3N7HA

Crystal structure of odorant binding protein 1 from anopheles gambiae (agamobp1) with deet (n,n-diethyl-meta-toluamide) and peg
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
b'DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein
publication title Anopheles gambiae odorant binding protein crystal complex with the synthetic repellent DEET: implications for structure-based design of novel mosquito repellents.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 44
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3n7hA01
1P28A 3NHIA 5EL2A 3B88A 3N7HA 2QEBA 3FE9A 3V2LA 4F7FA 3D75A 3FE8A 2FJYA 3S0EA 3CDNA 3CZ1A 3D76A 4PT1A 1XFRA 2QEHA 3L4AA 3CABA 2WCHA 3CZ0A 4OZDA 4FQTA 1LS8A 1OOHA 3DXLA 3D74A 3CYZA 3VB1A 3OGNA 3BFBA 3PJIA 3S0FA 2WCJA 3BFHA 4JD9A 2P71A 1QWVA 3D78A 5DICA 3B86A 2QEVA 3L4LA 2ERBA 1TUJA 3K1EA 2GTEA 1OW4A 3DY9A 2L2CA 3FE6A 3DYEA 1TWOA 3DZTA 2KPHA 3R1OA 2QEOA 1DQEA 3D73A 1C3ZA 3L47A 1ORGA 2QDIA 3CZ2A 2P70A 3BJHA 3NGVA 3QMEA 1C3YA 4INWA 3B7AA 3Q8IA 1OOFA 3B6XA 2JPOA 2WC6A 3RZSA 1T14A 3S0BA 1OOGA 2WC5A 3BFAA 3D77A 3B87A 3NHTA 2WCKA 2PQLA 3S0GA 1GM0A 1OOIX 3S0DA 4INXA 2WCLA 2WCMA 3R1VA 3R72A 3R1PA 2H8VA 3S0AA
chains in the Genus database with same CATH superfamily
1BJFA 1NUBA 3OB1B 4ZCVA 5EL2A 4I5NB 3RLZA 1MF8B 1UURA 1A29A 1EH2A 2SCPA 2I94A 2NXQA 3O2PA 4MBEA 3DF0B 3JTDC 1TNPA 3VRPA 1MXEA 1SL9A 3S0EA 2FJYA 1OZSA 1EL4A 1LVCD 1SR6B 1DJZA 5JOLA 4I5LB 5CSFA 3DD4A 1SBJA 1B8LA 2KI4C 1QV0A 2LLTA 1IKUA 4P2YB 2KSPA 1K94A 3PATA 2KBIA 4D1EA 4C0LA 1BG1A 1TNXA 2K61A 3H4SE 3TUYC 2WCHA 4ORBB 4MZLA 1TNWA 2WCEA 3KHEA 1EG4A 4FQTA 1OOHA 2JZIA 2COLB 2L4IA 5CSJA 1UHIA 1XFXO 2QACA 1CB1A 4NDCA 3S0FA 2BECA 3OB2B 5AXIA 2M1KB 3IVTA 5CSNA 2M7LA 2H61C 3O6BA 5HL1A 4GGNA 4DRWA 1C07A 2I7AA 3BUWB 1IRJA 1F8HA 5DICA 1XFVO 3B86A 2QEVA 2OPOA 1DELA 2ERBA 2O5GA 1CDMA 1GQMA 3DVMA 2KYFA 2LE9B 2Y1MA 1IJ6A 1LXFC 3EK4A 5HKYA 1TIZA 2ZRSA 4YI9A 3D10A 3DZTA 2ZN8A 1WDCC 1QIWA 3R1OA 3SG2A 1EJ3A 4QJ4B 1L2OC 2L98A 3LL8B 3OBVA 3D73A 1NX0A 1C3ZA 2MBXA 3L47A 3PN7C 1QASA 3O4XA 1R2UA 2FJUB 3GK2A 1KK7Y 3VROA 1H4BA 1SMGA 5HYDA 3OP0A 2QDIA 1JUOA 4PE1A 2HQWA 1SNLA 3CZTX 1J7OA 2BAPA 2E6WA 2OS8B 3EKHA 4GGFC 4KYNA 2KHNA 1NP8A 4PCWA 3BUOB 1UHHA 2TN4A 1UHKA 3LCPC 3PM8A 3SIBA 1AVSA 1PULA 2M97A 1WRZA 3Q8IA 4ICBA 1MUXA 4AOMA 2K7BA 3I5GB 1IWQA 1XFUO 2F8PA 2JPTA 1Y1UA 2Q91A 2G2BA 2PVBA 2JC2A 3PSRA 3S0BA 1KWOC 1OOGA 2LV7A 4PE0A 1SL7A 1X02A 