A 3R1OA 3L4LA 3R1VA 4PT1A 3QMEA 2ERBA 1P28A 2WC5A 1DQEA 1OOGA 3CZ2A 4INXA 3FE6A 3DY9A
chains in the Genus database with same CATH superfamily
5I2LA 1NWDA 2LAPA 1CLMA 1V1FA 4GFTA 3DYEA 5CSIA 2JT8A 3TS5C 1C07A 1HT9A 1Y0VH 1XVJA 4WRIA 2LCPA 1JUOA 2HETA 3CZTX 3HCMA 3I5GC 1CDLA 2BE4A 2FOTA 3SS4A 1KK8B 2M29A 4I5NB 3TS5B 1TWOA 3CZ1A 3EK8A 2H61C 3VROA 2A4JA 1QS7A 3BUXB 4AQJA 2EC6C 2HF5A 3VB1A 1EG4A 2COLB 1DF0A 1KWOB 1ZOTB 3BUMB 1S6IA 5ER4X 2MHHA 2RGIA 4L9MA 3Q8IA 4E68A 5PALA 2DOQA 1B8CA 1K93D 3PLFB 4P5OE 3FWBA 2I2RE 3PFVA 3FIAA 5I8NA 1FBVA 3DF0B 3B88A 1RWYA 5HLVA 1QASA 2TN4A 2FJYA 3PM8A 1YRUB 1CM4A 3OGNA 5D7FA 4NDBA 3SG2A 4ETOA 3BFHA 3NSOA 3TDZA 2ZRSA 1AJ5A 1NP8A 3V2LA 2ZNEA 3D73A 4NQGA 2CXJA 4IL1A 1YTZC 1SL9A 4C0KA 2CNPA 1LS8A 3CR4X 4M2QA 1B8RA 1MXEA 5DICA 2FJUB 1B7TZ 1CB1A 3JVTB 1H4BA 2LMTA 2E6WA 4D1EA 2KI4B 1JFKA 3MSEB 3WXAA 2K60A 4UPGA 2LMVA 1DC1A 3CGAA 1F8HA 4YI8A 2BECA 5G08A 1QTXA 1KFUL 1K9KA 1YR5A 1JC2A 1XK4C 3CABA 2WCEA 2KQYA 3AKBA 1IIOA 1XFZO 1OOFA 3CS1A 3BUWB 4M2OA 3VRNA 2LNKA 1LA3A 4INWA 2R2IA 1S6JA 1TNXA 4MZJA 1QX7A 1CLLA 1YVHA 1YRTB 1A03A 2WCHA 1MQ1A 2PASA 3IVTA 1S5GZ 3EK4A 4M2PA 1J1DA 2H2KA 4YI9A 1F70A 2LANA 1M63B 1KFXL 5I2OA 1CMGA 3I5IB 2F2PA 3CTNA 4YGEB 3BXKA 5J3XA 5FYXA 1BG1A 1K96A 1TRFA 2NLNA 1XFYO 1JBAA 2L98A 1IG5A 1N65A 1BF5A 2O5GA 4ICBA 3NGVA 3L4AA 2JT3A 3DZTA 5FI7A 4XJKA 2M97A 2PSRA 1DJIA 5AERA 3VRRA 1KSOA 3KO0A 3D78A 3EVUA 4FQTA 2M7LA 3SG5A 2WCBA 1QVIY 2PVBA 3BOWA 3DVJA 5AXIA 3L4LA 4PT1A 1SKTA 1RROA 4TNCA 1DF0B 2IS9A 1IJ6A 1GGZA 3FE6A 1SSEB 1WDCB 2NCOA 4PHJA 5DKQA 1TN4A 1H8BA 3CZ2A 1NUBA 4I5KA 2V53A 3VGOA 1YUUA 1QXPA 1K2HA 1NX3A 1TOPA 2E30A 4JWQA 3TDIA 2KLDA 1BMOA 2EHBA 2Y4QA 1YX8A 1IH0A 1IWQA 4OVNF 3S0DA 4WQ2A 3OB2B 2L2EA 3B7AA 2QDIA 2L4IA 1C3YA 1F71A 3CR5X 1LKJA 1YVLA 1XFWO 1YUTA 2LVIA 3QRXA 3SIBA 1TNPA 2WCKA 1MF8B 2CBLA 2P71A 3OB1B 4FTGA 1CDNA 2KFHA 3GK4X 1UWOA 5AFPA 1NX1A 2YGUA 1F55A 4A4BA 2Y1MA 1EH2A 1SRAA 2BKIB 3DVKA 1EJ3A 1OMVA 1SL7A 1XFUO 3L47A 1NPQA 1B8LA 2JOJA 1AUIB 2LP3A 4DIRA 4ZCVA 1RECA 2K0JA 1KK8C 1B4CA 4I5JA 2KLEA 1SR6B 2AAOA 3PJIA 1DTLA 1YUSA 5AANA 1CFFA 2Y1NA 5DKNA 2MJWB 1A75B 1LVCD 3I5HB 1E8AA 3FS7A 1LINA 4CIDA 1CTRA 1QIVA 1UP5A 2LC5A 1XK4A 1T14A 3ICBA 3VRQA 1QATA 1FF1A 1K90D 4MBEA 1KWOC 1ORGA 1F54A 1EL4A 1WRZA 1Y1XA 3AAJA 4AOMA 