3PM8A

Cad domain of pff0520w, calcium dependent protein kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
165
Chain Sequence
QGHVELSSTLLKNLKNFKKENELKKIALTIIAKHLCDVEINNLRNIFIALDVDNSGTLSSQEILDGLKKIGPPDIHQVLRDQIHYTDFLAATIDKQTYLKKEVCLIPFKFFDIDGNGKISVEELKRIFGENPLIDKAIDSLLQEVDLNGDGEIDFHEFMLMMSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-dependent protein kinase 2
publication title CAD domain of PFF0520w, Calcium dependent protein kinase
rcsb
source organism Plasmodium falciparum k1
molecule tags Transferase
total genus 57
structure length 165
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pm8A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pm8A01
4YGBB 4FTGA 1S36A 1SPYA 4DUQA 2K7OA 5KSZA 1MF8B 1TNPA 2AMIA 3CWGA 3AAJA 3F45A 2Y4QA 4PALA 2LLUA 4MBEA 5D7FA 1J7QA 1UUSA 1CDLA 2LVKA 1QASA 2HF5A 2CBLA 2MBXA 3HCMA 4I5JA 5KTYA 3AAKA 2H61A 4OV2A 1XFXO 5AXIA 2HQWA 2K61A 1PALA 5TNCA 1QX2A 4P5OE 4P2YB 1YUSA 2JOJA 5K89A 2Y1MA 3GK4X 1SNLA 3I5HC 1MUXA 1TNXA 2L4HA 3PFVA 5AFPA 3FS7A 1XFUO 3NSIA 1FI5A 3EVRA 2WORA 1BG1A 1CDMA 1RFJA 2BCAA 1NIWA 2IS9A 2AAOA 2KHNA 3TUYB 1WDCB 3JVTC 1JC2A 2F2PA 1JUOA 1QATA 2F3ZA 4MRXA 1ZOTB 1FI6A 1L7ZA 1ALWA 2EC6B 4QJ3B 2GGZA 3EK4A 1F71A 1PK0D 3WXAA 2LVIA 1QLKA 2Y1NA 1A4PA 1F8HA 1MQ1A 1KCYA 1CMGA 1EG4A 1EH2A 2CTNA 2CCMA 2F33A 3I5GC 2JU0A 3SG3A 1QX7A 2O5GA 3JTDB 2K0JA 4YGAA 1CFCA 5I2QA 2HQ8A 1BR4B 3DVKA 1R2UA 1SRAA 3NSOA 2NLNA 1SL9A 3AKBA 2BECA 2F8PA 4DIRA 5BPJA 2LC5A 2WCEA 3CR5X 2FCEA 4AOMA 1UURA 1A29A 2JC2A 3GK1A 3I5HB 4GGFC 1CLLA 1GJYA 2Y5IA 2K8MB 1JF0A 1WLZA 4I5LB 2ISDA 1GGZA 3IQOA 1YX8A 4U8DA 1ALVA 3PALA 4JPZB 1A75A 3SG2A 4GNKB 4YI9A 4JQ0D 2LM5A 1OMVA 1IKUA 1KFXS 2HETA 3A8RA 1CFDA 1IGVA 3O6BA 1Y1UA 2HPSA 3FWBA 5J3XA 2JTZA 1S26D 4I5KA 4XJKA 4D1EA 1BODA 1ZMZA 3D0YB 2KFHA 2WCBA 1SR6C 1DJXA 1M31A 1B9AA 2FCDA 4PE1A 4NDBA 1EJ3A 2M7LA 1TCFA 2KQYA 1KK7Y 1EG3A 2JXCA 2L51A 1SKTA 1RWYA 3TDIA 1J7PA 1F4OA 2I2RE 1B8CA 1ODBA 2ZFDA 3OHMB 3BUMB 1NX2A 3BQ3A 3FWCA 2H2KA 1DJGA 1OE9B 2RGIA 1BT6A 2G2BA 3CR2A 1TNWA 3DF0A 1QV0A 1G33A 5JOLA 1LVCD 1FPWA 2M29A 2KI4C 2LP2A 1MXEA 1BOCA 2TN4A 3O4YA 1IQ5A 2KDHA 5I8NA 1KSMA 1HT9A 2KI6C 2M0RA 3KO0A 2JTTA 1LINA 1CTRA 1CFPA 2QACA 1OZSA 2FOTA 1NCXA 4PHMA 1MWNA 2LUCA 1CKKA 4ICBA 1NUBA 1K9PA 2KBMA 1UHIA 4BY4A 1YVHA 3O2PA 1BF5A 4ORAB 1TTXA 1UHHA 2KSPA 5KU1A 1J7RA 1QV1A 2OTGB 1U5IB 3TZ1A 1PULA 1QS7A 1TNQA 4WRIA 1M46A 3TS5C 2KYFA 4OR9B 3MSEB 1IG5A 3VROA 3VRPA 1J7OA 1SR6B 1S1EA 2M97A 2MAZA 4CIDA 4CFRA 2NXQA 1TN4A 4PE7A 5ER4X 2LP3A 1XK4A 2I18A 1D1OA 2SCPA 3DD4A 1K90D 4YGDB 3CTNA 1PVBA 1UWOA 2BBMA 1F4QA 1DF0A 2KFFA 2AUCA 1FBVA 1J1EA 2CNPA 3RM1A 1DF0B 4HRGA 1S6JA 4AQJA 1LXFC 5HLOA 3NSLA 4DS7A 2BCXA 4PHNA 4YI8A 1KQMC 2JXLA 4NQGA 3NSKA 1XA5A 2BL0C 1Y6WA 1XFZO 1SBJA 2KI4B 2WCFA 3BUOB 2FJUB 1AP4A 1BR1B 2SASA 1JF2A 2K2FA 5G08A 3BYAA 5AANA 1TCOB 3QRXA 2CXJA 1DJYA 2L50A 3SG5A 1IJ5A 1SCMC 1BU3A 2LAPA 1CM1A 2JT0A 4YGEB 2GGMA 1SL7A 4A4CA 1K96A 1R6PA 1S6CA 3TS5B 1SK6D 1CM4A 3I5FC 1B4CA 2M7NA 3M0WA 1JBAA 3EKHA 1RTP1 4QJ4B 2F3YA 3IQQA 3DVEA 2F2OA 1PSRA 3SIAA 4GUKA 4MZKA 1IQ3A 1QX5B 3TDUA 3CR4X 1QTXA 4DRWA 3CLNA 1K95A 3A4UB 2LV7A 1KFXL 3FIAA 2OPOA 1S6IA 3ZNIA 1KSOA 4CPVA 3BOWB 1KFUS 1LA0A 2NZ0A 1XO5A 1S5GY 1KQMB 3LK0A 1QVIZ 4F0ZB 1FF1A 4A4BA 2L0PA 4E68A 1JFKA 4XYNA 1AK8A 1RROA 3EKJA 2A4JA 1F54A 3PATA 1LA3A 2WOSA 2KQ6A 2DOQA 3JVTB 4ZCUA 4DCKA 3OB1B 4I5NB 1J55A 1NPQA 4FQOA 3D0YA 2CT9A 2K7CA 2PVBA 3I5IC 2KYCA 2ZNEA 1A2XA 2JULA 1NX0A 2M8UA 1DTLA 2L98A 1PRWA 1AJ4A 1GGWA 2R2IA 2B1UA 1B7TZ 4ORBB 1S5GZ 2LANA 2WC8A 3LCPC 4PHJA 1DGVA 3I5GB 3OX5A 1BLQA 1YRTB 4YGCB 3KF9A 2M9GA 2Q91A 1M39A 5JJGA 3HX4A 4N5XA 1F70A 1NCZA 1OSAA 1NYAA 2KGBC 4L9MA 5B8IB 1FW4A 3ZWHA 5HYDA 2LMVA 2LUXA 1SW8A 4GGFA 2K7BA 1E8AA 1QIWA 1N65A 1WRZA 4OCIA 2G9BA 3AKAA 4HREE 2LE9B 1MR8A 4HSZA 5AEQA 3SG6A 1S3PA 1QXPA 2MHHA 1N2DA 1X02A 2PRUA 1YUTA 2V53A 2ZKMX 1OOJA 2BE6A 4WQ3A 2KBIA 2M49B 2L5XB 3KPXA 2MA2A 4M2OA 3SG4A 4C0KA 2BBNA 2LCPA 1CLMA 3OP0A 3SG7A 1UHJA 1TRFA 2WNDA 4IL1A 1U5IA 2BE4A 4CFQA 2VRGA 5GQQC 1TOPA 1CFFA 4ETOA 4C0LA 4MRYA 3NXAA 1DMOA 5HLVA 2MLEC 2ZRSA 2MJWB 1B8RA 5ER5A 3I5IB 1Y1AA 1EXRA 2BKIB 2BKHB 4PE4A 1JSAA 1YURA 2NCOA 2GV5A 2EC6C 4Q04A 1C07A 1F55A 1V1FA 5CSIA 2MLFC 1B1GA 1YTZC 3LK1A 1YUUA 1Q80A 4C0JA 3DVMA 4YRUA 1DJIA 4N1GA 1WRKA 2KAYA 1SL8A 5HKZA 1VRKA 3H4SE 1MHOA 1BMOA 1ZFSA 4MEWA 2M1UA 1N0YA 1CNPA 1XFWO 2K7DA 3JTDC 1L2OC 1Y0VH 3VRQA 3KHEA 1W7IB 1K2HA 2ZN8A 3KEVA 1DGUA 1G8IA 5AERA 2EHBA 1GQMA 2ZN9A 1EL4A 3LL8B 1YRUB 5DKQA 3BXKA 4OVNF 5I2OA 1AUIB 1Y1XA 1C7WA 2PASA 2BCBA 5HKYA 1NX1A 4GAOA 3BUXB 2M3WA 1KWOC 1M63B 2LVVA 3IF7A 4MVFA 4NDDA 1KQVA 1QVIY 4YBHB 2JQ6A 1K9UA 1MXLC 2PMYA 1CDNA 1IWQA 1YVLA 4MZLA 1OZOA 4MZJA 1IRJA 3TDZA 1KFUL 2MRDA 1RK9A 1SY9A 2QPTA 4HRHA 4AQIA 1QJTA 2PALA 3CZTX 1KK8C 2K2AA 1XFYO 3E3RA 1NSHA 2L2EA 1B8LA 1WLMA 2JPTA 4USLA 5DKNA 1JFJA 1AHRA 3BUWB 3BOWA 5F6TA 1NX3A 3VGOA 1K9KA 2M1KB 1IJ6A 2JWWA 4R1EA 4ZCVA 3WHTB 1B7TY 1UHKA 1SYMA 2KNEA 3PN7C 1A03A 1LKJA 2LLTA 2BL0B 3DVJA 4MSPA 3D10A 3VRNA 1NCYA 2I7AA 1L2OB 2JNXA 1YX7A 1NWDA 1V1GA 2P6BB 1BJFA 3EVUA 1OMDA 1J1DA 1DJZA 5CSFA 4BY5A 1SMGA 3ICBA 2OS8C 3BUNB 5FYXA 3RLZA 3SJSA 3WHUB 2L4IA 5HKWA 5DKRA 1DT7B 3EK7A 3PM8A 1ZUZA 5D69A 5CSNA 1DJHA 2JT8A 4PE0A 4TNCA 1HQVA 2LHIA 1UHNA 2LNKA 1YR5A 3LLEA 5I2LA 5CPVA 1SCMB 3OX6A 2E30A 2O60A 4GBAA 1DVIA 5CSJA 1KWOB 3K21A 1CMFA 4PCWA 2NCPA 4PDZA 4ORCB 1CLBA 1A75B 2ZNDA 1H4BA 3I5FB 1DJWA 1JWDA 2LVJA 2KFGA 4MLWA 4QJ5B 3GOFA 2PSRA 2OTGC 2JZIA 1G4YR 1K93D 1KK8B 3O78A 4GPLB 3EVVA 4UPGA 3CGAA 1NP8A 1M45A 2KGRA 4PHKA 4XJKB 1K8UA 5IBWA 4N1FA 4M2PA 2KI6D 1OQPA 2E6WA 2KAXA 4MN0A 1H8BA 2JRFA 4WQ2A 1XK4C 2H61C 3SIBA 2LMTA 3PN7B 3WNXB 4OKHA 1W7JB 3C1VA 1PVAA 4GGNA 1OMRA 1ZACA 2LHLA 3EK8A 1SCVA 2KAVA 1CB1A 1PSBA 1UP5A 1CDPA 4JWQA 1TIZA 3VRRA 1C7VA 1AVSA 2LLSA 3OB2B 2Q4UA 2COLB 2LMUA 1XFVO 2OS8B 1IH0A 4GFTA 2ZRTA 2KOTA 3GK2A 4CLNA 3DF0B 3CS1A 1AJ5A 1XYDA 1QLSA 1WY9A 3PSRA 2JNFA 2JT3A 1QIVA 4M2QA 1WRLA 2D8NA 1XVJA 3PLFB 1RECA 4NDCA 1B47A 1WDCC 3TUYC 2I94A 5PALA 1KK7Z 2EGDA 1K94A 1RJVA