3LK1A 3BFAA 2OTGC 1YTZC 1RTP1 3EVRA 1B47A 3NHTA 3I5HB 4JQ0D 3MSEB 3FWBA 1S3PA 1A75A 1BT6A 1K9KA 2K60A 2EHBA 1UUSA 1NX1A 3NSIA 1AUIB 4INXA 1DJHA 2BBNA 4DCKA 1B8CA 2F3YA 2D8NA 3R72A 1RK9A 1J55A 1CKKA 4JPZB 1QX2A 3SS3A 3R1PA 1B9AA 5CPVA 2M7NA 1ZMZA 2L5YA 1J1EA 1A03A 3B88A 5HKZA 1YUUA 1OZOA 2MA2A 2Y1NA 3EVVA 1A75B 3FE9A 5I2LA 1B8RA 2JT8A 2WC8A 2P6BB 1MHOA 2BCAA 1DGUA 1S1EA 1AJ4A 3EK8A 3UO9A 4F7FA 5I8NA 1DF0B 1BF5A 3D75A 3CDNA 4PE7A 2KAXA 1HQVA 3D76A 4GAOA 1J1DA 1KSMA 1IG5A 4C0KA 2R2IA 5DKQA 1QLKA 1JBAA 3BXKA 1F70A 4C0JA 3QRXA 1BR4B 2BE4A 1TTXA 2M9GA 3L4AA 2V53A 3M0WA 1UP5A 3CS1A 4GBAA 5K89A 2B1UA 2MAZA 3BUXB 5D3OA 3CZ0A 3VRRA 1SKTA 1S26D 3CR5X 3EKJA 2NCPA 1V1FA 2ZFDA 4M2QA 5I2OA 2MLEC 1G33A 1M31A 3VB1A 3OGNA 3JTDB 1DJGA 3PJIA 1CDPA 2LNKA 2F2OA 2EC6B 1HT9A 1ZFSA 1DMOA 3OX6A 2AAOA 2HF5A 2LMTA 1TNQA 2L2EA 2M1UA 3DVEA 4MZKA 3LK0A 1ZUZA 1ZOTB 3D78A 3GK4X 1Z2CB 3L4LA 4OR9B 2H61A 2M3WA 3K1EA 4MSPA 4OVNF 2CBLA 3FWCA 1KCYA 3CR2A 1MWNA 2LP3A 4PHMA 1KFXS 5FI2A 2L2CA 3FE6A 3DYEA 3TUYB 4AQIA 1TWOA 5ER4X 1NYAA 4JKTA 4YGEB 1B7TY 4PHNA 5B8IB 3D0YA 1SL8A 4YGCB 4A4BA 5AFPA 2CT9A 2MRDA 1YRUB 1PALA 3O4YA 1ORGA 4YGAA 1AK8A 1ZACA 5I94A 4IJ7A 2KDHA 1QTXA 3SIAA 2I2RE 1CLMA 2LVKA 2A4JA 3CLNA 1W7IB 3JVTB 5FI6A 4YI8A 2LMVA 1E8AA 4E68A 2LVJA 1SPYA 1F71A 1NIWA 1YX7A 3I5IC 3SJSA 1ALVA 1RROA 1SR6C 1CFDA 1XK4C 2KYCA 2MHHA 2K2AA 3QMEA 3TS5C 3PLFB 4CPVA 5HLOA 3BUNB 4GGFA 4ETOA 2BL0C 4INWA 4WRIA 3I5FC 1BODA 1Q80A 1RECA 2K7OA 3PM2A 4BY5A 1IGVA 2WC6A 3EG5B 1K95A 1NWDA 4MRXA 3RZSA 4UPGA 4F0ZB 1RFJA 3GK1A 2ZNDA 2JT0A 2K0JA 3OX5A 3PN7B 4N1GA 5D7FA 3WHUB 1TOPA 2BCBA 5IBWA 5BPJA 5KU1A 1BR1B 1CLBA 1XA5A 2JRFA 2VRGA 1NCXA 1CFCA 2KGRA 3B87A 2JXCA 2YGUA 2L50A 2M49B 2CTNA 1GM0A 1SY9A 2LMUA 3S0DA 1NCYA 3CWGA 3NSOA 2KFFA 1PRWA 1N2DA 1OE9B 1G4YR 1DJYA 2JXLA 5FYXA 1F4QA 4OV2A 4WQ3A 1NX2A 1S5GY 2JT3A 3R1VA 5D69A 1B1GA 1QX7A 3SG5A 4QJ5B 1Y6WA 1FI5A 2F2PA 1A4PA 3AAJA 2KQYA 3CGAA 1QATA 3LLEA 4MZJA 1K93D 3S0AA 1TUZA 1BU3A 1P28A 1KWOB 1L7ZA 1K90D 2NCOA 4GNKB 2I18A 1PSRA 1KK7Z 1DJXA 4BY4A 2JNFA 4WQ2A 4MRYA 1J7RA 5J3XA 4XJKA 2L5XB 4MVFA 2K7DA 3BQ3A 3BUMB 3IQQA 4GUKA 3V2LA 1QXPA 3IQOA 1LA3A 1GJYA 1YUSA 1KQMC 2HETA 1QVIY 1MR8A 3ICBA 4HREE 3CZ1A 2KGBC 2JQ6A 1KSOA 1DT7B 3BYAA 1ALWA 1XFRA 2QEHA 2DOQA 1M39A 4N5XA 4ZCUA 1LA0A 1K8UA 1CDLA 1CM4A 3CR4X 4DIRA 2NZ0A 2LAPA 4XJKB 1SCMC 5AANA 3SG4A 2LVIA 3I5GC 4FTGA 1TCFA 3TDZA 2F33A 5KSZA 4OZDA 1OMDA 1LS8A 4R1EA 2KFHA 