5I94A 1LA0A 1PSBA 2KAVA 2M9GA 3NHIA 2KSPA 4JKTA 4MRYA 2LMUA 1IQ5A 1OW4A 4YBHB 3CYZA 2L0PA 1IGVA 2QEVA 1XA5A 2M7NA 3R72A 3LK0A 1IQ3A 1K95A 1DGVA 1QJTA 3S0AA 4GUKA 1S3PA 4XJKB 2LUXA 1J1EA 2OTGB 3TUYB 1M31A 1UHHA 1JF2A 3K1EA 4P2YB 2P70A 4KYNA 5ER5A 4JPZB 2BE6A 2I94A 2QEBA 1U5IA 3BOWB 4GNKB 1MXLC 5JOLA 1XFRA 3C1VA 3I5FC 1ZFSA 1IJ5A 3OX6A 2QEOA 4ORBB 1ODBA 3JVTC 3I5FB 1B47A 5DKRA 1JSAA 2KI4C 1BOCA 1YURA 1TIZA 4OR9B 3SJSA 4F7FA 5D3OA 3DXLA 2KHNA 3WHTB 2KI6C 2L4HA 3O6BA 3UO9A 2NXQA 1SY9A 1F4QA 2KGRA 3A4UB 3O78A 3PATA 2JULA 2LV7A 3SG6A 3NXAA 4USLA 2LM5A 4OZDA 2QEHA 1S36A 1GQMA 2JPTA 2BBNA 1G8IA 1MUXA 1J7RA 1J55A 3BJHA 5HLOA 2ISDA 4CFRA 1C3ZA 1FI6A 2ZKMX 1DJWA 2PALA 1F4OA 1UURA 2KFFA 2KNEA 1ZACA 1WLZA 3NSLA 3OBVA 2M3WA 3R1OA 4ORAB 1W9ZA 2M1UA 1SNLA 2ERBA 3SG7A 3PN7C 1M39A 4C0LA 3I5IC 5JJGA 1S1EA 2SCPA 5I2QA 2K7DA 3PN7B 4I5LB 1W7IB 4YGBB 4GGFC 1CLBA 2I18A 3DY9A 1OZOA 1QLKA 2LP2A 5HKWA 1MR8A 1AP4A 1CKKA 1OE9B 3NSIA 1KK7Z 2H8VA 1DT7B 1QX5B 3KPXA 3SG4A 3DVEA 1DJXA 4C0JA 1PVAA 2L5YA 3O2PA 1SCMB 4HREE 1WY9A 1Y6WA 2ZNDA 1RFJA 1W7JB 3AKAA 4DRWA 4PHMA 4Q04A 2JTTA 1WDCC 2JXLA 1GGWA 2K61A 2WC8A 2K2FA 3KEVA 1SL8A 2LHIA 4NDDA 2H61A 3NHTA 1L2OB 4PHKA 3TDUA 5F6TA 1NX0A 4WQ3A 1EG3A 1NYAA 1UHJA 2BKHB 3IQQA 4MZLA 1HQVA 3LL8B 2BAPA 4JD9A 4BY5A 1MHOA 1X02A 2B1UA 2BCBA 2KOTA 2PQLA 1G4YR 2BCAA 2CT9A 2M0RA 2ZFDA 2O60A 5CPVA 2JT0A 3DF0A 1U5IB 2Q91A 2K2AA 1K9PA 3CZ0A 2KFGA 5EL2A 4PDZA 1BODA 1SCVA 5K89A 2K7OA 1ALWA 4N5XA 4F0ZB 1ZUZA 1N0YA 2M49B 4PALA 1C7WA 1IRJA 2D8NA 1J7OA 2OS8B 3M0WA 1Q80A 3GOFA 3CR2A 1S26D 1XFVO 4N1GA 2WCJA 1TUJA 1L7ZA 4GPLB 5CSJA 1CDPA 3H4SE 4HRHA 5AEQA 1QLSA 1SR6C 2BBMA 1K94A 2K7CA 2WC6A 1JWDA 1UUSA 3B6XA 2LUCA 1BT6A 3BYAA 4OCIA 1QX2A 3I5HC 2JWWA 3EK7A 3WHUB 2FCEA 2K7BA 4MN0A 3PSRA 1OOIX 1TCOB 2F33A 5FI2A 4YGAA 3RM1A 5KSZA 2KGBC 1AHRA 1SK6D 2PYQA 5GQQC 1M46A 1OQPA 2GTEA 1XFXO 5TNCA 1AK8A 1BU3A 3O4XA 2F8PA 1QV0A 2KPHA 4OV2A 1SPYA 4BY4A 1J7QA 4MRXA 1A2XA 3D10A 4MEWA 3S0EA 3OP0A 4DUQA 4QJ5B 3PM2A 4YGDB 2WORA 3EVVA 1CNPA 1PRWA 3FE9A 2EGDA 1CFDA 2L51A 3RLZA 1KQMC 2KYFA 2OTGC 2JC2A 1TNQA 2LLUA 2VRGA 3TUYC 5BPJA 4GGFA 3A8RA 1QIWA 2ZRTA 3HX4A 4YRUA 1KQMB 2WNDA 4OKHA 1DJYA 1PVBA 5HKYA 2KBIA 3I5GB 3CWGA 1UHIA 4JQ0D 1SYMA 4PE1A 1PSRA 1BJFA 1Y1UA 1M45A 2PRUA 1NCXA 3R1VA 1DVIA 3QMEA 1Z2CB 