3PM8A

Cad domain of pff0520w, calcium dependent protein kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
165
Chain Sequence
QGHVELSSTLLKNLKNFKKENELKKIALTIIAKHLCDVEINNLRNIFIALDVDNSGTLSSQEILDGLKKIGPPDIHQVLRDQIHYTDFLAATIDKQTYLKKEVCLIPFKFFDIDGNGKISVEELKRIFGENPLIDKAIDSLLQEVDLNGDGEIDFHEFMLMMSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-dependent protein kinase 2
publication title CAD domain of PFF0520w, Calcium dependent protein kinase
rcsb
source organism Plasmodium falciparum k1
molecule tags Transferase
total genus 57
structure length 165
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pm8A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pm8A01
1RROA 1M39A 3HX4A 3EVUA 1KQVA 1U5IB 2KBIA 3DD4A 4C0KA 5CSFA 3OX5A 1S3PA 4DS7A 4N1FA 4MZJA 2JXLA 1F4QA 4YI9A 1K8UA 1RJVA 1EG4A 1CKKA 4XYNA 3BOWB 1F71A 3O2PA 2BBMA 1YVLA 5HYDA 1OMVA 3VGOA 4PE4A 1ZFSA 5I2OA 1L2OC 2VRGA 1KCYA 2Y5IA 3SJSA 2LMVA 2LVIA 3EK7A 1PSBA 4GAOA 5J3XA 2L5XB 1B7TY 4PDZA 3A8RA 1KWOC 2OS8C 1Y0VH 2K8MB 1KQMB 5KTYA 1LINA 2LE9B 2L0PA 1CDPA 1FI5A 1G8IA 1UHJA 2FCEA 1JFJA 1FI6A 4YGBB 2LM5A 3OB2B 1Y1AA 1XK4C 1XVJA 1HT9A 1J7OA 4DRWA 3SIAA 2JT8A 1TNPA 2F2PA 1CMGA 3I5GB 2LP2A 1RFJA 3PLFB 4IL1A 4PE1A 1DJYA 4GGFA 1OMDA 1UURA 2MHHA 3OP0A 4WQ2A 1RECA 1C07A 1PVBA 4I5NB 1DVIA 1B4CA 2LLTA 1R2UA 2JQ6A 3RM1A 2V53A 3EKJA 2NZ0A 1DGVA 1HQVA 1B8CA 1OZOA 3SG3A 4CFRA 2K7CA 1XO5A 2CT9A 4OVNF 1KFUL 1OQPA 1YX7A 1L2OB 1PVAA 1SYMA 4M2OA 4BY5A 1M31A 1QVIZ 1IJ5A 2M3WA 5I8NA 1CMFA 1TOPA 1LXFC 4USLA 1TNXA 3FWCA 1YUUA 4C0JA 3BYAA 1QJTA 2MJWB 2LANA 1KWOB 2OS8B 1WRKA 1JUOA 1KK8B 4PHMA 1N65A 4M2QA 1WY9A 3GK4X 2EHBA 1W7IB 2R2IA 4YGDB 2EGDA 2JULA 3O4YA 1A29A 1AJ4A 2K2FA 3VRQA 5AERA 1SKTA 3KO0A 1DJIA 1IQ3A 3AKBA 1YUSA 2BCBA 3WNXB 3NSKA 2ZRTA 1CFCA 4MZKA 3I5FC 1IJ6A 3I5HC 1PALA 1C7VA 3PATA 2WC8A 2KI6C 2GGZA 1S5GY 1CM1A 2KNEA 1NWDA 2JRFA 4YGEB 1CM4A 2BKHB 4OR9B 1VRKA 4M2PA 4PALA 2L50A 1SL8A 1GGWA 2JNFA 1YUTA 1LVCD 2KFHA 5CSIA 3SIBA 1B8LA 1KQMC 4WQ3A 4U8DA 1Y1XA 2JTZA 1NX0A 2L98A 3CZTX 3EVRA 3FS7A 1BG1A 2JNXA 2BECA 4NDCA 1BT6A 4CPVA 2LHIA 2KBMA 4MEWA 2M1KB 2D8NA 2HQWA 2JWWA 3LK1A 4NDBA 2KAVA 4L9MA 3OX6A 2NXQA 1H8BA 4AQJA 1AK8A 1MR8A 1AP4A 2LLUA 1YR5A 1L7ZA 1PSRA 1Q80A 1UHKA 5G08A 3TZ1A 4ETOA 3A4UB 1SR6C 3H4SE 2IS9A 2JZIA 5JJGA 1XFZO 4ZCVA 2LUCA 4P2YB 2BKIB 1TNQA 1B47A 1SMGA 4CLNA 3PALA 2HF5A 1NSHA 5BPJA 2LUXA 5KSZA 1IH0A 1S6JA 3HCMA 2L2EA 1DJWA 2ZN9A 2PASA 2KFGA 3DVJA 4GNKB 1GQMA 4OV2A 2Q4UA 1KSOA 1A4PA 4PHNA 5PALA 1BOCA 1UUSA 2DOQA 1H4BA 4PHKA 1QV0A 1SW8A 5DKRA 3I5FB 3I5HB 1CLMA 3CR5X 1J7PA 1BR1B 4GGFC 2I94A 1K9UA 1AJ5A 2F3ZA 2PVBA 2LVJA 1JF2A 1S6IA 2ZRSA 2CNPA 1J7RA 1V1FA 2PSRA 3LL8B 2HQ8A 1KK8C 3PN7B 1F70A 1Y6WA 1XFWO 3BUXB 2KI6D 3AAKA 4FQOA 1K9KA 4ORCB 2SCPA 1WDCB 3CWGA 3CR2A 4GFTA 2KYFA 2AAOA 2PRUA 4ICBA 3KHEA 2I18A 3DF0A 3O78A 2MBXA 2SASA 2Q91A 4I5LB 1QIVA 2H61A 3TDIA 3BUWB 2LVVA 5DKNA 1TTXA 1XFVO 1SR6B 2KAYA 2O5GA 4YBHB 1EJ3A 1QASA 1J1DA 1CFDA 3SG6A 1NCZA 1DTLA 1FW4A 2ZNEA 5CSJA 1K9PA 2L4IA 5HKYA 4JQ0D 1JSAA 1XA5A 3VRNA 3JVTC 4QJ4B 1XFUO 1EL4A 1TCFA 3TDUA 1NX3A 1QV1A 2K7DA 2LP3A 2O60A 2JXCA 1CNPA 2KQYA 3LCPC 1IWQA 1UWOA 1OE9B 1SPYA 1CFFA 1OZSA 1PK0D 1Y1UA 1ZACA 3LK0A 3LLEA 4XJKA 3SG4A 