1DVIA 3CYZA 3D74A 1F54A 1NPQA 2JWWA 1TRFA 3BFHA 1DEKA 1OQPA 1S6IA 3NSLA 4JD9A 1K9UA 2LUCA 1BOCA 2GV5A 2P71A 4HRGA 1QWVA 4DS7A 1QLSA 2BBMA 2RGIA 4MN0A 2AMIA 4ORCB 1TUJA 2BE6A 1SW8A 2WNDA 2CCMA 1K96A 1K9PA 1QIVA 2GTEA 1OW4A 3EK7A 4XYNA 1DJIA 3DY9A 1SK6D 1OSAA 1FBVA 1C7WA 1F4OA 2BKHB 3E3RA 1JFJA 1H8BA 2SASA 2Y5IA 2KPHA 3F45A 3NSKA 4DUQA 1J7QA 5HLVA 3AKBA 2QEOA 5KTYA 2E30A 1DQEA 4QJ3B 3ZWHA 1WLMA 1J7PA 1YRTB 2GGZA 1MXLC 1N0YA 3SS5A 2L4HA 2JTTA 4CLNA 2HQ8A 2LM5A 3EVUA 1B4CA 1WRLA 1IH0A 1TCOB 3FS7A 2P70A 4CFQA 4YGBB 1U5IA 3NGVA 1M46A 1VRKA 1CDNA 2KI4B 1FPWA 1C3YA 2KFGA 1EXRA 1RJVA 1XK4A 1YURA 2EGDA 2JOJA 1W7JB 2AUCA 3B7AA 1OOFA 2FOTA 3B6XA 1XFZO 1CMGA 3VGOA 1KK8C 1PK0D 1QV1A 2KNEA 1KFXL 4JWQA 2NLNA 1G8IA 1Y1XA 3TZ1A 2FCDA 4PALA 1YX8A 3TDUA 5TNCA 2L0PA 2WC5A 3SG7A 1M45A 1U5IB 2GGMA 3RM1A 3SG6A 2WCKA 5GQQC 3WHTB 1V1GA 2EC6C 2PQLA 3I5IB 1OOIX 1OMRA 2LCPA 1ODBA 2LP2A 1DGVA 3HX4A 3TS5B 1PVBA 2WCLA 4N1FA 1IIOA 2BL0B 1JC2A 3WXAA 3I5FB 1FF1A 1RWYA 1M63B 1YVLA 3VRQA 1DJWA 3KF9A 3D0YB 2ZRTA 1B7TZ 1S6CA 3C1VA 2KLEA 1FW4A 1LINA 3A8RA 3A4UB 3KPXA 1WDCB 2H8VA 2WCBA 4AQJA 2LHLA 1SCVA 2KBMA 4TNCA 3NHIA 1L2OB 1Y1AA 2JNXA 5PALA 1IJ5A 3N7HA 4GPLB 2LHIA 2QEBA 2KAYA 1S36A 4MLWA 1CM1A 3BOWA 2H2KA 1CLLA 1Y0VH 2WCFA 2WOSA 1YUTA 3FE8A 3JVTC 1JWDA 2KI6D 2KQ6A 2Y4QA 2PRUA 3HCMA 5G08A 1NCZA 1WLZA 1XFWO 2BCXA 5DKRA 1IQ3A 1KFUS 4PT1A 3FIAA 2LC5A 2Q4UA 4FQOA 2G9BA 1NSHA 1QS7A 1KFUL 2M29A 1SSEB 2CNPA 1A2XA 3KO0A 3CABA 4NDDA 1GGZA 2KAVA 1PSBA 2LANA 2WORA 3BOWB 4NQGA 2MLFC 5HKWA 4PHJA 3IF7A 3DXLA 3UNWA 2OTGB 4P5OE 3BFBA 1AJ5A 2BKIB 2QPTA 2WCJA 3SS4A 1OMVA 1QJTA 1R6PA 1KQMB 4PHKA 1TN4A 3AAKA 4YRUA 1JSAA 1UHNA 1EG3A 1LKJA 1XYDA 4IL1A 1UHJA 1Z4HA 1S5GZ 2KOTA 2OS8C 4USLA 1CMFA 3PALA 1YVHA 4Q04A 1SRAA 5AERA 2K2FA 1SYMA 4A4CA 3GOFA 1AP4A 1SCMB 4HSZA 5CSIA 2JULA 4PDZA 1FI6A 1WY9A 4NDBA 1CTRA 1K2HA 1KQVA 2JU0A 2PYQA 1JF0A 2BNXA 3KEVA 1CNPA 2M0RA 4M2OA 2FCEA 1IQ5A 3PFVA 4OCIA 3WNXB 2ZN9A 1DC1A 2LLUA 5AEQA 2ISDA 1QVIZ 3I5HC 3CZ2A 5F6TA 1F55A 3OHMB 3TDIA 4CIDA 2JTZA 2IS9A 3BJHA 1DF0A 1NX3A 2KLDA 1CFFA 2PMYA 3CTNA 1OOJA 1YR5A 3K21A 5FI7A 1S6JA 1JFKA 5I2QA 1W9ZA 1XVJA 3DVKA 3AKAA 2KI6C 2JPOA 4YGDB 2LVVA 1C7VA 2O60A 1XO5A 1AHRA 2ZKMX 3VRNA 1DTLA 2L51A 2LUXA 4I5KA 1T14A 2MJWB 2M8UA 3NXAA 2PASA 4YBHB 1WRKA 5JJGA 4MEWA 1CFPA 4L9MA 1JF2A 1N65A 2ZNEA 5DKNA 3ZNIA 3D77A 2PALA 2PSRA 4M2PA 2K7CA 2F3ZA 4HRHA 3S0GA 1UWOA 4ORAB 2HPSA 3DF0A 1MQ1A 4PE4A 1QX5B 3DVJA 4I5JA 1PVAA 2WCMA 5ER5A 2K8MB 3O78A 4OKHA 1D1OA 1KK8B 1XFYO 2CXJA 2LLSA 1BLQA 4GFTA 3SG3A 1GGWA 4U8DA 4CFRA 1BMOA
