3CYZA

Dimeric crystal structure of a pheromone binding protein from apis mellifera in complex with 9-keto-2(e)-decenoic acid at ph 7.0
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
total genus 37
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cyzA00
3D75A 3D73A 1DQEA 3RZSA 2GTEA 3CDNA 2ERBA 3NHIA 2FJYA 1T14A 5EL2A 3B87A 2WCJA 3DY9A 2WC5A 3D78A 3D77A 2WCMA 3DXLA 3S0EA 3L4AA 1OOFA 1OW4A 3NHTA 3CZ1A 3BJHA 2WC6A 2WCKA 3B86A 3S0DA 2QEBA 3B7AA 3DYEA 3OGNA 3Q8IA 3BFHA 3K1EA 2KPHA 2WCHA 4F7FA 3DZTA 3B6XA 3S0AA 1C3YA 3S0FA 1ORGA 1C3ZA 4OZDA 3FE9A 3QMEA 1OOHA 3R72A 3N7HA 2WCLA 3D74A 3L4LA 2P70A 4INXA 3V2LA 4JD9A 3NGVA 2PQLA 2QEVA 3FE6A 1OOGA 2QEOA 3VB1A 4INWA 1TWOA 4PT1A 3S0GA 5DICA 1OOIX 2QEHA 3CABA 3L47A 2QDIA 4FQTA 3R1PA 3BFBA 1XFRA 1LS8A 2L2CA 3CZ0A 2H8VA 1P28A 3R1OA 3CZ2A 3BFAA 3D76A 1QWVA 3FE8A 2JPOA 3PJIA 2P71A 1GM0A 1TUJA 3CYZA 3R1VA 3B88A 3S0BA
chains in the Genus database with same CATH superfamily
1EJ3A 1FI5A 3D73A 1WDCC 1R2UA 1DJIA 3I5FC 1IQ3A 1QX2A 2F2PA 2PMYA 1NCXA 3TS5B 1BU3A 3CDNA 3BOWA 3IQOA 1JF2A 2AUCA 3NHIA 2BL0C 3BQ3A 1FBVA 4M2OA 2PSRA 1UHJA 2LCPA 1K95A 2K2AA 1XFVO 2WCJA 4U8DA 1TIZA 1ZACA 2KFHA 3WXAA 2WCMA 2L50A 3EK8A 3SG3A 3I5HC 3TDZA 3OHMB 1J1EA 2K61A 1CFCA 3L4AA 2TN4A 3ICBA 3NSLA 1OSAA 1OW4A 3DVJA 1AK8A 3JTDC 1K8UA 1KQMC 2QACA 4P2YB 1SKTA 2ZKMX 2EC6C 2WCKA 1S36A 3OB1B 3VGOA 2JXLA 4ZCVA 4QJ4B 1B7TY 3TDIA 2O5GA 2H61C 1J55A 1LXFC 1A75A 3OGNA 2KDHA 2KOTA 4F0ZB 1YTZC 3EKHA 3BFHA 4GFTA 4NDDA 3SJSA 1RROA 1TTXA 4HSZA 1NUBA 1BLQA 3BUXB 4PHNA 1QV0A 3SIAA 1EH2A 4MBEA 3B6XA 1A03A 1QTXA 1F4OA 1JWDA 1IG5A 1QATA 2BNXA 4I5LB 4A4CA 3PN7C 1NWDA 2KQYA 1C3YA 2LUXA 3S0FA 1ORGA 2K2FA 1F55A 4IJ7A 4C0JA 4OZDA 3KO0A 2KI6D 4GGNA 1QS7A 5FI6A 1KFUS 2WCLA 1Y1AA 1YVLA 2M8UA 3WHUB 5HKWA 3L4LA 1UUSA 3TUYC 1VRKA 4GGFA 3EG5B 4YBHB 3V2LA 4CLNA 3DF0B 2PRUA 5AANA 4JQ0D 1B7TZ 2PQLA 1S26D 1TNQA 2QEVA 1CB1A 1XO5A 1SL8A 1AJ4A 2K8MB 2KAYA 1M63B 1V1GA 2H2KA 2WNDA 1SR6B 2BBMA 4N1GA 2LLUA 3EK4A 1OOIX 2CBLA 2ZNEA 3PM8A 4PHJA 1CTRA 5ER4X 5DKNA 5BPJA 3GK1A 4C0KA 2BE6A 2M3WA 1XFUO 1IIOA 3EVVA 1DJWA 3BFBA 1XFWO 3F45A 1XFRA 1K90D 1OMRA 4HREE 2ISDA 2LLSA 2BCAA 1OOJA 4M2QA 1XYDA 5I2QA 2LVIA 1LS8A 2L2CA 2WORA 2NZ0A 3EKJA 3JVTB 4GBAA 5KTYA 1CMFA 2NCOA 2E6WA 1FPWA 3R1OA 5GQQC 2CTNA 1QWVA 2L2EA 2MLFC 5J3XA 3I5FB 4XJKB 3EK7A 3DF0A 4MZKA 1GQMA 2LP3A 4QJ5B 3PJIA 1BODA 1GGWA 2BAPA 1DEKA 4N5XA 