2F33A 2F2OA 2KOTA 2A4JA 2GGMA 3CR4X 3F45A 3O6BA 4A4CA 4D1EA 3OB1B 4NDDA 3IQQA 4FTGA 4QJ3B 3ZNIA 1DF0A 2L51A 2KYCA 2CCMA 2MLEC 2GV5A 2JTTA 1LKJA 3AKAA 1NP8A 4GBAA 2M49B 1RWYA 5GQQC 1KFUS 3TS5C 3VRRA 2P6BB 5AANA 2HPSA 1KFXL 3SG2A 3IQOA 4F0ZB 1EG3A 1MF8B 1QX5B 2CBLA 1KK7Y 2KHNA 3QRXA 4OCIA 5ER4X 4C0LA 1A75A 2KSPA 5B8IB 1IQ5A 3PSRA 3PFVA 1MUXA 1ODBA 4HRGA 1G4YR 1KSMA 2HETA 3FIAA 1S5GZ 1QVIY 3WHUB 1BR4B 3WXAA 3TUYB 5IBWA 2AMIA 1TIZA 5CSNA 1BMOA 3GK1A 5HKWA 1F55A 3FWBA 1XFYO 1F4OA 2BL0C 2KAXA 3ICBA 1IKUA 5ER5A 3D10A 1WLMA 3EK8A 1YTZC 4OKHA 3JVTB 3PN7C 1BJFA 2NCPA 1M63B 2FOTA 4N1GA 1LA3A 2WCEA 1SCMC 1K96A 1S26D 1WDCC 1GGZA 3D0YA 1M45A 3TDZA 3KEVA 4BY4A 3MSEB 4HREE 1FF1A 3JTDC 2KGRA 4CIDA 2WCBA 4AOMA 2LNKA 4I5JA 1SL9A 4MRYA 1QX2A 3E3RA 4DCKA 2G2BA 2EC6C 1YVHA 4E68A 1FPWA 1WRZA 1TNWA 3C1VA 1U5IA 1SBJA 4CFQA 3CLNA 2BE6A 4MBEA 3SG5A 5JOLA 1C7WA 3TS5B 5D7FA 1G33A 2ZNDA 2MA2A 4JPZB 3D0YB 5I2LA 2LV7A 1NPQA 1NUBA 1XYDA 2M8UA 1QS7A 4GPLB 2H61C 2M7LA 3BOWA 2MRDA 1QX7A 1S1EA 1QTXA 2M7NA 2TN4A 1FBVA 4PE0A 1F8HA 2OPOA 3GK2A 5HLVA 1B7TZ 1MQ1A 3CS1A 3EVVA 4P5OE 2BL0B 2WOSA 2ISDA 1A03A 1QXPA 1IRJA 1UHHA 1YURA 1QLKA 2QACA 1NCYA 5TNCA 3VRPA 1CLLA 3AAJA 1SY9A 2ZKMX 3NXAA 2LLSA 2Y1NA 1WLZA 2QPTA 1AVSA 1SCMB 2PALA 1DJZA 1PULA 1ZMZA 2I2RE 3I5IC 1ALWA 4JWQA 2COLB 5D69A 1B1GA 4MZLA 2K0JA 2K7BA 2KI4B 2E30A 3JTDB 3EKHA 2ZFDA 4TNCA 4PHJA 4ZCUA 4Q04A 1JWDA 1SK6D 3NSOA 1F54A 1B9AA 2FCDA 5FYXA 1M46A 1CFPA 5AXIA 1OOJA 4MVFA 3DVMA 4MSPA 4AQIA 2KGBC 1LA0A 3TUYC 1IG5A 3OHMB 5K89A 2EC6B 1S6CA 2JC2A 1YRUB 2JOJA 2MAZA 1CB1A 1XFXO 1DJXA 3BQ3A 1K2HA 1NYAA 2JT0A 1SNLA 3CTNA 3DVKA 4YGAA 4PCWA 2NCOA 2LCPA 1OMRA 3DF0B 5AEQA 2LMUA 1DT7B 1GJYA 1TN4A 3BUNB 1B8RA 1AHRA 1CDMA 1K94A 3RLZA 1SRAA 1UP5A 3NSLA 4NQGA 1CDLA 2NLNA 3GOFA 1J1EA 2AUCA 3K21A 1NCXA 1QLSA 1AUIB 2BE4A 2KDHA 4HRHA 1DJGA 2Y1MA 2MLFC 2OTGC 1K95A 2F3YA 1IGVA 2JPTA 4YGCB 1EXRA 2ZN8A 2I7AA 2RGIA 2WNDA 5AFPA 4QJ5B 3EK4A 3BXKA 3I5IB 1KK7Z 1TCOB 1TRFA 1QATA 3PM8A 1NX1A 3KF9A 2H2KA 1XK4A 4R1EA 2K7OA 3SG7A 5HKZA 4ORAB 3ZWHA 4WRIA 4XJKB 4DUQA 1YX8A 1V1GA 2BCXA 2LAPA 1EH2A 4PE7A 1X02A 2M1UA 4MLWA 1MXEA 2KQ6A 1JBAA 1OSAA 2FJUB 2Y4QA 1S36A 2K61A 1KFXS 1DF0B 1DGUA 1MXLC 2CXJA 4HSZA 3VROA 1N2DA 5I2QA 1JF0A 1JFKA 2BBNA 3BUOB 1MWNA 5DKQA 2E6WA 1W7JB 2LC5A 3CGAA 1E8AA 1R6PA 1A75B 1CDNA 4UPGA 1RK9A 2LMTA 1N0YA 1ALVA 4GGNA 1NIWA 1BF5A 3IF7A 4MN0A 5HLOA 4YI8A 2BCAA 2KI4C 5F6TA 1DMOA 2LVKA 4YRUA 3DVEA 1QIWA 3M0WA 1K90D 2L4HA 1UHIA 1NX2A 2CTNA 2K2AA 2JT3A 1RTP1 3BUMB 1CTRA 4MRXA 1J55A 1ZUZA 2OTGB 4N5XA 2KFFA 2G9BA 4DIRA 1WRLA 1CLBA 1J7QA 3NSIA 4I5KA 2JU0A 2B1UA 2LHLA 2M9GA 2PMYA 3KPXA 3WHTB 2M97A 4ORBB 2WORA 5CPVA 1DJHA 1K93D 1MHOA 5KU1A 1A2XA 2M29A 4A4BA 1YRTB 1BODA 1D1OA 2F8PA 1JC2A 1ZOTB 1UHNA 2M0RA 4GUKA 1BLQA 1SCVA 1PRWA 2WCFA 1BU3A 3I5GC 1SL7A
chains in the Genus database with same CATH superfamily