chains in the Genus database with same CATH topology
1P28A 3NHIA 5EL2A 3B88A 3N7HA 2QEBA 3FE9A 3V2LA 4F7FA 3D75A 3FE8A 2FJYA 3S0EA 3CDNA 3CZ1A 3D76A 4PT1A 1XFRA 2QEHA 3L4AA 3CABA 2WCHA 3CZ0A 4OZDA 4FQTA 1LS8A 1OOHA 3DXLA 3D74A 3CYZA 3VB1A 3OGNA 3BFBA 3PJIA 3S0FA 2WCJA 3BFHA 4JD9A 2P71A 1QWVA 3D78A 5DICA 3B86A 2QEVA 3L4LA 2ERBA 1TUJA 3K1EA 2GTEA 1OW4A 3DY9A 2L2CA 3FE6A 3DYEA 1TWOA 3DZTA 2KPHA 3R1OA 2QEOA 1DQEA 3D73A 1C3ZA 3L47A 1ORGA 2QDIA 3CZ2A 2P70A 3BJHA 3NGVA 3QMEA 1C3YA 4INWA 3B7AA 3Q8IA 1OOFA 3B6XA 2JPOA 2WC6A 3RZSA 1T14A 3S0BA 1OOGA 2WC5A 3BFAA 3D77A 3B87A 3NHTA 2WCKA 2PQLA 3S0GA 1GM0A 1OOIX 3S0DA 4INXA 2WCLA 2WCMA 3R1VA 3R72A 3R1PA 2H8VA 3S0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P28 A;  3NHI A;  5EL2 A;  3B88 A;  3N7H A;  2QEB A;  3FE9 A;  3V2L A;  4F7F A;  3D75 A;  3FE8 A;  2FJY A;  3S0E A;  3CDN A;  3CZ1 A;  3D76 A;  4PT1 A;  1XFR A;  2QEH A;  3L4A A;  3CAB A;  2WCH A;  3CZ0 A;  4OZD A;  4FQT A;  1LS8 A;  1OOH A;  3DXL A;  3D74 A;  3CYZ A;  3VB1 A;  3OGN A;  3BFB A;  3PJI A;  3S0F A;  2WCJ A;  3BFH A;  4JD9 A;  2P71 A;  1QWV A;  3D78 A;  5DIC A;  3B86 A;  2QEV A;  3L4L A;  2ERB A;  1TUJ A;  3K1E A;  2GTE A;  1OW4 A;  3DY9 A;  2L2C A;  3FE6 A;  3DYE A;  1TWO A;  3DZT A;  2KPH A;  3R1O A;  2QEO A;  1DQE A;  3D73 A;  1C3Z A;  3L47 A;  1ORG A;  2QDI A;  3CZ2 A;  2P70 A;  3BJH A;  3NGV A;  3QME A;  1C3Y A;  4INW A;  3B7A A;  3Q8I A;  1OOF A;  3B6X A;  2JPO A;  2WC6 A;  3RZS A;  1T14 A;  3S0B A;  1OOG A;  2WC5 A;  3BFA A;  3D77 A;  3B87 A;  3NHT A;  2WCK A;  2PQL A;  3S0G A;  1GM0 A;  1OOI X;  3S0D A;  4INX A;  2WCL A;  2WCM A;  3R1V A;  3R72 A;  3R1P A;  2H8V A;  3S0A A; 
#chains in the Genus database with same CATH topology
 1BJF A;  1NUB A;  3OB1 B;  4ZCV A;  5EL2 A;  4I5N B;  3RLZ A;  1MF8 B;  1UUR A;  1A29 A;  1EH2 A;  2SCP A;  2I94 A;  2NXQ A;  3O2P A;  4MBE A;  3DF0 B;  3JTD C;  1TNP A;  3VRP A;  1MXE A;  1SL9 A;  3S0E A;  2FJY A;  1OZS A;  1EL4 A;  1LVC D;  1SR6 B;  1DJZ A;  5JOL A;  4I5L B;  5CSF A;  3DD4 A;  1SBJ A;  1B8L A;  2KI4 C;  1QV0 A;  2LLT A;  1IKU A;  4P2Y B;  2KSP A;  1K94 A;  3PAT A;  2KBI A;  4D1E A;  4C0L A;  1BG1 A;  1TNX A;  2K61 A;  3H4S E;  3TUY C;  2WCH A;  4ORB B;  4MZL A;  1TNW A;  2WCE A;  3KHE A;  1EG4 A;  4FQT A;  1OOH A;  2JZI