3PM8A

Cad domain of pff0520w, calcium dependent protein kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
165
Chain Sequence
QGHVELSSTLLKNLKNFKKENELKKIALTIIAKHLCDVEINNLRNIFIALDVDNSGTLSSQEILDGLKKIGPPDIHQVLRDQIHYTDFLAATIDKQTYLKKEVCLIPFKFFDIDGNGKISVEELKRIFGENPLIDKAIDSLLQEVDLNGDGEIDFHEFMLMMSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Calcium-dependent protein kinase 2
publication title CAD domain of PFF0520w, Calcium dependent protein kinase
rcsb
source organism Plasmodium falciparum k1
total genus 57
structure length 165
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pm8A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pm8A01
2KGBC 4YGBB 2FCEA 1GJYA 1SBJA 2BCAA 5DKQA 1C7WA 1K9KA 1YUTA 2CT9A 4YGCB 1XFYO 2A4JA 1IJ6A 1MUXA 2JOJA 3PM8A 1KWOB 4OV2A 1FF1A 4AOMA 1LINA 1BLQA 4OR9B 5HLOA 1SL8A 3CZTX 3M0WA 1LA0A 5HLVA 2Q91A 1KFUS 2D8NA 1CMFA 1UP5A 4GUKA 1LKJA 3WHUB 4UPGA 4CFQA 3O78A 4L9MA 1BF5A 1ZACA 3K21A 5I2LA 2KHNA 4GNKB 3KO0A 5PALA 2KBIA 3I5FB 1JSAA 3FS7A 3PFVA 2BCBA 4C0KA 1J7OA 3I5IB 1QIVA 3EVUA 2PALA 3BUOB 2MBXA 5IBWA 4WQ2A 2LE9B 3ZNIA 2PASA 1KSMA 1NX3A 1MXEA 1C07A 2KI6D 4DUQA 4CIDA 1IH0A 1IWQA 1QV0A 2B1UA 2ZNEA 4NDDA 2JC2A 2KDHA 4PHNA 1RK9A 4A4CA 1X02A 1NP8A 4HSZA 2LHIA 1B8CA 2BKIB 1S3PA 2KI4C 1OZOA 2NCOA 1NYAA 5D7FA 2M29A 2P6BB 5GQQC 1S26D 2Y5IA 4NQGA 1Y1UA 2LHLA 4MZLA 3KF9A 1K94A 2CCMA 3DVKA 4FTGA 3O4YA 1FBVA 1G8IA 2PSRA 1KWOC 3CR4X 1B8LA 1DJZA 2BECA 1NSHA 3DVJA 1KSOA 5TNCA 2LUXA 1KK8B 2R2IA 3EKHA 1XK4A 5I8NA 3WHTB 3DVEA 1MF8B 1J55A 5F6TA 5G08A 1JF0A 2K7BA 1GGWA 3BUXB 4GBAA 4GGNA 1RTP1 3DF0B 2H61A 2ZN9A 2I2RE 3AKAA 5DKNA 1KK7Z 3I5IC 2KYCA 2OTGC 1M45A 2WCEA 1J7QA 1ZFSA 2BCXA 4CFRA 1TN4A 1QV1A 3WXAA 1B8RA 1YRTB 1BR4B 1F4OA 1JC2A 2EC6B 4MSPA 5CPVA 1IQ3A 1CTRA 2OS8C 2NLNA 4M2QA 1UHNA 1J1EA 2M9GA 1QIWA 1SR6B 4M2OA 1JFKA 4ORBB 1CFFA 1NIWA 2CTNA 1QASA 4MLWA 5CSNA 2KQ6A 3OX6A 3SG2A 3LK0A 1NPQA 4OCIA 4YGDB 1CFPA 1PSRA 3GOFA 2WCBA 1J7RA 1D1OA 3JVTB 1XYDA 2BBNA 3A4UB 3RLZA 1PSBA 3O2PA 1CDMA 1DJHA 2KI6C 1UUSA 4PALA 1EH2A 1QLKA 2E30A 4XYNA 2L5XB 1TNWA 1KQVA 1J7PA 4FQOA 1WRZA 1S5GY 1B9AA 4ZCUA 3IQQA 1IKUA 1B7TZ 3EVVA 1IJ5A 3D10A 1S36A 2I18A 3F45A 4HREE 1KFXL 3OP0A 1CDNA 1EG3A 1RROA 3FWBA 4YI9A 3SIAA 1K96A 1A29A 1N2DA 1TTXA 2L51A 2ZRTA 1RJVA 1BR1B 3EK7A 3I5GB 1SKTA 2MA2A 1YRUB 1YUSA 1BOCA 1SR6C 2WNDA 2LVIA 1SCMC 1YTZC 4OVNF 4MBEA 1S1EA 3NSOA 1MR8A 2PVBA 4E68A 2F33A 5KU1A 1V1FA 2M97A 1HQVA 4ICBA 4R1EA 4C0LA 1KFXS 1CB1A 4PCWA 3JVTC 2FOTA 2KGRA 4JPZB 2LV7A 2ZKMX 3GK2A 2L50A 2KAYA 1A03A 1SYMA 3NXAA 2EGDA 4MZJA 3TUYC 1V1GA 1EJ3A 5AANA 2KQYA 3PN7B 2LM5A 1FPWA 4NDBA 1KQMB 3VROA 3D0YA 1OSAA 1L2OB 4N1GA 1TNPA 1AP4A 2K7CA 4M2PA 4YGAA 2O60A 1FI6A 1QJTA 3SG4A 2JTZA 1IGVA 2JPTA 1AUIB 1YUUA 1EL4A 2MLEC 1XA5A 1AJ4A 1ALVA 1U5IB 3I5GC 4N5XA 1M63B 4P2YB 1DJGA 1WDCB 2HETA 2M8UA 1J1DA 1F4QA 2L0PA 3ICBA 4PHJA 1DJXA 1TOPA 5B8IB 1XFVO 1EG4A 2QPTA 5BPJA 3A8RA 2HQ8A 2KFGA 4XJKA 1F70A 1DGVA 1TNQA 2E6WA 4U8DA 1XFWO 1DMOA 1OMDA 4NDCA 3CR5X 3NSKA 2EHBA 1ZOTB 1DT7B 2K61A 4ORCB 4OKHA 2M3WA 3WNXB 3DVMA 4TNCA 3SG3A 3EVRA 1TCOB 4I5JA 2M7LA 4BY5A 1RECA 4D1EA 4GGFC 2F2PA 5CSJA 4QJ5B 3I5HB 3I5FC 2KBMA 4C0JA 2SCPA 1AHRA 1B47A 2M0RA 2JT0A 3CWGA 1L2OC 5AFPA 1Y1AA 3E3RA 1K90D 1JUOA 2MJWB 2ISDA 1G4YR 4YRUA 2K7DA 4BY4A 3OB1B 5KSZA 1QATA 1WLZA 2M49B 1PULA 2PMYA 5FYXA 1JFJA 1CLBA 1YR5A 3AAJA 2QACA 3ZWHA 2OPOA 3BOWA 3TS5B 4DCKA 4QJ4B 4MN0A 2JRFA 3TDUA 2JNFA 2SASA 3RM1A 4GAOA 1OE9B 1CM4A 1ZMZA 3BUWB 1CNPA 2AMIA 2WORA 2RGIA 4N1FA 2LC5A 2LVVA 2MRDA 4I5KA 2MAZA 1NX1A 1DVIA 2KAXA 4PHMA 1HT9A 1OOJA 1UHJA 3TDZA 1QTXA 4MRYA 1KK8C 5HYDA 1GQMA 3OHMB 1ZUZA 2LVKA 3GK4X 2G9BA 3OB2B 2WOSA 2JZIA 3EK8A 3LK1A 3IF7A 1K2HA 2KYFA 1R6PA 3JTDB 4XJKB 1S5GZ 1OMRA 4HRHA 1S6CA 2NCPA 1QLSA 3LCPC 1C7VA 1N0YA 1RWYA 1M39A 2H2KA 2L4HA 2TN4A 1QVIY 1QS7A 4CLNA 1QVIZ 2MHHA 3OX5A 1CFDA 1K9UA 2PRUA 4DRWA 1DTLA 2EC6C 1K8UA 1CKKA 1AJ5A 1CLMA 1S6IA 1PVAA 2LANA 1FI5A 3TS5C 1IG5A 1YX7A 3QRXA 1Y1XA 2K8MB 1F8HA 1H8BA 1YURA 3AAKA 5AXIA 2Y1MA 4MRXA 1DF0A 1A2XA 1SK6D 2NXQA 2KOTA 3CGAA 1PRWA 1SL7A 3NSIA 1ALWA 1L7ZA 1SY9A 1CM1A 5ER5A 1XFUO 1PALA 5JJGA 5KTYA 2K0JA 3PATA 1IRJA 1CDPA 1WRKA 3BOWB 1QX2A 2BE6A 1M46A 2LMTA 3BQ3A 5HKZA 1A4PA 1NX2A 1AVSA 2JT3A 2JQ6A 1SRAA 3FIAA 3VRQA 3HX4A 1AK8A 2JULA 3AKBA 2DOQA 3EK4A 2KI4B 2M1KB 4PE7A 2AUCA 2HQWA 1MXLC 3JTDC 4MZKA 4YGEB 3CS1A 1W7JB 3PLFB 5DKRA 1VRKA 2BKHB 4MEWA 4F0ZB 3DD4A 3DF0A 5AEQA 2KNEA 1SNLA 4IL1A 1XK4C 2ZRSA 5AERA 2JXCA 1B1GA 4QJ3B 1H4BA 2MLFC 2CBLA 5JOLA 3VGOA 2JXLA 4I5NB 1WRLA 2H61C 3CTNA 1F55A 1WLMA 1NX0A 2JTTA 1Y0VH 2COLB 4I5LB 3VRRA 3LLEA 1NCYA 2I7AA 1CDLA 2K7OA 1G33A 4DIRA 1DJWA 2OTGB 2HPSA 3KEVA 1E8AA 1JF2A 4WQ3A 2GGMA 2JT8A 2LLSA 1MHOA 3SIBA 3KHEA 2I94A 1UHIA 2M1UA 1JWDA 3C1VA 1B4CA 4YI8A 2OS8B 2FJUB 1YVHA 2V53A 4Q04A 2M7NA 2NZ0A 1LA3A 2CXJA 1DF0B 3PN7C 2LP2A 1QX5B 2KFFA 3MSEB 3PSRA 1KQMC 2ZNDA 2F3ZA 1PK0D 2BL0B 1Q80A 1QX7A 2O5GA 1IQ5A 2LMUA 1TNXA 1GGZA 4JQ0D 2KAVA 2LAPA 1NWDA 2LLUA 2VRGA 1SW8A 2WC8A 1F54A 1DGUA 1MWNA 2GGZA 2F8PA 1A75A 4PE0A 1UURA 4ETOA 1BG1A 1BMOA 2Q4UA 1TIZA 1NUBA 1SCVA 3CLNA 4ZCVA 1K95A 1W7IB 2JU0A 3D0YB 3SJSA 1UHKA 1WDCC 2LMVA 1FW4A 3TZ1A 3BUNB 1M31A 1SL9A 3EKJA 5J3XA 1RFJA 2LP3A 1KK7Y 2JWWA 1LVCD 4JWQA 4A4BA 2K2AA 2KFHA 3HCMA 1F71A 4AQIA 5D69A 4AQJA 3GK1A 4ORAB 1BJFA 2BBMA 1XO5A 2LLTA 1S6JA 2F3YA 2AAOA 1OZSA 5CSFA 1SMGA 1DJYA 2F2OA 1OMVA 2LCPA 2Y1NA 3KPXA 4PDZA 4CPVA 1WY9A 4HRGA 1YVLA 3FWCA 1XVJA 2L4IA 1SCMB 1BT6A 4WRIA 1DJIA 3I5HC 5HKWA 1YX8A 2BL0C 4P5OE 1EXRA 4GGFA 4USLA 3SG5A 1R2UA 1TCFA 5I2OA 3BUMB 2L2EA 1QXPA 1UWOA 2LUCA 2CNPA 3O6BA 4PE4A 4YBHB 1CFCA 5HKYA 1BODA 3CR2A 2LVJA 3BXKA 4GPLB 4PHKA 2K2FA 4PE1A 3TDIA 2G2BA 1XFZO 1KCYA 3TUYB 3SG7A 1JBAA 3H4SE 3PALA 2BE4A 5CSIA 4MVFA 5ER4X 4DS7A 1BU3A 1TRFA 1SPYA 1NCXA 2KSPA 5I2QA 2HF5A 1CLLA 1U5IA 2FCDA 2JNXA 1UHHA 4GFTA 1XFXO 2L98A 1LXFC 1B7TY 2IS9A 3IQOA 3SG6A 1PVBA 1MQ1A 2LNKA 3VRNA 1A75B 1N65A 1K9PA 2ZN8A 2Y4QA 1ODBA 5K89A 1KFUL 2WCFA 1K93D 1OQPA 3VRPA 1Y6WA 2GV5A 2ZFDA 3NSLA 3BYAA 3LL8B 1CMGA 1NCZA
