3N7HA

Crystal structure of odorant binding protein 1 from anopheles gambiae (agamobp1) with deet (n,n-diethyl-meta-toluamide) and peg
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein
publication title Anopheles gambiae odorant binding protein crystal complex with the synthetic repellent DEET: implications for structure-based design of novel mosquito repellents.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 44
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3n7hA01
3CZ2A 3CYZA 3S0EA 1OOIX 3R1VA 2WC6A 3DXLA 1TWOA 4OZDA 3K1EA 3B87A 2PQLA 3L47A 5EL2A 3NHIA 3CZ0A 3NHTA 3R1PA 3R1OA 1OOFA 3D77A 3S0DA 3Q8IA 3S0GA 3R72A 1GM0A 3N7HA 3B88A 3BFAA 1XFRA 2H8VA 2L2CA 3FE9A 4F7FA 4PT1A 1OW4A 2QEOA 3D76A 4INXA 3DZTA 2WCMA 3D78A 3S0AA 1TUJA 3CZ1A 2P70A 3CABA 2QEBA 1ORGA 1LS8A 3L4AA 2GTEA 1T14A 3B86A 3DY9A 1OOGA 3V2LA 3B6XA 2WCKA 3D75A 2FJYA 3RZSA 3BJHA 2KPHA 3D74A 3S0BA 2QDIA 2WCLA 2QEVA 3NGVA 4INWA 2WCJA 3VB1A 3OGNA 2QEHA 3BFHA 3CDNA 2JPOA 3S0FA 1QWVA 3PJIA 3QMEA 3L4LA 1P28A 3BFBA 2P71A 1OOHA 1C3YA 4FQTA 3B7AA 1C3ZA 2WC5A 2WCHA 3FE6A 1DQEA 3DYEA 3D73A 5DICA 4JD9A 2ERBA 3FE8A
chains in the Genus database with same CATH superfamily
4AOMA 1BLQA 2LHIA 1SR6B 4M2OA 1DC1A 2FJUB 1ZACA 1PVBA 5ER5A 3CYZA 2CT9A 1QX5B 2BAPA 1DF0B 1YUSA 4CFQA 3RM1A 1X02A 2BE4A 1OZOA 1SBJA 1TWOA 1NCXA 2WC6A 4KYNA 4L9MA 4NDBA 4OZDA 5FI7A 3BQ3A 3VRNA 3CTNA 5PALA 1KK7Y 1DGVA 1LVCD 1PALA 4USLA 3I5IB 1YX8A 3NHIA 3VRRA 4YGCB 5ER4X 3I5GC 4JWQA 4E68A 1HQVA 5D3OA 4PHMA 1LINA 1U5IA 1QV1A 1A75B 4NDCA 1IJ5A 4XYNA 1NYAA 4HRGA 3R72A 2JZIA 1KSMA 2KSPA 1CLMA 3A8RA 1GGWA 2WC8A 3PM2A 3TDUA 4N1GA 4QJ4B 1CDNA 1IIOA 1RWYA 1UHIA 3PATA 2CTNA 1CNPA 1XFRA 5CSJA 1SMGA 2JU0A 3GK1A 3K21A 1BOCA 1MHOA 3FWCA 3SIBA 1NP8A 1OQPA 3GK4X 4F7FA 1OW4A 2KNEA 5CSNA 3VRPA 3OHMB 1N65A 4YRUA 1CDMA 1QIWA 2L4IA 3IQOA 2KFHA 1G33A 1DJIA 3KEVA 4HRHA 1VRKA 1SY9A 1JWDA 1KWOC 4MZLA 2LMTA 1DJZA 2Q91A 4F0ZB 4MVFA 2L5YA 1QVIZ 3SIAA 4R1EA 1IJ6A 2TN4A 1LS8A 2EC6B 2LVJA 2SCPA 5HLOA 1CFDA 2NXQA 1KSOA 2BCBA 4OKHA 4YGBB 1U5IB 1Y6WA 1CM1A 3B86A 1IRJA 4GAOA 3B6XA 4DS7A 1TNQA 1RK9A 2KPHA 4ORAB 2JT3A 3JVTC 2P6BB 1XFYO 4ZCVA 2JWWA 2LLTA 2KLEA 3CGAA 4INWA 1N2DA 1WRKA 3KO0A 1K9KA 1PSRA 4M2QA 2K61A 3BUMB 4IJ7A 3EKHA 2FCEA 1K96A 2WCBA 4YBHB 5I2LA 1S6IA 4OR9B 1KWOB 1EL4A 2KAXA 1DJWA 1YRTB 2JPOA 2LANA 1OSAA 2KOTA 3MSEB 5FYXA 2ISDA 3SG2A 1N0YA 1QVIY 4MN0A 3RLZA 1NCZA 3LL8B 5HYDA 5BPJA 