1RROA 1M39A 3HX4A 3EVUA 3NHIA 1KQVA 3BFBA 1U5IB 2KBIA 3DD4A 4C0KA 5CSFA 2QEBA 3OX5A 3OBVA 1S3PA 3B6XA 4INWA 3DZTA 4DS7A 4N1FA 3S0GA 4MZJA 3NHTA 2PQLA 2JXLA 1F4QA 1OOGA 4YI9A 1K8UA 1RJVA 1EG4A 1CKKA 4XYNA 3BOWB 1F71A 3O2PA 2BBMA 1YVLA 5HYDA 1OMVA 3VGOA 4PE4A 1ZFSA 5I2OA 1L2OC 2VRGA 2BAPA 1KCYA 2Y5IA 3SJSA 2LMVA 2LVIA 3EK7A 1PSBA 2QEOA 4GAOA 5J3XA 2L5XB 3V2LA 3VB1A 1B7TY 4PDZA 3A8RA 1KWOC 2OS8C 1Y0VH 2K8MB 1KQMB 5KTYA 1LINA 2LE9B 2L0PA 3L47A 3B7AA 1CDPA 1FI5A 3QMEA 1G8IA 1UHJA 3FE8A 2FCEA 1JFJA 1FI6A 4YGBB 2LM5A 3OB2B 1Y1AA 1XK4C 1XVJA 1HT9A 5D3OA 1J7OA 4DRWA 3SIAA 2JT8A 1TNPA 2F2PA 1CMGA 3I5GB 2LP2A 1RFJA 4IJ7A 3PLFB 4IL1A 4PE1A 1DEKA 1DJYA 4GGFA 1OMDA 1UURA 2MHHA 3OP0A 4WQ2A 2PYQA 1RECA 1C07A 1PVBA 4I5NB 1DVIA 1B4CA 2LLTA 3D76A 1R2UA 2JQ6A 3RM1A 2V53A 2WCLA 3EKJA 2NZ0A 2L2CA 3CYZA 1DGVA 1HQVA 1B8CA 1OZOA 3FE9A 3SG3A 3SS5A 2K7CA 4CFRA 1XO5A 2CT9A 4OVNF 3FE6A 1KFUL 1OQPA 4INXA 3D73A 1YX7A 1L2OB 1PVAA 1SYMA 4M2OA 4BY5A 1M31A 1QVIZ 1IJ5A 2M3WA 5I8NA 1CMFA 1TOPA 1LXFC 4USLA 1TNXA 3FWCA 1YUUA 4C0JA 2H8VA 3BYAA 5EL2A 1QJTA 2MJWB 2BNXA 2LANA 1KWOB 2OS8B 1WRKA 1JUOA 1KK8B 1Z4HA 4PHMA 1N65A 4M2QA 1WY9A 3GK4X 3CZ1A 2EHBA 1W7IB 2GTEA 2R2IA 4YGDB 2EGDA 2JULA 3O4YA 1A29A 1AJ4A 3B86A 2K2FA 3VRQA 5AERA 1SKTA 3KO0A 1DJIA 1IQ3A 3AKBA 1YUSA 2BCBA 2P70A 5FI2A 3WNXB 3NSKA 2ZRTA 1CFCA 4MZKA 3I5FC 1IJ6A 3I5HC 1PALA 1C7VA 3PATA 2WC8A 2KI6C 2GGZA 1S5GY 3CABA 1CM1A 2KNEA 1NWDA 2JRFA 4YGEB 1CM4A 2BKHB 1GM0A 4OR9B 1VRKA 4M2PA 4PALA 2L50A 1P28A 1SL8A 1GGWA 2JNFA 1YUTA 1LVCD 2KFHA 3DYEA 5CSIA 3SIBA 1B8LA 1KQMC 4WQ3A 4U8DA 1Y1XA 3IVTA 2JTZA 1TWOA 1NX0A 2L98A 3CZTX 3EVRA 3N7HA 3FS7A 1BG1A 2JNXA 2BECA 4NDCA 1BT6A 4CPVA 2LHIA 2KBMA 4MEWA 2M1KB 2D8NA 2HQWA 2JWWA 3LK1A 4NDBA 2KAVA 4L9MA 3OX6A 4F0ZB 2NXQA 1H8BA 4AQJA 1AK8A 1MR8A 1AP4A 2LLUA 1YR5A 1L7ZA 1PSRA 1Q80A 1UHKA 5G08A 3TZ1A 4ETOA 1IIOA 3A4UB 1SR6C 3H4SE 2IS9A 2JZIA 5JJGA 1QWVA 3CDNA 1XFZO 1SSEB 4ZCVA 1W9ZA 2LUCA 4P2YB 2BKIB 1TNQA 3S0BA 1B47A 1SMGA 1TUZA 4CLNA 3PALA 2HF5A 1NSHA 5BPJA 2LUXA 5KSZA 1IH0A 1S6JA 3HCMA 2L2EA 1DJWA 2ZN9A 2PASA 2KFGA 3DVJA 4GNKB 1GQMA 4OV2A 2Q4UA 1KSOA 1A4PA 4PHNA 5PALA 1BOCA 1UUSA 2DOQA 2QDIA 3NGVA 3UNWA 1H4BA 4OZDA 1QV0A 1SW8A 4PHKA 5DKRA 3I5FB 1OW4A 3I5HB 1CLMA 3UO9A 3CR5X 1J7PA 1BR1B 3OGNA 4GGFC 2I94A 1K9UA 1AJ5A 2F3ZA 2PVBA 2LVJA 1JF2A 1S6IA 2ZRSA 1J7RA 1V1FA 2CNPA 2PSRA 3LL8B 2HQ8A 1KK8C 3PN7B 1F70A 1Y6WA 1XFWO 3BUXB 2KI6D 3AAKA 4FQOA 1K9KA 3BFHA 4ORCB 2SCPA 1WDCB 3CWGA 3CR2A 4GFTA 2KYFA 2AAOA 2PRUA 4ICBA 3KHEA 2I18A 3DF0A 3O78A 2MBXA 2SASA 2Q91A 1OOHA 2WCJA 4I5LB 3D74A 1QIVA 2H61A 3TDIA 3BUWB 2LVVA 5DKNA 1TTXA 1XFVO 1SR6B 3R72A 2KAYA 2O5GA 2QEVA 4YBHB 1EJ3A 4JKTA 1QASA 1J1DA 1CFDA 3SG6A 1NCZA 1DTLA 1FW4A 1DC1A 2ZNEA 5CSJA 1K9PA 2L4IA 5HKYA 4JQ0D 1JSAA 1XA5A 3VRNA 3JVTC 4QJ4B 1XFUO 1EL4A 1TCFA 3TDUA 1NX3A 1QV1A 2K7DA 2LP3A 2O60A 2JXCA 3PM2A 1CNPA 2KQYA 3LCPC 3R1OA 1IWQA 1UWOA 3BFAA 1OE9B 1SPYA 3R1VA 1CFFA 1OZSA 1PK0D 1Y1UA 1ZACA 3LK0A 3LLEA 4XJKA 2YGUA 3SG4A 2F33A 2F2OA 2KOTA 2A4JA 2GGMA 3CR4X 3F45A 3O6BA 4A4CA 4D1EA 1Z2CB 3OB1B 3L4LA 4NDDA 3IQQA 4FTGA 4QJ3B 3ZNIA 1OOIX 1DF0A 2L51A 2WC6A 2KYCA 2CCMA 2MLEC 2GV5A 2JTTA 1LKJA 3AKAA 1NP8A 4GBAA 2M49B 1ORGA 1RWYA 1KFUS 4FQTA 5GQQC 3TS5C 2P6BB 5AANA 3VRRA 2HPSA 1KFXL 2L5YA 3SG2A 3CZ0A 3IQOA 1EG3A 1MF8B 1QX5B 2CBLA 1KK7Y 2KHNA 3QRXA 4OCIA 5ER4X 4C0LA 1A75A 2KSPA 5B8IB 1IQ5A 2WC5A 2QEHA 3PSRA 3PFVA 1MUXA 1ODBA 5HL1A 4HRGA 1G4YR 1KSMA 2HETA 3FIAA 1S5GZ 1QVIY 3WHUB 1BR4B 3WXAA 3TUYB 5IBWA 2AMIA 1TIZA 1TUJA 5CSNA 1BMOA 3GK1A 5HKWA 1F55A 5FI6A 3FWBA 1XFYO 