chains in the Genus database with same CATH superfamily
1C3ZA 4YGBB 4FTGA 1S36A 1SPYA 5DICA 2K7OA 4DUQA 1MF8B 1TNPA 5KSZA 2AMIA 3CWGA 3AAJA 3F45A 1P28A 2Y4QA 3CZ1A 4PALA 2LLUA 4MBEA 5D7FA 1J7QA 1UUSA 1CDLA 2LVKA 1QASA 2HF5A 2CBLA 2MBXA 3HCMA 4I5JA 5KTYA 3AAKA 2H61A 4OV2A 1XFXO 5AXIA 2HQWA 2K61A 1PALA 5TNCA 1QX2A 4P5OE 4P2YB 1YUSA 2JOJA 5K89A 2BAPA 2P70A 2Y1MA 3D73A 1SNLA 3GK4X 3I5HC 3OBVA 1MUXA 1TNXA 2L4HA 3PFVA 5AFPA 3FS7A 1XFUO 3NSIA 1FI5A 3EVRA 1OOFA 2WORA 1BG1A 1CDMA 1RFJA 3S0BA 2BCAA 1NIWA 2IS9A 2AAOA 1Z4HA 3OGNA 2KHNA 3TUYB 1WDCB 3JVTC 1JC2A 2F2PA 3BFBA 1JUOA 1DQEA 1QATA 2F3ZA 3PJIA 4MRXA 3VB1A 1TWOA 1ZOTB 1FI6A 1L7ZA 1ALWA 2EC6B 4QJ3B 2GGZA 3EK4A 1F71A 1PK0D 3WXAA 2LVIA 1QLKA 2Y1NA 1A4PA 1F8HA 1MQ1A 1KCYA 1CMGA 1EG4A 2L2CA 1EH2A 2CTNA 2CCMA 2F33A 3I5GC 3NHTA 3D75A 2JU0A 3SG3A 1QX7A 2O5GA 3FE8A 2K0JA 3JTDB 4YGAA 1CFCA 5I2QA 2HQ8A 1BR4B 3DVKA 1R2UA 1SRAA 2PYQA 3NSOA 2NLNA 1SL9A 3AKBA 2BECA 2F8PA 4DIRA 5BPJA 2LC5A 2WCEA 3CR5X 2FCEA 4AOMA 1UURA 1A29A 2JC2A 3GK1A 1LS8A 3I5HB 4GGFC 5FI2A 1CLLA 1GJYA 3DY9A 2Y5IA 2K8MB 1JF0A 1WLZA 4I5LB 2ISDA 2KLDA 1GGZA 3IQOA 1YX8A 4U8DA 1ALVA 3PALA 4JPZB 1A75A 3SG2A 3CDNA 4GNKB 1TUJA 2YGUA 4YI9A 3PM2A 4JQ0D 2LM5A 1OMVA 1IKUA 1KFXS 2HETA 3A8RA 1CFDA 1IGVA 3B88A 2JPOA 3O6BA 1Y1UA 2HPSA 5EL2A 3FWBA 4JKTA 5J3XA 2JTZA 1S26D 4I5KA 4XJKA 4D1EA 1BODA 1ZMZA 3D0YB 2KFHA 2WCMA 2WCBA 1OOHA 1SR6C 1IIOA 1DJXA 1M31A 1B9AA 2FCDA 4PE1A 4NDBA 1EJ3A 2M7LA 1TCFA 2KQYA 1KK7Y 1EG3A 2JXCA 2L51A 1SKTA 1RWYA 3TDIA 1J7PA 1F4OA 3S0GA 2I2RE 1B8CA 1ODBA 2ZFDA 2L5YA 3BUMB 3OHMB 3S0DA 1NX2A 3BQ3A 3FWCA 2H2KA 1DJGA 1OE9B 2RGIA 1BT6A 1QWVA 2G2BA 3CR2A 3SS4A 1TNWA 3DF0A 1QV0A 1G33A 5JOLA 1LVCD 1FPWA 2M29A 2KI4C 2LP2A 1MXEA 1BOCA 1T14A 2TN4A 3O4YA 4KYNA 1IQ5A 2H8VA 2KDHA 3K1EA 5I8NA 1KSMA 1HT9A 2KI6C 2M0RA 3KO0A 2JTTA 1LINA 1CTRA 1CFPA 2QACA 1OZSA 2FOTA 1NCXA 4PHMA 1MWNA 2LUCA 1CKKA 4FQTA 4ICBA 2WC6A 1NUBA 1K9PA 2KBMA 1UHIA 3D74A 4BY4A 1YVHA 3O2PA 1BF5A 4ORAB 1TTXA 1UHHA 2KSPA 3SS3A 5KU1A 1J7RA 1QV1A 2OTGB 1U5IB 3TZ1A 1PULA 1QS7A 1TNQA 2WCHA 1M46A 4WRIA 3TS5C 2KYFA 4OR9B 3MSEB 1IG5A 3VROA 3VRPA 1J7OA 1SR6B 1S1EA 2M97A 2MAZA 4CIDA 3FE9A 4CFRA 2NXQA 1TN4A 4PE7A 5ER4X 2LP3A 1XK4A 2I18A 3EG5B 1D1OA 2SCPA 3DD4A 1K90D 4YGDB 3CTNA 1PVBA 1UWOA 3BJHA 2BBMA 1F4QA 1DF0A 2KFFA 2AUCA 1FBVA 1C3YA 1J1EA 2CNPA 3RM1A 3UO9A 1DF0B 4HRGA 1S6JA 4AQJA 1LXFC 5HLOA 3NSLA 4DS7A 2BCXA 3V2LA 4PHNA 4YI8A 1KQMC 2JXLA 4NQGA 3NSKA 1XA5A 2BL0C 1Y6WA 1XFZO 2QEVA 1SBJA 2KI4B 2WCFA 3BUOB 2FJUB 1AP4A 3CZ2A 3UNWA 1BR1B 2SASA 1JF2A 2QDIA 2K2FA 3NHIA 3BYAA 5G08A 5AANA 1OOGA 1TCOB 4JD9A 3QRXA 2CXJA 1DJYA 2L50A 3O4XA 3SG5A 1IJ5A 1SCMC 4OZDA 3B6XA 2WCKA 1BU3A 2LAPA 1CM1A 2JT0A 1W9ZA 2QEBA 4YGEB 2GGMA 1SL7A 4A4CA 1K96A 1R6PA 1S6CA 5FI6A 3TS5B 1SK6D 1CM4A 3I5FC 1B4CA 4INXA 2M7NA 3D77A 3B87A 3M0WA 1JBAA 3EKHA 1RTP1 4QJ4B 2F3YA 3IQQA 3DVEA 2F2OA 1PSRA 3IVTA 3SIAA 4GUKA 4MZKA 1IQ3A 1QX5B 3TDUA 3CR4X 1QTXA 4DRWA 3CLNA 1K95A 3A4UB 2LV7A 1KFXL 3FIAA 2OPOA 1S6IA 3ZNIA 1KSOA 4CPVA 3BOWB 1KFUS 1LA0A 2NZ0A 3CABA 1XO5A 1S5GY 1KQMB 3LK0A 1QVIZ 5FI7A 4F0ZB 3L4AA 3R1OA 1OOIX 1FF1A 4A4BA 2L0PA 3DYEA 4E68A 2BNXA 1JFKA 4XYNA 1AK8A 1RROA 3EKJA 2A4JA 1F54A 2PQLA 1LA3A 2WOSA 3PATA 2KQ6A 2DOQA 3JVTB 4ZCUA 3FE6A 4DCKA 3OB1B 4I5NB 1J55A 1NPQA 3L47A 4FQOA 3D0YA 2CT9A 2K7CA 3DXLA 1DC1A 2PVBA 3I5IC 2KYCA 2ZNEA 1A2XA 2JULA 1NX0A 2M8UA 1DTLA 2L98A 2P71A 1PRWA 1AJ4A 1GGWA 2R2IA 2B1UA 1B7TZ 4ORBB 1S5GZ 2LANA 2WC8A 3LCPC 4PHJA 1DGVA 3I5GB 3OX5A 1BLQA 1YRTB 4YGCB 1XFRA 3KF9A 3R72A 2M9GA 2Q91A 1M39A 5JJGA 3HX4A 4N5XA 1F70A 1NCZA 1OSAA 3R1VA 1NYAA 2KGBC 4L9MA 5B8IB 1FW4A 3ZWHA 5HYDA 2LMVA 2LUXA 1SW8A 4GGFA 2K7BA 1E8AA 3NGVA 1QIWA 1N65A 1WRZA 4OCIA 2G9BA 3AKAA 4HREE 2LE9B 1MR8A 4HSZA 5AEQA 3SG6A 1S3PA 1QXPA 2MHHA 1N2DA 1X02A 2PRUA 1YUTA 2V53A 2ZKMX 1OOJA 2BE6A 4WQ3A 2KBIA 2M49B 2L5XB 3KPXA 2MA2A 4M2OA 3SG4A 4C0KA 2BBNA 2LCPA 1CLMA 3OP0A 3SG7A 1UHJA 1TRFA 1DEKA 5I94A 2WNDA 4IL1A 1OW4A 1U5IA 2BE4A 4CFQA 2VRGA 5GQQC 1TOPA 1CFFA 3B7AA 3S0EA 4ETOA 4C0LA 4MRYA 3BFHA 3NXAA 1DMOA 5HLVA 2MLEC 2ZRSA 2MJWB 4F7FA 1B8RA 5ER5A 3I5IB 1Y1AA 1EXRA 2BKIB 2BKHB 4PE4A 1JSAA 1YURA 3R1PA 2NCOA 3RZSA 2GV5A 2EC6C 4Q04A 1C07A 1F55A 1V1FA 5CSIA 2MLFC 1B1GA 1YTZC 3LK1A 1YUUA 1Q80A 2WC5A 4C0JA 3DVMA 4YRUA 1DJIA 4N1GA 1WRKA 2KAYA 1SL8A 2K60A 3BFAA 1VRKA 5HKZA 2QEOA 1MHOA 1BMOA 3H4SE 1ZFSA 4MEWA 2M1UA 1N0YA 1CNPA 1XFWO 2K7DA 3JTDC 1L2OC 1Y0VH 3B86A 2FJYA 1W7IB 3KHEA 3VRQA 2ZN8A 1K2HA 3KEVA 1DGUA 1G8IA 2KLEA 5AERA 2EHBA 1GQMA 2ZN9A 1EL4A 3LL8B 1YRUB 5DKQA 3BXKA 4OVNF 5I2OA 1AUIB 1Y1XA 1C7WA 3QMEA 2PASA 1ORGA 2BCBA 5HKYA 1NX1A 4GAOA 3BUXB 2M3WA 1KWOC 1M63B 2LVVA 3IF7A 4MVFA 4NDDA 1KQVA 1QVIY 4YBHB 2JQ6A 1K9UA 1MXLC 2PMYA 1CDNA 1IWQA 2KPHA 1YVLA 4MZLA 1OZOA 4MZJA 1IRJA 