2P71A 3SG6A 3SS4A 1KFXL 4YGEB 1WRLA 1YX7A 1KFXS 2D8NA 2JTTA 2WCHA 2KQYA 4MBEA 4WQ2A 3UO9A 1J7PA 5G08A 1FI5A 3VGOA 2JXCA 2K7DA 4XJKA 2BL0C 4MSPA 1F71A 2QACA 1SCMC 1TN4A 3D73A 5DICA 2M3WA 2Y1MA 2LCPA 2ERBA 3NXAA 1UURA 2L50A 1J7RA 1YR5A 1RROA 1SL8A 4PCWA 3EVUA 3FE8A 1XFUO 4A4BA 2BE6A 3JVTB 2NCOA 2LP3A 4I5NB 1IH0A 1SYMA 1XVJA 2BCXA 1FPWA 4BY4A 1EH2A 4GBAA 4WRIA 1KK8C 1L2OC 5HKYA 4GPLB 3DXLA 4JPZB 4TNCA 2KI6D 3EK8A 2LV7A 2F3YA 5HL1A 1AJ4A 3CZTX 4I5JA 1JFJA 2F2PA 3L47A 5JOLA 1K2HA 4WQ3A 1ZFSA 3R1OA 3BOWA 1B1GA 4PHKA 2ZN8A 3O78A 1MUXA 3NSLA 3M0WA 2BKIB 3PFVA 3Q8IA 4XJKB 5I2QA 1GM0A 3D0YB 4PE1A 2BL0B 2HQ8A 1LKJA 3AAKA 5D7FA 1IQ3A 3B88A 1SCMB 2LM5A 4M2PA 2KI6C 2BBMA 2MLEC 2LP2A 1NIWA 1SK6D 2KBIA 1RFJA 2JOJA 1NSHA 2M9GA 2QEOA 2GGZA 3FIAA 3TUYB 3GK2A 1IKUA 1CTRA 1J7OA 5CSFA 2LC5A 3I5FB 1DJXA 5TNCA 2JPTA 1M31A 5IBWA 3PN7C 4PE4A 1B4CA 3CZ1A 1BJFA 1KK8B 1UP5A 1XA5A 1IGVA 3CR4X 2PMYA 3CABA 4FQOA 3ZWHA 1JC2A 4PE0A 3DF0B 2LLUA 1PK0D 4YI8A 3FWBA 1BMOA 1A2XA 2YGUA 3I5HC 2E30A 3EK7A 4OV2A 4PHNA 4AQJA 1FI6A 5D69A 2M1KB 3BOWB 4ETOA 3L4AA 2GTEA 1EG3A 1WY9A 1ZOTB 2WCFA 2DOQA 3BYAA 3DY9A 1K9UA 3F45A 2O5GA 1CMFA 1DJGA 4P2YB 1C7WA 3JTDC 3D74A 2LUCA 2MJWB 1AHRA 5JJGA 1QJTA 4PDZA 2R2IA 1SKTA 1RTP1 2ZKMX 3OP0A 2WCLA 2QEVA 5B8IB 4IL1A 1Y1AA 2AAOA 2WCJA 1NWDA 3VB1A 1CB1A 2KQ6A 1HT9A 2BBNA 2HPSA 1K94A 1OMDA 1TCFA 3O2PA 4CPVA 5AANA 3QRXA 3DVMA 3PJIA 4HSZA 1GGZA 2K60A 3I5GB 3WHTB 3QMEA 2K7CA 1MR8A 1QIVA 3L4LA 1OZSA 1P28A 3PLFB 1BODA 1OOHA 2FOTA 1C3ZA 1TRFA 2V53A 1NUBA 4C0LA 1KQMC 1TIZA 1S3PA 2JC2A 4QJ3B 3BUNB 1PVAA 3FE6A 2B1UA 2JTZA 2QPTA 1PRWA 3JTDB 2BNXA 2BCAA 1DELA 2LLSA 3BXKA 4PHJA 4P5OE 2M29A 1BR1B 1MXEA 3CS1A 3CZ2A 2LVVA 1TOPA 1J7QA 2JT8A 3LK0A 3DVJA 4ICBA 3TDZA 1JF2A 1V1GA 4GFTA 1K95A 4GGNA 2LNKA 3SG7A 5I2OA 2GGMA 3H4SE 4GGFC 3R1VA 2K2FA 1Z2CB 3LK1A 3VRQA 1H4BA 2ZNDA 4GGFA 3C1VA 4DRWA 2RGIA 1B47A 2K8MB 1Q80A 1A03A 1CFCA 3K1EA 4YGAA 1J1EA 1BU3A 3B87A 3O4XA 3OB2B 3AAJA 4DUQA 1CLBA 1XO5A 1NX1A 2M0RA 4QJ5B 1JFKA 4MRYA 1C7VA 1G8IA 3ICBA 3GOFA 3D77A 2L0PA 5K89A 5AXIA 2HQWA 5DKRA 1YRUB 2PALA 3IQQA 4JQ0D 4MRXA 2ZNEA 5GQQC 1Y1UA 1UHHA 1DTLA 1B9AA 1B8CA 1WDCC 2EHBA 2GV5A 2WOSA 3EVRA 2K2AA 3N7HA 4I5LB 3TS5C 3TZ1A 2LMVA 1NX0A 1NX2A 2PASA 1OMVA 2ZFDA 3BUOB 2L2CA 1DJHA 1LA0A 2KI4C 3DVEA 2KAVA 5HLVA 1AP4A 3LCPC 3D76A 1Y1XA 4CFRA 1B8LA 2OS8C 2JT0A 2CXJA 3DZTA 5I8NA 1GQMA 1TNXA 1JBAA 3WXAA 1Z4HA 1QTXA 3D78A 1TUJA 3DVKA 1CDPA 2PVBA 