1OMRA 1FPWA 2F3ZA 1RTP1 4R1EA 4ZCUA 2LVJA 2Y5IA 2EC6B 1WLMA 4INXA 2HPSA 5KTYA 4PE7A 2KAYA 2LVVA 2MLEC 4PCWA 2KDHA 2NCPA 3FE8A 2AMIA 4MZKA 2LLSA 2MAZA 1BR1B 1IKUA 2JNXA 4PE0A 2G2BA 1A4PA 1B7TY 2MA2A 2BNXA 4MSPA 3EKHA 2MBXA 3WNXB 1OOJA 3D0YA 2JU0A 3KF9A 4QJ4B 5IBWA 1KSMA 1BLQA 1S6CA 3EKJA 1MWNA 2WCMA 3DVMA 4XYNA 2F3YA 3LCPC 3ZNIA 1NX2A 2Q4UA 3JTDC 4CPVA 1LXFC 1JFJA 2SASA 2L50A 3S0BA 1VRKA 4CFQA 2KQ6A 3IF7A 3JTDB 2KBMA 1DJZA 1EXRA 4DCKA 2BCXA 2JRFA 1KCYA 2ZN8A 1B1GA 4CLNA 1TNWA 2JTZA 1TUZA 4N1FA 1CFPA 1S5GY 4HSZA 3UNWA 3D75A 3OHMB 2MLFC 1SMGA 4NDCA 4MVFA 3EG5B 5B8IB 2KAXA 5KU1A 2WCLA 3AAKA 3LK1A 4U8DA 1K9UA 2FCDA 1SCMC 2GGZA 2BL0C 1TCFA 2WOSA 1SBJA 3CLNA 2JZIA 2MRDA 1DEKA 3IQOA 1AJ4A 1KK7Y 1A75A 1KFUS 2LLTA 2BL0B 1CFCA 2NZ0A 3KHEA 1V1GA 2QACA 1B9AA 2HQ8A 3D74A 1CM1A 1JF0A 1L2OC 4AQIA 3BFBA 1J7PA 1N2DA 3EVRA 5CSNA 3BUOB 3F45A 1NCYA 2KYCA 4ORCB 3ZWHA 2OPOA 1FI5A 3N7HA 2G9BA 1ALVA 1GJYA 1UHNA 1CDMA 2JXCA 1KFXS 4QJ3B 1NCZA 4DS7A 2ZN9A 2I7AA 4PHNA 5HKZA 4GAOA 3BUNB 1XYDA 3PALA 2KI6D 3BQ3A 2K8MB 3D76A 3S0FA 1QVIZ 1KQVA 2GV5A 2HQWA 1QWVA 3SG3A 2L2CA 3E3RA 1DELA 4GBAA 4YGCB 5D69A 2OS8C 4A4CA 3SS5A 1ZMZA 2PMYA 2QPTA 2LE9B 3FWCA 5CSFA 1A29A 1Z4HA 2JQ6A 1AVSA 1PK0D 2JPOA 1XO5A 3SS3A 1BR4B 1UHKA 2LHLA 3B87A 3GK1A 1DJGA 1K8UA 1NSHA 1R6PA 2L5XB 3CDNA 3R1PA 2M1KB 4PE4A 3S0GA 1CMFA 1WRKA 1R2UA 3LLEA 1PULA 3OX5A 2CCMA 1QV1A 3D77A 1SW8A 2LVKA 3K21A 5HL1A 3B86A 1OOHA 2CTNA 3D0YB 1OMDA 1YX7A 3O4YA 3RZSA 1C7VA 1G33A 2M8UA 2GGMA 2AUCA 4IJ7A 5FI6A 4MLWA 1DMOA 3BFAA 1TTXA 1GM0A 4HRGA 2WCFA 1RJVA 3DD4A 1RK9A 3SIAA 1FW4A 1OSAA 2JNFA 5HYDA 3TZ1A 3VRPA 1Y1AA 1P28A 1WRLA 4FQOA 3GK2A 4GGNA 1D1OA 2WC5A 1DGUA 1DQEA 1DJHA 1OZSA 1OOGA 2F2OA 2P6BB 1PALA 1NIWA 3NSKA
chains in the Genus database with same CATH topology
3FE8A 3DYEA 3S0DA 2H8VA 3B7AA 2QDIA 1C3YA 1TWOA 3CZ1A 2WCKA 2P71A 2WCMA 3S0BA 3VB1A 3NHTA 3Q8IA 3L47A 4JD9A 2PQLA 3D75A 2WCLA 3B88A 3PJIA 3CZ0A 2FJYA 5EL2A 3OGNA 3BFHA 1T14A 3D74A 3V2LA 3D73A 1ORGA 3BFBA 1LS8A 3N7HA 3NHIA 5DICA 2WCJA 1TUJA 1OW4A 3CYZA 2QEVA 3R72A 2WC6A 3B6XA 3S0AA 3D76A 3S0FA 3K1EA 2P70A 1OOIX 3CABA 2QEBA 1QWVA 2L2CA 1OOFA 2GTEA 1XFRA 4INWA 2KPHA 2QEOA 2WCHA 3S0EA 2JPOA 3B87A 4F7FA 3R1PA 3CDNA 3DXLA 3S0GA 3FE9A 3D77A 4OZDA 3B86A 1OOHA 3NGVA 2QEHA 3L4AA 3DZTA 3RZSA 3BJHA 1C3ZA 