4PDZA 1KSOA 4WRIA 4USLA 4CFQA 2NLNA 4MVFA 3R1VA 1WY9A 2BL0B 2LVJA 1HT9A 1MQ1A 1CDPA 1L2OC 1WRLA 1QIWA 2CT9A 3BOWB 4GAOA 2LHIA 3FWBA 1YR5A 4P5OE 5JJGA 2OTGC 1WLZA 3I5IC 3SIBA 1KWOB 1S3PA 3AKBA 2FJYA 5B8IB 1NX0A 3A8RA 4ICBA 1CLMA 1KQMB 3DY9A 2WOSA 1KFUL 1ZUZA 1SY9A 2EC6B 2EGDA 3BYAA 4YGCB 5I94A 3D77A 2LMTA 1JF0A 3CGAA 3LK0A 1B47A 4MZJA 5F6TA 3DXLA 2HPSA 2KI4B 5TNCA 1N2DA 5HYDA 1U5IB 1IGVA 1H8BA 2Q91A 3SG5A 2L4IA 4AQJA 4YGAA 1OZOA 4XJKA 5G08A 2LAPA 3SS4A 3K21A 3AAKA 3SG4A 1KK8B 4YGDB 1K2HA 1TNXA 3IF7A 1UWOA 1A75B 3O78A 3S0DA 2PYQA 1TCFA 3GK2A 2HF5A 2Y5IA 1NX2A 1CM4A 2A4JA 2PASA 3B7AA 1C7VA 2KFGA 3VRQA 3ZWHA 1PULA 1XK4C 1OMVA 2LUCA 3SS3A 4YRUA 4E68A 1BR1B 1ALWA 2WCHA 1AJ5A 2CXJA 3BUWB 3HX4A 4HRGA 3DZTA 2I7AA 2GV5A 2L5YA 3OP0A 1S6CA 1JUOA 3EVRA 1BOCA 1SW8A 3M0WA 2CNPA 1MXLC 2L0PA 3PM2A 2ZRTA 2ZN8A 1J7PA 1GJYA 1CDMA 3A4UB 1U5IA 2H61A 1OMDA 1C3ZA 2LV7A 3TZ1A 1R6PA 1SMGA 2LC5A 1BG1A 1OOHA 3BXKA 2KAVA 1IH0A 1S5GY 1Z4HA 1QX5B 2KBMA 2MA2A 1TCOB 3D74A 2Q4UA 2P70A 2JT0A 3CLNA 4INXA 1B1GA 2AAOA 4PHMA 2JT3A 4UPGA 2CCMA 2P6BB 1FI6A 4I5NB 3FE6A 2JNXA 5I2OA 1YRTB 1V1FA 2G2BA 1UHKA 1XA5A 2JXCA 3PALA 4INWA 1JFJA 2KHNA 1DT7B 3LCPC 1H4BA 1DELA 1K96A 2JULA 5DICA 2LVVA 1QVIY 2FJUB 3CWGA 3WNXB 3CABA 3L47A 1XFZO 4GUKA 3DD4A 2OS8C 2BECA 2LMVA 5K89A 1N0YA 1YUTA 4C0LA 2BCBA 2H8VA 1L2OB 3I5GB 3AAJA 3NSOA 1NCYA 1QASA 1P28A 1S5GZ 1PK0D 4WQ3A 3BFAA 3D76A 1LA0A 1NPQA 1KQVA 4GPLB 1ALVA 1G4YR 4ORAB 2F3ZA 4NQGA 3TS5C 2BKIB 2P71A 3ZNIA 1PSRA 1N65A 2JZIA 2FOTA 1GM0A 2WCBA 3FS7A 3GK4X 3NSIA 1BMOA 1SNLA 1SPYA 1AUIB 1SCVA 3FIAA 4BY4A 4FTGA 1YRUB 1EXRA 3D75A 3AKAA 4Q04A 4PE1A 3DVKA 1SCMC 4JWQA 2Y4QA 4BY5A 3RZSA 5HKYA 4DS7A 1B9AA 1LVCD 1QVIZ 1WRKA 2BBNA 4JPZB 1MHOA 2KLDA 2LVKA 3SS5A 2ERBA 3OX5A 2LANA 1CFDA 5EL2A 3B87A 1TOPA 5KSZA 2SASA 1LA3A 1JC2A 2ZRSA 1C7WA 3D10A 1DJHA 1JBAA 1IRJA 2KYFA 4WQ2A 1NCZA 1DF0B 1MXEA 1WDCB 1Y6WA 2HQWA 4ETOA 1UHNA 3S0EA 4PE0A 1OOFA 3CR4X 1D1OA 1AHRA 2PVBA 1YURA 3E3RA 4PE4A 3OB2B 1TUZA 2FCEA 1J1DA 1CLBA 2R2IA 1KCYA 1CFFA 1EG4A 2BKHB 3DVMA 1K9PA 3BJHA 2ZNDA 3KF9A 1F70A 2WC6A 1A2XA 3B86A 1B8RA 1PVBA 1CFPA 2LHLA 2JTZA 2HQ8A 1WRZA 1DJGA 1YVHA 3I5HB 2K7CA 2QEBA 4ORBB 5DKRA 1JFKA 2K7DA 2Y1MA 4R1EA 1M46A 5CSJA 1G8IA 1HQVA 2NXQA 2I2RE 3K1EA 4YI9A 1Y1UA 2KPHA 1SL9A 2K0JA 1A4PA 3NSKA 3JTDB 1RFJA 3RLZA 5AERA 3KPXA 4F7FA 1CDNA 1CM1A 1J7RA 1YX8A 2L98A 2JNFA 1NX1A 1RK9A 3H4SE 1KK7Y 4MN0A 