A;  2COL B;  2L4I A;  5CSJ A;  1UHI A;  1XFX O;  2QAC A;  1CB1 A;  4NDC A;  3S0F A;  2BEC A;  3OB2 B;  5AXI A;  2M1K B;  3IVT A;  5CSN A;  2M7L A;  2H61 C;  3O6B A;  5HL1 A;  4GGN A;  4DRW A;  1C07 A;  2I7A A;  3BUW B;  1IRJ A;  1F8H A;  5DIC A;  1XFV O;  3B86 A;  2QEV A;  2OPO A;  1DEL A;  2ERB A;  2O5G A;  1CDM A;  1GQM A;  3DVM A;  2KYF A;  2LE9 B;  2Y1M A;  1IJ6 A;  1LXF C;  3EK4 A;  5HKY A;  1TIZ A;  2ZRS A;  4YI9 A;  3D10 A;  3DZT A;  2ZN8 A;  1WDC C;  1QIW A;  3R1O A;  3SG2 A;  1EJ3 A;  4QJ4 B;  1L2O C;  2L98 A;  3LL8 B;  3OBV A;  3D73 A;  1NX0 A;  1C3Z A;  2MBX A;  3L47 A;  3PN7 C;  1QAS A;  3O4X A;  1R2U A;  2FJU B;  3GK2 A;  1KK7 Y;  3VRO A;  1H4B A;  1SMG A;  5HYD A;  3OP0 A;  2QDI A;  1JUO A;  4PE1 A;  2HQW A;  1SNL A;  3CZT X;  1J7O A;  2BAP A;  2E6W A;  2OS8 B;  3EKH A;  4GGF C;  4KYN A;  2KHN A;  1NP8 A;  4PCW A;  3BUO B;  1UHH A;  2TN4 A;  1UHK A;  3LCP C;  3PM8 A;  3SIB A;  1AVS A;  1PUL A;  2M97 A;  1WRZ A;  3Q8I A;  4ICB A;  1MUX A;  4AOM A;  2K7B A;  3I5G B;  1IWQ A;  1XFU O;  2F8P A;  2JPT A;  1Y1U A;  2Q91 A;  2G2B A;  2PVB A;  2JC2 A;  3PSR A;  3S0B A;  1KWO C;  1OOG A;  2LV7 A;  4PE0 A;  1SL7 A;  1X02 A;  3LK1 A;  3BFA A;  2OTG C;  1YTZ C;  1RTP 1;  3EVR A;  1B47 A;  3NHT A;  3I5H B;  4JQ0 D;  3MSE B;  3FWB A;  1S3P A;  1A75 A;  1BT6 A;  1K9K A;  2K60 A;  2EHB A;  1UUS A;  1NX1 A;  3NSI A;  1AUI B;  4INX A;  1DJH A;  2BBN A;  4DCK A;  1B8C A;  2F3Y A;  2D8N A;  3R72 A;  1RK9 A;  1J55 A;  1CKK A;  4JPZ B;  1QX2 A;  3SS3 A;  3R1P A;  1B9A A;  5CPV A;  2M7N A;  1ZMZ A;  2L5Y A;  1J1E A;  1A03 A;  3B88 A;  5HKZ A;  1YUU A;  1OZO A;  2MA2 A;  2Y1N A;  3EVV A;  1A75 B;  3FE9 A;  5I2L A;  1B8R A;  2JT8 A;  2WC8 A;  2P6B B;  1MHO A;  2BCA A;  1DGU A;  1S1E A;  1AJ4 A;  3EK8 A;  3UO9 A;  4F7F A;  5I8N A;  1DF0 B;  1BF5 A;  3D75 A;  3CDN A;  4PE7 A;  2KAX A;  1HQV A;  3D76 A;  4GAO A;  1J1D A;  1KSM A;  1IG5 A;  4C0K A;  2R2I A;  5DKQ A;  1QLK A;  1JBA A;  3BXK A;  1F70 A;  4C0J A;  3QRX A;  1BR4 B;  2BE4 A;  1TTX A;  2M9G A;  3L4A A;  2V53 A;  3M0W A;  1UP5 A;  3CS1 A;  4GBA A;  5K89 A;  2B1U A;  2MAZ A;  3BUX B;  5D3O A;  3CZ0 A;  3VRR A;  1SKT A;  1S26 D;  3CR5 X;  3EKJ A;  2NCP A;  1V1F A;  2ZFD A;  4M2Q A;  5I2O A;  2MLE C;  1G33 A;  1M31 A;  3VB1 A;  3OGN A;  3JTD B;  1DJG A;  3PJI A;  1CDP A;  2LNK A;  2F2O A;  2EC6 B;  1HT9 A;  1ZFS A;  1DMO A;  3OX6 A;  2AAO A;  2HF5 A;  