3BFAA 4FQTA 3D78A 1GM0A 3R1OA 3L4LA 3R1VA 4PT1A 3QMEA 2ERBA 1P28A 2WC5A 1DQEA 1OOGA 3CZ2A 4INXA 3FE6A 3DY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE8 A;  3DYE A;  3S0D A;  2H8V A;  3B7A A;  2QDI A;  1C3Y A;  1TWO A;  3CZ1 A;  2WCK A;  2P71 A;  2WCM A;  3S0B A;  3VB1 A;  3NHT A;  3Q8I A;  3L47 A;  4JD9 A;  2PQL A;  3D75 A;  2WCL A;  3B88 A;  3PJI A;  3CZ0 A;  2FJY A;  5EL2 A;  3OGN A;  3BFH A;  1T14 A;  3D74 A;  3V2L A;  3D73 A;  1ORG A;  3BFB A;  1LS8 A;  3N7H A;  3NHI A;  5DIC A;  2WCJ A;  1TUJ A;  1OW4 A;  3CYZ A;  2QEV A;  3R72 A;  2WC6 A;  3B6X A;  3S0A A;  3D76 A;  3S0F A;  3K1E A;  2P70 A;  1OOI X;  3CAB A;  2QEB A;  1QWV A;  2L2C A;  1OOF A;  2GTE A;  1XFR A;  4INW A;  2KPH A;  2QEO A;  2WCH A;  3S0E A;  2JPO A;  3B87 A;  4F7F A;  3R1P A;  3CDN A;  3DXL A;  3S0G A;  3FE9 A;  3D77 A;  4OZD A;  3B86 A;  1OOH A;  3NGV A;  2QEH A;  3L4A A;  3DZT A;  3RZS A;  3BJH A;  1C3Z A;  3BFA A;  4FQT A;  3D78 A;  1GM0 A;  3R1O A;  3L4L A;  3R1V A;  4PT1 A;  3QME A;  2ERB A;  1P28 A;  2WC5 A;  1DQE A;  1OOG A;  3CZ2 A;  4INX A;  3FE6 A;  3DY9 A; 
#chains in the Genus database with same CATH topology
 5I2L A;  1NWD A;  2LAP A;  1CLM A;  1V1F A;  4GFT A;  3DYE A;  5CSI A;  2JT8 A;  3TS5 C;  1C07 A;  1HT9 A;  1Y0V H;  1XVJ A;  4WRI A;  2LCP A;  1JUO A;  2HET A;  3CZT X;  3HCM A;  3I5G C;  1CDL A;  2BE4 A;  2FOT A;  3SS4 A;  1KK8 B;  2M29 A;  4I5N B;  3TS5 B;  1TWO A;  3CZ1 A;  3EK8 A;  2H61 C;  3VRO A;  2A4J A;  1QS7 A;  3BUX B;  4AQJ A;  2EC6 C;  2HF5 A;  3VB1 A;  1EG4 A;  2COL B;  1DF0 A;  1KWO B;  1ZOT B;  3BUM B;  1S6I A;  5ER4 X;  2MHH A;  2RGI A;  4L9M A;  3Q8I A;  4E68 A;  5PAL A;  2DOQ A;  1B8C A;  1K93 D;  3PLF B;  4P5O E;  3FWB A;  2I2R E;  3PFV A;  3FIA A;  5I8N A;  1FBV A;  3DF0 B;  3B88 A;  1RWY A;  5HLV A;  1QAS A;  2TN4 A;  2FJY A;  3PM8 A;  1YRU B;  1CM4 A;  3OGN A;  5D7F A;  4NDB A;  3SG2 A;  4ETO A;  3BFH A;  3NSO A;  3TDZ A;  2ZRS A;  1AJ5 A;  1NP8 A;  3V2L A;  2ZNE A;  3D73 A;  4NQG A;  2CXJ A;  4IL1 A;  1YTZ C;  1SL9 A;  4C0K A;  2CNP A;  1LS8 A;  3CR4 X;  4M2Q A;  1B8R A;  1MXE A;  5DIC A;  2FJU B;  1B7T Z;  1CB1 A;  3JVT B;  1H4B A;  2LMT A;  2E6W A;  4D1E A;  2KI4 B;  1JFK A;  3MSE B;  3WXA A;  2K60 A;  4UPG A;  2LMV A;  1DC1 A;  3CGA A;  