2L4HA 4MZLA 1C07A 2K60A 2V53A 2GGMA 2ZN9A 1DF0A 2EHBA 2LM5A 1SBJA 1G33A 2FCDA 2KFFA 1TNWA 2I94A 2M49B 4FQOA 2PALA 1BJFA 3FE9A 2YGUA 3R72A 1XK4A 2M29A 4PE7A 1NSHA 1IQ5A 1SR6C 2M0RA 3D0YA 3CS1A 1E8AA 2KNEA 2F2OA 3PN7B 3SG6A 4MLWA 4CIDA 1DJYA 2SCPA 1K94A 1KFXS 2KLEA 3NGVA 2KSPA 5PALA 1CLLA 1GGZA 1MR8A 1OE9B 1OOGA 2OPOA 2QEOA 2WCEA 1KSMA 1M31A 3TUYB 4DCKA 2JQ6A 3JVTC 1DJXA 1QX7A 1YUSA 1ZMZA 2QEHA 1YX7A 1W7JB 1AP4A 1Y1XA 4IL1A 2MBXA 1QLSA 2GGZA 5AXIA 1KK7Z 2IS9A 2LE9B 3SG2A 4FQTA 1EL4A 3VROA 2E30A 4AQIA 1Y0VH 4OKHA 1PSBA 2M9GA 1TRFA 2HETA 4PCWA 2MLEC 4DUQA 4DIRA 3CZ0A 2MJWB 1FW4A 5FI2A 4DRWA 1DC1A 1QJTA 4NDBA 5JOLA 3CR5X 1SCMB 4XYNA 5ER5A 2RGIA 2MHHA 3FE8A 2JPOA 1OZSA 1CMGA 1UP5A 3PFVA 3RM1A 4M2PA 1F71A 1TUJA 2K7OA 1KWOC 1RJVA 2B1UA 3EVUA 2LMUA 2MAZA 4GNKB 4MRXA 1BR4B 3B88A 2KQ6A 3NXAA 3S0BA 2JPTA 3UO9A 5AEQA 3PLFB 1IWQA 3O6BA 2M7NA 3KEVA 2M7LA 1DQEA 1SK6D 2LP2A 1PRWA 4N1FA 5HLVA 1RTP1 2KI4C 2M97A 5CSFA 2GTEA 3CTNA 1NIWA 1SSEB 2M1UA 4MRYA 1RECA 3TDUA 2KGBC 1DGUA 2L5XB 2VRGA 1S6IA 1T14A 1KK8C 1F4QA 3IVTA 4OCIA 1XVJA 5HLOA 4OV2A 2WC5A 4CFRA 3D78A 1F54A 3UNWA 3O4YA 2JC2A 1NYAA 4KYNA 4MEWA 4OVNF 5FYXA 1BT6A 1QLKA 4ORCB 2LNKA 3QRXA 5D3OA 1DTLA 1BF5A 5CPVA 2OTGB 1KFXL 3I5IB 1MUXA 3NHTA 3BUMB 3OX6A 2JOJA 1B8CA 3C1VA 1YUUA 2WC8A 3BUNB 1ZOTB 1AVSA 3CZ1A 4MSPA 1J7QA 2M1KB 2F3YA 2F8PA 3O2PA 1IKUA 2BE4A 1UURA 4NDCA 2G9BA 3SG7A 1CNPA 1DGVA 1QIVA 4HRHA 3VRRA 3DVEA 3LLEA 3IQQA 1MWNA 2NCPA 3DYEA 3HCMA 1K9UA 2I18A 2QPTA 2O60A 3Q8IA 1EG3A 1WLMA 3WHTB 1FF1A 1UHIA 1TN4A 2KGRA 4OR9B 4GGFC 2JWWA 3OBVA 4PHKA 4YGBB 2KI6C 1M45A 4A4BA 1W9ZA 1CKKA 3PSRA 2Y1NA 1NP8A 3S0AA 1CDLA 2L51A 1S1EA 2JT8A 4JKTA 1J7OA 5IBWA 1ODBA 4CPVA 4L9MA 3CR2A 1PALA 5FI7A 3D0YB 4YI8A 5D7FA 3QMEA 1NX3A 1DVIA 3N7HA 3MSEB 5KU1A 2MRDA 1Z2CB 5I2LA 2LLTA 5CSIA 2JTTA 4I5KA 1RWYA 4JD9A 1M39A 1DJZA 3LL8B 1TNPA 4YGEB 5AFPA 4I5JA 5I8NA 4TNCA 1QV1A 5HL1A 1B8LA 2K7BA 2F33A 3VB1A 1TWOA 1XFXO 4AOMA 2JU0A 2JRFA 1IJ5A 2KYCA 3KHEA 4PT1A 1DMOA 3CZTX 1X02A 3I5GC 5CSNA 3S0GA 1JSAA 1S6JA 1OQPA 1SYMA 1F8HA 1SL7A 1K9KA 2QDIA 4PALA 3R1PA 4QJ3B 3BUOB 5DKQA 1W7IB 1B4CA 1Q80A 2D8NA 4D1EA 1K93D 1XFYO 3LK1A 2BCXA 1QXPA 4ZCUA 1A29A 3VRPA 1LINA 1L7ZA 3FWCA 5D69A 3GOFA 3CZ2A 1SRAA 1PVAA 5HKZA 2ZFDA 1LKJA 2OS8B 2KAXA 2AMIA 2COLB 3O4XA 2WCFA 3CYZA 1MF8B 2KBIA 2DOQA 1UHHA 1ZFSA 3VRNA 3PATA 1IJ6A
chains in the Genus database with same CATH topology