3TDZA 1KFUL 2MRDA 1RK9A 1SY9A 2QPTA 4HRHA 3L4LA 4AQIA 1QJTA 2PALA 3CZTX 1DELA 1KK8C 2K2AA 1XFYO 3E3RA 3SS5A 1NSHA 2L2EA 1B8LA 1WLMA 2JPTA 4USLA 5DKNA 1JFJA 1AHRA 3BUWB 3BOWA 5F6TA 1NX3A 3DZTA 2GTEA 3VGOA 1K9KA 2M1KB 3N7HA 1IJ6A 2JWWA 3Q8IA 4R1EA 4ZCVA 3WHTB 1B7TY 2WCLA 1UHKA 3D78A 1SYMA 2KNEA 3PN7C 1A03A 1LKJA 2LLTA 2BL0B 3DVJA 4MSPA 3S0AA 3D10A 3VRNA 1NCYA 2I7AA 1L2OB 2JNXA 1YX7A 1NWDA 1V1GA 2P6BB 1BJFA 3CZ0A 3D76A 1OMDA 3EVUA 1J1DA 1DJZA 1TUZA 5CSFA 4BY5A 1SMGA 3ICBA 2OS8C 3BUNB 5FYXA 3RLZA 3SJSA 3WHUB 2L4IA 5HKWA 5DKRA 3S0FA 3EK7A 3PM8A 1ZUZA 5D69A 5CSNA 1DT7B 2ERBA 1DJHA 2JT8A 4PE0A 4TNCA 1HQVA 2LHIA 1UHNA 2LNKA 1YR5A 3LLEA 5I2LA 5CPVA 1SCMB 3OX6A 2E30A 2O60A 4GBAA 1DVIA 4IJ7A 5CSJA 1KWOB 3K21A 1CMFA 4PCWA 2NCPA 4PDZA 4ORCB 1CLBA 1A75B 2ZNDA 1H4BA 3I5FB 1DJWA 1JWDA 2LVJA 2KFGA 4MLWA 4INWA 3GOFA 4QJ5B 2PSRA 1GM0A 2OTGC 2JZIA 2WCJA 1G4YR 1K93D 1SSEB 5D3OA 3CYZA 1KK8B 3O78A 4GPLB 3EVVA 4UPGA 3CGAA 1NP8A 1M45A 1Z2CB 2KGRA 4PHKA 4XJKB 1K8UA 5IBWA 4N1FA 4M2PA 2KI6D 1OQPA 2E6WA 2KAXA 4MN0A 1H8BA 2JRFA 4WQ2A 1XK4C 2H61C 3SIBA 2LMTA 3PN7B 3WNXB 4OKHA 1W7JB 3C1VA 1PVAA 4GGNA 1OMRA 1ZACA 2LHLA 3EK8A 5HL1A 1SCVA 2KAVA 1CB1A 1PSBA 1UP5A 1CDPA 4JWQA 1TIZA 3VRRA 1C7VA 2QEHA 1AVSA 2LLSA 3OB2B 2Q4UA 2COLB 2LMUA 1XFVO 2OS8B 1IH0A 4GFTA 2ZRTA 2KOTA 3GK2A 4CLNA 3DF0B 3CS1A 1AJ5A 1XYDA 1QLSA 1WY9A 3PSRA 2JNFA 2JT3A 1QIVA 4M2QA 1WRLA 2D8NA 1XVJA 3PLFB 1RECA 4NDCA 1B47A 1WDCC 3TUYC 2I94A 5PALA 1KK7Z 2EGDA 1K94A 4PT1A 1RJVA
chains in the Genus database with same CATH topology
4YGBB 4FTGA 1S36A 1SPYA 4DUQA 2K7OA 5KSZA 1MF8B 1TNPA 2AMIA 3CWGA 3AAJA 3F45A 2Y4QA 4PALA 2LLUA 4MBEA 5D7FA 1J7QA 1UUSA 1CDLA 2LVKA 1QASA 2HF5A 2CBLA 2MBXA 3HCMA 4I5JA 5KTYA 3AAKA 2H61A 4OV2A 1XFXO 5AXIA 2HQWA 2K61A 1PALA 5TNCA 1QX2A 4P5OE 4P2YB 1YUSA 2JOJA 5K89A 2Y1MA 3GK4X 1SNLA 3I5HC 1MUXA 1TNXA 2L4HA 3PFVA 5AFPA 3FS7A 1XFUO 3NSIA 1FI5A 3EVRA 2WORA 1BG1A 1CDMA 1RFJA 2BCAA 1NIWA 2IS9A 2AAOA 2KHNA 3TUYB 1WDCB 3JVTC 1JC2A 2F2PA 1JUOA 1QATA 2F3ZA 4MRXA 1ZOTB 1FI6A 1L7ZA 1ALWA 2EC6B 4QJ3B 2GGZA 3EK4A 1F71A 1PK0D 3WXAA 2LVIA 1QLKA 2Y1NA 1A4PA 1F8HA 1MQ1A 1KCYA 1CMGA 1EG4A 1EH2A 2CTNA 2CCMA 2F33A 3I5GC 2JU0A 3SG3A 1QX7A 2O5GA 3JTDB 2K0JA 4YGAA 1CFCA 5I2QA 2HQ8A 1BR4B 3DVKA 1R2UA 1SRAA 3NSOA 2NLNA 1SL9A 3AKBA 2BECA 2F8PA 4DIRA 5BPJA 2LC5A 2WCEA 3CR5X 2FCEA 4AOMA 1UURA 1A29A 2JC2A 3GK1A 3I5HB 4GGFC 1CLLA 1GJYA 2Y5IA 2K8MB 1JF0A 1WLZA 4I5LB 2ISDA 1GGZA 3IQOA 1YX8A 4U8DA 1ALVA 3PALA 4JPZB 1A75A 3SG2A 4GNKB 4YI9A 4JQ0D 2LM5A 1OMVA 1IKUA 1KFXS 2HETA 3A8RA 1CFDA 1IGVA 3O6BA 1Y1UA 2HPSA 3FWBA 5J3XA 2JTZA 1S26D 4I5KA 4XJKA 4D1EA 1BODA 1ZMZA 3D0YB 2KFHA 2WCBA 1SR6C 1DJXA 1M31A 1B9AA 2FCDA 4PE1A 4NDBA 1EJ3A 2M7LA 1TCFA 2KQYA 1KK7Y 1EG3A 2JXCA 2L51A 1SKTA 1RWYA 3TDIA 1J7PA 1F4OA 2I2RE 1B8CA 1ODBA 2ZFDA 3OHMB 3BUMB 1NX2A 3BQ3A 3FWCA 2H2KA 1DJGA 1OE9B 2RGIA 1BT6A 2G2BA 3CR2A 1TNWA 3DF0A 1QV0A 1G33A 5JOLA 1LVCD 1FPWA 2M29A 2KI4C 2LP2A 1MXEA 1BOCA 2TN4A 3O4YA 1IQ5A 2KDHA 5I8NA 1KSMA 1HT9A 2KI6C 2M0RA 3KO0A 2JTTA 1LINA 1CTRA 1CFPA 2QACA 1OZSA 2FOTA 1NCXA 4PHMA 1MWNA 2LUCA 1CKKA 4ICBA 1NUBA 1K9PA 2KBMA 1UHIA 4BY4A 1YVHA 3O2PA 1BF5A 4ORAB 1TTXA 1UHHA 2KSPA 5KU1A 1J7RA 1QV1A 2OTGB 1U5IB 3TZ1A 1PULA 1QS7A 1TNQA 4WRIA 1M46A 3TS5C 2KYFA 4OR9B 3MSEB 1IG5A 3VROA 3VRPA 1J7OA 1SR6B 1S1EA 2M97A 2MAZA 4CIDA 4CFRA 2NXQA 1TN4A 4PE7A 5ER4X 2LP3A 1XK4A 2I18A 1D1OA 2SCPA 3DD4A 1K90D 4YGDB 3CTNA 1PVBA 1UWOA 2BBMA 1F4QA 1DF0A 2KFFA 2AUCA 1FBVA 1J1EA 2CNPA 3RM1A 1DF0B 4HRGA 1S6JA 4AQJA 1LXFC 5HLOA 3NSLA 4DS7A 2BCXA 4PHNA 4YI8A 1KQMC 2JXLA 4NQGA 3NSKA 1XA5A 2BL0C 1Y6WA 1XFZO 1SBJA 2KI4B 2WCFA 3BUOB 2FJUB 1AP4A 1BR1B 2SASA 1JF2A 2K2FA 5G08A 3BYAA 5AANA 1TCOB 3QRXA 2CXJA 1DJYA 2L50A 3SG5A 1IJ5A 1SCMC 1BU3A 2LAPA 1CM1A 2JT0A 4YGEB 2GGMA 1SL7A 4A4CA 1K96A 1R6PA 1S6CA 3TS5B 1SK6D 1CM4A 3I5FC 1B4CA 2M7NA 3M0WA 1JBAA 3EKHA 1RTP1 4QJ4B 2F3YA 3IQQA 3DVEA 2F2OA 1PSRA 3SIAA 4GUKA 4MZKA 1IQ3A 1QX5B 3TDUA 3CR4X 1QTXA 4DRWA 3CLNA 1K95A 3A4UB 2LV7A 1KFXL 3FIAA 2OPOA 1S6IA 3ZNIA 1KSOA 4CPVA 3BOWB 1KFUS 1LA0A 2NZ0A 1XO5A 1S5GY 1KQMB 3LK0A 1QVIZ 4F0ZB 1FF1A 4A4BA 2L0PA 4E68A 1JFKA 4XYNA 1AK8A 1RROA 3EKJA 2A4JA 1F54A 3PATA 1LA3A 2WOSA 2KQ6A 2DOQA 3JVTB 4ZCUA 4DCKA 3OB1B 4I5NB 1J55A 1NPQA 4FQOA 3D0YA 2CT9A 2K7CA 2PVBA 3I5IC 2KYCA 2ZNEA 1A2XA 2JULA 1NX0A 2M8UA 1DTLA 2L98A 1PRWA 1AJ4A 1GGWA 2R2IA 2B1UA 1B7TZ 4ORBB 1S5GZ 2LANA 2WC8A 3LCPC 4PHJA 1DGVA 3I5GB 3OX5A 1BLQA 1YRTB 4YGCB 3KF9A 2M9GA 2Q91A 1M39A 5JJGA 3HX4A 4N5XA 1F70A 1NCZA 1OSAA 1NYAA 2KGBC 4L9MA 5B8IB 1FW4A 3ZWHA 5HYDA 2LMVA 2LUXA 1SW8A 4GGFA 2K7BA 1E8AA 1QIWA 1N65A 1WRZA 4OCIA 2G9BA 3AKAA 4HREE 2LE9B 1MR8A 4HSZA 5AEQA 3SG6A 1S3PA 1QXPA 2MHHA 1N2DA 1X02A 2PRUA 1YUTA 2V53A 2ZKMX 1OOJA 2BE6A 4WQ3A 2KBIA 2M49B 2L5XB 3KPXA 2MA2A 4M2OA 3SG4A 4C0KA 2BBNA 2LCPA 1CLMA 3OP0A 3SG7A 1UHJA 1TRFA 2WNDA 4IL1A 1U5IA 2BE4A 4CFQA 2VRGA 5GQQC 1TOPA 1CFFA 4ETOA 4C0LA 4MRYA 3NXAA 1DMOA 5HLVA 2MLEC 2ZRSA 2MJWB 1B8RA 5ER5A 3I5IB 1Y1AA 1EXRA 2BKIB 2BKHB 4PE4A 1JSAA 1YURA 2NCOA 2GV5A 2EC6C 4Q04A 1C07A 1F55A 1V1FA 5CSIA 2MLFC 1B1GA 1YTZC 3LK1A 1YUUA 1Q80A 4C0JA 3DVMA 4YRUA 1DJIA 4N1GA 1WRKA 2KAYA 1SL8A 5HKZA 1VRKA 3H4SE 1MHOA 1BMOA 1ZFSA 4MEWA 2M1UA 1N0YA 1CNPA 1XFWO 2K7DA 3JTDC 1L2OC 1Y0VH 3VRQA 3KHEA 1W7IB 1K2HA 2ZN8A 3KEVA 1DGUA 1G8IA 5AERA 2EHBA 1GQMA 2ZN9A 1EL4A 3LL8B 1YRUB 5DKQA 3BXKA 4OVNF 5I2OA 1AUIB 1Y1XA 1C7WA 2PASA 2BCBA 5HKYA 