1F4OA 2BL0C 2KAXA 3ICBA 3K1EA 1IKUA 5ER5A 3D10A 3S0AA 3EG5B 1WLMA 3EK8A 1YTZC 4OKHA 3S0DA 3JVTB 3PN7C 1BJFA 2NCPA 1M63B 2FOTA 4N1GA 1LA3A 2WCEA 1SCMC 1K96A 1S26D 1WDCC 2WCHA 3SS4A 1GGZA 3D0YA 1M45A 3TDZA 3KEVA 4BY4A 3MSEB 4HREE 1FF1A 3JTDC 2KGRA 4CIDA 2WCBA 2P71A 4AOMA 1C3YA 2LNKA 4I5JA 1SL9A 4MRYA 1QX2A 3E3RA 3DY9A 4DCKA 2G2BA 2EC6C 1YVHA 4E68A 1FPWA 1WRZA 1TNWA 3C1VA 1U5IA 1SBJA 4CFQA 3CLNA 2BE6A 4MBEA 3SG5A 5JOLA 1C7WA 3TS5B 5D7FA 1G33A 1C3ZA 2ZNDA 2MA2A 4JPZB 3D0YB 5I2LA 2LV7A 1NPQA 1NUBA 1XYDA 4JD9A 3D78A 3BJHA 2M8UA 1QS7A 4GPLB 2H61C 2M7LA 3BOWA 2MRDA 1QX7A 4PT1A 3Q8IA 1S1EA 1QTXA 2FJYA 2M7NA 3CZ2A 2TN4A 1FBVA 4PE0A 1F8HA 2JPOA 2OPOA 3GK2A 5HLVA 1B7TZ 1MQ1A 3PJIA 3CS1A 3EVVA 1XFRA 4P5OE 2BL0B 2WOSA 2ISDA 1A03A 1QXPA 1IRJA 1UHHA 1YURA 1QLKA 2QACA 1NCYA 5TNCA 1LS8A 3VRPA 1CLLA 3AAJA 1SY9A 2K60A 2ZKMX 3NXAA 2LLSA 2Y1NA 1WLZA 2QPTA 1AVSA 1SCMB 2PALA 1DJZA 1PULA 1ZMZA 2I2RE 3I5IC 1ALWA 4JWQA 2COLB 5D69A 1B1GA 4MZLA 2WCKA 2K0JA 2K7BA 2KI4B 2E30A 3JTDB 3EKHA 2ZFDA 4TNCA 4PHJA 4ZCUA 1DELA 4Q04A 1JWDA 1SK6D 3NSOA 1F54A 1B9AA 2FCDA 5FYXA 1M46A 1CFPA 5AXIA 1OOJA 4MVFA 3SS3A 3DVMA 4MSPA 4AQIA 2KGBC 1LA0A 3TUYC 1IG5A 3OHMB 5K89A 2EC6B 1S6CA 2JC2A 1YRUB 2JOJA 2MAZA 1CB1A 1XFXO 1DJXA 3BQ3A 1K2HA 1NYAA 2JT0A 1SNLA 3CTNA 3DVKA 4YGAA 4PCWA 2NCOA 2LCPA 1OMRA 3DF0B 5AEQA 2LMUA 1DT7B 1GJYA 1TN4A 3BUNB 1B8RA 1AHRA 1CDMA 1K94A 3RLZA 1SRAA 2ERBA 1UP5A 3NSLA 4NQGA 1CDLA 2NLNA 3GOFA 1J1EA 2AUCA 3K21A 1NCXA 1QLSA 1AUIB 2BE4A 2KDHA 4HRHA 1DJGA 2Y1MA 4KYNA 2KPHA 2MLFC 2OTGC 1K95A 2F3YA 1IGVA 2JPTA 2WCMA 1EXRA 2ZN8A 4YGCB 2I7AA 2RGIA 3D75A 2WNDA 5AFPA 4QJ5B 3RZSA 3EK4A 3BXKA 3I5IB 1KK7Z 1TCOB 1TRFA 1QATA 3PM8A 5DICA 2KLDA 1DQEA 1NX1A 3KF9A 2H2KA 1XK4A 3DXLA 4R1EA 2K7OA 3SG7A 5HKZA 4ORAB 3ZWHA 4WRIA 4XJKB 4DUQA 1YX8A 1V1GA 2BCXA 2LAPA 1EH2A 4PE7A 1X02A 2M1UA 4MLWA 1MXEA 2KQ6A 1JBAA 1OSAA 2FJUB 2Y4QA 1S36A 2K61A 1KFXS 1DF0B 1DGUA 1MXLC 2CXJA 4HSZA 3VROA 1N2DA 5I2QA 1JF0A 1JFKA 2BBNA 3BUOB 1MWNA 3R1PA 3B87A 5DKQA 2E6WA 1W7JB 1T14A 4F7FA 1OOFA 2LC5A 3CGAA 1E8AA 1R6PA 1A75B 1CDNA 4UPGA 2KLEA 3S0FA 1RK9A 2LMTA 1N0YA 3D77A 1ALVA 4GGNA 1NIWA 1BF5A 3IF7A 4MN0A 5HLOA 3S0EA 4YI8A 2BCAA 2KI4C 5F6TA 1DMOA 2LVKA 4YRUA 3DVEA 1QIWA 3M0WA 1K90D 5I94A 2L4HA 1UHIA 1NX2A 2CTNA 2K2AA 2JT3A 1RTP1 3BUMB 1CTRA 4MRXA 1J55A 1ZUZA 2OTGB 3O4XA 4N5XA 2KFFA 2G9BA 4DIRA 1WRLA 1CLBA 1J7QA 3NSIA 4I5KA 2JU0A 2B1UA 2LHLA 2M9GA 5FI7A 2PMYA 3KPXA 3WHTB 2M97A 4ORBB 2WORA 5CPVA 1DJHA 1K93D 1MHOA 5KU1A 1A2XA 2M29A 4A4BA 1YRTB 1BODA 3B88A 1D1OA 2F8PA 1JC2A 1ZOTB 1UHNA 2M0RA 4GUKA 1BLQA 1SCVA 3L4AA 1PRWA 2WCFA 1BU3A 3I5GC 1SL7A
chains in the Genus database with same CATH topology
1RROA 1M39A 3HX4A 3EVUA 1KQVA 1U5IB 2KBIA 3DD4A 4C0KA 5CSFA 3OX5A 1S3PA 4DS7A 4N1FA 4MZJA 2JXLA 1F4QA 4YI9A 1K8UA 1RJVA 1EG4A 1CKKA 4XYNA 3BOWB 1F71A 3O2PA 2BBMA 1YVLA 5HYDA 1OMVA 3VGOA 4PE4A 1ZFSA 5I2OA 1L2OC 2VRGA 1KCYA 2Y5IA 3SJSA 2LMVA 2LVIA 3EK7A 1PSBA 4GAOA 5J3XA 2L5XB 1B7TY 4PDZA 3A8RA 1KWOC 2OS8C 1Y0VH 2K8MB 1KQMB 5KTYA 1LINA 2LE9B 2L0PA 1CDPA 1FI5A 1G8IA 1UHJA 2FCEA 1JFJA 1FI6A 4YGBB 2LM5A 3OB2B 1Y1AA 1XK4C 1XVJA 1HT9A 1J7OA 4DRWA 3SIAA 2JT8A 1TNPA 2F2PA 1CMGA 3I5GB 2LP2A 1RFJA 3PLFB 4IL1A 4PE1A 1DJYA 