1F8H A;  4YI8 A;  2BEC A;  5G08 A;  1QTX A;  1KFU L;  1K9K A;  1YR5 A;  1JC2 A;  1XK4 C;  3CAB A;  2WCE A;  2KQY A;  3AKB A;  1IIO A;  1XFZ O;  1OOF A;  3CS1 A;  3BUW B;  4M2O A;  3VRN A;  2LNK A;  1LA3 A;  4INW A;  2R2I A;  1S6J A;  1TNX A;  4MZJ A;  1QX7 A;  1CLL A;  1YVH A;  1YRT B;  1A03 A;  2WCH A;  1MQ1 A;  2PAS A;  3IVT A;  1S5G Z;  3EK4 A;  4M2P A;  1J1D A;  2H2K A;  4YI9 A;  1F70 A;  2LAN A;  1M63 B;  1KFX L;  5I2O A;  1CMG A;  3I5I B;  2F2P A;  3CTN A;  4YGE B;  3BXK A;  5J3X A;  5FYX A;  1BG1 A;  1K96 A;  1TRF A;  2NLN A;  1XFY O;  1JBA A;  2L98 A;  1IG5 A;  1N65 A;  1BF5 A;  2O5G A;  4ICB A;  3NGV A;  3L4A A;  2JT3 A;  3DZT A;  5FI7 A;  4XJK A;  2M97 A;  2PSR A;  1DJI A;  5AER A;  3VRR A;  1KSO A;  3KO0 A;  3D78 A;  3EVU A;  4FQT A;  2M7L A;  3SG5 A;  2WCB A;  1QVI Y;  2PVB A;  3BOW A;  3DVJ A;  5AXI A;  3L4L A;  4PT1 A;  1SKT A;  1RRO A;  4TNC A;  1DF0 B;  2IS9 A;  1IJ6 A;  1GGZ A;  3FE6 A;  1SSE B;  1WDC B;  2NCO A;  4PHJ A;  5DKQ A;  1TN4 A;  1H8B A;  3CZ2 A;  1NUB A;  4I5K A;  2V53 A;  3VGO A;  1YUU A;  1QXP A;  1K2H A;  1NX3 A;  1TOP A;  2E30 A;  4JWQ A;  3TDI A;  2KLD A;  1BMO A;  2EHB A;  2Y4Q A;  1YX8 A;  1IH0 A;  1IWQ A;  4OVN F;  3S0D A;  4WQ2 A;  3OB2 B;  2L2E A;  3B7A A;  2QDI A;  2L4I A;  1C3Y A;  1F71 A;  3CR5 X;  1LKJ A;  1YVL A;  1XFW O;  1YUT A;  2LVI A;  3QRX A;  3SIB A;  1TNP A;  2WCK A;  1MF8 B;  2CBL A;  2P71 A;  3OB1 B;  4FTG A;  1CDN A;  2KFH A;  3GK4 X;  1UWO A;  5AFP A;  1NX1 A;  2YGU A;  1F55 A;  4A4B A;  2Y1M A;  1EH2 A;  1SRA A;  2BKI B;  3DVK A;  1EJ3 A;  1OMV A;  1SL7 A;  1XFU O;  3L47 A;  1NPQ A;  1B8L A;  2JOJ A;  1AUI B;  2LP3 A;  4DIR A;  4ZCV A;  1REC A;  2K0J A;  1KK8 C;  1B4C A;  4I5J A;  2KLE A;  1SR6 B;  2AAO A;  3PJI A;  1DTL A;  1YUS A;  5AAN A;  1CFF A;  2Y1N A;  5DKN A;  2MJW B;  1A75 B;  1LVC D;  3I5H B;  1E8A A;  3FS7 A;  1LIN A;  4CID A;  1CTR A;  1QIV A;  1UP5 A;  2LC5 A;  1XK4 A;  1T14 A;  3ICB A;  3VRQ A;  1QAT A;  1FF1 A;  1K90 D;  4MBE A;  1KWO C;  1ORG A;  1F54 A;  1EL4 A;  1WRZ A;  1Y1X A;  3AAJ A;  4AOM A;  5I94 A;  1LA0 A;  1PSB A;  2KAV A;  2M9G A;  3NHI A;  2KSP A;  4JKT A;  4MRY A;  2LMU A;  1IQ5 A;  1OW4 A;  4YBH B;  3CYZ A;  2L0P A;  1IGV A;  2QEV A;  1XA5 A;  2M7N A;  3R72 A;  3LK0 A;  1IQ3 