3D75A 3D73A 1DQEA 3RZSA 2GTEA 3CDNA 2ERBA 3NHIA 2FJYA 1T14A 5EL2A 3B87A 2WCJA 3DY9A 2WC5A 3D78A 3D77A 2WCMA 3DXLA 3S0EA 3L4AA 1OOFA 1OW4A 3NHTA 3CZ1A 3BJHA 2WC6A 2WCKA 3B86A 3S0DA 2QEBA 3B7AA 3DYEA 3OGNA 3Q8IA 3BFHA 3K1EA 2KPHA 2WCHA 4F7FA 3DZTA 3B6XA 3S0AA 1C3YA 3S0FA 1ORGA 1C3ZA 4OZDA 3FE9A 3QMEA 1OOHA 3R72A 3N7HA 2WCLA 3D74A 3L4LA 2P70A 4INXA 3V2LA 4JD9A 3NGVA 2PQLA 2QEVA 3FE6A 1OOGA 2QEOA 3VB1A 4INWA 1TWOA 4PT1A 3S0GA 5DICA 1OOIX 2QEHA 3CABA 3L47A 2QDIA 4FQTA 3R1PA 3BFBA 1XFRA 1LS8A 2L2CA 3CZ0A 2H8VA 1P28A 3R1OA 3CZ2A 3BFAA 3D76A 1QWVA 3FE8A 2JPOA 3PJIA 2P71A 1GM0A 1TUJA 3CYZA 3R1VA 3B88A 3S0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D75 A;  3D73 A;  1DQE A;  3RZS A;  2GTE A;  3CDN A;  2ERB A;  3NHI A;  2FJY A;  1T14 A;  5EL2 A;  3B87 A;  2WCJ A;  3DY9 A;  2WC5 A;  3D78 A;  3D77 A;  2WCM A;  3DXL A;  3S0E A;  3L4A A;  1OOF A;  1OW4 A;  3NHT A;  3CZ1 A;  3BJH A;  2WC6 A;  2WCK A;  3B86 A;  3S0D A;  2QEB A;  3B7A A;  3DYE A;  3OGN A;  3Q8I A;  3BFH A;  3K1E A;  2KPH A;  2WCH A;  4F7F A;  3DZT A;  3B6X A;  3S0A A;  1C3Y A;  3S0F A;  1ORG A;  1C3Z A;  4OZD A;  3FE9 A;  3QME A;  1OOH A;  3R72 A;  3N7H A;  2WCL A;  3D74 A;  3L4L A;  2P70 A;  4INX A;  3V2L A;  4JD9 A;  3NGV A;  2PQL A;  2QEV A;  3FE6 A;  1OOG A;  2QEO A;  3VB1 A;  4INW A;  1TWO A;  4PT1 A;  3S0G A;  5DIC A;  1OOI X;  2QEH A;  3CAB A;  3L47 A;  2QDI A;  4FQT A;  3R1P A;  3BFB A;  1XFR A;  1LS8 A;  2L2C A;  3CZ0 A;  2H8V A;  1P28 A;  3R1O A;  3CZ2 A;  3BFA A;  3D76 A;  1QWV A;  3FE8 A;  2JPO A;  3PJI A;  2P71 A;  1GM0 A;  1TUJ A;  3CYZ A;  3R1V A;  3B88 A;  3S0B A; 
#chains in the Genus database with same CATH topology
 1EJ3 A;  1FI5 A;  3D73 A;  1WDC C;  1R2U A;  1DJI A;  3I5F C;  1IQ3 A;  1QX2 A;  2F2P A;  2PMY A;  1NCX A;  3TS5 B;  1BU3 A;  3CDN A;  3BOW A;  3IQO A;  1JF2 A;  2AUC A;  3NHI A;  2BL0 C;  3BQ3 A;  1FBV A;  4M2O A;  2PSR A;  1UHJ A;  2LCP A;  1K95 A;  2K2A A;  1XFV O;  2WCJ A;  4U8D A;  1TIZ A;  1ZAC A;  2KFH A;  3WXA A;  2WCM A;  2L50 A;  3EK8 A;  3SG3 A;  3I5H C;  3TDZ A;  3OHM B;  1J1E A;  2K61 A;  1CFC A;  3L4A A;  2TN4 A;  3ICB A;  3NSL A;  1OSA A;  1OW4 A;  3DVJ A;  1AK8 A;  3JTD C;  1K8U A;  1KQM C;  2QAC A;  4P2Y B;  1SKT A;  2ZKM X;  2EC6 C;  2WCK A;  1S36 A;  3OB1 B;  3VGO A;  2JXL A;  4ZCV A;  4QJ4 B;  1B7T Y;  3TDI A;  2O5G A;  2H61 C;  1J55 A;  1LXF C;  1A75 A;  