4N5XA 1DGUA 2MA2A 2CNPA 2OTGC 1JUOA 2QEBA 1DF0A 1RJVA 1BF5A 2BECA 2AUCA 1EG4A 2NCPA 2G9BA 3DD4A 3OBVA 5FI6A 1PSBA 1DMOA 1F8HA 4Q04A 2ZRSA 3UNWA 1UHKA 2LAPA 1DJYA 1E8AA 1GJYA 1SL9A 1T14A 3I5IC 2K7BA 2MLFC 2VRGA 2F3ZA 2ZN9A 4MEWA 5KSZA 1DT7B 2I2RE 2WORA 2FCDA 3AKBA 3CLNA 3D75A 3KF9A 3RZSA 2JNXA 1NCYA 2MAZA 1QX2A 1F4OA 3O4YA 4CIDA 2M49B 2Y5IA 3SG3A 1CDLA 1A75A 2Y4QA 5F6TA 3S0BA 5DKQA 1J55A 3TS5B 1YURA 2K7OA 4GNKB 1A4PA 2KI4B 1LA3A 1L2OB 1F4QA 2HETA 1OMRA 2M8UA 4HREE 5HKWA 1R2UA 2Q4UA 2OS8B 1QASA 4ORCB 2M1UA 1OOJA 1JSAA 3D10A 3BUXB 2QEHA 1M46A 2IS9A 1MXLC 2NLNA 3BFHA 3CDNA 2JXLA 4NDDA 2COLB 1K9PA 2OTGB 1JF0A 1QWVA 3S0FA 1FBVA 2H2KA 5J3XA 4MLWA 2ZRTA 3SG5A 1K90D 2JQ6A 4DCKA 3BFBA 2F33A 4FQTA 3B7AA 4N1FA 2L51A 2EC6C 1FF1A 2WCEA 5CPVA 4FTGA 1ZUZA 2F2OA 1MF8B 1LXFC 3CR5X 1YVHA 2JRFA 3OB1B 3PM8A 2L98A 4JD9A 2KGRA 2KHNA 2L4HA 1BG1A 1CM4A 3EVVA 4AQIA 4C0KA 2PSRA 1SL7A 4PE7A 1SCVA 5CSIA 1WRZA 1YTZC 2JNFA 1B7TZ 4I5KA 1F54A 2KYCA 1UUSA 3PN7B 3S0EA 3BUWB 1L7ZA 2LHLA 2HF5A 1OOIX 1QATA 1QV0A 4C0JA 1S26D 1A29A 2M7NA 1QXPA 2Y1NA 1MQ1A 3FS7A 3I5HB 2G2BA 1QX7A 1AK8A 1XFZO 1QLKA 2PQLA 2NZ0A 5EL2A 3CZ0A 3NHTA 2E6WA 3O6BA 3R1PA 4BY5A 1AJ5A 2M97A 1OOFA 2I7AA 3HCMA 3S0DA 1SW8A 1H8BA 1QLSA 3S0GA 1W7IB 2F8PA 3PALA 3HX4A 2KFFA 3SS3A 2L5XB 1KFUL 1YUTA 2I94A 2LE9B 3WHUB 1KFUS 1D1OA 2KDHA 4YGDB 2CCMA 2MRDA 3SS5A 3BFAA 3NSOA 3TDIA 3OX6A 2H8VA 1R6PA 1Y0VH 3FE9A 2K0JA 1ALVA 4PT1A 2LVKA 1MWNA 4INXA 1XK4C 4OCIA 4UPGA 1B7TY 1TNWA 3KPXA 3WNXB 3ZNIA 1TCOB 2EGDA 4D1EA 1XK4A 1CKKA 1S6JA 2AMIA 2MHHA 2WCMA 3S0AA 1F70A 2I18A 1WLZA 3NSKA 5AFPA 1C07A 2P70A 4A4CA 1SRAA 1J1DA 3SJSA 2PYQA 1XFWO 3A4UB 3KHEA 1KQVA 1AVSA 2BKHB 1W9ZA 1ORGA 2KGBC 4MZKA 2L2EA 2PRUA 3IF7A 1XFXO 2M7LA 4ORBB 1KQMB 1M39A 2KYFA 1YUUA 1IWQA 1S5GZ 1ZMZA 5FI2A 2LVIA 1UHJA 1OOGA 2A4JA 2LMUA 3V2LA 2SASA 1XFVO 2WCKA 2FJYA 3BJHA 4U8DA 3AKAA 1CMGA 1CLLA 1XYDA 1SR6C 1UHNA 2KAYA 2QDIA 4JKTA 1V1FA 4GUKA 3D0YA 2MBXA 3LLEA 1DEKA 5AERA 3VROA 2KFGA 2JULA 1NX3A 1SSEB 1EXRA 3NGVA 4ZCUA 1M45A 2LUXA 3IVTA 1KCYA 5KU1A 1TNPA 3E3RA 3TUYC 1K8UA 1BR4B 4OVNF 3NSIA 3OGNA 3I5FC 1KK7Z 1QS7A 5DKNA 1IQ5A 3OX5A 2KLDA 1S1EA 1ALWA 1WLMA 3CR2A 3EKJA 4YI9A 4DIRA 1G4YR 5KTYA 1M63B 1TUZA 1W7JB 1TTXA 1OE9B 1NPQA 1AUIB 1F55A 3DF0A 1C3YA 1BT6A 1YVLA 1CFFA 3PSRA 1FW4A 1K93D 1S6CA 1SNLA 1SPYA 3SG4A 5I94A 2CBLA 2WC5A 4CLNA 1PULA 1WDCB 1S5GY 2WNDA 1B8RA 3EG5B 1EJ3A 1ODBA 3EK4A 4NQGA 4PALA 5AEQA 2H61C 1DQEA 3CWGA 2O60A 2OPOA 1IG5A 1DVIA 3DYEA 1CFPA 1S36A 5HKZA 2H61A 4MZJA 2KBMA 1UWOA 1RECA