A;  1K95 A;  1DGV A;  1QJT A;  3S0A A;  4GUK A;  1S3P A;  4XJK B;  2LUX A;  1J1E A;  2OTG B;  3TUY B;  1M31 A;  1UHH A;  1JF2 A;  3K1E A;  4P2Y B;  2P70 A;  4KYN A;  5ER5 A;  4JPZ B;  2BE6 A;  2I94 A;  2QEB A;  1U5I A;  3BOW B;  4GNK B;  1MXL C;  5JOL A;  1XFR A;  3C1V A;  3I5F C;  1ZFS A;  1IJ5 A;  3OX6 A;  2QEO A;  4ORB B;  1ODB A;  3JVT C;  3I5F B;  1B47 A;  5DKR A;  1JSA A;  2KI4 C;  1BOC A;  1YUR A;  1TIZ A;  4OR9 B;  3SJS A;  4F7F A;  5D3O A;  3DXL A;  2KHN A;  3WHT B;  2KI6 C;  2L4H A;  3O6B A;  3UO9 A;  2NXQ A;  1SY9 A;  1F4Q A;  2KGR A;  3A4U B;  3O78 A;  3PAT A;  2JUL A;  2LV7 A;  3SG6 A;  3NXA A;  4USL A;  2LM5 A;  4OZD A;  2QEH A;  1S36 A;  1GQM A;  2JPT A;  2BBN A;  1G8I A;  1MUX A;  1J7R A;  1J55 A;  3BJH A;  5HLO A;  2ISD A;  4CFR A;  1C3Z A;  1FI6 A;  2ZKM X;  1DJW A;  2PAL A;  1F4O A;  1UUR A;  2KFF A;  2KNE A;  1ZAC A;  1WLZ A;  3NSL A;  3OBV A;  2M3W A;  3R1O A;  4ORA B;  1W9Z A;  2M1U A;  1SNL A;  2ERB A;  3SG7 A;  3PN7 C;  1M39 A;  4C0L A;  3I5I C;  5JJG A;  1S1E A;  2SCP A;  5I2Q A;  2K7D A;  3PN7 B;  4I5L B;  1W7I B;  4YGB B;  4GGF C;  1CLB A;  2I18 A;  3DY9 A;  1OZO A;  1QLK A;  2LP2 A;  5HKW A;  1MR8 A;  1AP4 A;  1CKK A;  1OE9 B;  3NSI A;  1KK7 Z;  2H8V A;  1DT7 B;  1QX5 B;  3KPX A;  3SG4 A;  3DVE A;  1DJX A;  4C0J A;  1PVA A;  2L5Y A;  3O2P A;  1SCM B;  4HRE E;  1WY9 A;  1Y6W A;  2ZND A;  1RFJ A;  1W7J B;  3AKA A;  4DRW A;  4PHM A;  4Q04 A;  2JTT A;  1WDC C;  2JXL A;  1GGW A;  2K61 A;  2WC8 A;  2K2F A;  3KEV A;  1SL8 A;  2LHI A;  4NDD A;  2H61 A;  3NHT A;  1L2O B;  4PHK A;  3TDU A;  5F6T A;  1NX0 A;  4WQ3 A;  1EG3 A;  1NYA A;  1UHJ A;  2BKH B;  3IQQ A;  4MZL A;  1HQV A;  3LL8 B;  2BAP A;  4JD9 A;  4BY5 A;  1MHO A;  1X02 A;  2B1U A;  2BCB A;  2KOT A;  2PQL A;  1G4Y R;  2BCA A;  2CT9 A;  2M0R A;  2ZFD A;  2O60 A;  5CPV A;  2JT0 A;  3DF0 A;  1U5I B;  2Q91 A;  2K2A A;  1K9P A;  3CZ0 A;  2KFG A;  5EL2 A;  4PDZ A;  1BOD A;  1SCV A;  5K89 A;  2K7O A;  1ALW A;  4N5X A;  4F0Z B;  1ZUZ A;  1N0Y A;  2M49 B;  4PAL A;  1C7W A;  1IRJ A;  2D8N A;  1J7O A;  2OS8 B;  3M0W A;  1Q80 A;  3GOF A;  3CR2 A;  1S26 D;  1XFV O;  4N1G A;  2WCJ A;  1TUJ A;  1L7Z A;  4GPL B;  5CSJ A;  1CDP A;  3H4S E;  4HRH A;  5AEQ A;  1QLS A;  1SR6 C;  2BBM A;  1K94 A;  2K7C A;  2WC6 