chains in the Genus database with same CATH superfamily
2KGBC 4YGBB 2FCEA 1GJYA 1SBJA 2BCAA 5DKQA 1C7WA 1K9KA 1YUTA 2CT9A 4YGCB 1XFYO 2A4JA 1IJ6A 1MUXA 2JOJA 3PM8A 1KWOB 4OV2A 1FF1A 4AOMA 1LINA 2WCHA 1BLQA 4OR9B 5HLOA 1SL8A 3CZTX 3SS4A 2ERBA 3M0WA 1LA0A 5HLVA 2Q91A 1KFUS 3S0AA 2D8NA 1CMFA 1UP5A 4GUKA 1LKJA 3WHUB 3CZ2A 4UPGA 4CFQA 3O78A 4L9MA 1BF5A 1ZACA 3K21A 5I2LA 2KHNA 4GNKB 3KO0A 5PALA 2KBIA 3I5FB 3S0BA 1JSAA 3FS7A 3PFVA 2BCBA 3O4XA 5FI2A 3I5IB 4C0KA 1J7OA 1QIVA 3EVUA 2PALA 3BUOB 2MBXA 5IBWA 4WQ2A 2LE9B 3ZNIA 2PASA 1KSMA 1NX3A 1MXEA 1C07A 1QWVA 2KI6D 4DUQA 4CIDA 1IH0A 1IWQA 1QV0A 2B1UA 2ZNEA 4NDDA 2JC2A 2KDHA 4PHNA 1RK9A 4A4CA 1X02A 1NP8A 4HSZA 2LHIA 3D74A 4OZDA 1B8CA 2BKIB 1S3PA 2KI4C 1OZOA 2NCOA 1NYAA 5D7FA 2M29A 2P6BB 5GQQC 1S26D 2Y5IA 4NQGA 1Y1UA 2LHLA 4MZLA 3KF9A 1K94A 2CCMA 3DVKA 4FTGA 3PJIA 3O4YA 1FBVA 1G8IA 2PSRA 1KWOC 3CR4X 1B8LA 1DJZA 1NSHA 2BECA 3DVJA 1KSOA 5TNCA 2LUXA 1KK8B 2R2IA 3EKHA 1XK4A 3EG5B 5I8NA 3WHTB 3DVEA 1MF8B 1J55A 5F6TA 5G08A 1JF0A 2K7BA 1GGWA 3B7AA 3BUXB 4GBAA 4GGNA 1RTP1 3DF0B 3FE8A 2H61A 2ZN9A 4KYNA 1T14A 2I2RE 2QEHA 3AKAA 5DKNA 1KK7Z 3I5IC 2KYCA 2OTGC 1M45A 2WCEA 3CYZA 1J7QA 1ZFSA 2BCXA 4CFRA 1TN4A 1QV1A 3WXAA 1B8RA 1YRTB 5D3OA 1BR4B 1F4OA 1JC2A 2EC6B 4MSPA 5CPVA 1IQ3A 1CTRA 1OOGA 2NLNA 2OS8C 4M2QA 3DXLA 1UHNA 1J1EA 2M9GA 1QIWA 1SR6B 4M2OA 1JFKA 4ORBB 1CFFA 1NIWA 2CTNA 1QASA 4MLWA 1DC1A 5CSNA 2KQ6A 3OX6A 3SG2A 3LK0A 1NPQA 2QEVA 4OCIA 4YGDB 1CFPA 1PSRA 3GOFA 3RZSA 2WCBA 1J7RA 3VB1A 1D1OA 3JVTB 1XYDA 2BBNA 3A4UB 3RLZA 1PSBA 3O2PA 1CDMA 1DJHA 2KI6C 1UUSA 3D75A 4PALA 1EH2A 1QLKA 2E30A 4XYNA 2L5XB 3K1EA 1TNWA 1KQVA 1J7PA 4FQOA 1WRZA 1S5GY 1B9AA 4ZCUA 1LS8A 5DICA 3IQQA 1IKUA 1B7TZ 3EVVA 1IJ5A 3D10A 1S36A 2I18A 3F45A 4HREE 1KFXL 2WC5A 3OP0A 1CDNA 1EG3A 1RROA 3FWBA 4YI9A 3SIAA 1K96A 1A29A 1SSEB 3FE9A 1N2DA 1TTXA 4JKTA 2L51A 2ZRTA 1RJVA 1BR1B 3EK7A 3I5GB 1SKTA 2MA2A 1YRUB 1YUSA 1BOCA 1SR6C 2WNDA 2LVIA 1SCMC 1YTZC 4OVNF 4MBEA 1S1EA 3NSOA 3S0GA 1MR8A 2PVBA 4E68A 2F33A 5KU1A 1V1FA 2M97A 1HQVA 2H8VA 4ICBA 4R1EA 4C0LA 1KFXS 1CB1A 3CZ1A 4PCWA 3JVTC 2FOTA 2KGRA 4JPZB 2LV7A 2ZKMX 2PYQA 3BFBA 4JD9A 3GK2A 2L50A 2KAYA 1A03A 1SYMA 3NXAA 2EGDA 4MZJA 3TUYC 2YGUA 1V1GA 1EJ3A 5AANA 2QEOA 2KQYA 3PN7B 1ORGA 2LM5A 1FPWA 4NDBA 1KQMB 3VROA 3D0YA 1OSAA 1L2OB 4N1GA 1TNPA 2WCMA 2K7CA 3R72A 1AP4A 4M2PA 4YGAA 2O60A 1FI6A 1QJTA 3SG4A 2JTZA 1IGVA 2JPTA 1AUIB 1YUUA 1EL4A 2MLEC 1XA5A 3R1PA 1AJ4A 1ALVA 1U5IB 2KLEA 3I5GC 1M63B 3NHTA 4N5XA 1DJGA 1WDCB 4P2YB 2HETA 2M8UA 1J1DA 1F4QA 2L0PA 2WCJA 3ICBA 4PHJA 1DJXA 1TOPA 5B8IB 1C3YA 1XFVO 1EG4A 2QPTA 5BPJA 3A8RA 2HQ8A 2KFGA 4XJKA 1F70A 1DGVA 1TNQA 2E6WA 4U8DA 1XFWO 1DMOA 1Z2CB 4FQTA 1OMDA 4NDCA 3CR5X 3NSKA 2EHBA 1ZOTB 1OW4A 2FJYA 3UNWA 1DT7B 2K61A 4ORCB 4OKHA 2M3WA 3S0DA 3DVMA 3WNXB 4TNCA 3SG3A 3EVRA 1TCOB 4I5JA 2M7LA 4BY5A 1RECA 4D1EA 4GGFC 2F2PA 5CSJA 2QEBA 4QJ5B 3I5HB 3I5FC 2KBMA 4C0JA 2SCPA 1AHRA 1B47A 2M0RA 2JT0A 3CWGA 5I94A 5FI6A 1L2OC 1XFRA 5AFPA 1Y1AA 3E3RA 1K90D 1JUOA 2MJWB 2ISDA 1G4YR 4YRUA 2K7DA 4BY4A 1IIOA 3OB1B 5HL1A 5KSZA 1QATA 1WLZA 2M49B 1PULA 2PMYA 3D78A 5FYXA 1JFJA 3B86A 1YR5A 2KPHA 3AAJA 1CLBA 2QACA 3ZWHA 2OPOA 3BOWA 3TS5B 4INXA 4DCKA 3CZ0A 4MN0A 4QJ4B 2JRFA 3TDUA 2JNFA 1OOIX 2SASA 4GAOA 3RM1A 1OE9B 1CM4A 1W9ZA 1ZMZA 3BUWB 1CNPA 2AMIA 2WORA 2GTEA 2RGIA 4N1FA 2LC5A 1TWOA 2LVVA 2MRDA 4I5KA 2MAZA 1NX1A 3B88A 1DVIA 2KAXA 4PHMA 1HT9A 1OOJA 1UHJA 3TDZA 1QTXA 4MRYA 1KK8C 5HYDA 1GQMA 3OHMB 1ZUZA 2LVKA 3GK4X 2G9BA 3OB2B 2WOSA 2JZIA 2PQLA 2BAPA 1BODA 3EK8A 3LK1A 3IF7A 1K2HA 2KYFA 1R6PA 3JTDB 4XJKB 1S5GZ 1DELA 1OMRA 4HRHA 1S6CA 2NCPA 1QLSA 3LCPC 1C7VA 1N0YA 1RWYA 1M39A 2H2KA 2L4HA 3R1VA 2JPOA 2TN4A 1QVIY 3BFAA 1QS7A 1TUZA 4CLNA 1QVIZ 2MHHA 3OX5A 1CFDA 1K9UA 2PRUA 4DRWA 1DTLA 2EC6C 1K8UA 3D77A 1CKKA 1C3ZA 1AJ5A 1CLMA 1S6IA 1PVAA 2LANA 1FI5A 3TS5C 1IG5A 1YX7A 3QRXA 1Y1XA 2K8MB 3V2LA 1F8HA 1H8BA 1YURA 3AAKA 3N7HA 2Y1MA 2P70A 5AXIA 4MRXA 1DF0A 1A2XA 1SK6D 2NXQA 2KOTA 3CGAA 1PRWA 1SL7A 3NSIA 1ALWA 1L7ZA 1SY9A 1CM1A 3DYEA 1XFUO 5ER5A 3DZTA 1PALA 5JJGA 5KTYA 2K0JA 4F7FA 3PATA 1IRJA 1CDPA 1WRKA 3BOWB 1QX2A 2BE6A 1M46A 2LMTA 3BQ3A 5HKZA 1A4PA 1NX2A 1AVSA 2JT3A 2JQ6A 3Q8IA 3L4LA 1SRAA 3FIAA 3VRQA 3HX4A 1AK8A 2JULA 3AKBA 2DOQA 3EK4A 2KI4B 2M1KB 4PE7A 2AUCA 2HQWA 1MXLC 2WCLA 3JTDC 4MZKA 4YGEB 3CS1A 1W7JB 3PLFB 5DKRA 1VRKA 2BKHB 4MEWA 1DQEA 4F0ZB 1GM0A 3DD4A 3DF0A 3PM2A 5AEQA 2KNEA 1SNLA 4IL1A 1XK4C 2ZRSA 3BFHA 4IJ7A 5AERA 2JXCA 5EL2A 1B1GA 4QJ3B 1H4BA 2MLFC 2CBLA 5JOLA 4PT1A 3VGOA 2JXLA 4I5NB 1WRLA 2H61C 3CTNA 1OOHA 1F55A 1WLMA 1NX0A 2JTTA 1Y0VH 2COLB 4I5LB 3VRRA 3SS5A 3LLEA 1NCYA 2I7AA 1CDLA 2P71A 2K7OA 3L47A 1G33A 3QMEA 4DIRA 1DJWA 2OTGB 2HPSA 3KEVA 3OGNA 1E8AA 1JF2A 4WQ3A 2GGMA 2JT8A 2LLSA 1MHOA 3SIBA 1P28A 3KHEA 2I94A 1UHIA 2M1UA 1JWDA 