4GGFA 1OMDA 1UURA 2MHHA 3OP0A 4WQ2A 1RECA 1C07A 1PVBA 4I5NB 1DVIA 1B4CA 2LLTA 1R2UA 2JQ6A 3RM1A 2V53A 3EKJA 2NZ0A 1DGVA 1HQVA 1B8CA 1OZOA 3SG3A 4CFRA 2K7CA 1XO5A 2CT9A 4OVNF 1KFUL 1OQPA 1YX7A 1L2OB 1PVAA 1SYMA 4M2OA 4BY5A 1M31A 1QVIZ 1IJ5A 2M3WA 5I8NA 1CMFA 1TOPA 1LXFC 4USLA 1TNXA 3FWCA 1YUUA 4C0JA 3BYAA 1QJTA 2MJWB 2LANA 1KWOB 2OS8B 1WRKA 1JUOA 1KK8B 4PHMA 1N65A 4M2QA 1WY9A 3GK4X 2EHBA 1W7IB 2R2IA 4YGDB 2EGDA 2JULA 3O4YA 1A29A 1AJ4A 2K2FA 3VRQA 5AERA 1SKTA 3KO0A 1DJIA 1IQ3A 3AKBA 1YUSA 2BCBA 3WNXB 3NSKA 2ZRTA 1CFCA 4MZKA 3I5FC 1IJ6A 3I5HC 1PALA 1C7VA 3PATA 2WC8A 2KI6C 2GGZA 1S5GY 1CM1A 2KNEA 1NWDA 2JRFA 4YGEB 1CM4A 2BKHB 4OR9B 1VRKA 4M2PA 4PALA 2L50A 1SL8A 1GGWA 2JNFA 1YUTA 1LVCD 2KFHA 5CSIA 3SIBA 1B8LA 1KQMC 4WQ3A 4U8DA 1Y1XA 2JTZA 1NX0A 2L98A 3CZTX 3EVRA 3FS7A 1BG1A 2JNXA 2BECA 4NDCA 1BT6A 4CPVA 2LHIA 2KBMA 4MEWA 2M1KB 2D8NA 2HQWA 2JWWA 3LK1A 4NDBA 2KAVA 4L9MA 3OX6A 2NXQA 1H8BA 4AQJA 1AK8A 1MR8A 1AP4A 2LLUA 1YR5A 1L7ZA 1PSRA 1Q80A 1UHKA 5G08A 3TZ1A 4ETOA 3A4UB 1SR6C 3H4SE 2IS9A 2JZIA 5JJGA 1XFZO 4ZCVA 2LUCA 4P2YB 2BKIB 1TNQA 1B47A 1SMGA 4CLNA 3PALA 2HF5A 1NSHA 5BPJA 2LUXA 5KSZA 1IH0A 1S6JA 3HCMA 2L2EA 1DJWA 2ZN9A 2PASA 2KFGA 3DVJA 4GNKB 1GQMA 4OV2A 2Q4UA 1KSOA 1A4PA 4PHNA 5PALA 1BOCA 1UUSA 2DOQA 1H4BA 4PHKA 1QV0A 1SW8A 5DKRA 3I5FB 3I5HB 1CLMA 3CR5X 1J7PA 1BR1B 4GGFC 2I94A 1K9UA 1AJ5A 2F3ZA 2PVBA 2LVJA 1JF2A 1S6IA 2ZRSA 2CNPA 1J7RA 1V1FA 2PSRA 3LL8B 2HQ8A 1KK8C 3PN7B 1F70A 1Y6WA 1XFWO 3BUXB 2KI6D 3AAKA 4FQOA 1K9KA 4ORCB 2SCPA 1WDCB 3CWGA 3CR2A 4GFTA 2KYFA 2AAOA 2PRUA 4ICBA 3KHEA 2I18A 3DF0A 3O78A 2MBXA 2SASA 2Q91A 4I5LB 1QIVA 2H61A 3TDIA 3BUWB 2LVVA 5DKNA 1TTXA 1XFVO 1SR6B 2KAYA 2O5GA 4YBHB 1EJ3A 1QASA 1J1DA 1CFDA 3SG6A 1NCZA 1DTLA 1FW4A 2ZNEA 5CSJA 1K9PA 2L4IA 5HKYA 4JQ0D 1JSAA 1XA5A 3VRNA 3JVTC 4QJ4B 1XFUO 1EL4A 1TCFA 3TDUA 1NX3A 1QV1A 2K7DA 2LP3A 2O60A 2JXCA 1CNPA 2KQYA 3LCPC 1IWQA 1UWOA 1OE9B 1SPYA 1CFFA 1OZSA 1PK0D 1Y1UA 1ZACA 3LK0A 3LLEA 4XJKA 3SG4A 2F33A 2F2OA 2KOTA 2A4JA 2GGMA 3CR4X 3F45A 3O6BA 4A4CA 4D1EA 3OB1B 4NDDA 3IQQA 4FTGA 4QJ3B 3ZNIA 1DF0A 2L51A 2KYCA 2CCMA 2MLEC 2GV5A 2JTTA 1LKJA 3AKAA 1NP8A 4GBAA 2M49B 1RWYA 5GQQC 1KFUS 3TS5C 3VRRA 2P6BB 5AANA 2HPSA 1KFXL 3SG2A 3IQOA 4F0ZB 1EG3A 1MF8B 1QX5B 2CBLA 1KK7Y 2KHNA 3QRXA 4OCIA 5ER4X 4C0LA 1A75A 2KSPA 5B8IB 1IQ5A 3PSRA 3PFVA 1MUXA 1ODBA 4HRGA 1G4YR 1KSMA 2HETA 3FIAA 1S5GZ 1QVIY 3WHUB 1BR4B 3WXAA 3TUYB 5IBWA 2AMIA 1TIZA 5CSNA 1BMOA 3GK1A 5HKWA 1F55A 3FWBA 1XFYO 1F4OA 2BL0C 2KAXA 3ICBA 1IKUA 5ER5A 3D10A 1WLMA 3EK8A 1YTZC 4OKHA 3JVTB 3PN7C 1BJFA 2NCPA 1M63B 2FOTA 4N1GA 1LA3A 2WCEA 1SCMC 1K96A 1S26D 1WDCC 1GGZA 3D0YA 1M45A 3TDZA 3KEVA 4BY4A 3MSEB 4HREE 1FF1A 3JTDC 2KGRA 4CIDA 2WCBA 4AOMA 2LNKA 4I5JA 1SL9A 4MRYA 1QX2A 3E3RA 4DCKA 2G2BA 2EC6C 1YVHA 4E68A 1FPWA 1WRZA 1TNWA 3C1VA 1U5IA 1SBJA 4CFQA 3CLNA 2BE6A 4MBEA 3SG5A 5JOLA 1C7WA 3TS5B 5D7FA 1G33A 2ZNDA 2MA2A 4JPZB 3D0YB 5I2LA 2LV7A 1NPQA 1NUBA 1XYDA 2M8UA 1QS7A 4GPLB 2H61C 2M7LA 3BOWA 2MRDA 1QX7A 1S1EA 1QTXA 2M7NA 2TN4A 1FBVA 4PE0A 1F8HA 2OPOA 3GK2A 5HLVA 1B7TZ 1MQ1A 3CS1A 3EVVA 4P5OE 2BL0B 2WOSA 2ISDA 1A03A 1QXPA 1IRJA 1UHHA 1YURA 1QLKA 2QACA 1NCYA 5TNCA 3VRPA 1CLLA 3AAJA 1SY9A 2ZKMX 3NXAA 2LLSA 2Y1NA 1WLZA 2QPTA 