A;  1JWD A;  1UUS A;  3B6X A;  2LUC A;  1BT6 A;  3BYA A;  4OCI A;  1QX2 A;  3I5H C;  2JWW A;  3EK7 A;  3WHU B;  2FCE A;  2K7B A;  4MN0 A;  3PSR A;  1OOI X;  1TCO B;  2F33 A;  5FI2 A;  4YGA A;  3RM1 A;  5KSZ A;  2KGB C;  1AHR A;  1SK6 D;  2PYQ A;  5GQQ C;  1M46 A;  1OQP A;  2GTE A;  1XFX O;  5TNC A;  1AK8 A;  1BU3 A;  3O4X A;  2F8P A;  1QV0 A;  2KPH A;  4OV2 A;  1SPY A;  4BY4 A;  1J7Q A;  4MRX A;  1A2X A;  3D10 A;  4MEW A;  3S0E A;  3OP0 A;  4DUQ A;  4QJ5 B;  3PM2 A;  4YGD B;  2WOR A;  3EVV A;  1CNP A;  1PRW A;  3FE9 A;  2EGD A;  1CFD A;  2L51 A;  3RLZ A;  1KQM C;  2KYF A;  2OTG C;  2JC2 A;  1TNQ A;  2LLU A;  2VRG A;  3TUY C;  5BPJ A;  4GGF A;  3A8R A;  1QIW A;  2ZRT A;  3HX4 A;  4YRU A;  1KQM B;  2WND A;  4OKH A;  1DJY A;  1PVB A;  5HKY A;  2KBI A;  3I5G B;  3CWG A;  1UHI A;  4JQ0 D;  1SYM A;  4PE1 A;  1PSR A;  1BJF A;  1Y1U A;  1M45 A;  2PRU A;  1NCX A;  3R1V A;  1DVI A;  3QME A;  1Z2C B;  1OMR A;  1FPW A;  2F3Z A;  1RTP 1;  4R1E A;  4ZCU A;  2LVJ A;  2Y5I A;  2EC6 B;  1WLM A;  4INX A;  2HPS A;  5KTY A;  4PE7 A;  2KAY A;  2LVV A;  2MLE C;  4PCW A;  2KDH A;  2NCP A;  3FE8 A;  2AMI A;  4MZK A;  2LLS A;  2MAZ A;  1BR1 B;  1IKU A;  2JNX A;  4PE0 A;  2G2B A;  1A4P A;  1B7T Y;  2MA2 A;  2BNX A;  4MSP A;  3EKH A;  2MBX A;  3WNX B;  1OOJ A;  3D0Y A;  2JU0 A;  3KF9 A;  4QJ4 B;  5IBW A;  1KSM A;  1BLQ A;  1S6C A;  3EKJ A;  1MWN A;  2WCM A;  3DVM A;  4XYN A;  2F3Y A;  3LCP C;  3ZNI A;  1NX2 A;  2Q4U A;  3JTD C;  4CPV A;  1LXF C;  1JFJ A;  2SAS A;  2L50 A;  3S0B A;  1VRK A;  4CFQ A;  2KQ6 A;  3IF7 A;  3JTD B;  2KBM A;  1DJZ A;  1EXR A;  4DCK A;  2BCX A;  2JRF A;  1KCY A;  2ZN8 A;  1B1G A;  4CLN A;  1TNW A;  2JTZ A;  1TUZ A;  4N1F A;  1CFP A;  1S5G Y;  4HSZ A;  3UNW A;  3D75 A;  3OHM B;  2MLF C;  1SMG A;  4NDC A;  4MVF A;  3EG5 B;  5B8I B;  2KAX A;  5KU1 A;  2WCL A;  3AAK A;  3LK1 A;  4U8D A;  1K9U A;  2FCD A;  1SCM C;  2GGZ A;  2BL0 C;  1TCF A;  2WOS A;  1SBJ A;  3CLN A;  2JZI A;  2MRD A;  1DEK A;  3IQO A;  1AJ4 A;  1KK7 Y;  1A75 A;  1KFU S;  2LLT A;  2BL0 B;  1CFC A;  2NZ0 A;  3KHE A;  1V1G A;  2QAC A;  1B9A A;  2HQ8 A;  3D74 A;  1CM1 A;  1JF0 A;  1L2O C;  4AQI A;  3BFB A;  1J7P A;  1N2D A;  3EVR A;  5CSN A;  3BUO B;  3F45 A;  1NCY A;  2KYC A;  4ORC B;  3ZWH A;  2OPO A;  