3C1VA 1B4CA 4YI8A 2OS8B 2FJUB 1YVHA 2V53A 4Q04A 2M7NA 2NZ0A 1LA3A 2CXJA 1DF0B 3PN7C 2LP2A 1QX5B 2KFFA 3MSEB 3PSRA 5FI7A 1KQMC 2ZNDA 2F3ZA 1PK0D 2BL0B 1Q80A 1QX7A 2O5GA 1IQ5A 2LMUA 1TNXA 1Z4HA 1GGZA 4JQ0D 2KAVA 2LAPA 2WC6A 1NWDA 2LLUA 2VRGA 1SW8A 3OBVA 2WC8A 1F54A 1DGUA 1MWNA 2GGZA 2F8PA 1A75A 4PE0A 1UURA 4ETOA 1BG1A 3R1OA 1BMOA 2Q4UA 1TIZA 1NUBA 1SCVA 3CLNA 4ZCVA 1K95A 1W7IB 2JU0A 3D0YB 3SJSA 1UHKA 1WDCC 2LMVA 3SS3A 1FW4A 3TZ1A 3BUNB 2L5YA 1M31A 1SL9A 3EKJA 5J3XA 3NGVA 1RFJA 2LP3A 1KK7Y 2JWWA 3BJHA 1LVCD 4JWQA 4A4BA 2K2AA 2KFHA 3HCMA 2WCKA 1F71A 4AQIA 5D69A 4AQJA 3B6XA 3GK1A 4ORAB 1BJFA 2BBMA 3S0EA 1XO5A 2LLTA 1S6JA 2KLDA 2F3YA 2AAOA 1OZSA 5CSFA 3CABA 1SMGA 1DJYA 2F2OA 1OMVA 2LCPA 2Y1NA 3KPXA 3FE6A 4PDZA 4CPVA 1WY9A 4HRGA 1YVLA 2K60A 3FWCA 1XVJA 2L4IA 1SCMB 1BT6A 4WRIA 1DJIA 3I5HC 3L4AA 5HKWA 1YX8A 2BL0C 4INWA 1EXRA 4GGFA 4P5OE 4USLA 3SG5A 1R2UA 1TCFA 5I2OA 3BUMB 2L2EA 1QXPA 1UWOA 2LUCA 2CNPA 1DEKA 3O6BA 4PE4A 4YBHB 1OOFA 1CFCA 3D73A 1TUJA 5HKYA 3D76A 3CDNA 3CR2A 2LVJA 3BXKA 4GPLB 4PHKA 2K2FA 4PE1A 3TDIA 2G2BA 1XFZO 1KCYA 3TUYB 3UO9A 3SG7A 1JBAA 3H4SE 3PALA 2BE4A 2BNXA 4MVFA 5CSIA 5ER4X 4DS7A 1BU3A 1TRFA 1SPYA 1NCXA 2KSPA 5I2QA 2HF5A 1CLLA 1U5IA 2FCDA 2JNXA 2L2CA 1UHHA 4GFTA 1XFXO 2L98A 1LXFC 1B7TY 2IS9A 3IQOA 3SG6A 1PVBA 1MQ1A 2LNKA 2QDIA 3VRNA 3NHIA 3DY9A 3IVTA 1A75B 1N65A 3S0FA 1K9PA 2ZN8A 3B87A 2Y4QA 1ODBA 5K89A 1KFUL 2WCFA 1K93D 1OQPA 3VRPA 1Y6WA 2GV5A 2ZFDA 3NSLA 3BYAA 3LL8B 1CMGA 1NCZA
chains in the Genus database with same CATH topology
2KGBC 4YGBB 2FCEA 1GJYA 1SBJA 2BCAA 5DKQA 1C7WA 1K9KA 1YUTA 2CT9A 4YGCB 1XFYO 2A4JA 1IJ6A 1MUXA 2JOJA 3PM8A 1KWOB 4OV2A 1FF1A 4AOMA 1LINA 1BLQA 4OR9B 5HLOA 1SL8A 3CZTX 3M0WA 1LA0A 5HLVA 2Q91A 1KFUS 2D8NA 1CMFA 1UP5A 4GUKA 1LKJA 3WHUB 4UPGA 4CFQA 3O78A 4L9MA 1BF5A 1ZACA 3K21A 5I2LA 2KHNA 4GNKB 3KO0A 5PALA 2KBIA 3I5FB 1JSAA 3FS7A 3PFVA 2BCBA 4C0KA 1J7OA 3I5IB 1QIVA 3EVUA 2PALA 3BUOB 2MBXA 5IBWA 4WQ2A 2LE9B 3ZNIA 2PASA 1KSMA 1NX3A 1MXEA 1C07A 2KI6D 4DUQA 4CIDA 1IH0A 1IWQA 1QV0A 2B1UA 2ZNEA 4NDDA 2JC2A 2KDHA 4PHNA 1RK9A 4A4CA 1X02A 1NP8A 4HSZA 2LHIA 1B8CA 2BKIB 1S3PA 2KI4C 1OZOA 2NCOA 1NYAA 5D7FA 2M29A 2P6BB 5GQQC 1S26D 2Y5IA 4NQGA 1Y1UA 2LHLA 4MZLA 3KF9A 1K94A 2CCMA 3DVKA 4FTGA 3O4YA 1FBVA 1G8IA 2PSRA 1KWOC 3CR4X 1B8LA 1DJZA 2BECA 1NSHA 3DVJA 1KSOA 5TNCA 2LUXA 1KK8B 2R2IA 3EKHA 1XK4A 5I8NA 3WHTB 3DVEA 1MF8B 1J55A 5F6TA 5G08A 1JF0A 2K7BA 1GGWA 3BUXB 4GBAA 4GGNA 1RTP1 3DF0B 2H61A 2ZN9A 2I2RE 3AKAA 5DKNA 1KK7Z 3I5IC 2KYCA 2OTGC 1M45A 2WCEA 1J7QA 1ZFSA 2BCXA 4CFRA 1TN4A 1QV1A 3WXAA 1B8RA 1YRTB 1BR4B 1F4OA 1JC2A 2EC6B 4MSPA 5CPVA 1IQ3A 1CTRA 2OS8C 2NLNA 4M2QA 1UHNA 1J1EA 2M9GA 1QIWA 1SR6B 4M2OA 1JFKA 4ORBB 1CFFA 1NIWA 2CTNA 1QASA 4MLWA 5CSNA 2KQ6A 3OX6A 3SG2A 3LK0A 1NPQA 4OCIA 4YGDB 1CFPA 1PSRA 3GOFA 2WCBA 1J7RA 1D1OA 3JVTB 1XYDA 2BBNA 3A4UB 3RLZA 1PSBA 3O2PA 1CDMA 1DJHA 2KI6C 1UUSA 4PALA 1EH2A 1QLKA 2E30A 4XYNA 2L5XB 1TNWA 1KQVA 1J7PA 4FQOA 1WRZA 1S5GY 1B9AA 4ZCUA 3IQQA 1IKUA 1B7TZ 3EVVA 1IJ5A 3D10A 1S36A 2I18A 3F45A 4HREE 1KFXL 3OP0A 1CDNA 1EG3A 1RROA 3FWBA 4YI9A 3SIAA 1K96A 1A29A 1N2DA 1TTXA 2L51A 2ZRTA 1RJVA 1BR1B 3EK7A 3I5GB 1SKTA 2MA2A 1YRUB 1YUSA 1BOCA 1SR6C 2WNDA 2LVIA 1SCMC 1YTZC 4OVNF 4MBEA 1S1EA 3NSOA 1MR8A 2PVBA 4E68A 2F33A 5KU1A 1V1FA 2M97A 1HQVA 4ICBA 4R1EA 4C0LA 1KFXS 1CB1A 4PCWA 3JVTC 2FOTA 2KGRA 4JPZB 2LV7A 2ZKMX 3GK2A 2L50A 2KAYA 1A03A 1SYMA 3NXAA 2EGDA 4MZJA 3TUYC 1V1GA 1EJ3A 5AANA 2KQYA 3PN7B 2LM5A 1FPWA 4NDBA 1KQMB 3VROA 3D0YA 1OSAA 1L2OB 4N1GA 1TNPA 1AP4A 2K7CA 4M2PA 4YGAA 2O60A 1FI6A 1QJTA 3SG4A 2JTZA 1IGVA 2JPTA 1AUIB 1YUUA 1EL4A 2MLEC 1XA5A 1AJ4A 1ALVA 1U5IB 3I5GC 4N5XA 1M63B 4P2YB 1DJGA 1WDCB 2HETA 2M8UA 1J1DA 1F4QA 2L0PA 3ICBA 4PHJA 1DJXA 1TOPA 5B8IB 1XFVO 1EG4A 2QPTA 5BPJA 3A8RA 2HQ8A 2KFGA 4XJKA 1F70A 1DGVA 1TNQA 2E6WA 4U8DA 1XFWO 1DMOA 1OMDA 4NDCA 3CR5X 3NSKA 2EHBA 1ZOTB 1DT7B 2K61A 4ORCB 4OKHA 2M3WA 3WNXB 3DVMA 4TNCA 3SG3A 3EVRA 1TCOB 4I5JA 2M7LA 4BY5A 1RECA 4D1EA 4GGFC 2F2PA 5CSJA 4QJ5B 3I5HB 3I5FC 2KBMA 4C0JA 2SCPA 1AHRA 1B47A 2M0RA 2JT0A 3CWGA 1L2OC 5AFPA 1Y1AA 3E3RA 1K90D 1JUOA 2MJWB 2ISDA 1G4YR 4YRUA 2K7DA 4BY4A 3OB1B 5KSZA 1QATA 1WLZA 2M49B 1PULA 2PMYA 5FYXA 1JFJA 1CLBA 1YR5A 3AAJA 2QACA 3ZWHA 2OPOA 3BOWA 3TS5B 4DCKA 4QJ4B 4MN0A 2JRFA 3TDUA 2JNFA 2SASA 3RM1A 4GAOA 1OE9B 1CM4A 1ZMZA 3BUWB 1CNPA 2AMIA 2WORA 2RGIA 4N1FA 2LC5A 2LVVA 2MRDA 4I5KA 2MAZA 1NX1A 1DVIA 2KAXA 4PHMA 1HT9A 1OOJA 1UHJA 3TDZA 1QTXA 4MRYA 1KK8C 5HYDA 1GQMA 3OHMB 1ZUZA 2LVKA 3GK4X 2G9BA 3OB2B 2WOSA 2JZIA 3EK8A 3LK1A 3IF7A 1K2HA 2KYFA 1R6PA 3JTDB 4XJKB 1S5GZ 1OMRA 4HRHA 1S6CA 2NCPA 1QLSA 3LCPC 1C7VA 1N0YA 1RWYA 1M39A 2H2KA 2L4HA 2TN4A 1QVIY 1QS7A 4CLNA 1QVIZ 2MHHA 3OX5A 1CFDA 1K9UA 2PRUA 4DRWA 1DTLA 2EC6C 1K8UA 1CKKA 1AJ5A 1CLMA 1S6IA 1PVAA 2LANA 1FI5A 3TS5C 1IG5A 1YX7A 3QRXA 1Y1XA 2K8MB 1F8HA 1H8BA 1YURA 3AAKA 5AXIA 2Y1MA 4MRXA 1DF0A 1A2XA 1SK6D 2NXQA 2KOTA 3CGAA 1PRWA 1SL7A 3NSIA 1ALWA 1L7ZA 1SY9A 1CM1A 5ER5A 1XFUO 1PALA 5JJGA 5KTYA 2K0JA 3PATA 1IRJA 1CDPA 1WRKA 3BOWB 1QX2A 2BE6A 1M46A 2LMTA 3BQ3A 5HKZA 1A4PA 1NX2A 1AVSA 2JT3A 2JQ6A 1SRAA 3FIAA 3VRQA 3HX4A 1AK8A 2JULA 3AKBA 2DOQA 3EK4A 2KI4B 2M1KB 4PE7A 2AUCA 2HQWA 1MXLC 3JTDC 4MZKA 4YGEB 3CS1A 1W7JB 3PLFB 5DKRA 1VRKA 2BKHB 4MEWA 4F0ZB 3DD4A 3DF0A 5AEQA 2KNEA 1SNLA 4IL1A 1XK4C 2ZRSA 5AERA 2JXCA 1B1GA 4QJ3B 1H4BA 2MLFC 2CBLA 5JOLA 3VGOA 2JXLA 4I5NB 1WRLA 2H61C 3CTNA 1F55A 1WLMA 