1AVSA 1SCMB 2PALA 1DJZA 1PULA 1ZMZA 2I2RE 3I5IC 1ALWA 4JWQA 2COLB 5D69A 1B1GA 4MZLA 2K0JA 2K7BA 2KI4B 2E30A 3JTDB 3EKHA 2ZFDA 4TNCA 4PHJA 4ZCUA 4Q04A 1JWDA 1SK6D 3NSOA 1F54A 1B9AA 2FCDA 5FYXA 1M46A 1CFPA 5AXIA 1OOJA 4MVFA 3DVMA 4MSPA 4AQIA 2KGBC 1LA0A 3TUYC 1IG5A 3OHMB 5K89A 2EC6B 1S6CA 2JC2A 1YRUB 2JOJA 2MAZA 1CB1A 1XFXO 1DJXA 3BQ3A 1K2HA 1NYAA 2JT0A 1SNLA 3CTNA 3DVKA 4YGAA 4PCWA 2NCOA 2LCPA 1OMRA 3DF0B 5AEQA 2LMUA 1DT7B 1GJYA 1TN4A 3BUNB 1B8RA 1AHRA 1CDMA 1K94A 3RLZA 1SRAA 1UP5A 3NSLA 4NQGA 1CDLA 2NLNA 3GOFA 1J1EA 2AUCA 3K21A 1NCXA 1QLSA 1AUIB 2BE4A 2KDHA 4HRHA 1DJGA 2Y1MA 2MLFC 2OTGC 1K95A 2F3YA 1IGVA 2JPTA 4YGCB 1EXRA 2ZN8A 2I7AA 2RGIA 2WNDA 5AFPA 4QJ5B 3EK4A 3BXKA 3I5IB 1KK7Z 1TCOB 1TRFA 1QATA 3PM8A 1NX1A 3KF9A 2H2KA 1XK4A 4R1EA 2K7OA 3SG7A 5HKZA 4ORAB 3ZWHA 4WRIA 4XJKB 4DUQA 1YX8A 1V1GA 2BCXA 2LAPA 1EH2A 4PE7A 1X02A 2M1UA 4MLWA 1MXEA 2KQ6A 1JBAA 1OSAA 2FJUB 2Y4QA 1S36A 2K61A 1KFXS 1DF0B 1DGUA 1MXLC 2CXJA 4HSZA 3VROA 1N2DA 5I2QA 1JF0A 1JFKA 2BBNA 3BUOB 1MWNA 5DKQA 2E6WA 1W7JB 2LC5A 3CGAA 1E8AA 1R6PA 1A75B 1CDNA 4UPGA 1RK9A 2LMTA 1N0YA 1ALVA 4GGNA 1NIWA 1BF5A 3IF7A 4MN0A 5HLOA 4YI8A 2BCAA 2KI4C 5F6TA 1DMOA 2LVKA 4YRUA 3DVEA 1QIWA 3M0WA 1K90D 2L4HA 1UHIA 1NX2A 2CTNA 2K2AA 2JT3A 1RTP1 3BUMB 1CTRA 4MRXA 1J55A 1ZUZA 2OTGB 4N5XA 2KFFA 2G9BA 4DIRA 1WRLA 1CLBA 1J7QA 3NSIA 4I5KA 2JU0A 2B1UA 2LHLA 2M9GA 2PMYA 3KPXA 3WHTB 2M97A 4ORBB 2WORA 5CPVA 1DJHA 1K93D 1MHOA 5KU1A 1A2XA 2M29A 4A4BA 1YRTB 1BODA 1D1OA 2F8PA 1JC2A 1ZOTB 1UHNA 2M0RA 4GUKA 1BLQA 1SCVA 1PRWA 2WCFA 1BU3A 3I5GC 1SL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRO A;  1M39 A;  3HX4 A;  3EVU A;  1KQV A;  1U5I B;  2KBI A;  3DD4 A;  4C0K A;  5CSF A;  3OX5 A;  1S3P A;  4DS7 A;  4N1F A;  4MZJ A;  2JXL A;  1F4Q A;  4YI9 A;  1K8U A;  1RJV A;  1EG4 A;  1CKK A;  4XYN A;  3BOW B;  1F71 A;  3O2P A;  2BBM A;  1YVL A;  5HYD A;  1OMV A;  3VGO A;  4PE4 A;  1ZFS A;  5I2O A;  1L2O C;  2VRG A;  1KCY A;  2Y5I A;  3SJS A;  2LMV A;  2LVI A;  3EK7 A;  1PSB A;  4GAO A;  5J3X A;  2L5X B;  1B7T Y;  4PDZ A;  3A8R A;  1KWO C;  2OS8 C;  1Y0V H;  2K8M B;  1KQM B;  5KTY A;  1LIN A;  2LE9 B;  2L0P A;  1CDP A;  1FI5 A;  1G8I A;  1UHJ A;  2FCE A;  1JFJ A;  1FI6 A;  4YGB B;  2LM5 A;  3OB2 B;  1Y1A A;  1XK4 C;  1XVJ A;  1HT9 A;  1J7O A;  4DRW A;  3SIA A;  2JT8 A;  1TNP A;  2F2P A;  1CMG A;  3I5G B;  2LP2 A;  1RFJ A;  3PLF B;  4IL1 A;  4PE1 A;  1DJY A;  4GGF A;  1OMD A;  1UUR A;  2MHH A;  3OP0 A;  4WQ2 A;  1REC A;  1C07 A;  1PVB A;  4I5N B;  1DVI A;  1B4C A;  2LLT A;  1R2U A;  2JQ6 A;  3RM1 A;  2V53 A;  3EKJ A;  2NZ0 A;  1DGV A;  1HQV A;  1B8C A;  1OZO A;  3SG3 A;  4CFR A;  2K7C A;  1XO5 A;  2CT9 A;  4OVN F;  1KFU L;  1OQP A;  1YX7 A;  1L2O B;  1PVA A;  1SYM A;  4M2O A;  4BY5 A;  1M31 A;  1QVI Z;  1IJ5 A;  2M3W A;  5I8N A;  1CMF A;  1TOP A;  1LXF C;  4USL A;  1TNX A;  3FWC A;  1YUU A;  4C0J A;  3BYA A;  1QJT A;  2MJW B;  2LAN A;  1KWO B;  2OS8 B;  1WRK A;  1JUO A;  1KK8 B;  4PHM A;  1N65 A;  4M2Q A;  1WY9 A;  3GK4 X;  2EHB A;  1W7I B;  2R2I A;  4YGD B;  2EGD A;  2JUL A;  3O4Y A;  1A29 A;  1AJ4 A;  2K2F A;  3VRQ A;  5AER A;  1SKT A;  3KO0 A;  1DJI A;  1IQ3 A;  3AKB A;  1YUS A;  2BCB A;  3WNX B;  3NSK