1NX1A 4GAOA 3BUXB 2M3WA 1KWOC 1M63B 2LVVA 3IF7A 4MVFA 4NDDA 1KQVA 1QVIY 4YBHB 2JQ6A 1K9UA 1MXLC 2PMYA 1CDNA 1IWQA 1YVLA 4MZLA 1OZOA 4MZJA 1IRJA 3TDZA 1KFUL 2MRDA 1RK9A 1SY9A 2QPTA 4HRHA 4AQIA 1QJTA 2PALA 3CZTX 1KK8C 2K2AA 1XFYO 3E3RA 1NSHA 2L2EA 1B8LA 1WLMA 2JPTA 4USLA 5DKNA 1JFJA 1AHRA 3BUWB 3BOWA 5F6TA 1NX3A 3VGOA 1K9KA 2M1KB 1IJ6A 2JWWA 4R1EA 4ZCVA 3WHTB 1B7TY 1UHKA 1SYMA 2KNEA 3PN7C 1A03A 1LKJA 2LLTA 2BL0B 3DVJA 4MSPA 3D10A 3VRNA 1NCYA 2I7AA 1L2OB 2JNXA 1YX7A 1NWDA 1V1GA 2P6BB 1BJFA 3EVUA 1OMDA 1J1DA 1DJZA 5CSFA 4BY5A 1SMGA 3ICBA 2OS8C 3BUNB 5FYXA 3RLZA 3SJSA 3WHUB 2L4IA 5HKWA 5DKRA 1DT7B 3EK7A 3PM8A 1ZUZA 5D69A 5CSNA 1DJHA 2JT8A 4PE0A 4TNCA 1HQVA 2LHIA 1UHNA 2LNKA 1YR5A 3LLEA 5I2LA 5CPVA 1SCMB 3OX6A 2E30A 2O60A 4GBAA 1DVIA 5CSJA 1KWOB 3K21A 1CMFA 4PCWA 2NCPA 4PDZA 4ORCB 1CLBA 1A75B 2ZNDA 1H4BA 3I5FB 1DJWA 1JWDA 2LVJA 2KFGA 4MLWA 4QJ5B 3GOFA 2PSRA 2OTGC 2JZIA 1G4YR 1K93D 1KK8B 3O78A 4GPLB 3EVVA 4UPGA 3CGAA 1NP8A 1M45A 2KGRA 4PHKA 4XJKB 1K8UA 5IBWA 4N1FA 4M2PA 2KI6D 1OQPA 2E6WA 2KAXA 4MN0A 1H8BA 2JRFA 4WQ2A 1XK4C 2H61C 3SIBA 2LMTA 3PN7B 3WNXB 4OKHA 1W7JB 3C1VA 1PVAA 4GGNA 1OMRA 1ZACA 2LHLA 3EK8A 1SCVA 2KAVA 1CB1A 1PSBA 1UP5A 1CDPA 4JWQA 1TIZA 3VRRA 1C7VA 1AVSA 2LLSA 3OB2B 2Q4UA 2COLB 2LMUA 1XFVO 2OS8B 1IH0A 4GFTA 2ZRTA 2KOTA 3GK2A 4CLNA 3DF0B 3CS1A 1AJ5A 1XYDA 1QLSA 1WY9A 3PSRA 2JNFA 2JT3A 1QIVA 4M2QA 1WRLA 2D8NA 1XVJA 3PLFB 1RECA 4NDCA 1B47A 1WDCC 3TUYC 2I94A 5PALA 1KK7Z 2EGDA 1K94A 1RJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGB B;  4FTG A;  1S36 A;  1SPY A;  4DUQ A;  2K7O A;  5KSZ A;  1MF8 B;  1TNP A;  2AMI A;  3CWG A;  3AAJ A;  3F45 A;  2Y4Q A;  4PAL A;  2LLU A;  4MBE A;  5D7F A;  1J7Q A;  1UUS A;  1CDL A;  2LVK A;  1QAS A;  2HF5 A;  2CBL A;  2MBX A;  3HCM A;  4I5J A;  5KTY A;  3AAK A;  2H61 A;  4OV2 A;  1XFX O;  5AXI A;  2HQW A;  2K61 A;  1PAL A;  5TNC A;  1QX2 A;  4P5O E;  4P2Y B;  1YUS A;  2JOJ A;  5K89 A;  2Y1M A;  3GK4 X;  1SNL A;  3I5H C;  1MUX A;  1TNX A;  2L4H A;  3PFV A;  5AFP A;  3FS7 A;  1XFU O;  3NSI A;  1FI5 A;  3EVR A;  2WOR A;  1BG1 A;  1CDM A;  1RFJ A;  2BCA A;  1NIW A;  2IS9 A;  2AAO A;  2KHN A;  3TUY B;  1WDC B;  3JVT C;  1JC2 A;  2F2P A;  1JUO A;  1QAT A;  2F3Z A;  4MRX A;  1ZOT B;  1FI6 A;  1L7Z A;  1ALW A;  2EC6 B;  4QJ3 B;  2GGZ A;  3EK4 A;  1F71 A;  1PK0 D;  3WXA A;  2LVI A;  1QLK A;  2Y1N A;  1A4P A;  1F8H A;  1MQ1 A;  1KCY A;  1CMG A;  1EG4 A;  1EH2 A;  2CTN A;  2CCM A;  2F33 A;  3I5G C;  2JU0 A;  3SG3 A;  1QX7 A;  2O5G A;  3JTD B;  2K0J A;  4YGA A;  1CFC A;  5I2Q A;  2HQ8 A;  1BR4 B;  3DVK A;  1R2U A;  1SRA A;  3NSO A;  2NLN A;  1SL9 A;  3AKB A;  2BEC A;  2F8P A;  4DIR A;  5BPJ A;  2LC5 A;  2WCE A;  3CR5 X;  2FCE A;  4AOM A;  1UUR A;  1A29 A;  2JC2 A;  3GK1 A;  3I5H B;  4GGF C;  1CLL A;  1GJY A;  2Y5I A;  2K8M B;  1JF0 A;  1WLZ A;  4I5L B;  2ISD A;  1GGZ A;  3IQO A;  1YX8 A;  4U8D A;  1ALV A;  3PAL A;  4JPZ B;  1A75 A;  3SG2 A;  4GNK B;  4YI9 A;  4JQ0 D;  2LM5 A;  1OMV A;  1IKU A;  1KFX S;  2HET A;  3A8R A;  1CFD A;  1IGV A;  3O6B A;  1Y1U A;  2HPS A;  3FWB A;  5J3X A;  2JTZ A;  1S26 D;  4I5K A;  4XJK A;  4D1E A;  1BOD A;  1ZMZ A;  3D0Y B;  2KFH A;  2WCB A;  1SR6 C;  1DJX A;  1M31 A;  1B9A A;  2FCD A;  4PE1 A;  4NDB A;  1EJ3 A;  2M7L A;  1TCF A;  2KQY A;  1KK7 Y;  1EG3 A;  2JXC A;  2L51 A;  1SKT A;  1RWY A;  3TDI A;  1J7P A;  1F4O A;  2I2R E;  1B8C A;  1ODB A;  2ZFD A;  3OHM B;  3BUM B;  1NX2 A;  3BQ3 A;  3FWC A;  2H2K A;  1DJG A;  1OE9 B;  2RGI A;  1BT6 A;  2G2B A;  3CR2 A;  1TNW A;  3DF0 A;  1QV0 A;  1G33 A;  5JOL A;  1LVC D;  1FPW A;  2M29 A;  2KI4 C;  2LP2 A;  1MXE A;  1BOC A;  2TN4 A;  3O4Y A;  1IQ5 A;  2KDH A;  5I8N A;  1KSM A;  1HT9 A;  2KI6 C;  2M0R A;  3KO0 A;  2JTT A;  1LIN A;  1CTR A;  1CFP A;  2QAC A;  1OZS A;  2FOT A;  1NCX A;  4PHM A;  1MWN A;  2LUC A;  1CKK A;  4ICB A;  1NUB A;  1K9P A;  2KBM A;  1UHI A;  4BY4 A;  1YVH A;  3O2P A;  1BF5 A;  4ORA B;  1TTX A;  1UHH A;  2KSP A;  5KU1 A;  1J7R A;  1QV1 A;  2OTG B;  1U5I B;  3TZ1 A;  1PUL A;  1QS7 A;  1TNQ A;  4WRI A;  1M46 A;  3TS5 C;  2KYF A;  4OR9 B;  3MSE B;  1IG5 A;  3VRO A;  3VRP A;  1J7O A;  1SR6 B;  1S1E A;  2M97 A;  2MAZ A;  4CID A;  4CFR A;  2NXQ A;  1TN4 A;  4PE7 A;  5ER4 X;  2LP3 A;  1XK4 A;  2I18 A;  1D1O A;  2SCP A;  3DD4 A;  1K90 D;  4YGD B;  3CTN A;  1PVB A;  1UWO A;  2BBM A;  1F4Q A;  1DF0 A;  2KFF A;  2AUC A;  1FBV A;  1J1E A;  2CNP A;  3RM1 A;  1DF0 B;  4HRG A;  1S6J A;  4AQJ A;  1LXF C;  5HLO A;  3NSL A;  4DS7 A;  2BCX A;  4PHN A;  4YI8 A;  1KQM C;  2JXL A;  4NQG A;  3NSK A;  1XA5 A;  2BL0 C;  1Y6W A;  1XFZ O;  1SBJ A;  2KI4 B;  2WCF A;  3BUO B;  2FJU B;  1AP4 A;  1BR1 B;  2SAS A;  1JF2 A;  2K2F A;  5G08 A;  3BYA A;  5AAN A;  1TCO B;  3QRX A;  2CXJ A;  1DJY A;  2L50 A;  3SG5 A;  1IJ5 A;  1SCM C;  1BU3 A;  2LAP A;  1CM1 A;  2JT0 A;  4YGE B;  2GGM A;  1SL7 A;  4A4C A;  1K96 A;  1R6P A;  1S6C A;  3TS5 B;  1SK6 D;  1CM4 A;  3I5F C;  1B4C A;  2M7N A;  3M0W A;  1JBA A;  3EKH A;  1RTP 1;  4QJ4 B;  2F3Y A;  3IQQ A;  3DVE A;  2F2O A;  1PSR A;  3SIA A;  4GUK A;  4MZK A;  1IQ3 A;  1QX5 B;  3TDU A;  3CR4 X;  1QTX A;  4DRW A;  3CLN A;  1K95 A;  3A4U B;  2LV7 A;  1KFX L;  3FIA A;  2OPO A;  1S6I A;  3ZNI A;  1KSO A;  4CPV A;  3BOW B;  1KFU S;  1LA0 A;  2NZ0 A;  1XO5 A;  1S5G Y;  1KQM B;  3LK0 A;  1QVI Z;  4F0Z B;  1FF1 A;  4A4B A;  2L0P A;  4E68 A;  