chains in the Genus database with same CATH topology
3CZ2A 3CYZA 3S0EA 1OOIX 3R1VA 2WC6A 3DXLA 1TWOA 4OZDA 3K1EA 3B87A 2PQLA 3L47A 5EL2A 3NHIA 3CZ0A 3NHTA 3R1PA 3R1OA 1OOFA 3D77A 3S0DA 3Q8IA 3S0GA 3R72A 1GM0A 3N7HA 3B88A 3BFAA 1XFRA 2H8VA 2L2CA 3FE9A 4F7FA 4PT1A 1OW4A 2QEOA 3D76A 4INXA 3DZTA 2WCMA 3D78A 3S0AA 1TUJA 3CZ1A 2P70A 3CABA 2QEBA 1ORGA 1LS8A 3L4AA 2GTEA 1T14A 3B86A 3DY9A 1OOGA 3V2LA 3B6XA 2WCKA 3D75A 2FJYA 3RZSA 3BJHA 2KPHA 3D74A 3S0BA 2QDIA 2WCLA 2QEVA 3NGVA 4INWA 2WCJA 3VB1A 3OGNA 2QEHA 3BFHA 3CDNA 2JPOA 3S0FA 1QWVA 3PJIA 3QMEA 3L4LA 1P28A 3BFBA 2P71A 1OOHA 1C3YA 4FQTA 3B7AA 1C3ZA 2WC5A 2WCHA 3FE6A 1DQEA 3DYEA 3D73A 5DICA 4JD9A 2ERBA 3FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ2 A;  3CYZ A;  3S0E A;  1OOI X;  3R1V A;  2WC6 A;  3DXL A;  1TWO A;  4OZD A;  3K1E A;  3B87 A;  2PQL A;  3L47 A;  5EL2 A;  3NHI A;  3CZ0 A;  3NHT A;  3R1P A;  3R1O A;  1OOF A;  3D77 A;  3S0D A;  3Q8I A;  3S0G A;  3R72 A;  1GM0 A;  3N7H A;  3B88 A;  3BFA A;  1XFR A;  2H8V A;  2L2C A;  3FE9 A;  4F7F A;  4PT1 A;  1OW4 A;  2QEO A;  3D76 A;  4INX A;  3DZT A;  2WCM A;  3D78 A;  3S0A A;  1TUJ A;  3CZ1 A;  2P70 A;  3CAB A;  2QEB A;  1ORG A;  1LS8 A;  3L4A A;  2GTE A;  1T14 A;  3B86 A;  3DY9 A;  1OOG A;  3V2L A;  3B6X A;  2WCK A;  3D75 A;  2FJY A;  3RZS A;  3BJH A;  2KPH A;  3D74 A;  3S0B A;  2QDI A;  2WCL A;  2QEV A;  3NGV A;  4INW A;  2WCJ A;  3VB1 A;  3OGN A;  2QEH A;  3BFH A;  3CDN A;  2JPO A;  3S0F A;  1QWV A;  3PJI A;  3QME A;  3L4L A;  1P28 A;  3BFB A;  2P71 A;  1OOH A;  1C3Y A;  4FQT A;  3B7A A;  1C3Z A;  2WC5 A;  2WCH A;  3FE6 A;  1DQE A;  3DYE A;  3D73 A;  5DIC A;  4JD9 A;  2ERB A;  3FE8 A; 
#chains in the Genus database with same CATH topology
 4AOM A;  1BLQ A;  2LHI A;  1SR6 B;  4M2O A;  1DC1 A;  2FJU B;  1ZAC A;  1PVB A;  5ER5 A;  3CYZ A;  2CT9 A;  1QX5 B;  2BAP A;  1DF0 B;  1YUS A;  4CFQ A;  3RM1 A;  1X02 A;  2BE4 A;  1OZO A;  1SBJ A;  1TWO A;  1NCX A;  2WC6 A;  4KYN A;  4L9M A;  4NDB A;  4OZD A;  5FI7 A;  3BQ3 A;  3VRN A;  3CTN A;  5PAL A;  1KK7 Y;  1DGV A;  1LVC D;  1PAL A;  4USL A;  3I5I B;  1YX8 A;  3NHI A;  3VRR A;  4YGC B;  5ER4 X;  3I5G C;  4JWQ A;  4E68 A;  1HQV A;  5D3O A;  4PHM A;  1LIN A;  1U5I A;  1QV1 A;  1A75 B;  4NDC A;  1IJ5 A;  4XYN A;  1NYA A;  4HRG A;  3R72 A;  2JZI A;  1KSM A;  2KSP A;  