3OGN A;  2KDH A;  2KOT A;  4F0Z B;  1YTZ C;  3EKH A;  3BFH A;  4GFT A;  4NDD A;  3SJS A;  1RRO A;  1TTX A;  4HSZ A;  1NUB A;  1BLQ A;  3BUX B;  4PHN A;  1QV0 A;  3SIA A;  1EH2 A;  4MBE A;  3B6X A;  1A03 A;  1QTX A;  1F4O A;  1JWD A;  1IG5 A;  1QAT A;  2BNX A;  4I5L B;  4A4C A;  3PN7 C;  1NWD A;  2KQY A;  1C3Y A;  2LUX A;  3S0F A;  1ORG A;  2K2F A;  1F55 A;  4IJ7 A;  4C0J A;  4OZD A;  3KO0 A;  2KI6 D;  4GGN A;  1QS7 A;  5FI6 A;  1KFU S;  2WCL A;  1Y1A A;  1YVL A;  2M8U A;  3WHU B;  5HKW A;  3L4L A;  1UUS A;  3TUY C;  1VRK A;  4GGF A;  3EG5 B;  4YBH B;  3V2L A;  4CLN A;  3DF0 B;  2PRU A;  5AAN A;  4JQ0 D;  1B7T Z;  2PQL A;  1S26 D;  1TNQ A;  2QEV A;  1CB1 A;  1XO5 A;  1SL8 A;  1AJ4 A;  2K8M B;  2KAY A;  1M63 B;  1V1G A;  2H2K A;  2WND A;  1SR6 B;  2BBM A;  4N1G A;  2LLU A;  3EK4 A;  1OOI X;  2CBL A;  2ZNE A;  3PM8 A;  4PHJ A;  1CTR A;  5ER4 X;  5DKN A;  5BPJ A;  3GK1 A;  4C0K A;  2BE6 A;  2M3W A;  1XFU O;  1IIO A;  3EVV A;  1DJW A;  3BFB A;  1XFW O;  3F45 A;  1XFR A;  1K90 D;  1OMR A;  4HRE E;  2ISD A;  2LLS A;  2BCA A;  1OOJ A;  4M2Q A;  1XYD A;  5I2Q A;  2LVI A;  1LS8 A;  2L2C A;  2WOR A;  2NZ0 A;  3EKJ A;  3JVT B;  4GBA A;  5KTY A;  1CMF A;  2NCO A;  2E6W A;  1FPW A;  3R1O A;  5GQQ C;  2CTN A;  1QWV A;  2L2E A;  2MLF C;  5J3X A;  3I5F B;  4XJK B;  3EK7 A;  3DF0 A;  4MZK A;  1GQM A;  2LP3 A;  4QJ5 B;  3PJI A;  1BOD A;  1GGW A;  2BAP A;  1DEK A;  4N5X A;  4PDZ A;  1KSO A;  4WRI A;  4USL A;  4CFQ A;  2NLN A;  4MVF A;  3R1V A;  1WY9 A;  2BL0 B;  2LVJ A;  1HT9 A;  1MQ1 A;  1CDP A;  1L2O C;  1WRL A;  1QIW A;  2CT9 A;  3BOW B;  4GAO A;  2LHI A;  3FWB A;  1YR5 A;  4P5O E;  5JJG A;  2OTG C;  1WLZ A;  3I5I C;  3SIB A;  1KWO B;  1S3P A;  3AKB A;  2FJY A;  5B8I B;  1NX0 A;  3A8R A;  4ICB A;  1CLM A;  1KQM B;  3DY9 A;  2WOS A;  1KFU L;  1ZUZ A;  1SY9 A;  2EC6 B;  2EGD A;  3BYA A;  4YGC B;  5I94 A;  3D77 A;  2LMT A;  1JF0 A;  3CGA A;  3LK0 A;  1B47 A;  4MZJ A;  5F6T A;  3DXL A;  2HPS A;  2KI4 B;  5TNC A;  1N2D A;  5HYD A;  1U5I B;  1IGV A;  1H8B A;  2Q91 A;  3SG5 A;  2L4I A;  4AQJ A;  4YGA A;  1OZO A;  4XJK A;  5G08 A;  2LAP A;  3SS4 A;  3K21 A;  3AAK A;  3SG4 A;  1KK8 B;  4YGD B;  1K2H A;  1TNX A;  3IF7 A;  1UWO A;  1A75 B;  3O78 A;  3S0D A;  2PYQ A;  1TCF A;  3GK2 A;  2HF5 A;  2Y5I A;  1NX2 A;  1CM4 A;  2A4J A;  2PAS A;  3B7A A;  1C7V A;  2KFG A;  3VRQ A;  3ZWH A;  1PUL A;  