1JFK A;  4XYN A;  1AK8 A;  1RRO A;  3EKJ A;  2A4J A;  1F54 A;  3PAT A;  1LA3 A;  2WOS A;  2KQ6 A;  2DOQ A;  3JVT B;  4ZCU A;  4DCK A;  3OB1 B;  4I5N B;  1J55 A;  1NPQ A;  4FQO A;  3D0Y A;  2CT9 A;  2K7C A;  2PVB A;  3I5I C;  2KYC A;  2ZNE A;  1A2X A;  2JUL A;  1NX0 A;  2M8U A;  1DTL A;  2L98 A;  1PRW A;  1AJ4 A;  1GGW A;  2R2I A;  2B1U A;  1B7T Z;  4ORB B;  1S5G Z;  2LAN A;  2WC8 A;  3LCP C;  4PHJ A;  1DGV A;  3I5G B;  3OX5 A;  1BLQ A;  1YRT B;  4YGC B;  3KF9 A;  2M9G A;  2Q91 A;  1M39 A;  5JJG A;  3HX4 A;  4N5X A;  1F70 A;  1NCZ A;  1OSA A;  1NYA A;  2KGB C;  4L9M A;  5B8I B;  1FW4 A;  3ZWH A;  5HYD A;  2LMV A;  2LUX A;  1SW8 A;  4GGF A;  2K7B A;  1E8A A;  1QIW A;  1N65 A;  1WRZ A;  4OCI A;  2G9B A;  3AKA A;  4HRE E;  2LE9 B;  1MR8 A;  4HSZ A;  5AEQ A;  3SG6 A;  1S3P A;  1QXP A;  2MHH A;  1N2D A;  1X02 A;  2PRU A;  1YUT A;  2V53 A;  2ZKM X;  1OOJ A;  2BE6 A;  4WQ3 A;  2KBI A;  2M49 B;  2L5X B;  3KPX A;  2MA2 A;  4M2O A;  3SG4 A;  4C0K A;  2BBN A;  2LCP A;  1CLM A;  3OP0 A;  3SG7 A;  1UHJ A;  1TRF A;  2WND A;  4IL1 A;  1U5I A;  2BE4 A;  4CFQ A;  2VRG A;  5GQQ C;  1TOP A;  1CFF A;  4ETO A;  4C0L A;  4MRY A;  3NXA A;  1DMO A;  5HLV A;  2MLE C;  2ZRS A;  2MJW B;  1B8R A;  5ER5 A;  3I5I B;  1Y1A A;  1EXR A;  2BKI B;  2BKH B;  4PE4 A;  1JSA A;  1YUR A;  2NCO A;  2GV5 A;  2EC6 C;  4Q04 A;  1C07 A;  1F55 A;  1V1F A;  5CSI A;  2MLF C;  1B1G A;  1YTZ C;  3LK1 A;  1YUU A;  1Q80 A;  4C0J A;  3DVM A;  4YRU A;  1DJI A;  4N1G A;  1WRK A;  2KAY A;  1SL8 A;  5HKZ A;  1VRK A;  3H4S E;  1MHO A;  1BMO A;  1ZFS A;  4MEW A;  2M1U A;  1N0Y A;  1CNP A;  1XFW O;  2K7D A;  3JTD C;  1L2O C;  1Y0V H;  3VRQ A;  3KHE A;  1W7I B;  1K2H A;  2ZN8 A;  3KEV A;  1DGU A;  1G8I A;  5AER A;  2EHB A;  1GQM A;  2ZN9 A;  1EL4 A;  3LL8 B;  1YRU B;  5DKQ A;  3BXK A;  4OVN F;  5I2O A;  1AUI B;  1Y1X A;  1C7W A;  2PAS A;  2BCB A;  5HKY A;  1NX1 A;  4GAO A;  3BUX B;  2M3W A;  1KWO C;  1M63 B;  2LVV A;  3IF7 A;  4MVF A;  4NDD A;  1KQV A;  1QVI Y;  4YBH B;  2JQ6 A;  1K9U A;  1MXL C;  2PMY A;  1CDN A;  1IWQ A;  1YVL A;  4MZL A;  1OZO A;  4MZJ A;  1IRJ A;  3TDZ A;  1KFU L;  2MRD A;  1RK9 A;  1SY9 A;  2QPT A;  4HRH A;  4AQI A;  1QJT A;  2PAL A;  3CZT X;  1KK8 C;  2K2A A;  1XFY O;  3E3R A;  1NSH A;  2L2E A;  1B8L A;  1WLM A;  2JPT A;  4USL A;  5DKN A;  1JFJ A;  1AHR A;  3BUW B;  3BOW A;  5F6T A;  1NX3 A;  3VGO A;  1K9K A;  2M1K B;  1IJ6 A;  2JWW A;  4R1E A;  4ZCV A;  3WHT B;  1B7T Y;  1UHK A;  1SYM A;  2KNE A;  3PN7 C;  1A03 A;  1LKJ A;  2LLT A;  2BL0 B;  3DVJ A;  4MSP A;  3D10 A;  3VRN A;  1NCY A;  2I7A A;  1L2O B;  2JNX A;  1YX7 A;  1NWD A;  1V1G A;  2P6B B;  1BJF A;  3EVU A;  1OMD A;  1J1D A;  1DJZ A;  5CSF A;  4BY5 A;  1SMG A;  3ICB A;  2OS8 C;  3BUN B;  5FYX A;  3RLZ A;  3SJS A;  3WHU B;  2L4I A;  5HKW A;  5DKR A;  1DT7 B;  3EK7 A;  3PM8 A;  1ZUZ A;  5D69 A;  5CSN A;  1DJH A;  2JT8 A;  4PE0 A;  4TNC A;  1HQV A;  2LHI A;  1UHN A;  2LNK A;  1YR5 A;  3LLE A;  5I2L A;  5CPV A;  1SCM B;  3OX6 A;  2E30 A;  2O60 A;  4GBA A;  1DVI A;  5CSJ A;  1KWO B;  3K21 A;  1CMF A;  4PCW A;  2NCP A;  4PDZ A;  4ORC B;  1CLB A;  1A75 B;  2ZND A;  1H4B A;  3I5F B;  1DJW A;  1JWD A;  2LVJ A;  2KFG A;  4MLW A;  4QJ5 B;  3GOF A;  2PSR A;  2OTG C;  2JZI A;  1G4Y R;  1K93 D;  1KK8 B;  3O78 A;  4GPL B;  3EVV A;  4UPG A;  3CGA A;  1NP8 A;  1M45 A;  2KGR A;  4PHK A;  4XJK B;  1K8U A;  5IBW A;  4N1F A;  4M2P A;  2KI6 D;  1OQP A;  2E6W A;  2KAX A;  4MN0 A;  1H8B A;  2JRF A;  4WQ2 A;  1XK4 C;  2H61 C;  3SIB A;  2LMT A;  3PN7 B;  3WNX B;  4OKH A;  1W7J B;  3C1V A;  1PVA A;  4GGN A;  1OMR A;  1ZAC A;  2LHL A;  3EK8 A;  1SCV A;  2KAV A;  1CB1 A;  1PSB A;  1UP5 A;  1CDP A;  4JWQ A;  1TIZ A;  3VRR A;  1C7V A;  1AVS A;  2LLS A;  3OB2 B;  2Q4U A;  2COL B;  2LMU A;  1XFV O;  2OS8 B;  1IH0 A;  4GFT A;  2ZRT A;  2KOT A;  3GK2 A;  4CLN A;  3DF0 B;  3CS1 A;  1AJ5 A;  1XYD A;  1QLS A;  1WY9 A;  3PSR A;  2JNF A;  2JT3 A;  1QIV A;  4M2Q A;  1WRL A;  2D8N A;  1XVJ A;  3PLF B;  1REC A;  4NDC A;  1B47 A;  1WDC C;  3TUY C;  2I94 A;  5PAL A;  1KK7 Z;  2EGD A;  1K94 A;  1RJV A; 
#chains in the Genus database with same CATH topology
 1C3Z A;  4YGB B;  4FTG A;  1S36 A;  1SPY A;  5DIC A;  2K7O A;  4DUQ A;  1MF8 B;  1TNP A;  5KSZ A;  2AMI A;  3CWG A;  3AAJ A;  3F45 A;  1P28 A;  2Y4Q A;  3CZ1 A;  4PAL A;  2LLU A;  4MBE A;  5D7F A;  1J7Q A;  1UUS A;  1CDL A;  2LVK A;  1QAS A;  2HF5 A;  2CBL A;  2MBX A;  3HCM A;  4I5J A;  5KTY A;  3AAK A;  2H61 A;  4OV2 A;  1XFX O;  5AXI A;  2HQW A;  2K61 A;  1PAL A;  5TNC A;  1QX2 A;  4P5O E;  4P2Y B;  1YUS A;  2JOJ A;  5K89 A;  2BAP A;  2P70 A;  2Y1M A;  3D73 A;  1SNL A;  3GK4 X;  3I5H C;  3OBV A;  1MUX A;  1TNX A;  2L4H A;  3PFV A;  5AFP A;  3FS7 A;  1XFU O;  3NSI A;  1FI5 A;  3EVR A;  1OOF A;  2WOR A;  1BG1 A;  1CDM A;  1RFJ A;  3S0B A;  2BCA A;  1NIW A;  2IS9 A;  2AAO A;  1Z4H A;  3OGN A;  2KHN A;  3TUY B;  1WDC B;  3JVT C;  1JC2 A;  2F2P A;  3BFB A;  1JUO A;  1DQE A;  1QAT A;  2F3Z A;  3PJI A;  4MRX A;  3VB1 A;  1TWO A;  1ZOT B;  1FI6 A;  1L7Z A;  1ALW A;  2EC6 B;  4QJ3 B;  2GGZ A;  3EK4 A;  1F71 A;  1PK0 D;  3WXA A;  2LVI A;  1QLK A;  2Y1N A;  1A4P A;  1F8H A;  1MQ1 A;  1KCY A;  1CMG A;  1EG4 A;  2L2C A;  1EH2 A;  2CTN A;  2CCM A;  2F33 A;  3I5G C;  3NHT A;  3D75 A;  2JU0 A;  3SG3 A;  1QX7 A;  2O5G A;  3FE8 A;  2K0J A;  3JTD B;  