1CLM A;  3A8R A;  1GGW A;  2WC8 A;  3PM2 A;  3TDU A;  4N1G A;  4QJ4 B;  1CDN A;  1IIO A;  1RWY A;  1UHI A;  3PAT A;  2CTN A;  1CNP A;  1XFR A;  5CSJ A;  1SMG A;  2JU0 A;  3GK1 A;  3K21 A;  1BOC A;  1MHO A;  3FWC A;  3SIB A;  1NP8 A;  1OQP A;  3GK4 X;  4F7F A;  1OW4 A;  2KNE A;  5CSN A;  3VRP A;  3OHM B;  1N65 A;  4YRU A;  1CDM A;  1QIW A;  2L4I A;  3IQO A;  2KFH A;  1G33 A;  1DJI A;  3KEV A;  4HRH A;  1VRK A;  1SY9 A;  1JWD A;  1KWO C;  4MZL A;  2LMT A;  1DJZ A;  2Q91 A;  4F0Z B;  4MVF A;  2L5Y A;  1QVI Z;  3SIA A;  4R1E A;  1IJ6 A;  2TN4 A;  1LS8 A;  2EC6 B;  2LVJ A;  2SCP A;  5HLO A;  1CFD A;  2NXQ A;  1KSO A;  2BCB A;  4OKH A;  4YGB B;  1U5I B;  1Y6W A;  1CM1 A;  3B86 A;  1IRJ A;  4GAO A;  3B6X A;  4DS7 A;  1TNQ A;  1RK9 A;  2KPH A;  4ORA B;  2JT3 A;  3JVT C;  2P6B B;  1XFY O;  4ZCV A;  2JWW A;  2LLT A;  2KLE A;  3CGA A;  4INW A;  1N2D A;  1WRK A;  3KO0 A;  1K9K A;  1PSR A;  4M2Q A;  2K61 A;  3BUM B;  4IJ7 A;  3EKH A;  2FCE A;  1K96 A;  2WCB A;  4YBH B;  5I2L A;  1S6I A;  4OR9 B;  1KWO B;  1EL4 A;  2KAX A;  1DJW A;  1YRT B;  2JPO A;  2LAN A;  1OSA A;  2KOT A;  3MSE B;  5FYX A;  2ISD A;  3SG2 A;  1N0Y A;  1QVI Y;  4MN0 A;  3RLZ A;  1NCZ A;  3LL8 B;  5HYD A;  5BPJ A;  2P71 A;  3SG6 A;  3SS4 A;  1KFX L;  4YGE B;  1WRL A;  1YX7 A;  1KFX S;  2D8N A;  2JTT A;  2WCH A;  2KQY A;  4MBE A;  4WQ2 A;  3UO9 A;  1J7P A;  5G08 A;  1FI5 A;  3VGO A;  2JXC A;  2K7D A;  4XJK A;  2BL0 C;  4MSP A;  1F71 A;  2QAC A;  1SCM C;  1TN4 A;  3D73 A;  5DIC A;  2M3W A;  2Y1M A;  2LCP A;  2ERB A;  3NXA A;  1UUR A;  2L50 A;  1J7R A;  1YR5 A;  1RRO A;  1SL8 A;  4PCW A;  3EVU A;  3FE8 A;  1XFU O;  4A4B A;  2BE6 A;  3JVT B;  2NCO A;  2LP3 A;  4I5N B;  1IH0 A;  1SYM A;  1XVJ A;  2BCX A;  1FPW A;  4BY4 A;  1EH2 A;  4GBA A;  4WRI A;  1KK8 C;  1L2O C;  5HKY A;  4GPL B;  3DXL A;  4JPZ B;  4TNC A;  2KI6 D;  3EK8 A;  2LV7 A;  2F3Y A;  5HL1 A;  1AJ4 A;  3CZT X;  4I5J A;  1JFJ A;  2F2P A;  3L47 A;  5JOL A;  1K2H A;  4WQ3 A;  1ZFS A;  3R1O A;  3BOW A;  1B1G A;  4PHK A;  2ZN8 A;  3O78 A;  1MUX A;  3NSL A;  3M0W A;  2BKI B;  3PFV A;  3Q8I A;  4XJK B;  5I2Q A;  1GM0 A;  3D0Y B;  4PE1 A;  2BL0 B;  2HQ8 A;  1LKJ A;  3AAK A;  5D7F A;  1IQ3 A;  3B88 A;  1SCM B;  2LM5 A;  4M2P A;  2KI6 C;  2BBM A;  2MLE C;  2LP2 A;  1NIW A;  1SK6 D;  2KBI A;  1RFJ A;  2JOJ A;  1NSH A;  2M9G A;  2QEO A;  2GGZ A;  3FIA A;  3TUY B;  3GK2 A;  1IKU A;  1CTR