A;  2ZRT A;  1CFC A;  4MZK A;  3I5F C;  1IJ6 A;  3I5H C;  1PAL A;  1C7V A;  3PAT A;  2WC8 A;  2KI6 C;  2GGZ A;  1S5G Y;  1CM1 A;  2KNE A;  1NWD A;  2JRF A;  4YGE B;  1CM4 A;  2BKH B;  4OR9 B;  1VRK A;  4M2P A;  4PAL A;  2L50 A;  1SL8 A;  1GGW A;  2JNF A;  1YUT A;  1LVC D;  2KFH A;  5CSI A;  3SIB A;  1B8L A;  1KQM C;  4WQ3 A;  4U8D A;  1Y1X A;  2JTZ A;  1NX0 A;  2L98 A;  3CZT X;  3EVR A;  3FS7 A;  1BG1 A;  2JNX A;  2BEC A;  4NDC A;  1BT6 A;  4CPV A;  2LHI A;  2KBM A;  4MEW A;  2M1K B;  2D8N A;  2HQW A;  2JWW A;  3LK1 A;  4NDB A;  2KAV A;  4L9M A;  3OX6 A;  2NXQ A;  1H8B A;  4AQJ A;  1AK8 A;  1MR8 A;  1AP4 A;  2LLU A;  1YR5 A;  1L7Z A;  1PSR A;  1Q80 A;  1UHK A;  5G08 A;  3TZ1 A;  4ETO A;  3A4U B;  1SR6 C;  3H4S E;  2IS9 A;  2JZI A;  5JJG A;  1XFZ O;  4ZCV A;  2LUC A;  4P2Y B;  2BKI B;  1TNQ A;  1B47 A;  1SMG A;  4CLN A;  3PAL A;  2HF5 A;  1NSH A;  5BPJ A;  2LUX A;  5KSZ A;  1IH0 A;  1S6J A;  3HCM A;  2L2E A;  1DJW A;  2ZN9 A;  2PAS A;  2KFG A;  3DVJ A;  4GNK B;  1GQM A;  4OV2 A;  2Q4U A;  1KSO A;  1A4P A;  4PHN A;  5PAL A;  1BOC A;  1UUS A;  2DOQ A;  1H4B A;  4PHK A;  1QV0 A;  1SW8 A;  5DKR A;  3I5F B;  3I5H B;  1CLM A;  3CR5 X;  1J7P A;  1BR1 B;  4GGF C;  2I94 A;  1K9U A;  1AJ5 A;  2F3Z A;  2PVB A;  2LVJ A;  1JF2 A;  1S6I A;  2ZRS A;  2CNP A;  1J7R A;  1V1F A;  2PSR A;  3LL8 B;  2HQ8 A;  1KK8 C;  3PN7 B;  1F70 A;  1Y6W A;  1XFW O;  3BUX B;  2KI6 D;  3AAK A;  4FQO A;  1K9K A;  4ORC B;  2SCP A;  1WDC B;  3CWG A;  3CR2 A;  4GFT A;  2KYF A;  2AAO A;  2PRU A;  4ICB A;  3KHE A;  2I18 A;  3DF0 A;  3O78 A;  2MBX A;  2SAS A;  2Q91 A;  4I5L B;  1QIV A;  2H61 A;  3TDI A;  3BUW B;  2LVV A;  5DKN A;  1TTX A;  1XFV O;  1SR6 B;  2KAY A;  2O5G A;  4YBH B;  1EJ3 A;  1QAS A;  1J1D A;  1CFD A;  3SG6 A;  1NCZ A;  1DTL A;  1FW4 A;  2ZNE A;  5CSJ A;  1K9P A;  2L4I A;  5HKY A;  4JQ0 D;  1JSA A;  1XA5 A;  3VRN A;  3JVT C;  4QJ4 B;  1XFU O;  1EL4 A;  1TCF A;  3TDU A;  1NX3 A;  1QV1 A;  2K7D A;  2LP3 A;  2O60 A;  2JXC A;  1CNP A;  2KQY A;  3LCP C;  1IWQ A;  1UWO A;  1OE9 B;  1SPY A;  1CFF A;  1OZS A;  1PK0 D;  1Y1U A;  1ZAC A;  3LK0 A;  3LLE A;  4XJK A;  3SG4 A;  2F33 A;  2F2O A;  2KOT A;  2A4J A;  2GGM A;  3CR4 X;  3F45 A;  3O6B A;  4A4C A;  4D1E A;  3OB1 B;  4NDD A;  3IQQ A;  4FTG A;  4QJ3 B;  3ZNI A;  1DF0 A;  2L51 A;  2KYC A;  2CCM A;  2MLE C;  2GV5 A;  2JTT A;  1LKJ A;  3AKA A;  1NP8 A;  4GBA A;  2M49 B;  1RWY A;  5GQQ C;  1KFU S;  3TS5 C;  3VRR A;  2P6B B;  5AAN A;  2HPS A;  1KFX L;  3SG2 A;  3IQO A;  4F0Z B;  1EG3 A;  1MF8 B;  1QX5 B;  2CBL A;  1KK7 Y;  2KHN A;  3QRX A;  4OCI A;  5ER4 X;  4C0L A;  1A75 A;  2KSP A;  5B8I B;  1IQ5 A;  3PSR A;  3PFV A;  1MUX A;  1ODB A;  4HRG A;  1G4Y R;  1KSM A;  2HET A;  3FIA A;  1S5G Z;  1QVI Y;  3WHU B;  1BR4 B;  3WXA A;  3TUY B;  5IBW A;  2AMI A;  1TIZ A;  5CSN A;  1BMO A;  3GK1 A;  5HKW A;  1F55 A;  3FWB A;  1XFY O;  1F4O A;  2BL0 C;  2KAX A;  3ICB A;  1IKU A;  5ER5 A;  3D10 A;  1WLM A;  3EK8 A;  1YTZ C;  4OKH A;  3JVT B;  3PN7 C;  1BJF A;  2NCP A;  1M63 B;  2FOT A;  4N1G A;  1LA3 A;  2WCE A;  1SCM C;  1K96 A;  1S26 D;  1WDC C;  1GGZ A;  3D0Y A;  1M45 A;  3TDZ A;  3KEV A;  4BY4 A;  3MSE B;  4HRE E;  1FF1 