1FI5 A;  3N7H A;  2G9B A;  1ALV A;  1GJY A;  1UHN A;  1CDM A;  2JXC A;  1KFX S;  4QJ3 B;  1NCZ A;  4DS7 A;  2ZN9 A;  2I7A A;  4PHN A;  5HKZ A;  4GAO A;  3BUN B;  1XYD A;  3PAL A;  2KI6 D;  3BQ3 A;  2K8M B;  3D76 A;  3S0F A;  1QVI Z;  1KQV A;  2GV5 A;  2HQW A;  1QWV A;  3SG3 A;  2L2C A;  3E3R A;  1DEL A;  4GBA A;  4YGC B;  5D69 A;  2OS8 C;  4A4C A;  3SS5 A;  1ZMZ A;  2PMY A;  2QPT A;  2LE9 B;  3FWC A;  5CSF A;  1A29 A;  1Z4H A;  2JQ6 A;  1AVS A;  1PK0 D;  2JPO A;  1XO5 A;  3SS3 A;  1BR4 B;  1UHK A;  2LHL A;  3B87 A;  3GK1 A;  1DJG A;  1K8U A;  1NSH A;  1R6P A;  2L5X B;  3CDN A;  3R1P A;  2M1K B;  4PE4 A;  3S0G A;  1CMF A;  1WRK A;  1R2U A;  3LLE A;  1PUL A;  3OX5 A;  2CCM A;  1QV1 A;  3D77 A;  1SW8 A;  2LVK A;  3K21 A;  5HL1 A;  3B86 A;  1OOH A;  2CTN A;  3D0Y B;  1OMD A;  1YX7 A;  3O4Y A;  3RZS A;  1C7V A;  1G33 A;  2M8U A;  2GGM A;  2AUC A;  4IJ7 A;  5FI6 A;  4MLW A;  1DMO A;  3BFA A;  1TTX A;  1GM0 A;  4HRG A;  2WCF A;  1RJV A;  3DD4 A;  1RK9 A;  3SIA A;  1FW4 A;  1OSA A;  2JNF A;  5HYD A;  3TZ1 A;  3VRP A;  1Y1A A;  1P28 A;  1WRL A;  4FQO A;  3GK2 A;  4GGN A;  1D1O A;  2WC5 A;  1DGU A;  1DQE A;  1DJH A;  1OZS A;  1OOG A;  2F2O A;  2P6B B;  1PAL A;  1NIW A;  3NSK A; 
#chains in the Genus database with same CATH homology
 3FE8 A;  3DYE A;  3S0D A;  2H8V A;  3B7A A;  2QDI A;  1C3Y A;  1TWO A;  3CZ1 A;  2WCK A;  2P71 A;  2WCM A;  3S0B A;  3VB1 A;  3NHT A;  3Q8I A;  3L47 A;  4JD9 A;  2PQL A;  3D75 A;  2WCL A;  3B88 A;  3PJI A;  3CZ0 A;  2FJY A;  5EL2 A;  3OGN A;  3BFH A;  1T14 A;  3D74 A;  3V2L A;  3D73 A;  1ORG A;  3BFB A;  1LS8 A;  3N7H A;  3NHI A;  5DIC A;  2WCJ A;  1TUJ A;  1OW4 A;  3CYZ A;  2QEV A;  3R72 A;  2WC6 A;  3B6X A;  3S0A A;  3D76 A;  3S0F A;  3K1E A;  2P70 A;  1OOI X;  3CAB A;  2QEB A;  1QWV A;  2L2C A;  1OOF A;  2GTE A;  1XFR A;  4INW A;  2KPH A;  2QEO A;  2WCH A;  3S0E A;  2JPO A;  3B87 A;  4F7F A;  3R1P A;  3CDN A;  3DXL A;  3S0G A;  3FE9 A;  3D77 A;  4OZD A;  3B86 A;  1OOH A;  3NGV A;  2QEH A;  3L4A A;  3DZT A;  3RZS A;  3BJH A;  1C3Z A;  3BFA A;  4FQT A;  3D78 A;  1GM0 A;  3R1O A;  3L4L A;  3R1V A;  4PT1 A;  3QME A;  2ERB A;  1P28 A;  2WC5 A;  1DQE A;  1OOG A;  3CZ2 A;  4INX A;  3FE6 A;  3DY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...