A;  1J7O A;  5CSF A;  2LC5 A;  3I5F B;  1DJX A;  5TNC A;  2JPT A;  1M31 A;  5IBW A;  3PN7 C;  4PE4 A;  1B4C A;  3CZ1 A;  1BJF A;  1KK8 B;  1UP5 A;  1XA5 A;  1IGV A;  3CR4 X;  2PMY A;  3CAB A;  4FQO A;  3ZWH A;  1JC2 A;  4PE0 A;  3DF0 B;  2LLU A;  1PK0 D;  4YI8 A;  3FWB A;  1BMO A;  1A2X A;  2YGU A;  3I5H C;  2E30 A;  3EK7 A;  4OV2 A;  4PHN A;  4AQJ A;  1FI6 A;  5D69 A;  2M1K B;  3BOW B;  4ETO A;  3L4A A;  2GTE A;  1EG3 A;  1WY9 A;  1ZOT B;  2WCF A;  2DOQ A;  3BYA A;  3DY9 A;  1K9U A;  3F45 A;  2O5G A;  1CMF A;  1DJG A;  4P2Y B;  1C7W A;  3JTD C;  3D74 A;  2LUC A;  2MJW B;  1AHR A;  5JJG A;  1QJT A;  4PDZ A;  2R2I A;  1SKT A;  1RTP 1;  2ZKM X;  3OP0 A;  2WCL A;  2QEV A;  5B8I B;  4IL1 A;  1Y1A A;  2AAO A;  2WCJ A;  1NWD A;  3VB1 A;  1CB1 A;  2KQ6 A;  1HT9 A;  2BBN A;  2HPS A;  1K94 A;  1OMD A;  1TCF A;  3O2P A;  4CPV A;  5AAN A;  3QRX A;  3DVM A;  3PJI A;  4HSZ A;  1GGZ A;  2K60 A;  3I5G B;  3WHT B;  3QME A;  2K7C A;  1MR8 A;  1QIV A;  3L4L A;  1OZS A;  1P28 A;  3PLF B;  1BOD A;  1OOH A;  2FOT A;  1C3Z A;  1TRF A;  2V53 A;  1NUB A;  4C0L A;  1KQM C;  1TIZ A;  1S3P A;  2JC2 A;  4QJ3 B;  3BUN B;  1PVA A;  3FE6 A;  2B1U A;  2JTZ A;  2QPT A;  1PRW A;  3JTD B;  2BNX A;  2BCA A;  1DEL A;  2LLS A;  3BXK A;  4PHJ A;  4P5O E;  2M29 A;  1BR1 B;  1MXE A;  3CS1 A;  3CZ2 A;  2LVV A;  1TOP A;  1J7Q A;  2JT8 A;  3LK0 A;  3DVJ A;  4ICB A;  3TDZ A;  1JF2 A;  1V1G A;  4GFT A;  1K95 A;  4GGN A;  2LNK A;  3SG7 A;  5I2O A;  2GGM A;  3H4S E;  4GGF C;  3R1V A;  2K2F A;  1Z2C B;  3LK1 A;  3VRQ A;  1H4B A;  2ZND A;  4GGF A;  3C1V A;  4DRW A;  2RGI A;  1B47 A;  2K8M B;  1Q80 A;  1A03 A;  1CFC A;  3K1E A;  4YGA A;  1J1E A;  1BU3 A;  3B87 A;  3O4X A;  3OB2 B;  3AAJ A;  4DUQ A;  1CLB A;  1XO5 A;  1NX1 A;  2M0R A;  4QJ5 B;  1JFK A;  4MRY A;  1C7V A;  1G8I A;  3ICB A;  3GOF A;  3D77 A;  2L0P A;  5K89 A;  5AXI A;  2HQW A;  5DKR A;  1YRU B;  2PAL A;  3IQQ A;  4JQ0 D;  4MRX A;  2ZNE A;  5GQQ C;  1Y1U A;  1UHH A;  1DTL A;  1B9A A;  1B8C A;  1WDC C;  2EHB A;  2GV5 A;  2WOS A;  3EVR A;  2K2A A;  3N7H A;  4I5L B;  3TS5 C;  3TZ1 A;  2LMV A;  1NX0 A;  1NX2 A;  2PAS A;  1OMV A;  2ZFD A;  3BUO B;  2L2C A;  1DJH A;  1LA0 A;  2KI4 C;  3DVE A;  2KAV A;  5HLV A;  1AP4 A;  3LCP C;  3D76 A;  1Y1X A;  4CFR A;  1B8L A;  2OS8 C;  2JT0 A;  2CXJ A;  3DZT A;  5I8N A;  1GQM A;  1TNX A;  1JBA A;  3WXA A;  1Z4H A;  1QTX A;  3D78 A;  1TUJ A;  