4YGA A;  1CFC A;  5I2Q A;  2HQ8 A;  1BR4 B;  3DVK A;  1R2U A;  1SRA A;  2PYQ A;  3NSO A;  2NLN A;  1SL9 A;  3AKB A;  2BEC A;  2F8P A;  4DIR A;  5BPJ A;  2LC5 A;  2WCE A;  3CR5 X;  2FCE A;  4AOM A;  1UUR A;  1A29 A;  2JC2 A;  3GK1 A;  1LS8 A;  3I5H B;  4GGF C;  5FI2 A;  1CLL A;  1GJY A;  3DY9 A;  2Y5I A;  2K8M B;  1JF0 A;  1WLZ A;  4I5L B;  2ISD A;  2KLD A;  1GGZ A;  3IQO A;  1YX8 A;  4U8D A;  1ALV A;  3PAL A;  4JPZ B;  1A75 A;  3SG2 A;  3CDN A;  4GNK B;  1TUJ A;  2YGU A;  4YI9 A;  3PM2 A;  4JQ0 D;  2LM5 A;  1OMV A;  1IKU A;  1KFX S;  2HET A;  3A8R A;  1CFD A;  1IGV A;  3B88 A;  2JPO A;  3O6B A;  1Y1U A;  2HPS A;  5EL2 A;  3FWB A;  4JKT A;  5J3X A;  2JTZ A;  1S26 D;  4I5K A;  4XJK A;  4D1E A;  1BOD A;  1ZMZ A;  3D0Y B;  2KFH A;  2WCM A;  2WCB A;  1OOH A;  1SR6 C;  1IIO A;  1DJX A;  1M31 A;  1B9A A;  2FCD A;  4PE1 A;  4NDB A;  1EJ3 A;  2M7L A;  1TCF A;  2KQY A;  1KK7 Y;  1EG3 A;  2JXC A;  2L51 A;  1SKT A;  1RWY A;  3TDI A;  1J7P A;  1F4O A;  3S0G A;  2I2R E;  1B8C A;  1ODB A;  2ZFD A;  2L5Y A;  3BUM B;  3OHM B;  3S0D A;  1NX2 A;  3BQ3 A;  3FWC A;  2H2K A;  1DJG A;  1OE9 B;  2RGI A;  1BT6 A;  1QWV A;  2G2B A;  3CR2 A;  3SS4 A;  1TNW A;  3DF0 A;  1QV0 A;  1G33 A;  5JOL A;  1LVC D;  1FPW A;  2M29 A;  2KI4 C;  2LP2 A;  1MXE A;  1BOC A;  1T14 A;  2TN4 A;  3O4Y A;  4KYN A;  1IQ5 A;  2H8V A;  2KDH A;  3K1E A;  5I8N A;  1KSM A;  1HT9 A;  2KI6 C;  2M0R A;  3KO0 A;  2JTT A;  1LIN A;  1CTR A;  1CFP A;  2QAC A;  1OZS A;  2FOT A;  1NCX A;  4PHM A;  1MWN A;  2LUC A;  1CKK A;  4FQT A;  4ICB A;  2WC6 A;  1NUB A;  1K9P A;  2KBM A;  1UHI A;  3D74 A;  4BY4 A;  1YVH A;  3O2P A;  1BF5 A;  4ORA B;  1TTX A;  1UHH A;  2KSP A;  3SS3 A;  5KU1 A;  1J7R A;  1QV1 A;  2OTG B;  1U5I B;  3TZ1 A;  1PUL A;  1QS7 A;  1TNQ A;  2WCH A;  1M46 A;  4WRI A;  3TS5 C;  2KYF A;  4OR9 B;  3MSE B;  1IG5 A;  3VRO A;  3VRP A;  1J7O A;  1SR6 B;  1S1E A;  2M97 A;  2MAZ A;  4CID A;  3FE9 A;  4CFR A;  2NXQ A;  1TN4 A;  4PE7 A;  5ER4 X;  2LP3 A;  1XK4 A;  2I18 A;  3EG5 B;  1D1O A;  2SCP A;  3DD4 A;  1K90 D;  4YGD B;  3CTN A;  1PVB A;  1UWO A;  3BJH A;  2BBM A;  1F4Q A;  1DF0 A;  2KFF A;  2AUC A;  1FBV A;  1C3Y A;  1J1E A;  2CNP A;  3RM1 A;  3UO9 A;  1DF0 B;  4HRG A;  1S6J A;  4AQJ A;  1LXF C;  5HLO A;  3NSL A;  4DS7 A;  2BCX A;  3V2L A;  4PHN A;  4YI8 A;  1KQM C;  2JXL A;  4NQG A;  3NSK A;  1XA5 A;  2BL0 C;  1Y6W A;  1XFZ O;  2QEV A;  1SBJ A;  2KI4 B;  2WCF A;  3BUO B;  2FJU B;  1AP4 A;  3CZ2 A;  3UNW A;  1BR1 B;  2SAS A;  1JF2 A;  2QDI A;  2K2F A;  3NHI A;  3BYA A;  5G08 A;  5AAN A;  1OOG A;  1TCO B;  4JD9 A;  3QRX A;  2CXJ A;  1DJY A;  2L50 A;  3O4X A;  3SG5 A;  1IJ5 A;  1SCM C;  4OZD A;  3B6X A;  2WCK A;  1BU3 A;  2LAP A;  1CM1 A;  2JT0 A;  1W9Z A;  2QEB A;  4YGE B;  2GGM A;  1SL7 A;  4A4C A;  1K96 A;  1R6P A;  1S6C A;  5FI6 A;  3TS5 B;  1SK6 D;  1CM4 A;  3I5F C;  1B4C A;  4INX A;  2M7N A;  3D77 A;  3B87 A;  3M0W A;  1JBA A;  3EKH A;  1RTP 1;  4QJ4 B;  2F3Y A;  3IQQ A;  3DVE A;  2F2O A;  1PSR A;  3IVT A;  3SIA A;  4GUK A;  4MZK A;  1IQ3 A;  1QX5 B;  3TDU A;  3CR4 X;  1QTX A;  4DRW A;  3CLN A;  1K95 A;  3A4U B;  2LV7 A;  1KFX L;  3FIA A;  2OPO A;  1S6I A;  3ZNI A;  1KSO A;  4CPV A;  3BOW B;  1KFU S;  1LA0 A;  2NZ0 A;  3CAB A;  1XO5 A;  1S5G Y;  1KQM B;  3LK0 A;  1QVI Z;  5FI7 A;  4F0Z B;  3L4A A;  3R1O A;  1OOI X;  1FF1 A;  4A4B A;  2L0P A;  3DYE A;  4E68 A;  2BNX A;  1JFK A;  4XYN A;  1AK8 A;  1RRO A;  3EKJ A;  2A4J A;  1F54 A;  2PQL A;  1LA3 A;  2WOS A;  3PAT A;  2KQ6 A;  2DOQ A;  3JVT B;  4ZCU A;  3FE6 A;  4DCK A;  3OB1 B;  4I5N B;  1J55 A;  1NPQ A;  3L47 A;  4FQO A;  3D0Y A;  2CT9 A;  2K7C A;  3DXL A;  1DC1 A;  2PVB A;  3I5I C;  2KYC A;  2ZNE A;  1A2X A;  2JUL A;  1NX0 A;  2M8U A;  1DTL A;  2L98 A;  2P71 A;  1PRW A;  1AJ4 A;  1GGW A;  2R2I A;  2B1U A;  1B7T Z;  4ORB B;  1S5G Z;  2LAN A;  2WC8 A;  3LCP C;  4PHJ A;  1DGV A;  3I5G B;  3OX5 A;  1BLQ A;  1YRT B;  4YGC B;  1XFR A;  3KF9 A;  3R72 A;  2M9G A;  2Q91 A;  1M39 A;  5JJG A;  3HX4 A;  4N5X A;  1F70 A;  1NCZ A;  1OSA A;  3R1V A;  1NYA A;  2KGB C;  4L9M A;  5B8I B;  1FW4 A;  3ZWH A;  5HYD A;  2LMV A;  2LUX A;  1SW8 A;  4GGF A;  2K7B A;  1E8A A;  3NGV A;  1QIW A;  1N65 A;  1WRZ A;  4OCI A;  2G9B A;  3AKA A;  4HRE E;  2LE9 B;  1MR8 A;  4HSZ A;  5AEQ A;  3SG6 A;  1S3P A;  1QXP A;  2MHH A;  1N2D A;  1X02 A;  2PRU A;  1YUT A;  2V53 A;  2ZKM X;  1OOJ A;  2BE6 A;  4WQ3 A;  2KBI A;  2M49 B;  2L5X B;  3KPX A;  2MA2 A;  4M2O A;  3SG4 A;  4C0K A;  2BBN A;  2LCP A;  1CLM A;  3OP0 A;  3SG7 A;  1UHJ A;  1TRF A;  1DEK A;  5I94 A;  2WND A;  4IL1 A;  1OW4 A;  1U5I A;  2BE4 A;  4CFQ A;  2VRG A;  5GQQ C;  1TOP A;  1CFF A;  3B7A A;  3S0E A;  4ETO A;  4C0L A;  4MRY A;  3BFH A;  3NXA A;  1DMO A;  5HLV A;  2MLE C;  2ZRS A;  2MJW B;  4F7F A;  1B8R A;  5ER5 A;  3I5I B;  1Y1A A;  1EXR A;  2BKI B;  2BKH B;  4PE4 A;  1JSA A;  1YUR A;  3R1P A;  2NCO A;  3RZS A;  2GV5 A;  2EC6 C;  4Q04 A;  1C07 A;  1F55 A;  1V1F A;  5CSI A;  2MLF C;  1B1G A;  1YTZ C;  3LK1 A;  1YUU A;  1Q80 A;  2WC5 A;  4C0J A;  3DVM A;  4YRU A;  1DJI A;  4N1G A;  1WRK A;  2KAY A;  1SL8 A;  2K60 A;  3BFA A;  1VRK A;  5HKZ A;  2QEO A;  1MHO A;  1BMO A;  3H4S E;  1ZFS A;  4MEW A;  2M1U A;  1N0Y A;  1CNP A;  1XFW O;  2K7D A;  3JTD C;  1L2O C;  1Y0V H;  3B86 A;  2FJY A;  1W7I B;  3KHE A;  3VRQ A;  2ZN8 A;  1K2H A;  3KEV