1NX0A 2JTTA 1Y0VH 2COLB 4I5LB 3VRRA 3LLEA 1NCYA 2I7AA 1CDLA 2K7OA 1G33A 4DIRA 1DJWA 2OTGB 2HPSA 3KEVA 1E8AA 1JF2A 4WQ3A 2GGMA 2JT8A 2LLSA 1MHOA 3SIBA 3KHEA 2I94A 1UHIA 2M1UA 1JWDA 3C1VA 1B4CA 4YI8A 2OS8B 2FJUB 1YVHA 2V53A 4Q04A 2M7NA 2NZ0A 1LA3A 2CXJA 1DF0B 3PN7C 2LP2A 1QX5B 2KFFA 3MSEB 3PSRA 1KQMC 2ZNDA 2F3ZA 1PK0D 2BL0B 1Q80A 1QX7A 2O5GA 1IQ5A 2LMUA 1TNXA 1GGZA 4JQ0D 2KAVA 2LAPA 1NWDA 2LLUA 2VRGA 1SW8A 2WC8A 1F54A 1DGUA 1MWNA 2GGZA 2F8PA 1A75A 4PE0A 1UURA 4ETOA 1BG1A 1BMOA 2Q4UA 1TIZA 1NUBA 1SCVA 3CLNA 4ZCVA 1K95A 1W7IB 2JU0A 3D0YB 3SJSA 1UHKA 1WDCC 2LMVA 1FW4A 3TZ1A 3BUNB 1M31A 1SL9A 3EKJA 5J3XA 1RFJA 2LP3A 1KK7Y 2JWWA 1LVCD 4JWQA 4A4BA 2K2AA 2KFHA 3HCMA 1F71A 4AQIA 5D69A 4AQJA 3GK1A 4ORAB 1BJFA 2BBMA 1XO5A 2LLTA 1S6JA 2F3YA 2AAOA 1OZSA 5CSFA 1SMGA 1DJYA 2F2OA 1OMVA 2LCPA 2Y1NA 3KPXA 4PDZA 4CPVA 1WY9A 4HRGA 1YVLA 3FWCA 1XVJA 2L4IA 1SCMB 1BT6A 4WRIA 1DJIA 3I5HC 5HKWA 1YX8A 2BL0C 4P5OE 1EXRA 4GGFA 4USLA 3SG5A 1R2UA 1TCFA 5I2OA 3BUMB 2L2EA 1QXPA 1UWOA 2LUCA 2CNPA 3O6BA 4PE4A 4YBHB 1CFCA 5HKYA 1BODA 3CR2A 2LVJA 3BXKA 4GPLB 4PHKA 2K2FA 4PE1A 3TDIA 2G2BA 1XFZO 1KCYA 3TUYB 3SG7A 1JBAA 3H4SE 3PALA 2BE4A 5CSIA 4MVFA 5ER4X 4DS7A 1BU3A 1TRFA 1SPYA 1NCXA 2KSPA 5I2QA 2HF5A 1CLLA 1U5IA 2FCDA 2JNXA 1UHHA 4GFTA 1XFXO 2L98A 1LXFC 1B7TY 2IS9A 3IQOA 3SG6A 1PVBA 1MQ1A 2LNKA 3VRNA 1A75B 1N65A 1K9PA 2ZN8A 2Y4QA 1ODBA 5K89A 1KFUL 2WCFA 1K93D 1OQPA 3VRPA 1Y6WA 2GV5A 2ZFDA 3NSLA 3BYAA 3LL8B 1CMGA 1NCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGB C;  4YGB B;  2FCE A;  1GJY A;  1SBJ A;  2BCA A;  5DKQ A;  1C7W A;  1K9K A;  1YUT A;  2CT9 A;  4YGC B;  1XFY O;  2A4J A;  1IJ6 A;  1MUX A;  2JOJ A;  3PM8 A;  1KWO B;  4OV2 A;  1FF1 A;  4AOM A;  1LIN A;  1BLQ A;  4OR9 B;  5HLO A;  1SL8 A;  3CZT X;  3M0W A;  1LA0 A;  5HLV A;  2Q91 A;  1KFU S;  2D8N A;  1CMF A;  1UP5 A;  4GUK A;  1LKJ A;  3WHU B;  4UPG A;  4CFQ A;  3O78 A;  4L9M A;  1BF5 A;  1ZAC A;  3K21 A;  5I2L A;  2KHN A;  4GNK B;  3KO0 A;  5PAL A;  2KBI A;  3I5F B;  1JSA A;  3FS7 A;  3PFV A;  2BCB A;  4C0K A;  1J7O A;  3I5I B;  1QIV A;  3EVU A;  2PAL A;  3BUO B;  2MBX A;  5IBW A;  4WQ2 A;  2LE9 B;  3ZNI A;  2PAS A;  1KSM A;  1NX3 A;  1MXE A;  1C07 A;  2KI6 D;  4DUQ A;  4CID A;  1IH0 A;  1IWQ A;  1QV0 A;  2B1U A;  2ZNE A;  4NDD A;  2JC2 A;  2KDH A;  4PHN A;  1RK9 A;  4A4C A;  1X02 A;  1NP8 A;  4HSZ A;  2LHI A;  1B8C A;  2BKI B;  1S3P A;  2KI4 C;  1OZO A;  2NCO A;  1NYA A;  5D7F A;  2M29 A;  2P6B B;  5GQQ C;  1S26 D;  2Y5I A;  4NQG A;  1Y1U A;  2LHL A;  4MZL A;  3KF9 A;  1K94 A;  2CCM A;  3DVK A;  4FTG A;  3O4Y A;  1FBV A;  1G8I A;  2PSR A;  1KWO C;  3CR4 X;  1B8L A;  1DJZ A;  2BEC A;  1NSH A;  3DVJ A;  1KSO A;  5TNC A;  2LUX A;  1KK8 B;  2R2I A;  3EKH A;  1XK4 A;  5I8N A;  3WHT B;  3DVE A;  1MF8 B;  1J55 A;  5F6T A;  5G08 A;  1JF0 A;  2K7B A;  1GGW A;  3BUX B;  4GBA A;  4GGN A;  1RTP 1;  3DF0 B;  2H61 A;  2ZN9 A;  2I2R E;  3AKA A;  5DKN A;  1KK7 Z;  3I5I C;  2KYC A;  2OTG C;  1M45 A;  2WCE A;  1J7Q A;  1ZFS A;  2BCX A;  4CFR A;  1TN4 A;  1QV1 A;  3WXA A;  1B8R A;  1YRT B;  1BR4 B;  1F4O A;  1JC2 A;  2EC6 B;  4MSP A;  5CPV A;  1IQ3 A;  1CTR A;  2OS8 C;  2NLN A;  4M2Q A;  1UHN A;  1J1E A;  2M9G A;  1QIW A;  1SR6 B;  4M2O A;  1JFK A;  4ORB B;  1CFF A;  1NIW A;  2CTN A;  1QAS A;  4MLW A;  5CSN A;  2KQ6 A;  3OX6 A;  3SG2 A;  3LK0 A;  1NPQ A;  4OCI A;  4YGD B;  1CFP A;  1PSR A;  3GOF A;  2WCB A;  1J7R A;  1D1O A;  3JVT B;  1XYD A;  2BBN A;  3A4U B;  3RLZ A;  1PSB A;  3O2P A;  1CDM A;  1DJH A;  2KI6 C;  1UUS A;  4PAL A;  1EH2 A;  1QLK A;  2E30 A;  4XYN A;  2L5X B;  1TNW A;  1KQV A;  1J7P A;  4FQO A;  1WRZ A;  1S5G Y;  1B9A A;  4ZCU A;  3IQQ A;  1IKU A;  1B7T Z;  3EVV A;  1IJ5 A;  3D10 A;  1S36 A;  2I18 A;  3F45 A;  4HRE E;  1KFX L;  3OP0 A;  1CDN A;  1EG3 A;  1RRO A;  3FWB A;  4YI9 A;  3SIA A;  1K96 A;  1A29 A;  1N2D A;  1TTX A;  2L51 A;  2ZRT A;  1RJV A;  1BR1 B;  3EK7 A;  3I5G B;  1SKT A;  2MA2 A;  1YRU B;  1YUS A;  1BOC A;  1SR6 C;  2WND A;  2LVI A;  1SCM C;  1YTZ C;  4OVN F;  4MBE A;  1S1E A;  3NSO A;  1MR8 A;  2PVB A;  4E68 A;  2F33 A;  5KU1 A;  1V1F A;  2M97 A;  1HQV A;  4ICB A;  4R1E A;  4C0L A;  1KFX S;  1CB1 A;  4PCW A;  3JVT C;  2FOT A;  2KGR A;  4JPZ B;  2LV7 A;  2ZKM X;  3GK2 A;  2L50 A;  2KAY A;  1A03 A;  1SYM A;  3NXA A;  2EGD A;  4MZJ A;  3TUY C;  1V1G A;  1EJ3 A;  5AAN A;  2KQY A;  3PN7 B;  2LM5 A;  1FPW A;  4NDB A;  1KQM B;  3VRO A;  3D0Y A;  1OSA A;  1L2O B;  4N1G A;  1TNP A;  1AP4 A;  2K7C A;  4M2P A;  4YGA A;  2O60 A;  1FI6 A;  1QJT A;  3SG4 A;  2JTZ A;  1IGV A;  2JPT A;  1AUI B;  1YUU A;  1EL4 A;  2MLE C;  1XA5 A;  1AJ4 A;  1ALV A;  1U5I B;  3I5G C;  4N5X A;  1M63 B;  4P2Y B;  1DJG A;  1WDC B;  2HET A;  2M8U A;  1J1D A;  1F4Q A;  2L0P A;  3ICB A;  4PHJ A;  1DJX A;  1TOP A;  5B8I B;  1XFV O;  1EG4 A;  2QPT A;  5BPJ A;  3A8R A;  2HQ8 A;  2KFG A;  4XJK A;  1F70 A;  1DGV A;  1TNQ A;  2E6W A;  4U8D A;  1XFW O;  1DMO A;  1OMD A;  4NDC A;  3CR5 X;  3NSK A;  2EHB A;  1ZOT B;  1DT7 B;  2K61 A;  4ORC B;  4OKH A;  2M3W A;  3WNX B;  3DVM A;  4TNC A;  3SG3 A;  3EVR A;  1TCO B;  4I5J A;  2M7L A;  4BY5 A;  1REC A;  4D1E A;  4GGF C;  2F2P A;  5CSJ A;  4QJ5 B;  3I5H B;  3I5F C;  2KBM A;  4C0J A;  2SCP A;  1AHR A;  1B47 A;  2M0R A;  2JT0 A;  3CWG A;  1L2O C;  5AFP A;  1Y1A A;  3E3R A;  1K90 D;  1JUO A;  2MJW B;  2ISD A;  1G4Y R;  