3DVK A;  1CDP A;  2PVB A;  4N5X A;  1DGU A;  2MA2 A;  2CNP A;  2OTG C;  1JUO A;  2QEB A;  1DF0 A;  1RJV A;  1BF5 A;  2BEC A;  2AUC A;  1EG4 A;  2NCP A;  2G9B A;  3DD4 A;  3OBV A;  5FI6 A;  1PSB A;  1DMO A;  1F8H A;  4Q04 A;  2ZRS A;  3UNW A;  1UHK A;  2LAP A;  1DJY A;  1E8A A;  1GJY A;  1SL9 A;  1T14 A;  3I5I C;  2K7B A;  2MLF C;  2VRG A;  2F3Z A;  2ZN9 A;  4MEW A;  5KSZ A;  1DT7 B;  2I2R E;  2WOR A;  2FCD A;  3AKB A;  3CLN A;  3D75 A;  3KF9 A;  3RZS A;  2JNX A;  1NCY A;  2MAZ A;  1QX2 A;  1F4O A;  3O4Y A;  4CID A;  2M49 B;  2Y5I A;  3SG3 A;  1CDL A;  1A75 A;  2Y4Q A;  5F6T A;  3S0B A;  5DKQ A;  1J55 A;  3TS5 B;  1YUR A;  2K7O A;  4GNK B;  1A4P A;  2KI4 B;  1LA3 A;  1L2O B;  1F4Q A;  2HET A;  1OMR A;  2M8U A;  4HRE E;  5HKW A;  1R2U A;  2Q4U A;  2OS8 B;  1QAS A;  4ORC B;  2M1U A;  1OOJ A;  1JSA A;  3D10 A;  3BUX B;  2QEH A;  1M46 A;  2IS9 A;  1MXL C;  2NLN A;  3BFH A;  3CDN A;  2JXL A;  4NDD A;  2COL B;  1K9P A;  2OTG B;  1JF0 A;  1QWV A;  3S0F A;  1FBV A;  2H2K A;  5J3X A;  4MLW A;  2ZRT A;  3SG5 A;  1K90 D;  2JQ6 A;  4DCK A;  3BFB A;  2F33 A;  4FQT A;  3B7A A;  4N1F A;  2L51 A;  2EC6 C;  1FF1 A;  2WCE A;  5CPV A;  4FTG A;  1ZUZ A;  2F2O A;  1MF8 B;  1LXF C;  3CR5 X;  1YVH A;  2JRF A;  3OB1 B;  3PM8 A;  2L98 A;  4JD9 A;  2KGR A;  2KHN A;  2L4H A;  1BG1 A;  1CM4 A;  3EVV A;  4AQI A;  4C0K A;  2PSR A;  1SL7 A;  4PE7 A;  1SCV A;  5CSI A;  1WRZ A;  1YTZ C;  2JNF A;  1B7T Z;  4I5K A;  1F54 A;  2KYC A;  1UUS A;  3PN7 B;  3S0E A;  3BUW B;  1L7Z A;  2LHL A;  2HF5 A;  1OOI X;  1QAT A;  1QV0 A;  4C0J A;  1S26 D;  1A29 A;  2M7N A;  1QXP A;  2Y1N A;  1MQ1 A;  3FS7 A;  3I5H B;  2G2B A;  1QX7 A;  1AK8 A;  1XFZ O;  1QLK A;  2PQL A;  2NZ0 A;  5EL2 A;  3CZ0 A;  3NHT A;  2E6W A;  3O6B A;  3R1P A;  4BY5 A;  1AJ5 A;  2M97 A;  1OOF A;  2I7A A;  3HCM A;  3S0D A;  1SW8 A;  1H8B A;  1QLS A;  3S0G A;  1W7I B;  2F8P A;  3PAL A;  3HX4 A;  2KFF A;  3SS3 A;  2L5X B;  1KFU L;  1YUT A;  2I94 A;  2LE9 B;  3WHU B;  1KFU S;  1D1O A;  2KDH A;  4YGD B;  2CCM A;  2MRD A;  3SS5 A;  3BFA A;  3NSO A;  3TDI A;  3OX6 A;  2H8V A;  1R6P A;  1Y0V H;  3FE9 A;  2K0J A;  1ALV A;  4PT1 A;  2LVK A;  1MWN A;  4INX A;  1XK4 C;  4OCI A;  4UPG A;  1B7T Y;  1TNW A;  3KPX A;  3WNX B;  3ZNI A;  1TCO B;  2EGD A;  4D1E A;  1XK4 A;  1CKK A;  1S6J A;  2AMI A;  2MHH A;  2WCM A;  3S0A A;  1F70 A;  2I18 A;  1WLZ A;  3NSK A;  5AFP A;  1C07 A;  2P70 A;  