1XK4 C;  1OMV A;  2LUC A;  3SS3 A;  4YRU A;  4E68 A;  1BR1 B;  1ALW A;  2WCH A;  1AJ5 A;  2CXJ A;  3BUW B;  3HX4 A;  4HRG A;  3DZT A;  2I7A A;  2GV5 A;  2L5Y A;  3OP0 A;  1S6C A;  1JUO A;  3EVR A;  1BOC A;  1SW8 A;  3M0W A;  2CNP A;  1MXL C;  2L0P A;  3PM2 A;  2ZRT A;  2ZN8 A;  1J7P A;  1GJY A;  1CDM A;  3A4U B;  1U5I A;  2H61 A;  1OMD A;  1C3Z A;  2LV7 A;  3TZ1 A;  1R6P A;  1SMG A;  2LC5 A;  1BG1 A;  1OOH A;  3BXK A;  2KAV A;  1IH0 A;  1S5G Y;  1Z4H A;  1QX5 B;  2KBM A;  2MA2 A;  1TCO B;  3D74 A;  2Q4U A;  2P70 A;  2JT0 A;  3CLN A;  4INX A;  1B1G A;  2AAO A;  4PHM A;  2JT3 A;  4UPG A;  2CCM A;  2P6B B;  1FI6 A;  4I5N B;  3FE6 A;  2JNX A;  5I2O A;  1YRT B;  1V1F A;  2G2B A;  1UHK A;  1XA5 A;  2JXC A;  3PAL A;  4INW A;  1JFJ A;  2KHN A;  1DT7 B;  3LCP C;  1H4B A;  1DEL A;  1K96 A;  2JUL A;  5DIC A;  2LVV A;  1QVI Y;  2FJU B;  3CWG A;  3WNX B;  3CAB A;  3L47 A;  1XFZ O;  4GUK A;  3DD4 A;  2OS8 C;  2BEC A;  2LMV A;  5K89 A;  1N0Y A;  1YUT A;  4C0L A;  2BCB A;  2H8V A;  1L2O B;  3I5G B;  3AAJ A;  3NSO A;  1NCY A;  1QAS A;  1P28 A;  1S5G Z;  1PK0 D;  4WQ3 A;  3BFA A;  3D76 A;  1LA0 A;  1NPQ A;  1KQV A;  4GPL B;  1ALV A;  1G4Y R;  4ORA B;  2F3Z A;  4NQG A;  3TS5 C;  2BKI B;  2P71 A;  3ZNI A;  1PSR A;  1N65 A;  2JZI A;  2FOT A;  1GM0 A;  2WCB A;  3FS7 A;  3GK4 X;  3NSI A;  1BMO A;  1SNL A;  1SPY A;  1AUI B;  1SCV A;  3FIA A;  4BY4 A;  4FTG A;  1YRU B;  1EXR A;  3D75 A;  3AKA A;  4Q04 A;  4PE1 A;  3DVK A;  1SCM C;  4JWQ A;  2Y4Q A;  4BY5 A;  3RZS A;  5HKY A;  4DS7 A;  1B9A A;  1LVC D;  1QVI Z;  1WRK A;  2BBN A;  4JPZ B;  1MHO A;  2KLD A;  2LVK A;  3SS5 A;  2ERB A;  3OX5 A;  2LAN A;  1CFD A;  5EL2 A;  3B87 A;  1TOP A;  5KSZ A;  2SAS A;  1LA3 A;  1JC2 A;  2ZRS A;  1C7W A;  3D10 A;  1DJH A;  1JBA A;  1IRJ A;  2KYF A;  4WQ2 A;  1NCZ A;  1DF0 B;  1MXE A;  1WDC B;  1Y6W A;  2HQW A;  4ETO A;  1UHN A;  3S0E A;  4PE0 A;  1OOF A;  3CR4 X;  1D1O A;  1AHR A;  2PVB A;  1YUR A;  3E3R A;  4PE4 A;  3OB2 B;  1TUZ A;  2FCE A;  1J1D A;  1CLB A;  2R2I A;  1KCY A;  1CFF A;  1EG4 A;  2BKH B;  3DVM A;  1K9P A;  3BJH A;  2ZND A;  3KF9 A;  1F70 A;  2WC6 A;  1A2X A;  3B86 A;  1B8R A;  1PVB A;  1CFP A;  2LHL A;  2JTZ A;  2HQ8 A;  1WRZ A;  1DJG A;  1YVH A;  3I5H B;  2K7C A;  2QEB A;  4ORB B;  5DKR A;  1JFK A;  2K7D A;  2Y1M A;  4R1E A;  1M46 A;  5CSJ A;  1G8I A;  1HQV A;  2NXQ A;  2I2R E;  3K1E