4YRU A;  2K7D A;  4BY4 A;  3OB1 B;  5KSZ A;  1QAT A;  1WLZ A;  2M49 B;  1PUL A;  2PMY A;  5FYX A;  1JFJ A;  1CLB A;  1YR5 A;  3AAJ A;  2QAC A;  3ZWH A;  2OPO A;  3BOW A;  3TS5 B;  4DCK A;  4QJ4 B;  4MN0 A;  2JRF A;  3TDU A;  2JNF A;  2SAS A;  3RM1 A;  4GAO A;  1OE9 B;  1CM4 A;  1ZMZ A;  3BUW B;  1CNP A;  2AMI A;  2WOR A;  2RGI A;  4N1F A;  2LC5 A;  2LVV A;  2MRD A;  4I5K A;  2MAZ A;  1NX1 A;  1DVI A;  2KAX A;  4PHM A;  1HT9 A;  1OOJ A;  1UHJ A;  3TDZ A;  1QTX A;  4MRY A;  1KK8 C;  5HYD A;  1GQM A;  3OHM B;  1ZUZ A;  2LVK A;  3GK4 X;  2G9B A;  3OB2 B;  2WOS A;  2JZI A;  3EK8 A;  3LK1 A;  3IF7 A;  1K2H A;  2KYF A;  1R6P A;  3JTD B;  4XJK B;  1S5G Z;  1OMR A;  4HRH A;  1S6C A;  2NCP A;  1QLS A;  3LCP C;  1C7V A;  1N0Y A;  1RWY A;  1M39 A;  2H2K A;  2L4H A;  2TN4 A;  1QVI Y;  1QS7 A;  4CLN A;  1QVI Z;  2MHH A;  3OX5 A;  1CFD A;  1K9U A;  2PRU A;  4DRW A;  1DTL A;  2EC6 C;  1K8U A;  1CKK A;  1AJ5 A;  1CLM A;  1S6I A;  1PVA A;  2LAN A;  1FI5 A;  3TS5 C;  1IG5 A;  1YX7 A;  3QRX A;  1Y1X A;  2K8M B;  1F8H A;  1H8B A;  1YUR A;  3AAK A;  5AXI A;  2Y1M A;  4MRX A;  1DF0 A;  1A2X A;  1SK6 D;  2NXQ A;  2KOT A;  3CGA A;  1PRW A;  1SL7 A;  3NSI A;  1ALW A;  1L7Z A;  1SY9 A;  1CM1 A;  5ER5 A;  1XFU O;  1PAL A;  5JJG A;  5KTY A;  2K0J A;  3PAT A;  1IRJ A;  1CDP A;  1WRK A;  3BOW B;  1QX2 A;  2BE6 A;  1M46 A;  2LMT A;  3BQ3 A;  5HKZ A;  1A4P A;  1NX2 A;  1AVS A;  2JT3 A;  2JQ6 A;  1SRA A;  3FIA A;  3VRQ A;  3HX4 A;  1AK8 A;  2JUL A;  3AKB A;  2DOQ A;  3EK4 A;  2KI4 B;  2M1K B;  4PE7 A;  2AUC A;  2HQW A;  1MXL C;  3JTD C;  4MZK A;  4YGE B;  3CS1 A;  1W7J B;  3PLF B;  5DKR A;  1VRK A;  2BKH B;  4MEW A;  4F0Z B;  3DD4 A;  3DF0 A;  5AEQ A;  2KNE A;  1SNL A;  4IL1 A;  1XK4 C;  2ZRS A;  5AER A;  2JXC A;  1B1G A;  4QJ3 B;  1H4B A;  2MLF C;  2CBL A;  5JOL A;  3VGO A;  2JXL A;  4I5N B;  1WRL A;  2H61 C;  3CTN A;  1F55 A;  1WLM A;  1NX0 A;  2JTT A;  1Y0V H;  2COL B;  4I5L B;  3VRR A;  3LLE A;  1NCY A;  2I7A A;  1CDL A;  2K7O A;  1G33 A;  4DIR A;  1DJW A;  2OTG B;  2HPS A;  3KEV A;  1E8A A;  1JF2 A;  4WQ3 A;  2GGM A;  2JT8 A;  2LLS A;  1MHO A;  3SIB A;  3KHE A;  2I94 A;  1UHI A;  2M1U A;  1JWD A;  3C1V A;  1B4C A;  4YI8 A;  2OS8 B;  2FJU B;  1YVH A;  2V53 A;  4Q04 A;  2M7N A;  2NZ0 A;  1LA3 A;  2CXJ A;  1DF0 B;  3PN7 C;  2LP2 A;  1QX5 B;  2KFF A;  3MSE B;  3PSR A;  1KQM C;  2ZND A;  2F3Z A;  1PK0 D;  2BL0 B;  1Q80 A;  1QX7 A;  2O5G A;  1IQ5 A;  2LMU A;  1TNX A;  1GGZ A;  4JQ0 D;  2KAV A;  2LAP A;  1NWD A;  2LLU A;  2VRG A;  1SW8 A;  2WC8 A;  1F54 A;  1DGU A;  1MWN A;  2GGZ A;  2F8P A;  1A75 A;  4PE0 A;  1UUR A;  4ETO A;  1BG1 A;  1BMO A;  2Q4U A;  1TIZ A;  1NUB A;  1SCV A;  3CLN A;  4ZCV A;  1K95 A;  1W7I B;  2JU0 A;  3D0Y B;  3SJS A;  1UHK A;  1WDC C;  2LMV A;  1FW4 A;  3TZ1 A;  3BUN B;  1M31 A;  1SL9 A;  3EKJ A;  5J3X A;  1RFJ A;  2LP3 A;  1KK7 Y;  2JWW A;  1LVC D;  4JWQ A;  4A4B A;  2K2A A;  2KFH A;  3HCM A;  1F71 A;  4AQI A;  5D69 A;  4AQJ A;  3GK1 A;  4ORA B;  1BJF A;  2BBM A;  1XO5 A;  2LLT A;  1S6J A;  2F3Y A;  2AAO A;  1OZS A;  5CSF A;  1SMG A;  1DJY A;  2F2O A;  1OMV A;  2LCP A;  2Y1N A;  3KPX A;  4PDZ A;  4CPV A;  1WY9 A;  4HRG A;  1YVL A;  3FWC A;  1XVJ A;  2L4I A;  1SCM B;  1BT6 A;  4WRI A;  1DJI A;  3I5H C;  5HKW A;  1YX8 A;  2BL0 C;  4P5O E;  1EXR A;  4GGF A;  4USL A;  3SG5 A;  1R2U A;  1TCF A;  5I2O A;  3BUM B;  2L2E A;  1QXP A;  1UWO A;  2LUC A;  2CNP A;  3O6B A;  4PE4 A;  4YBH B;  1CFC A;  5HKY A;  1BOD A;  3CR2 A;  2LVJ A;  3BXK A;  4GPL B;  4PHK A;  2K2F A;  4PE1 A;  3TDI A;  2G2B A;  1XFZ O;  1KCY A;  3TUY B;  3SG7 A;  1JBA A;  3H4S E;  3PAL A;  2BE4 A;  5CSI A;  4MVF A;  5ER4 X;  4DS7 A;  1BU3 A;  1TRF A;  1SPY A;  1NCX A;  2KSP A;  5I2Q A;  2HF5 A;  1CLL A;  1U5I A;  2FCD A;  2JNX A;  1UHH A;  4GFT A;  1XFX O;  2L98 A;  1LXF C;  1B7T Y;  2IS9 A;  3IQO A;  3SG6 A;  1PVB A;  1MQ1 A;  2LNK A;  3VRN A;  1A75 B;  1N65 A;  1K9P A;  2ZN8 A;  2Y4Q A;  1ODB A;  5K89 A;  1KFU L;  2WCF A;  1K93 D;  1OQP A;  3VRP A;  1Y6W A;  2GV5 A;  2ZFD A;  3NSL A;  3BYA A;  3LL8 B;  1CMG A;  1NCZ A; 
#chains in the Genus database with same CATH topology
 2KGB C;  4YGB B;  2FCE A;  1GJY A;  1SBJ A;  2BCA A;  5DKQ A;  1C7W A;  1K9K A;  1YUT A;  2CT9 A;  4YGC B;  1XFY O;  2A4J A;  1IJ6 A;  1MUX A;  2JOJ A;  3PM8 A;  1KWO B;  4OV2 A;  1FF1 A;  4AOM A;  1LIN A;  2WCH A;  1BLQ A;  4OR9 B;  5HLO A;  1SL8 A;  3CZT X;  3SS4 A;  2ERB A;  3M0W A;  1LA0 A;  5HLV A;  2Q91 A;  1KFU S;  3S0A A;  2D8N A;  1CMF A;  1UP5 A;  4GUK A;  1LKJ A;  3WHU B;  3CZ2 A;  4UPG A;  4CFQ A;  3O78 A;  4L9M A;  1BF5 A;  1ZAC A;  3K21 A;  5I2L A;  2KHN A;  4GNK B;  3KO0 A;  5PAL A;  2KBI A;  3I5F B;  3S0B A;  1JSA A;  3FS7 A;  3PFV A;  2BCB A;  3O4X A;  5FI2 A;  3I5I B;  4C0K A;  1J7O A;  1QIV A;  3EVU A;  2PAL A;  3BUO B;  2MBX A;  5IBW A;  4WQ2 A;  2LE9 B;  3ZNI A;  2PAS A;  1KSM A;  1NX3 A;  1MXE A;  1C07 A;  1QWV A;  2KI6 D;  4DUQ A;  4CID A;  1IH0 A;  1IWQ A;  1QV0 A;  2B1U A;  2ZNE A;  4NDD A;  2JC2 A;  2KDH A;  4PHN A;  1RK9 A;  4A4C A;  1X02 A;  1NP8 A;  4HSZ A;  2LHI A;  3D74 A;  4OZD A;  1B8C A;  2BKI B;  1S3P A;  2KI4 C;  1OZO A;  2NCO A;  1NYA A;  5D7F A;  2M29 A;  2P6B B;  5GQQ C;  1S26 D;  2Y5I A;  4NQG A;  1Y1U A;  2LHL A;  4MZL A;  3KF9 A;  1K94 A;  2CCM A;  3DVK A;  4FTG A;  3PJI A;  3O4Y A;  1FBV A;  1G8I