4A4C A;  1SRA A;  1J1D A;  3SJS A;  2PYQ A;  1XFW O;  3A4U B;  3KHE A;  1KQV A;  1AVS A;  2BKH B;  1W9Z A;  1ORG A;  2KGB C;  4MZK A;  2L2E A;  2PRU A;  3IF7 A;  1XFX O;  2M7L A;  4ORB B;  1KQM B;  1M39 A;  2KYF A;  1YUU A;  1IWQ A;  1S5G Z;  1ZMZ A;  5FI2 A;  2LVI A;  1UHJ A;  1OOG A;  2A4J A;  2LMU A;  3V2L A;  2SAS A;  1XFV O;  2WCK A;  2FJY A;  3BJH A;  4U8D A;  3AKA A;  1CMG A;  1CLL A;  1XYD A;  1SR6 C;  1UHN A;  2KAY A;  2QDI A;  4JKT A;  1V1F A;  4GUK A;  3D0Y A;  2MBX A;  3LLE A;  1DEK A;  5AER A;  3VRO A;  2KFG A;  2JUL A;  1NX3 A;  1SSE B;  1EXR A;  3NGV A;  4ZCU A;  1M45 A;  2LUX A;  3IVT A;  1KCY A;  5KU1 A;  1TNP A;  3E3R A;  3TUY C;  1K8U A;  1BR4 B;  4OVN F;  3NSI A;  3OGN A;  3I5F C;  1KK7 Z;  1QS7 A;  5DKN A;  1IQ5 A;  3OX5 A;  2KLD A;  1S1E A;  1ALW A;  1WLM A;  3CR2 A;  3EKJ A;  4YI9 A;  4DIR A;  1G4Y R;  5KTY A;  1M63 B;  1TUZ A;  1W7J B;  1TTX A;  1OE9 B;  1NPQ A;  1AUI B;  1F55 A;  3DF0 A;  1C3Y A;  1BT6 A;  1YVL A;  1CFF A;  3PSR A;  1FW4 A;  1K93 D;  1S6C A;  1SNL A;  1SPY A;  3SG4 A;  5I94 A;  2CBL A;  2WC5 A;  4CLN A;  1PUL A;  1WDC B;  1S5G Y;  2WND A;  1B8R A;  3EG5 B;  1EJ3 A;  1ODB A;  3EK4 A;  4NQG A;  4PAL A;  5AEQ A;  2H61 C;  1DQE A;  3CWG A;  2O60 A;  2OPO A;  1IG5 A;  1DVI A;  3DYE A;  1CFP A;  1S36 A;  5HKZ A;  2H61 A;  4MZJ A;  2KBM A;  1UWO A;  1REC A; 
#chains in the Genus database with same CATH homology
 3CZ2 A;  3CYZ A;  3S0E A;  1OOI X;  3R1V A;  2WC6 A;  3DXL A;  1TWO A;  4OZD A;  3K1E A;  3B87 A;  2PQL A;  3L47 A;  5EL2 A;  3NHI A;  3CZ0 A;  3NHT A;  3R1P A;  3R1O A;  1OOF A;  3D77 A;  3S0D A;  3Q8I A;  3S0G A;  3R72 A;  1GM0 A;  3N7H A;  3B88 A;  3BFA A;  1XFR A;  2H8V A;  2L2C A;  3FE9 A;  4F7F A;  4PT1 A;  1OW4 A;  2QEO A;  3D76 A;  4INX A;  3DZT A;  2WCM A;  3D78 A;  3S0A A;  1TUJ A;  3CZ1 A;  2P70 A;  3CAB A;  2QEB A;  1ORG A;  1LS8 A;  3L4A A;  2GTE A;  1T14 A;  3B86 A;  3DY9 A;  1OOG A;  3V2L A;  3B6X A;  2WCK A;  3D75 A;  2FJY A;  3RZS A;  3BJH A;  2KPH A;  3D74 A;  3S0B A;  2QDI A;  2WCL A;  2QEV A;  3NGV A;  4INW A;  2WCJ A;  3VB1 A;  3OGN A;  2QEH A;  3BFH A;  3CDN A;  2JPO A;  3S0F A;  1QWV A;  3PJI A;  3QME A;  3L4L A;  1P28 A;  3BFB A;  2P71 A;  1OOH A;  1C3Y A;  4FQT A;  3B7A A;  1C3Z A;  2WC5 A;  2WCH A;  3FE6 A;  1DQE A;  3DYE A;  3D73 A;  5DIC A;  4JD9 A;  2ERB A;  3FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...