A;  4YI9 A;  1Y1U A;  2KPH A;  1SL9 A;  2K0J A;  1A4P A;  3NSK A;  3JTD B;  1RFJ A;  3RLZ A;  5AER A;  3KPX A;  4F7F A;  1CDN A;  1CM1 A;  1J7R A;  1YX8 A;  2L98 A;  2JNF A;  1NX1 A;  1RK9 A;  3H4S E;  1KK7 Y;  4MN0 A;  2L4H A;  4MZL A;  1C07 A;  2K60 A;  2V53 A;  2GGM A;  2ZN9 A;  1DF0 A;  2EHB A;  2LM5 A;  1SBJ A;  1G33 A;  2FCD A;  2KFF A;  1TNW A;  2I94 A;  2M49 B;  4FQO A;  2PAL A;  1BJF A;  3FE9 A;  2YGU A;  3R72 A;  1XK4 A;  2M29 A;  4PE7 A;  1NSH A;  1IQ5 A;  1SR6 C;  2M0R A;  3D0Y A;  3CS1 A;  1E8A A;  2KNE A;  2F2O A;  3PN7 B;  3SG6 A;  4MLW A;  4CID A;  1DJY A;  2SCP A;  1K94 A;  1KFX S;  2KLE A;  3NGV A;  2KSP A;  5PAL A;  1CLL A;  1GGZ A;  1MR8 A;  1OE9 B;  1OOG A;  2OPO A;  2QEO A;  2WCE A;  1KSM A;  1M31 A;  3TUY B;  4DCK A;  2JQ6 A;  3JVT C;  1DJX A;  1QX7 A;  1YUS A;  1ZMZ A;  2QEH A;  1YX7 A;  1W7J B;  1AP4 A;  1Y1X A;  4IL1 A;  2MBX A;  1QLS A;  2GGZ A;  5AXI A;  1KK7 Z;  2IS9 A;  2LE9 B;  3SG2 A;  4FQT A;  1EL4 A;  3VRO A;  2E30 A;  4AQI A;  1Y0V H;  4OKH A;  1PSB A;  2M9G A;  1TRF A;  2HET A;  4PCW A;  2MLE C;  4DUQ A;  4DIR A;  3CZ0 A;  2MJW B;  1FW4 A;  5FI2 A;  4DRW A;  1DC1 A;  1QJT A;  4NDB A;  5JOL A;  3CR5 X;  1SCM B;  4XYN A;  5ER5 A;  2RGI A;  2MHH A;  3FE8 A;  2JPO A;  1OZS A;  1CMG A;  1UP5 A;  3PFV A;  3RM1 A;  4M2P A;  1F71 A;  1TUJ A;  2K7O A;  1KWO C;  1RJV A;  2B1U A;  3EVU A;  2LMU A;  2MAZ A;  4GNK B;  4MRX A;  1BR4 B;  3B88 A;  2KQ6 A;  3NXA A;  3S0B A;  2JPT A;  3UO9 A;  5AEQ A;  3PLF B;  1IWQ A;  3O6B A;  2M7N A;  3KEV A;  2M7L A;  1DQE A;  1SK6 D;  2LP2 A;  1PRW A;  4N1F A;  5HLV A;  1RTP 1;  2KI4 C;  2M97 A;  5CSF A;  2GTE A;  3CTN A;  1NIW A;  1SSE B;  2M1U A;  4MRY A;  1REC A;  3TDU A;  2KGB C;  1DGU A;  2L5X B;  2VRG A;  1S6I A;  1T14 A;  1KK8 C;  1F4Q A;  3IVT A;  4OCI A;  1XVJ A;  5HLO A;  4OV2 A;  2WC5 A;  4CFR A;  3D78 A;  1F54 A;  3UNW A;  3O4Y A;  2JC2 A;  1NYA A;  4KYN A;  4MEW A;  4OVN F;  5FYX A;  1BT6 A;  1QLK A;  4ORC B;  2LNK A;  3QRX A;  5D3O A;  1DTL A;  1BF5 A;  5CPV A;  2OTG B;  1KFX L;  3I5I B;  1MUX A;  3NHT A;  3BUM B;  3OX6 A;  2JOJ A;  1B8C A;  3C1V A;  1YUU A;  2WC8 A;  3BUN B;  1ZOT B;  1AVS A;  3CZ1 A;  4MSP A;  1J7Q A;  2M1K B;  2F3Y A;  2F8P A;  3O2P A;  1IKU A;  2BE4 A;  1UUR A;  4NDC A;  2G9B A;  3SG7 A;  1CNP A;  1DGV A;  1QIV A;  4HRH A;  3VRR A;  3DVE A;  3LLE A;  3IQQ A;  1MWN A;  