A;  2PSR A;  1KWO C;  3CR4 X;  1B8L A;  1DJZ A;  1NSH A;  2BEC A;  3DVJ A;  1KSO A;  5TNC A;  2LUX A;  1KK8 B;  2R2I A;  3EKH A;  1XK4 A;  3EG5 B;  5I8N A;  3WHT B;  3DVE A;  1MF8 B;  1J55 A;  5F6T A;  5G08 A;  1JF0 A;  2K7B A;  1GGW A;  3B7A A;  3BUX B;  4GBA A;  4GGN A;  1RTP 1;  3DF0 B;  3FE8 A;  2H61 A;  2ZN9 A;  4KYN A;  1T14 A;  2I2R E;  2QEH A;  3AKA A;  5DKN A;  1KK7 Z;  3I5I C;  2KYC A;  2OTG C;  1M45 A;  2WCE A;  3CYZ A;  1J7Q A;  1ZFS A;  2BCX A;  4CFR A;  1TN4 A;  1QV1 A;  3WXA A;  1B8R A;  1YRT B;  5D3O A;  1BR4 B;  1F4O A;  1JC2 A;  2EC6 B;  4MSP A;  5CPV A;  1IQ3 A;  1CTR A;  1OOG A;  2NLN A;  2OS8 C;  4M2Q A;  3DXL A;  1UHN A;  1J1E A;  2M9G A;  1QIW A;  1SR6 B;  4M2O A;  1JFK A;  4ORB B;  1CFF A;  1NIW A;  2CTN A;  1QAS A;  4MLW A;  1DC1 A;  5CSN A;  2KQ6 A;  3OX6 A;  3SG2 A;  3LK0 A;  1NPQ A;  2QEV A;  4OCI A;  4YGD B;  1CFP A;  1PSR A;  3GOF A;  3RZS A;  2WCB A;  1J7R A;  3VB1 A;  1D1O A;  3JVT B;  1XYD A;  2BBN A;  3A4U B;  3RLZ A;  1PSB A;  3O2P A;  1CDM A;  1DJH A;  2KI6 C;  1UUS A;  3D75 A;  4PAL A;  1EH2 A;  1QLK A;  2E30 A;  4XYN A;  2L5X B;  3K1E A;  1TNW A;  1KQV A;  1J7P A;  4FQO A;  1WRZ A;  1S5G Y;  1B9A A;  4ZCU A;  1LS8 A;  5DIC A;  3IQQ A;  1IKU A;  1B7T Z;  3EVV A;  1IJ5 A;  3D10 A;  1S36 A;  2I18 A;  3F45 A;  4HRE E;  1KFX L;  2WC5 A;  3OP0 A;  1CDN A;  1EG3 A;  1RRO A;  3FWB A;  4YI9 A;  3SIA A;  1K96 A;  1A29 A;  1SSE B;  3FE9 A;  1N2D A;  1TTX A;  4JKT A;  2L51 A;  2ZRT A;  1RJV A;  1BR1 B;  3EK7 A;  3I5G B;  1SKT A;  2MA2 A;  1YRU B;  1YUS A;  1BOC A;  1SR6 C;  2WND A;  2LVI A;  1SCM C;  1YTZ C;  4OVN F;  4MBE A;  1S1E A;  3NSO A;  3S0G A;  1MR8 A;  2PVB A;  4E68 A;  2F33 A;  5KU1 A;  1V1F A;  2M97 A;  1HQV A;  2H8V A;  4ICB A;  4R1E A;  4C0L A;  1KFX S;  1CB1 A;  3CZ1 A;  4PCW A;  3JVT C;  2FOT A;  2KGR A;  4JPZ B;  2LV7 A;  2ZKM X;  2PYQ A;  3BFB A;  4JD9 A;  3GK2 A;  2L50 A;  2KAY A;  1A03 A;  1SYM A;  3NXA A;  2EGD A;  4MZJ A;  3TUY C;  2YGU A;  1V1G A;  1EJ3 A;  5AAN A;  2QEO A;  2KQY A;  3PN7 B;  1ORG A;  2LM5 A;  1FPW A;  4NDB A;  1KQM B;  3VRO A;  3D0Y A;  1OSA A;  1L2O B;  4N1G A;  1TNP A;  2WCM A;  2K7C A;  3R72 A;  1AP4 A;  4M2P A;  4YGA A;  2O60 A;  1FI6 A;  1QJT A;  3SG4 A;  2JTZ A;  1IGV A;  2JPT A;  1AUI B;  1YUU A;  1EL4 A;  2MLE C;  1XA5 A;  3R1P A;  1AJ4 A;  1ALV A;  1U5I B;  2KLE A;  3I5G C;  1M63 B;  3NHT A;  4N5X A;  1DJG A;  1WDC B;  4P2Y B;  2HET A;  2M8U A;  1J1D A;  1F4Q A;  2L0P A;  2WCJ A;  3ICB A;  4PHJ A;  1DJX A;  1TOP A;  5B8I B;  1C3Y A;  1XFV O;  1EG4 A;  2QPT A;  5BPJ A;  3A8R A;  2HQ8 A;  2KFG A;  4XJK A;  1F70 A;  1DGV A;  1TNQ A;  2E6W A;  4U8D A;  1XFW O;  1DMO A;  1Z2C B;  4FQT A;  1OMD A;  4NDC A;  3CR5 X;  3NSK A;  2EHB A;  1ZOT B;  1OW4 A;  2FJY A;  3UNW A;  1DT7 B;  2K61 A;  4ORC B;  4OKH A;  2M3W A;  3S0D A;  3DVM A;  3WNX B;  4TNC A;  3SG3 A;  3EVR A;  1TCO B;  4I5J A;  2M7L A;  4BY5 A;  1REC A;  4D1E A;  4GGF C;  2F2P A;  5CSJ A;  2QEB A;  4QJ5 B;  3I5H B;  3I5F C;  2KBM A;  4C0J A;  2SCP A;  1AHR A;  1B47 A;  2M0R A;  2JT0 A;  3CWG A;  5I94 A;  5FI6 A;  1L2O C;  1XFR A;  5AFP A;  1Y1A A;  3E3R A;  1K90 D;  1JUO A;  2MJW B;  2ISD A;  1G4Y R;  4YRU A;  2K7D A;  4BY4 A;  1IIO A;  3OB1 B;  5HL1 A;  5KSZ A;  1QAT A;  1WLZ A;  2M49 B;  1PUL A;  2PMY A;  3D78 A;  5FYX A;  1JFJ A;  3B86 A;  1YR5 A;  2KPH A;  3AAJ A;  1CLB A;  2QAC A;  3ZWH A;  2OPO A;  3BOW A;  3TS5 B;  4INX A;  4DCK A;  3CZ0 A;  4MN0 A;  4QJ4 B;  2JRF A;  3TDU A;  2JNF A;  1OOI X;  2SAS A;  4GAO A;  3RM1 A;  1OE9 B;  1CM4 A;  1W9Z A;  1ZMZ A;  3BUW B;  1CNP A;  2AMI A;  2WOR A;  2GTE A;  2RGI A;  4N1F A;  2LC5 A;  1TWO A;  2LVV A;  2MRD A;  4I5K A;  2MAZ A;  1NX1 A;  3B88 A;  1DVI A;  2KAX A;  4PHM A;  1HT9 A;  1OOJ A;  1UHJ A;  3TDZ A;  1QTX A;  4MRY A;  1KK8 C;  5HYD A;  1GQM A;  3OHM B;  1ZUZ A;  2LVK A;  3GK4 X;  2G9B A;  3OB2 B;  2WOS A;  2JZI A;  2PQL A;  2BAP A;  1BOD A;  3EK8 A;  3LK1 A;  3IF7 A;  1K2H A;  2KYF A;  1R6P A;  3JTD B;  4XJK B;  1S5G Z;  1DEL A;  1OMR A;  4HRH A;  1S6C A;  2NCP A;  1QLS A;  3LCP C;  1C7V A;  1N0Y A;  1RWY A;  1M39 A;  2H2K A;  2L4H A;  3R1V A;  2JPO A;  2TN4 A;  1QVI Y;  3BFA A;  1QS7 A;  1TUZ A;  4CLN A;  1QVI Z;  2MHH A;  3OX5 A;  1CFD A;  1K9U A;  2PRU A;  4DRW A;  1DTL A;  2EC6 C;  1K8U A;  3D77 A;  1CKK A;  1C3Z A;  1AJ5 A;  1CLM A;  1S6I A;  1PVA A;  2LAN A;  1FI5 A;  3TS5 C;  1IG5 A;  1YX7 A;  3QRX A;  1Y1X A;  2K8M B;  3V2L A;  1F8H A;  1H8B A;  1YUR A;  3AAK A;  3N7H A;  2Y1M A;  2P70 A;  5AXI A;  4MRX A;  1DF0 A;  1A2X A;  1SK6 D;  2NXQ A;  2KOT A;  3CGA A;  1PRW A;  1SL7 A;  3NSI A;  1ALW A;  1L7Z A;  1SY9 A;  1CM1 A;  3DYE A;  1XFU O;  5ER5 A;  3DZT A;  1PAL A;  5JJG A;  5KTY A;  2K0J A;  4F7F A;  3PAT A;  1IRJ A;  1CDP A;  1WRK A;  3BOW B;  1QX2 A;  2BE6 A;  1M46 A;  2LMT A;  3BQ3 A;  5HKZ A;  1A4P A;  1NX2 A;  1AVS A;  2JT3 A;  2JQ6 A;  3Q8I A;  3L4L A;  1SRA A;  3FIA A;  3VRQ A;  3HX4 A;  1AK8 A;  2JUL A;  3AKB A;  2DOQ A;  3EK4 A;  2KI4 B;  2M1K B;  4PE7 A;  2AUC A;  2HQW A;  1MXL C;  2WCL A;  3JTD C;  4MZK A;  4YGE B;  3CS1 A;  1W7J B;  3PLF B;  5DKR A;  1VRK A;  2BKH B;  4MEW A;  1DQE A;  4F0Z B;  1GM0 A;  3DD4 A;  3DF0 A;  3PM2 A;  5AEQ A;  2KNE A;  1SNL A;  4IL1 A;  1XK4 C;  2ZRS A;  3BFH A;  4IJ7 A;  5AER A;  2JXC A;  5EL2 A;  1B1G A;  4QJ3 B;  1H4B A;  2MLF