A;  1DGU A;  1G8I A;  2KLE A;  5AER A;  2EHB A;  1GQM A;  2ZN9 A;  1EL4 A;  3LL8 B;  1YRU B;  5DKQ A;  3BXK A;  4OVN F;  5I2O A;  1AUI B;  1Y1X A;  1C7W A;  3QME A;  2PAS A;  1ORG A;  2BCB A;  5HKY A;  1NX1 A;  4GAO A;  3BUX B;  2M3W A;  1KWO C;  1M63 B;  2LVV A;  3IF7 A;  4MVF A;  4NDD A;  1KQV A;  1QVI Y;  4YBH B;  2JQ6 A;  1K9U A;  1MXL C;  2PMY A;  1CDN A;  1IWQ A;  2KPH A;  1YVL A;  4MZL A;  1OZO A;  4MZJ A;  1IRJ A;  3TDZ A;  1KFU L;  2MRD A;  1RK9 A;  1SY9 A;  2QPT A;  4HRH A;  3L4L A;  4AQI A;  1QJT A;  2PAL A;  3CZT X;  1DEL A;  1KK8 C;  2K2A A;  1XFY O;  3E3R A;  3SS5 A;  1NSH A;  2L2E A;  1B8L A;  1WLM A;  2JPT A;  4USL A;  5DKN A;  1JFJ A;  1AHR A;  3BUW B;  3BOW A;  5F6T A;  1NX3 A;  3DZT A;  2GTE A;  3VGO A;  1K9K A;  2M1K B;  3N7H A;  1IJ6 A;  2JWW A;  3Q8I A;  4R1E A;  4ZCV A;  3WHT B;  1B7T Y;  2WCL A;  1UHK A;  3D78 A;  1SYM A;  2KNE A;  3PN7 C;  1A03 A;  1LKJ A;  2LLT A;  2BL0 B;  3DVJ A;  4MSP A;  3S0A A;  3D10 A;  3VRN A;  1NCY A;  2I7A A;  1L2O B;  2JNX A;  1YX7 A;  1NWD A;  1V1G A;  2P6B B;  1BJF A;  3CZ0 A;  3D76 A;  1OMD A;  3EVU A;  1J1D A;  1DJZ A;  1TUZ A;  5CSF A;  4BY5 A;  1SMG A;  3ICB A;  2OS8 C;  3BUN B;  5FYX A;  3RLZ A;  3SJS A;  3WHU B;  2L4I A;  5HKW A;  5DKR A;  3S0F A;  3EK7 A;  3PM8 A;  1ZUZ A;  5D69 A;  5CSN A;  1DT7 B;  2ERB A;  1DJH A;  2JT8 A;  4PE0 A;  4TNC A;  1HQV A;  2LHI A;  1UHN A;  2LNK A;  1YR5 A;  3LLE A;  5I2L A;  5CPV A;  1SCM B;  3OX6 A;  2E30 A;  2O60 A;  4GBA A;  1DVI A;  4IJ7 A;  5CSJ A;  1KWO B;  3K21 A;  1CMF A;  4PCW A;  2NCP A;  4PDZ A;  4ORC B;  1CLB A;  1A75 B;  2ZND A;  1H4B A;  3I5F B;  1DJW A;  1JWD A;  2LVJ A;  2KFG A;  4MLW A;  4INW A;  3GOF A;  4QJ5 B;  2PSR A;  1GM0 A;  2OTG C;  2JZI A;  2WCJ A;  1G4Y R;  1K93 D;  1SSE B;  5D3O A;  3CYZ A;  1KK8 B;  3O78 A;  4GPL B;  3EVV A;  4UPG A;  3CGA A;  1NP8 A;  1M45 A;  1Z2C B;  2KGR A;  4PHK A;  4XJK B;  1K8U A;  5IBW A;  4N1F A;  4M2P A;  2KI6 D;  1OQP A;  2E6W A;  2KAX A;  4MN0 A;  1H8B A;  2JRF A;  4WQ2 A;  1XK4 C;  2H61 C;  3SIB A;  2LMT A;  3PN7 B;  3WNX B;  4OKH A;  1W7J B;  3C1V A;  1PVA A;  4GGN A;  1OMR A;  1ZAC A;  2LHL A;  3EK8 A;  5HL1 A;  1SCV A;  2KAV A;  1CB1 A;  1PSB A;  1UP5 A;  1CDP A;  4JWQ A;  1TIZ A;  3VRR A;  1C7V A;  2QEH A;  1AVS A;  2LLS A;  3OB2 B;  2Q4U A;  2COL B;  2LMU A;  1XFV O;  2OS8 B;  1IH0 A;  4GFT A;  2ZRT A;  2KOT A;  3GK2 A;  4CLN A;  3DF0 B;  3CS1 A;  1AJ5 A;  1XYD A;  1QLS A;  1WY9 A;  3PSR A;  2JNF A;  2JT3 A;  1QIV A;  4M2Q A;  1WRL A;  2D8N A;  1XVJ A;  3PLF B;  1REC A;  4NDC A;  1B47 A;  1WDC C;  3TUY C;  2I94 A;  5PAL A;  1KK7 Z;  2EGD A;  1K94 A;  4PT1 A;  1RJV A; 
#chains in the Genus database with same CATH homology
 4YGB B;  4FTG A;  1S36 A;  1SPY A;  4DUQ A;  2K7O A;  5KSZ A;  1MF8 B;  1TNP A;  2AMI A;  3CWG A;  3AAJ A;  3F45 A;  2Y4Q A;  4PAL A;  2LLU A;  4MBE A;  5D7F A;  1J7Q A;  1UUS A;  1CDL A;  2LVK A;  1QAS A;  2HF5 A;  2CBL A;  2MBX A;  3HCM A;  4I5J A;  5KTY A;  3AAK A;  2H61 A;  4OV2 A;  1XFX O;  5AXI A;  2HQW A;  2K61 A;  1PAL A;  5TNC A;  1QX2 A;  4P5O E;  4P2Y B;  1YUS A;  2JOJ A;  5K89 A;  2Y1M A;  3GK4 X;  1SNL A;  3I5H C;  1MUX A;  1TNX A;  2L4H A;  3PFV A;  5AFP A;  3FS7 A;  1XFU O;  3NSI A;  1FI5 A;  3EVR A;  2WOR A;  1BG1 A;  1CDM A;  1RFJ A;  2BCA A;  1NIW A;  2IS9 A;  2AAO A;  2KHN A;  3TUY B;  1WDC B;  3JVT C;  1JC2 A;  2F2P A;  1JUO A;  1QAT A;  2F3Z A;  4MRX A;  1ZOT B;  1FI6 A;  1L7Z A;  1ALW A;  2EC6 B;  4QJ3 B;  2GGZ A;  3EK4 A;  1F71 A;  1PK0 D;  3WXA A;  2LVI A;  1QLK A;  2Y1N A;  1A4P A;  1F8H A;  1MQ1 A;  1KCY A;  1CMG A;  1EG4 A;  1EH2 A;  2CTN A;  2CCM A;  2F33 A;  3I5G C;  2JU0 A;  3SG3 A;  1QX7 A;  2O5G A;  3JTD B;  2K0J A;  4YGA A;  1CFC A;  5I2Q A;  2HQ8 A;  1BR4 B;  3DVK A;  1R2U A;  1SRA A;  3NSO A;  2NLN A;  1SL9 A;  3AKB A;  2BEC A;  2F8P A;  4DIR A;  5BPJ A;  2LC5 A;  2WCE A;  3CR5 X;  2FCE A;  4AOM A;  1UUR A;  1A29 A;  2JC2 A;  3GK1 A;  3I5H B;  4GGF C;  1CLL A;  1GJY A;  2Y5I A;  2K8M B;  1JF0 A;  1WLZ A;  4I5L B;  2ISD A;  1GGZ A;  3IQO A;  1YX8 A;  4U8D A;  1ALV A;  3PAL A;  4JPZ B;  1A75 A;  3SG2 A;  4GNK B;  4YI9 A;  4JQ0 D;  2LM5 A;  1OMV A;  1IKU A;  1KFX S;  2HET A;  3A8R A;  1CFD A;  1IGV A;  3O6B A;  1Y1U A;  2HPS A;  3FWB A;  5J3X A;  2JTZ A;  1S26 D;  4I5K A;  4XJK A;  4D1E A;  1BOD A;  1ZMZ A;  3D0Y B;  2KFH A;  2WCB A;  1SR6 C;  1DJX A;  1M31 A;  1B9A A;  2FCD A;  4PE1 A;  4NDB A;  1EJ3 A;  2M7L A;  1TCF A;  2KQY A;  1KK7 Y;  1EG3 A;  2JXC A;  2L51 A;  1SKT A;  1RWY A;  3TDI A;  1J7P A;  1F4O A;  2I2R E;  1B8C A;  1ODB A;  2ZFD A;  3OHM B;  3BUM B;  1NX2 A;  3BQ3 A;  3FWC A;  2H2K A;  1DJG A;  1OE9 B;  2RGI A;  1BT6 A;  2G2B A;  3CR2 A;  1TNW A;  3DF0 A;  1QV0 A;  1G33 A;  5JOL A;  1LVC D;  1FPW A;  2M29 A;  2KI4 C;  2LP2 A;  1MXE A;  1BOC A;  2TN4 A;  3O4Y A;  1IQ5 A;  2KDH A;  5I8N A;  1KSM A;  1HT9 A;  2KI6 C;  2M0R A;  3KO0 A;  2JTT A;  1LIN A;  1CTR A;  1CFP A;  2QAC A;  1OZS A;  2FOT A;  1NCX A;  4PHM A;  1MWN A;  2LUC A;  1CKK A;  4ICB A;  1NUB A;  1K9P A;  2KBM A;  1UHI A;  4BY4 A;  1YVH A;  3O2P A;  1BF5 A;  4ORA B;  1TTX A;  1UHH A;  2KSP A;  5KU1 A;  1J7R A;  1QV1 A;  2OTG B;  1U5I B;  3TZ1 A;  1PUL A;  1QS7 A;  1TNQ A;  4WRI A;  1M46 A;  3TS5 C;  2KYF A;  4OR9 B;  3MSE B;  1IG5 A;  3VRO A;  3VRP A;  1J7O A;  1SR6 B;  1S1E A;  2M97 