2NCP A;  3DYE A;  3HCM A;  1K9U A;  2I18 A;  2QPT A;  2O60 A;  3Q8I A;  1EG3 A;  1WLM A;  3WHT B;  1FF1 A;  1UHI A;  1TN4 A;  2KGR A;  4OR9 B;  4GGF C;  2JWW A;  3OBV A;  4PHK A;  4YGB B;  2KI6 C;  1M45 A;  4A4B A;  1W9Z A;  1CKK A;  3PSR A;  2Y1N A;  1NP8 A;  3S0A A;  1CDL A;  2L51 A;  1S1E A;  2JT8 A;  4JKT A;  1J7O A;  5IBW A;  1ODB A;  4CPV A;  4L9M A;  3CR2 A;  1PAL A;  5FI7 A;  3D0Y B;  4YI8 A;  5D7F A;  3QME A;  1NX3 A;  1DVI A;  3N7H A;  3MSE B;  5KU1 A;  2MRD A;  1Z2C B;  5I2L A;  2LLT A;  5CSI A;  2JTT A;  4I5K A;  1RWY A;  4JD9 A;  1M39 A;  1DJZ A;  3LL8 B;  1TNP A;  4YGE B;  5AFP A;  4I5J A;  5I8N A;  4TNC A;  1QV1 A;  5HL1 A;  1B8L A;  2K7B A;  2F33 A;  3VB1 A;  1TWO A;  1XFX O;  4AOM A;  2JU0 A;  2JRF A;  1IJ5 A;  2KYC A;  3KHE A;  4PT1 A;  1DMO A;  3CZT X;  1X02 A;  3I5G C;  5CSN A;  3S0G A;  1JSA A;  1S6J A;  1OQP A;  1SYM A;  1F8H A;  1SL7 A;  1K9K A;  2QDI A;  4PAL A;  3R1P A;  4QJ3 B;  3BUO B;  5DKQ A;  1W7I B;  1B4C A;  1Q80 A;  2D8N A;  4D1E A;  1K93 D;  1XFY O;  3LK1 A;  2BCX A;  1QXP A;  4ZCU A;  1A29 A;  3VRP A;  1LIN A;  1L7Z A;  3FWC A;  5D69 A;  3GOF A;  3CZ2 A;  1SRA A;  1PVA A;  5HKZ A;  2ZFD A;  1LKJ A;  2OS8 B;  2KAX A;  2AMI A;  2COL B;  3O4X A;  2WCF A;  3CYZ A;  1MF8 B;  2KBI A;  2DOQ A;  1UHH A;  1ZFS A;  3VRN A;  3PAT A;  1IJ6 A; 
#chains in the Genus database with same CATH homology
 3D75 A;  3D73 A;  1DQE A;  3RZS A;  2GTE A;  3CDN A;  2ERB A;  3NHI A;  2FJY A;  1T14 A;  5EL2 A;  3B87 A;  2WCJ A;  3DY9 A;  2WC5 A;  3D78 A;  3D77 A;  2WCM A;  3DXL A;  3S0E A;  3L4A A;  1OOF A;  1OW4 A;  3NHT A;  3CZ1 A;  3BJH A;  2WC6 A;  2WCK A;  3B86 A;  3S0D A;  2QEB A;  3B7A A;  3DYE A;  3OGN A;  3Q8I A;  3BFH A;  3K1E A;  2KPH A;  2WCH A;  4F7F A;  3DZT A;  3B6X A;  3S0A A;  1C3Y A;  3S0F A;  1ORG A;  1C3Z A;  4OZD A;  3FE9 A;  3QME A;  1OOH A;  3R72 A;  3N7H A;  2WCL A;  3D74 A;  3L4L A;  2P70 A;  4INX A;  3V2L A;  4JD9 A;  3NGV A;  2PQL A;  2QEV A;  3FE6 A;  1OOG A;  2QEO A;  3VB1 A;  4INW A;  1TWO A;  4PT1 A;  3S0G A;  5DIC A;  1OOI X;  2QEH A;  3CAB A;  3L47 A;  2QDI A;  4FQT A;  3R1P A;  3BFB A;  1XFR A;  1LS8 A;  2L2C A;  3CZ0 A;  2H8V A;  1P28 A;  3R1O A;  3CZ2 A;  3BFA A;  3D76 A;  1QWV A;  3FE8 A;  2JPO A;  3PJI A;  2P71 A;  1GM0 A;  1TUJ A;  3CYZ A;  3R1V A;  3B88 A;  3S0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...