C;  2CBL A;  5JOL A;  4PT1 A;  3VGO A;  2JXL A;  4I5N B;  1WRL A;  2H61 C;  3CTN A;  1OOH A;  1F55 A;  1WLM A;  1NX0 A;  2JTT A;  1Y0V H;  2COL B;  4I5L B;  3VRR A;  3SS5 A;  3LLE A;  1NCY A;  2I7A A;  1CDL A;  2P71 A;  2K7O A;  3L47 A;  1G33 A;  3QME A;  4DIR A;  1DJW A;  2OTG B;  2HPS A;  3KEV A;  3OGN A;  1E8A A;  1JF2 A;  4WQ3 A;  2GGM A;  2JT8 A;  2LLS A;  1MHO A;  3SIB A;  1P28 A;  3KHE A;  2I94 A;  1UHI A;  2M1U A;  1JWD A;  3C1V A;  1B4C A;  4YI8 A;  2OS8 B;  2FJU B;  1YVH A;  2V53 A;  4Q04 A;  2M7N A;  2NZ0 A;  1LA3 A;  2CXJ A;  1DF0 B;  3PN7 C;  2LP2 A;  1QX5 B;  2KFF A;  3MSE B;  3PSR A;  5FI7 A;  1KQM C;  2ZND A;  2F3Z A;  1PK0 D;  2BL0 B;  1Q80 A;  1QX7 A;  2O5G A;  1IQ5 A;  2LMU A;  1TNX A;  1Z4H A;  1GGZ A;  4JQ0 D;  2KAV A;  2LAP A;  2WC6 A;  1NWD A;  2LLU A;  2VRG A;  1SW8 A;  3OBV A;  2WC8 A;  1F54 A;  1DGU A;  1MWN A;  2GGZ A;  2F8P A;  1A75 A;  4PE0 A;  1UUR A;  4ETO A;  1BG1 A;  3R1O A;  1BMO A;  2Q4U A;  1TIZ A;  1NUB A;  1SCV A;  3CLN A;  4ZCV A;  1K95 A;  1W7I B;  2JU0 A;  3D0Y B;  3SJS A;  1UHK A;  1WDC C;  2LMV A;  3SS3 A;  1FW4 A;  3TZ1 A;  3BUN B;  2L5Y A;  1M31 A;  1SL9 A;  3EKJ A;  5J3X A;  3NGV A;  1RFJ A;  2LP3 A;  1KK7 Y;  2JWW A;  3BJH A;  1LVC D;  4JWQ A;  4A4B A;  2K2A A;  2KFH A;  3HCM A;  2WCK A;  1F71 A;  4AQI A;  5D69 A;  4AQJ A;  3B6X A;  3GK1 A;  4ORA B;  1BJF A;  2BBM A;  3S0E A;  1XO5 A;  2LLT A;  1S6J A;  2KLD A;  2F3Y A;  2AAO A;  1OZS A;  5CSF A;  3CAB A;  1SMG A;  1DJY A;  2F2O A;  1OMV A;  2LCP A;  2Y1N A;  3KPX A;  3FE6 A;  4PDZ A;  4CPV A;  1WY9 A;  4HRG A;  1YVL A;  2K60 A;  3FWC A;  1XVJ A;  2L4I A;  1SCM B;  1BT6 A;  4WRI A;  1DJI A;  3I5H C;  3L4A A;  5HKW A;  1YX8 A;  2BL0 C;  4INW A;  1EXR A;  4GGF A;  4P5O E;  4USL A;  3SG5 A;  1R2U A;  1TCF A;  5I2O A;  3BUM B;  2L2E A;  1QXP A;  1UWO A;  2LUC A;  2CNP A;  1DEK A;  3O6B A;  4PE4 A;  4YBH B;  1OOF A;  1CFC A;  3D73 A;  1TUJ A;  5HKY A;  3D76 A;  3CDN A;  3CR2 A;  2LVJ A;  3BXK A;  4GPL B;  4PHK A;  2K2F A;  4PE1 A;  3TDI A;  2G2B A;  1XFZ O;  1KCY A;  3TUY B;  3UO9 A;  3SG7 A;  1JBA A;  3H4S E;  3PAL A;  2BE4 A;  2BNX A;  4MVF A;  5CSI A;  5ER4 X;  4DS7 A;  1BU3 A;  1TRF A;  1SPY A;  1NCX A;  2KSP A;  5I2Q A;  2HF5 A;  1CLL A;  1U5I A;  2FCD A;  2JNX A;  2L2C A;  1UHH A;  4GFT A;  1XFX O;  2L98 A;  1LXF C;  1B7T Y;  2IS9 A;  3IQO A;  3SG6 A;  1PVB A;  1MQ1 A;  2LNK A;  2QDI A;  3VRN A;  3NHI A;  3DY9 A;  3IVT A;  1A75 B;  1N65 A;  3S0F A;  1K9P A;  2ZN8 A;  3B87 A;  2Y4Q A;  1ODB A;  5K89 A;  1KFU L;  2WCF A;  1K93 D;  1OQP A;  3VRP A;  1Y6W A;  2GV5 A;  2ZFD A;  3NSL A;  3BYA A;  3LL8 B;  1CMG A;  1NCZ A; 
#chains in the Genus database with same CATH homology
 2KGB C;  4YGB B;  2FCE A;  1GJY A;  1SBJ A;  2BCA A;  5DKQ A;  1C7W A;  1K9K A;  1YUT A;  2CT9 A;  4YGC B;  1XFY O;  2A4J A;  1IJ6 A;  1MUX A;  2JOJ A;  3PM8 A;  1KWO B;  4OV2 A;  1FF1 A;  4AOM A;  1LIN A;  1BLQ A;  4OR9 B;  5HLO A;  1SL8 A;  3CZT X;  3M0W A;  1LA0 A;  5HLV A;  2Q91 A;  1KFU S;  2D8N A;  1CMF A;  1UP5 A;  4GUK A;  1LKJ A;  3WHU B;  4UPG A;  4CFQ A;  3O78 A;  4L9M A;  1BF5 A;  1ZAC A;  3K21 A;  5I2L A;  2KHN A;  4GNK B;  3KO0 A;  5PAL A;  2KBI A;  3I5F B;  1JSA A;  3FS7 A;  3PFV A;  2BCB A;  4C0K A;  1J7O A;  3I5I B;  1QIV A;  3EVU A;  2PAL A;  3BUO B;  2MBX A;  5IBW A;  4WQ2 A;  2LE9 B;  3ZNI A;  2PAS A;  1KSM A;  1NX3 A;  1MXE A;  1C07 A;  2KI6 D;  4DUQ A;  4CID A;  1IH0 A;  1IWQ A;  1QV0 A;  2B1U A;  2ZNE A;  4NDD A;  2JC2 A;  2KDH A;  4PHN A;  1RK9 A;  4A4C A;  1X02 A;  1NP8 A;  4HSZ A;  2LHI A;  1B8C A;  2BKI B;  1S3P A;  2KI4 C;  1OZO A;  2NCO A;  1NYA A;  5D7F A;  2M29 A;  2P6B B;  5GQQ C;  1S26 D;  2Y5I A;  4NQG A;  1Y1U A;  2LHL A;  4MZL A;  3KF9 A;  1K94 A;  2CCM A;  3DVK A;  4FTG A;  3O4Y A;  1FBV A;  1G8I A;  2PSR A;  1KWO C;  3CR4 X;  1B8L A;  1DJZ A;  2BEC A;  1NSH A;  3DVJ A;  1KSO A;  5TNC A;  2LUX A;  1KK8 B;  2R2I A;  3EKH A;  1XK4 A;  5I8N A;  3WHT B;  3DVE A;  1MF8 B;  1J55 A;  5F6T A;  5G08 A;  1JF0 A;  2K7B A;  1GGW A;  3BUX B;  4GBA A;  4GGN A;  1RTP 1;  3DF0 B;  2H61 A;  2ZN9 A;  2I2R E;  3AKA A;  5DKN A;  1KK7 Z;  3I5I C;  2KYC A;  2OTG C;  1M45 A;  2WCE A;  1J7Q A;  1ZFS A;  2BCX A;  4CFR A;  1TN4 A;  1QV1 A;  3WXA A;  1B8R A;  1YRT B;  1BR4 B;  1F4O A;  1JC2 A;  2EC6 B;  4MSP A;  5CPV A;  1IQ3 A;  1CTR A;  2OS8 C;  2NLN A;  4M2Q A;  1UHN A;  1J1E A;  2M9G A;  1QIW A;  1SR6 B;  4M2O A;  1JFK A;  4ORB B;  1CFF A;  1NIW A;  2CTN A;  1QAS A;  4MLW A;  5CSN A;  2KQ6 A;  3OX6 A;  3SG2 A;  3LK0 A;  1NPQ A;  4OCI A;  4YGD B;  1CFP A;  1PSR A;  3GOF A;  2WCB A;  1J7R A;  1D1O A;  3JVT B;  1XYD A;  2BBN A;  3A4U B;  3RLZ A;  1PSB A;  3O2P A;  1CDM A;  1DJH A;  2KI6 C;  1UUS A;  4PAL A;  1EH2 A;  1QLK A;  2E30 A;  4XYN A;  2L5X B;  1TNW A;  1KQV A;  1J7P A;  4FQO A;  1WRZ A;  1S5G Y;  1B9A A;  4ZCU A;  3IQQ A;  1IKU A;  1B7T Z;  3EVV A;  1IJ5 A;  3D10 A;  1S36 A;  2I18 A;  3F45 A;  4HRE E;  1KFX L;  3OP0 A;  1CDN A;  1EG3 A;  1RRO A;  3FWB A;  4YI9 A;  3SIA A;  1K96 A;  1A29 A;  1N2D A;  1TTX A;  2L51 A;  2ZRT A;  1RJV A;  1BR1 B;  3EK7 A;  3I5G B;  1SKT A;  2MA2 A;  1YRU B;  1YUS A;  1BOC A;  1SR6 C;  2WND A;  2LVI A;  1SCM C;  1YTZ C;  4OVN F;  4MBE A;  1S1E A;  3NSO A;  1MR8 A;  2PVB A;  4E68 A;  2F33 A;  5KU1 A;  1V1F A;  2M97 A;  1HQV A;  4ICB A;  4R1E A;  