2LMT A;  1TNQ A;  2L2E A;  2M1U A;  3DVE A;  4MZK A;  3LK0 A;  1ZUZ A;  1ZOT B;  3D78 A;  3GK4 X;  1Z2C B;  3L4L A;  4OR9 B;  2H61 A;  2M3W A;  3K1E A;  4MSP A;  4OVN F;  2CBL A;  3FWC A;  1KCY A;  3CR2 A;  1MWN A;  2LP3 A;  4PHM A;  1KFX S;  5FI2 A;  2L2C A;  3FE6 A;  3DYE A;  3TUY B;  4AQI A;  1TWO A;  5ER4 X;  1NYA A;  4JKT A;  4YGE B;  1B7T Y;  4PHN A;  5B8I B;  3D0Y A;  1SL8 A;  4YGC B;  4A4B A;  5AFP A;  2CT9 A;  2MRD A;  1YRU B;  1PAL A;  3O4Y A;  1ORG A;  4YGA A;  1AK8 A;  1ZAC A;  5I94 A;  4IJ7 A;  2KDH A;  1QTX A;  3SIA A;  2I2R E;  1CLM A;  2LVK A;  2A4J A;  3CLN A;  1W7I B;  3JVT B;  5FI6 A;  4YI8 A;  2LMV A;  1E8A A;  4E68 A;  2LVJ A;  1SPY A;  1F71 A;  1NIW A;  1YX7 A;  3I5I C;  3SJS A;  1ALV A;  1RRO A;  1SR6 C;  1CFD A;  1XK4 C;  2KYC A;  2MHH A;  2K2A A;  3QME A;  3TS5 C;  3PLF B;  4CPV A;  5HLO A;  3BUN B;  4GGF A;  4ETO A;  2BL0 C;  4INW A;  4WRI A;  3I5F C;  1BOD A;  1Q80 A;  1REC A;  2K7O A;  3PM2 A;  4BY5 A;  1IGV A;  2WC6 A;  3EG5 B;  1K95 A;  1NWD A;  4MRX A;  3RZS A;  4UPG A;  4F0Z B;  1RFJ A;  3GK1 A;  2ZND A;  2JT0 A;  2K0J A;  3OX5 A;  3PN7 B;  4N1G A;  5D7F A;  3WHU B;  1TOP A;  2BCB A;  5IBW A;  5BPJ A;  5KU1 A;  1BR1 B;  1CLB A;  1XA5 A;  2JRF A;  2VRG A;  1NCX A;  1CFC A;  2KGR A;  3B87 A;  2JXC A;  2YGU A;  2L50 A;  2M49 B;  2CTN A;  1GM0 A;  1SY9 A;  2LMU A;  3S0D A;  1NCY A;  3CWG A;  3NSO A;  2KFF A;  1PRW A;  1N2D A;  1OE9 B;  1G4Y R;  1DJY A;  2JXL A;  5FYX A;  1F4Q A;  4OV2 A;  4WQ3 A;  1NX2 A;  1S5G Y;  2JT3 A;  3R1V A;  5D69 A;  1B1G A;  1QX7 A;  3SG5 A;  4QJ5 B;  1Y6W A;  1FI5 A;  2F2P A;  1A4P A;  3AAJ A;  2KQY A;  3CGA A;  1QAT A;  3LLE A;  4MZJ A;  1K93 D;  3S0A A;  1TUZ A;  1BU3 A;  1P28 A;  1KWO B;  1L7Z A;  1K90 D;  2NCO A;  4GNK B;  2I18 A;  1PSR A;  1KK7 Z;  1DJX A;  4BY4 A;  2JNF A;  4WQ2 A;  4MRY A;  1J7R A;  5J3X A;  4XJK A;  2L5X B;  4MVF A;  2K7D A;  3BQ3 A;  3BUM B;  3IQQ A;  4GUK A;  3V2L A;  1QXP A;  3IQO A;  1LA3 A;  1GJY A;  1YUS A;  1KQM C;  2HET A;  1QVI Y;  1MR8 A;  3ICB A;  4HRE E;  3CZ1 A;  2KGB C;  2JQ6 A;  1KSO A;  1DT7 B;  3BYA A;  1ALW A;  1XFR A;  2QEH A;  2DOQ A;  1M39 A;  4N5X A;  4ZCU A;  1LA0 A;  1K8U A;  1CDL A;  1CM4 A;  3CR4 X;  4DIR A;  2NZ0 A;  2LAP A;  4XJK B;  1SCM C;  5AAN A;  3SG4 A;  2LVI A;  3I5G C;  4FTG A;  1TCF A;  3TDZ A;  2F33 A;  5KSZ A;  4OZD A;  1OMD A;  1LS8 A;  4R1E A;  2KFH A;  1DVI A;  3CYZ A;  3D74 