A;  2MAZ A;  4CID A;  4CFR A;  2NXQ A;  1TN4 A;  4PE7 A;  5ER4 X;  2LP3 A;  1XK4 A;  2I18 A;  1D1O A;  2SCP A;  3DD4 A;  1K90 D;  4YGD B;  3CTN A;  1PVB A;  1UWO A;  2BBM A;  1F4Q A;  1DF0 A;  2KFF A;  2AUC A;  1FBV A;  1J1E A;  2CNP A;  3RM1 A;  1DF0 B;  4HRG A;  1S6J A;  4AQJ A;  1LXF C;  5HLO A;  3NSL A;  4DS7 A;  2BCX A;  4PHN A;  4YI8 A;  1KQM C;  2JXL A;  4NQG A;  3NSK A;  1XA5 A;  2BL0 C;  1Y6W A;  1XFZ O;  1SBJ A;  2KI4 B;  2WCF A;  3BUO B;  2FJU B;  1AP4 A;  1BR1 B;  2SAS A;  1JF2 A;  2K2F A;  5G08 A;  3BYA A;  5AAN A;  1TCO B;  3QRX A;  2CXJ A;  1DJY A;  2L50 A;  3SG5 A;  1IJ5 A;  1SCM C;  1BU3 A;  2LAP A;  1CM1 A;  2JT0 A;  4YGE B;  2GGM A;  1SL7 A;  4A4C A;  1K96 A;  1R6P A;  1S6C A;  3TS5 B;  1SK6 D;  1CM4 A;  3I5F C;  1B4C A;  2M7N A;  3M0W A;  1JBA A;  3EKH A;  1RTP 1;  4QJ4 B;  2F3Y A;  3IQQ A;  3DVE A;  2F2O A;  1PSR A;  3SIA A;  4GUK A;  4MZK A;  1IQ3 A;  1QX5 B;  3TDU A;  3CR4 X;  1QTX A;  4DRW A;  3CLN A;  1K95 A;  3A4U B;  2LV7 A;  1KFX L;  3FIA A;  2OPO A;  1S6I A;  3ZNI A;  1KSO A;  4CPV A;  3BOW B;  1KFU S;  1LA0 A;  2NZ0 A;  1XO5 A;  1S5G Y;  1KQM B;  3LK0 A;  1QVI Z;  4F0Z B;  1FF1 A;  4A4B A;  2L0P A;  4E68 A;  1JFK A;  4XYN A;  1AK8 A;  1RRO A;  3EKJ A;  2A4J A;  1F54 A;  3PAT A;  1LA3 A;  2WOS A;  2KQ6 A;  2DOQ A;  3JVT B;  4ZCU A;  4DCK A;  3OB1 B;  4I5N B;  1J55 A;  1NPQ A;  4FQO A;  3D0Y A;  2CT9 A;  2K7C A;  2PVB A;  3I5I C;  2KYC A;  2ZNE A;  1A2X A;  2JUL A;  1NX0 A;  2M8U A;  1DTL A;  2L98 A;  1PRW A;  1AJ4 A;  1GGW A;  2R2I A;  2B1U A;  1B7T Z;  4ORB B;  1S5G Z;  2LAN A;  2WC8 A;  3LCP C;  4PHJ A;  1DGV A;  3I5G B;  3OX5 A;  1BLQ A;  1YRT B;  4YGC B;  3KF9 A;  2M9G A;  2Q91 A;  1M39 A;  5JJG A;  3HX4 A;  4N5X A;  1F70 A;  1NCZ A;  1OSA A;  1NYA A;  2KGB C;  4L9M A;  5B8I B;  1FW4 A;  3ZWH A;  5HYD A;  2LMV A;  2LUX A;  1SW8 A;  4GGF A;  2K7B A;  1E8A A;  1QIW A;  1N65 A;  1WRZ A;  4OCI A;  2G9B A;  3AKA A;  4HRE E;  2LE9 B;  1MR8 A;  4HSZ A;  5AEQ A;  3SG6 A;  1S3P A;  1QXP A;  2MHH A;  1N2D A;  1X02 A;  2PRU A;  1YUT A;  2V53 A;  2ZKM X;  1OOJ A;  2BE6 A;  4WQ3 A;  2KBI A;  2M49 B;  2L5X B;  3KPX A;  2MA2 A;  4M2O A;  3SG4 A;  4C0K A;  2BBN A;  2LCP A;  1CLM A;  3OP0 A;  3SG7 A;  1UHJ A;  1TRF A;  2WND A;  4IL1 A;  1U5I A;  2BE4 A;  4CFQ A;  2VRG A;  5GQQ C;  1TOP A;  1CFF A;  4ETO A;  4C0L A;  4MRY A;  3NXA A;  1DMO A;  5HLV A;  2MLE C;  2ZRS A;  2MJW B;  1B8R A;  5ER5 A;  3I5I B;  1Y1A A;  1EXR A;  2BKI B;  2BKH B;  4PE4 A;  1JSA A;  1YUR A;  2NCO A;  2GV5 A;  2EC6 C;  4Q04 A;  1C07 A;  1F55 A;  1V1F A;  5CSI A;  2MLF C;  1B1G A;  1YTZ C;  3LK1 A;  1YUU A;  1Q80 A;  4C0J A;  3DVM A;  4YRU A;  1DJI A;  4N1G A;  1WRK A;  2KAY A;  1SL8 A;  5HKZ A;  1VRK A;  3H4S E;  1MHO A;  1BMO A;  1ZFS A;  4MEW A;  2M1U A;  1N0Y A;  1CNP A;  1XFW O;  2K7D A;  3JTD C;  1L2O C;  1Y0V H;  3VRQ A;  3KHE A;  1W7I B;  1K2H A;  2ZN8 A;  3KEV A;  1DGU A;  1G8I A;  5AER A;  2EHB A;  1GQM A;  2ZN9 A;  1EL4 A;  3LL8 B;  1YRU B;  5DKQ A;  3BXK A;  4OVN F;  5I2O A;  1AUI B;  1Y1X A;  1C7W A;  2PAS A;  2BCB A;  5HKY A;  1NX1 A;  4GAO A;  3BUX B;  2M3W A;  1KWO C;  1M63 B;  2LVV A;  3IF7 A;  4MVF A;  4NDD A;  1KQV A;  1QVI Y;  4YBH B;  2JQ6 A;  1K9U A;  1MXL C;  2PMY A;  1CDN A;  1IWQ A;  1YVL A;  4MZL A;  1OZO A;  4MZJ A;  1IRJ A;  3TDZ A;  1KFU L;  2MRD A;  1RK9 A;  1SY9 A;  2QPT A;  4HRH A;  4AQI A;  1QJT A;  2PAL A;  3CZT X;  1KK8 C;  2K2A A;  1XFY O;  3E3R A;  1NSH A;  2L2E A;  1B8L A;  1WLM A;  2JPT A;  4USL A;  5DKN A;  1JFJ A;  1AHR A;  3BUW B;  3BOW A;  5F6T A;  1NX3 A;  3VGO A;  1K9K A;  2M1K B;  1IJ6 A;  2JWW A;  4R1E A;  4ZCV A;  3WHT B;  1B7T Y;  1UHK A;  1SYM A;  2KNE A;  3PN7 C;  1A03 A;  1LKJ A;  2LLT A;  2BL0 B;  3DVJ A;  4MSP A;  3D10 A;  3VRN A;  1NCY A;  2I7A A;  1L2O B;  2JNX A;  1YX7 A;  1NWD A;  1V1G A;  2P6B B;  1BJF A;  3EVU A;  1OMD A;  1J1D A;  1DJZ A;  5CSF A;  4BY5 A;  1SMG A;  3ICB A;  2OS8 C;  3BUN B;  5FYX A;  3RLZ A;  3SJS A;  3WHU B;  2L4I A;  5HKW A;  5DKR A;  1DT7 B;  3EK7 A;  3PM8 A;  1ZUZ A;  5D69 A;  5CSN A;  1DJH A;  2JT8 A;  4PE0 A;  4TNC A;  1HQV A;  2LHI A;  1UHN A;  2LNK A;  1YR5 A;  3LLE A;  5I2L A;  5CPV A;  1SCM B;  3OX6 A;  2E30 A;  2O60 A;  4GBA A;  1DVI A;  5CSJ A;  1KWO B;  3K21 A;  1CMF A;  4PCW A;  2NCP A;  4PDZ A;  4ORC B;  1CLB A;  1A75 B;  2ZND A;  1H4B A;  3I5F B;  1DJW A;  1JWD A;  2LVJ A;  2KFG A;  4MLW A;  4QJ5 B;  3GOF A;  2PSR A;  2OTG C;  2JZI A;  1G4Y R;  1K93 D;  1KK8 B;  3O78 A;  4GPL B;  3EVV A;  4UPG A;  3CGA A;  1NP8 A;  1M45 A;  2KGR A;  4PHK A;  4XJK B;  1K8U A;  5IBW A;  4N1F A;  4M2P A;  2KI6 D;  1OQP A;  2E6W A;  2KAX A;  4MN0 A;  1H8B A;  2JRF A;  4WQ2 A;  1XK4 C;  2H61 C;  3SIB A;  2LMT A;  3PN7 B;  3WNX B;  4OKH A;  1W7J B;  3C1V A;  1PVA A;  4GGN A;  1OMR A;  1ZAC A;  2LHL A;  3EK8 A;  1SCV A;  2KAV A;  1CB1 A;  1PSB A;  1UP5 A;  1CDP A;  4JWQ A;  1TIZ A;  3VRR A;  1C7V A;  1AVS A;  2LLS A;  3OB2 B;  2Q4U A;  2COL B;  2LMU A;  1XFV O;  2OS8 B;  1IH0 A;  4GFT A;  2ZRT A;  2KOT A;  3GK2 A;  4CLN A;  3DF0 B;  3CS1 A;  1AJ5 A;  1XYD A;  1QLS A;  1WY9 A;  3PSR A;  2JNF A;  2JT3 A;  1QIV A;  4M2Q A;  1WRL A;  2D8N A;  1XVJ A;  3PLF B;  1REC A;  4NDC A;  1B47 A;  1WDC C;  3TUY C;  2I94 A;  5PAL A;  1KK7 Z;  2EGD A;  1K94 A;  1RJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...