4C0L A;  1KFX S;  1CB1 A;  4PCW A;  3JVT C;  2FOT A;  2KGR A;  4JPZ B;  2LV7 A;  2ZKM X;  3GK2 A;  2L50 A;  2KAY A;  1A03 A;  1SYM A;  3NXA A;  2EGD A;  4MZJ A;  3TUY C;  1V1G A;  1EJ3 A;  5AAN A;  2KQY A;  3PN7 B;  2LM5 A;  1FPW A;  4NDB A;  1KQM B;  3VRO A;  3D0Y A;  1OSA A;  1L2O B;  4N1G A;  1TNP A;  1AP4 A;  2K7C A;  4M2P A;  4YGA A;  2O60 A;  1FI6 A;  1QJT A;  3SG4 A;  2JTZ A;  1IGV A;  2JPT A;  1AUI B;  1YUU A;  1EL4 A;  2MLE C;  1XA5 A;  1AJ4 A;  1ALV A;  1U5I B;  3I5G C;  4N5X A;  1M63 B;  4P2Y B;  1DJG A;  1WDC B;  2HET A;  2M8U A;  1J1D A;  1F4Q A;  2L0P A;  3ICB A;  4PHJ A;  1DJX A;  1TOP A;  5B8I B;  1XFV O;  1EG4 A;  2QPT A;  5BPJ A;  3A8R A;  2HQ8 A;  2KFG A;  4XJK A;  1F70 A;  1DGV A;  1TNQ A;  2E6W A;  4U8D A;  1XFW O;  1DMO A;  1OMD A;  4NDC A;  3CR5 X;  3NSK A;  2EHB A;  1ZOT B;  1DT7 B;  2K61 A;  4ORC B;  4OKH A;  2M3W A;  3WNX B;  3DVM A;  4TNC A;  3SG3 A;  3EVR A;  1TCO B;  4I5J A;  2M7L A;  4BY5 A;  1REC A;  4D1E A;  4GGF C;  2F2P A;  5CSJ A;  4QJ5 B;  3I5H B;  3I5F C;  2KBM A;  4C0J A;  2SCP A;  1AHR A;  1B47 A;  2M0R A;  2JT0 A;  3CWG A;  1L2O C;  5AFP A;  1Y1A A;  3E3R A;  1K90 D;  1JUO A;  2MJW B;  2ISD A;  1G4Y R;  4YRU A;  2K7D A;  4BY4 A;  3OB1 B;  5KSZ A;  1QAT A;  1WLZ A;  2M49 B;  1PUL A;  2PMY A;  5FYX A;  1JFJ A;  1CLB A;  1YR5 A;  3AAJ A;  2QAC A;  3ZWH A;  2OPO A;  3BOW A;  3TS5 B;  4DCK A;  4QJ4 B;  4MN0 A;  2JRF A;  3TDU A;  2JNF A;  2SAS A;  3RM1 A;  4GAO A;  1OE9 B;  1CM4 A;  1ZMZ A;  3BUW B;  1CNP A;  2AMI A;  2WOR A;  2RGI A;  4N1F A;  2LC5 A;  2LVV A;  2MRD A;  4I5K A;  2MAZ A;  1NX1 A;  1DVI A;  2KAX A;  4PHM A;  1HT9 A;  1OOJ A;  1UHJ A;  3TDZ A;  1QTX A;  4MRY A;  1KK8 C;  5HYD A;  1GQM A;  3OHM B;  1ZUZ A;  2LVK A;  3GK4 X;  2G9B A;  3OB2 B;  2WOS A;  2JZI A;  3EK8 A;  3LK1 A;  3IF7 A;  1K2H A;  2KYF A;  1R6P A;  3JTD B;  4XJK B;  1S5G Z;  1OMR A;  4HRH A;  1S6C A;  2NCP A;  1QLS A;  3LCP C;  1C7V A;  1N0Y A;  1RWY A;  1M39 A;  2H2K A;  2L4H A;  2TN4 A;  1QVI Y;  1QS7 A;  4CLN A;  1QVI Z;  2MHH A;  3OX5 A;  1CFD A;  1K9U A;  2PRU A;  4DRW A;  1DTL A;  2EC6 C;  1K8U A;  1CKK A;  1AJ5 A;  1CLM A;  1S6I A;  1PVA A;  2LAN A;  1FI5 A;  3TS5 C;  1IG5 A;  1YX7 A;  3QRX A;  1Y1X A;  2K8M B;  1F8H A;  1H8B A;  1YUR A;  3AAK A;  5AXI A;  2Y1M A;  4MRX A;  1DF0 A;  1A2X A;  1SK6 D;  2NXQ A;  2KOT A;  3CGA A;  1PRW A;  1SL7 A;  3NSI A;  1ALW A;  1L7Z A;  1SY9 A;  1CM1 A;  5ER5 A;  1XFU O;  1PAL A;  5JJG A;  5KTY A;  2K0J A;  3PAT A;  1IRJ A;  1CDP A;  1WRK A;  3BOW B;  1QX2 A;  2BE6 A;  1M46 A;  2LMT A;  3BQ3 A;  5HKZ A;  1A4P A;  1NX2 A;  1AVS A;  2JT3 A;  2JQ6 A;  1SRA A;  3FIA A;  3VRQ A;  3HX4 A;  1AK8 A;  2JUL A;  3AKB A;  2DOQ A;  3EK4 A;  2KI4 B;  2M1K B;  4PE7 A;  2AUC A;  2HQW A;  1MXL C;  3JTD C;  4MZK A;  4YGE B;  3CS1 A;  1W7J B;  3PLF B;  5DKR A;  1VRK A;  2BKH B;  4MEW A;  4F0Z B;  3DD4 A;  3DF0 A;  5AEQ A;  2KNE A;  1SNL A;  4IL1 A;  1XK4 C;  2ZRS A;  5AER A;  2JXC A;  1B1G A;  4QJ3 B;  1H4B A;  2MLF C;  2CBL A;  5JOL A;  3VGO A;  2JXL A;  4I5N B;  1WRL A;  2H61 C;  3CTN A;  1F55 A;  1WLM A;  1NX0 A;  2JTT A;  1Y0V H;  2COL B;  4I5L B;  3VRR A;  3LLE A;  1NCY A;  2I7A A;  1CDL A;  2K7O A;  1G33 A;  4DIR A;  1DJW A;  2OTG B;  2HPS A;  3KEV A;  1E8A A;  1JF2 A;  4WQ3 A;  2GGM A;  2JT8 A;  2LLS A;  1MHO A;  3SIB A;  3KHE A;  2I94 A;  1UHI A;  2M1U A;  1JWD A;  3C1V A;  1B4C A;  4YI8 A;  2OS8 B;  2FJU B;  1YVH A;  2V53 A;  4Q04 A;  2M7N A;  2NZ0 A;  1LA3 A;  2CXJ A;  1DF0 B;  3PN7 C;  2LP2 A;  1QX5 B;  2KFF A;  3MSE B;  3PSR A;  1KQM C;  2ZND A;  2F3Z A;  1PK0 D;  2BL0 B;  1Q80 A;  1QX7 A;  2O5G A;  1IQ5 A;  2LMU A;  1TNX A;  1GGZ A;  4JQ0 D;  2KAV A;  2LAP A;  1NWD A;  2LLU A;  2VRG A;  1SW8 A;  2WC8 A;  1F54 A;  1DGU A;  1MWN A;  2GGZ A;  2F8P A;  1A75 A;  4PE0 A;  1UUR A;  4ETO A;  1BG1 A;  1BMO A;  2Q4U A;  1TIZ A;  1NUB A;  1SCV A;  3CLN A;  4ZCV A;  1K95 A;  1W7I B;  2JU0 A;  3D0Y B;  3SJS A;  1UHK A;  1WDC C;  2LMV A;  1FW4 A;  3TZ1 A;  3BUN B;  1M31 A;  1SL9 A;  3EKJ A;  5J3X A;  1RFJ A;  2LP3 A;  1KK7 Y;  2JWW A;  1LVC D;  4JWQ A;  4A4B A;  2K2A A;  2KFH A;  3HCM A;  1F71 A;  4AQI A;  5D69 A;  4AQJ A;  3GK1 A;  4ORA B;  1BJF A;  2BBM A;  1XO5 A;  2LLT A;  1S6J A;  2F3Y A;  2AAO A;  1OZS A;  5CSF A;  1SMG A;  1DJY A;  2F2O A;  1OMV A;  2LCP A;  2Y1N A;  3KPX A;  4PDZ A;  4CPV A;  1WY9 A;  4HRG A;  1YVL A;  3FWC A;  1XVJ A;  2L4I A;  1SCM B;  1BT6 A;  4WRI A;  1DJI A;  3I5H C;  5HKW A;  1YX8 A;  2BL0 C;  4P5O E;  1EXR A;  4GGF A;  4USL A;  3SG5 A;  1R2U A;  1TCF A;  5I2O A;  3BUM B;  2L2E A;  1QXP A;  1UWO A;  2LUC A;  2CNP A;  3O6B A;  4PE4 A;  4YBH B;  1CFC A;  5HKY A;  1BOD A;  3CR2 A;  2LVJ A;  3BXK A;  4GPL B;  4PHK A;  2K2F A;  4PE1 A;  3TDI A;  2G2B A;  1XFZ O;  1KCY A;  3TUY B;  3SG7 A;  1JBA A;  3H4S E;  3PAL A;  2BE4 A;  5CSI A;  4MVF A;  5ER4 X;  4DS7 A;  1BU3 A;  1TRF A;  1SPY A;  1NCX A;  2KSP A;  5I2Q A;  2HF5 A;  1CLL A;  1U5I A;  2FCD A;  2JNX A;  1UHH A;  4GFT A;  1XFX O;  2L98 A;  1LXF C;  1B7T Y;  2IS9 A;  3IQO A;  3SG6 A;  1PVB A;  1MQ1 A;  2LNK A;  3VRN A;  1A75 B;  1N65 A;  1K9P A;  2ZN8 A;  2Y4Q A;  1ODB A;  5K89 A;  1KFU L;  2WCF A;  1K93 D;  1OQP A;  3VRP A;  1Y6W A;  2GV5 A;  2ZFD A;  3NSL A;  3BYA A;  3LL8 B;  1CMG A;  1NCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...