A;  1F54 A;  1NPQ A;  2JWW A;  1TRF A;  3BFH A;  1DEK A;  1OQP A;  1S6I A;  3NSL A;  4JD9 A;  1K9U A;  2LUC A;  1BOC A;  2GV5 A;  2P71 A;  4HRG A;  1QWV A;  4DS7 A;  1QLS A;  2BBM A;  2RGI A;  4MN0 A;  2AMI A;  4ORC B;  1TUJ A;  2BE6 A;  1SW8 A;  2WND A;  2CCM A;  1K96 A;  1K9P A;  1QIV A;  2GTE A;  1OW4 A;  3EK7 A;  4XYN A;  1DJI A;  3DY9 A;  1SK6 D;  1OSA A;  1FBV A;  1C7W A;  1F4O A;  2BKH B;  3E3R A;  1JFJ A;  1H8B A;  2SAS A;  2Y5I A;  2KPH A;  3F45 A;  3NSK A;  4DUQ A;  1J7Q A;  5HLV A;  3AKB A;  2QEO A;  5KTY A;  2E30 A;  1DQE A;  4QJ3 B;  3ZWH A;  1WLM A;  1J7P A;  1YRT B;  2GGZ A;  1MXL C;  1N0Y A;  3SS5 A;  2L4H A;  2JTT A;  4CLN A;  2HQ8 A;  2LM5 A;  3EVU A;  1B4C A;  1WRL A;  1IH0 A;  1TCO B;  3FS7 A;  2P70 A;  4CFQ A;  4YGB B;  1U5I A;  3NGV A;  1M46 A;  1VRK A;  1CDN A;  2KI4 B;  1FPW A;  1C3Y A;  2KFG A;  1EXR A;  1RJV A;  1XK4 A;  1YUR A;  2EGD A;  2JOJ A;  1W7J B;  2AUC A;  3B7A A;  1OOF A;  2FOT A;  3B6X A;  1XFZ O;  1CMG A;  3VGO A;  1KK8 C;  1PK0 D;  1QV1 A;  2KNE A;  1KFX L;  4JWQ A;  2NLN A;  1G8I A;  1Y1X A;  3TZ1 A;  2FCD A;  4PAL A;  1YX8 A;  3TDU A;  5TNC A;  2L0P A;  2WC5 A;  3SG7 A;  1M45 A;  1U5I B;  2GGM A;  3RM1 A;  3SG6 A;  2WCK A;  5GQQ C;  3WHT B;  1V1G A;  2EC6 C;  2PQL A;  3I5I B;  1OOI X;  1OMR A;  2LCP A;  1ODB A;  2LP2 A;  1DGV A;  3HX4 A;  3TS5 B;  1PVB A;  2WCL A;  4N1F A;  1IIO A;  2BL0 B;  1JC2 A;  3WXA A;  3I5F B;  1FF1 A;  1RWY A;  1M63 B;  1YVL A;  3VRQ A;  1DJW A;  3KF9 A;  3D0Y B;  2ZRT A;  1B7T Z;  1S6C A;  3C1V A;  2KLE A;  1FW4 A;  1LIN A;  3A8R A;  3A4U B;  3KPX A;  1WDC B;  2H8V A;  2WCB A;  4AQJ A;  2LHL A;  1SCV A;  2KBM A;  4TNC A;  3NHI A;  1L2O B;  1Y1A A;  2JNX A;  5PAL A;  1IJ5 A;  3N7H A;  4GPL B;  2LHI A;  2QEB A;  2KAY A;  1S36 A;  4MLW A;  1CM1 A;  3BOW A;  2H2K A;  1CLL A;  1Y0V H;  2WCF A;  2WOS A;  1YUT A;  3FE8 A;  3JVT C;  1JWD A;  2KI6 D;  2KQ6 A;  2Y4Q A;  2PRU A;  3HCM A;  5G08 A;  1NCZ A;  1WLZ A;  1XFW O;  2BCX A;  5DKR A;  1IQ3 A;  1KFU S;  4PT1 A;  3FIA A;  2LC5 A;  2Q4U A;  4FQO A;  2G9B A;  1NSH A;  1QS7 A;  1KFU L;  2M29 A;  1SSE B;  2CNP A;  1A2X A;  3KO0 A;  3CAB A;  4NDD A;  1GGZ A;  2KAV A;  1PSB A;  2LAN A;  2WOR A;  3BOW B;  4NQG A;  2MLF C;  5HKW A;  4PHJ A;  3IF7 A;  3DXL A;  3UNW A;  2OTG B;  4P5O E;  3BFB A;  1AJ5 A;  2BKI B;  2QPT A;  2WCJ A;  3SS4 A;  1OMV A;  1QJT A;  1R6P A;  1KQM B;  4PHK A;  1TN4 A;  3AAK A;  4YRU A;  1JSA A;  1UHN A;  1EG3 A;  1LKJ A;  1XYD A;  4IL1 A;  1UHJ A;  1Z4H A;  1S5G Z;  2KOT A;  2OS8 C;  4USL A;  1CMF A;  3PAL A;  1YVH A;  4Q04 A;  1SRA A;  5AER A;  2K2F A;  1SYM A;  4A4C A;  3GOF A;  1AP4 A;  1SCM B;  4HSZ A;  5CSI A;  2JUL A;  4PDZ A;  1FI6 A;  1WY9 A;  4NDB A;  1CTR A;  1K2H A;  1KQV A;  2JU0 A;  2PYQ A;  1JF0 A;  2BNX A;  3KEV A;  1CNP A;  2M0R A;  4M2O A;  2FCE A;  1IQ5 A;  3PFV A;  4OCI A;  3WNX B;  2ZN9 A;  1DC1 A;  2LLU A;  5AEQ A;  2ISD A;  1QVI Z;  3I5H C;  3CZ2 A;  5F6T A;  1F55 A;  3OHM B;  3TDI A;  4CID A;  2JTZ A;  2IS9 A;  3BJH A;  1DF0 A;  1NX3 A;  2KLD A;  1CFF A;  2PMY A;  3CTN A;  1OOJ A;  1YR5 A;  3K21 A;  5FI7 A;  1S6J A;  1JFK A;  5I2Q A;  1W9Z A;  1XVJ A;  3DVK A;  3AKA A;  2KI6 C;  2JPO A;  4YGD B;  2LVV A;  1C7V A;  2O60 A;  1XO5 A;  1AHR A;  2ZKM X;  3VRN A;  1DTL A;  2L51 A;  2LUX A;  4I5K A;  1T14 A;  2MJW B;  2M8U A;  3NXA A;  2PAS A;  4YBH B;  1WRK A;  5JJG A;  4MEW A;  1CFP A;  4L9M A;  1JF2 A;  1N65 A;  2ZNE A;  5DKN A;  3ZNI A;  3D77 A;  2PAL A;  2PSR A;  4M2P A;  2K7C A;  2F3Z A;  4HRH A;  3S0G A;  1UWO A;  4ORA B;  2HPS A;  3DF0 A;  1MQ1 A;  4PE4 A;  1QX5 B;  3DVJ A;  4I5J A;  1PVA A;  2WCM A;  5ER5 A;  2K8M B;  3O78 A;  4OKH A;  1D1O A;  1KK8 B;  1XFY O;  2CXJ A;  2LLS A;  1BLQ A;  4GFT A;  3SG3 A;  1GGW A;  4U8D A;  4CFR A;  1BMO A; 
#chains in the Genus database with same CATH homology
 1P28 A;  3NHI A;  5EL2 A;  3B88 A;  3N7H A;  2QEB A;  3FE9 A;  3V2L A;  4F7F A;  3D75 A;  3FE8 A;  2FJY A;  3S0E A;  3CDN A;  3CZ1 A;  3D76 A;  4PT1 A;  1XFR A;  2QEH A;  3L4A A;  3CAB A;  2WCH A;  3CZ0 A;  4OZD A;  4FQT A;  1LS8 A;  1OOH A;  3DXL A;  3D74 A;  3CYZ A;  3VB1 A;  3OGN A;  3BFB A;  3PJI A;  3S0F A;  2WCJ A;  3BFH A;  4JD9 A;  2P71 A;  1QWV A;  3D78 A;  5DIC A;  3B86 A;  2QEV A;  3L4L A;  2ERB A;  1TUJ A;  3K1E A;  2GTE A;  1OW4 A;  3DY9 A;  2L2C A;  3FE6 A;  3DYE A;  1TWO A;  3DZT A;  2KPH A;  3R1O A;  2QEO A;  1DQE A;  3D73 A;  1C3Z A;  3L47 A;  1ORG A;  2QDI A;  3CZ2 A;  2P70 A;  3BJH A;  3NGV A;  3QME A;  1C3Y A;  4INW A;  3B7A A;  3Q8I A;  1OOF A;  3B6X A;  2JPO A;  2WC6 A;  3RZS A;  1T14 A;  3S0B A;  1OOG A;  2WC5 A;  3BFA A;  3D77 A;  3B87 A;  3NHT A;  2WCK A;  2PQL A;  3S0G A;  1GM0 A;  1OOI X;  3S0D A;  4INX A;  2WCL A;  2WCM A;  3R1V A;  3R72 A;  3R1P A;  2H8V A;  3S0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...