A;  3JTD C;  2KGR A;  4CID A;  2WCB A;  4AOM A;  2LNK A;  4I5J A;  1SL9 A;  4MRY A;  1QX2 A;  3E3R A;  4DCK A;  2G2B A;  2EC6 C;  1YVH A;  4E68 A;  1FPW A;  1WRZ A;  1TNW A;  3C1V A;  1U5I A;  1SBJ A;  4CFQ A;  3CLN A;  2BE6 A;  4MBE A;  3SG5 A;  5JOL A;  1C7W A;  3TS5 B;  5D7F A;  1G33 A;  2ZND A;  2MA2 A;  4JPZ B;  3D0Y B;  5I2L A;  2LV7 A;  1NPQ A;  1NUB A;  1XYD A;  2M8U A;  1QS7 A;  4GPL B;  2H61 C;  2M7L A;  3BOW A;  2MRD A;  1QX7 A;  1S1E A;  1QTX A;  2M7N A;  2TN4 A;  1FBV A;  4PE0 A;  1F8H A;  2OPO A;  3GK2 A;  5HLV A;  1B7T Z;  1MQ1 A;  3CS1 A;  3EVV A;  4P5O E;  2BL0 B;  2WOS A;  2ISD A;  1A03 A;  1QXP A;  1IRJ A;  1UHH A;  1YUR A;  1QLK A;  2QAC A;  1NCY A;  5TNC A;  3VRP A;  1CLL A;  3AAJ A;  1SY9 A;  2ZKM X;  3NXA A;  2LLS A;  2Y1N A;  1WLZ A;  2QPT A;  1AVS A;  1SCM B;  2PAL A;  1DJZ A;  1PUL A;  1ZMZ A;  2I2R E;  3I5I C;  1ALW A;  4JWQ A;  2COL B;  5D69 A;  1B1G A;  4MZL A;  2K0J A;  2K7B A;  2KI4 B;  2E30 A;  3JTD B;  3EKH A;  2ZFD A;  4TNC A;  4PHJ A;  4ZCU A;  4Q04 A;  1JWD A;  1SK6 D;  3NSO A;  1F54 A;  1B9A A;  2FCD A;  5FYX A;  1M46 A;  1CFP A;  5AXI A;  1OOJ A;  4MVF A;  3DVM A;  4MSP A;  4AQI A;  2KGB C;  1LA0 A;  3TUY C;  1IG5 A;  3OHM B;  5K89 A;  2EC6 B;  1S6C A;  2JC2 A;  1YRU B;  2JOJ A;  2MAZ A;  1CB1 A;  1XFX O;  1DJX A;  3BQ3 A;  1K2H A;  1NYA A;  2JT0 A;  1SNL A;  3CTN A;  3DVK A;  4YGA A;  4PCW A;  2NCO A;  2LCP A;  1OMR A;  3DF0 B;  5AEQ A;  2LMU A;  1DT7 B;  1GJY A;  1TN4 A;  3BUN B;  1B8R A;  1AHR A;  1CDM A;  1K94 A;  3RLZ A;  1SRA A;  1UP5 A;  3NSL A;  4NQG A;  1CDL A;  2NLN A;  3GOF A;  1J1E A;  2AUC A;  3K21 A;  1NCX A;  1QLS A;  1AUI B;  2BE4 A;  2KDH A;  4HRH A;  1DJG A;  2Y1M A;  2MLF C;  2OTG C;  1K95 A;  2F3Y A;  1IGV A;  2JPT A;  4YGC B;  1EXR A;  2ZN8 A;  2I7A A;  2RGI A;  2WND A;  5AFP A;  4QJ5 B;  3EK4 A;  3BXK A;  3I5I B;  1KK7 Z;  1TCO B;  1TRF A;  1QAT A;  3PM8 A;  1NX1 A;  3KF9 A;  2H2K A;  1XK4 A;  4R1E A;  2K7O A;  3SG7 A;  5HKZ A;  4ORA B;  3ZWH A;  4WRI A;  4XJK B;  4DUQ A;  1YX8 A;  1V1G A;  2BCX A;  2LAP A;  1EH2 A;  4PE7 A;  1X02 A;  2M1U A;  4MLW A;  1MXE A;  2KQ6 A;  1JBA A;  1OSA A;  2FJU B;  2Y4Q A;  1S36 A;  2K61 A;  1KFX S;  1DF0 B;  1DGU A;  1MXL C;  2CXJ A;  4HSZ A;  3VRO A;  1N2D A;  5I2Q A;  1JF0 A;  1JFK A;  2BBN A;  3BUO B;  1MWN A;  5DKQ A;  2E6W A;  1W7J B;  2LC5 A;  3CGA A;  1E8A A;  1R6P A;  1A75 B;  1CDN A;  4UPG A;  1RK9 A;  2LMT A;  1N0Y A;  1ALV A;  4GGN A;  1NIW A;  1BF5 A;  3IF7 A;  4MN0 A;  5HLO A;  4YI8 A;  2BCA A;  2KI4 C;  5F6T A;  1DMO A;  2LVK A;  4YRU A;  3DVE A;  1QIW A;  3M0W A;  1K90 D;  2L4H A;  1UHI A;  1NX2 A;  2CTN A;  2K2A A;  2JT3 A;  1RTP 1;  3BUM B;  1CTR A;  4MRX A;  1J55 A;  1ZUZ A;  2OTG B;  4N5X A;  2KFF A;  2G9B A;  4DIR A;  1WRL A;  1CLB A;  1J7Q A;  3NSI A;  4I5K A;  2JU0 A;  2B1U A;  2LHL A;  2M9G A;  2PMY A;  3KPX A;  3WHT B;  2M97 A;  4ORB B;  2WOR A;  5CPV A;  1DJH A;  1K93 D;  1MHO A;  5KU1 A;  1A2X A;  2M29 A;  4A4B A;  1YRT B;  1BOD A;  1D1O A;  2F8P A;  1JC2 A;  1ZOT B;  1UHN A;  2M0R A;  4GUK A;  1BLQ A;  1SCV A;  1PRW A;  2WCF A;  1BU3 A;  3I5G C;  1SL7 A; 
#chains in the Genus database with same CATH topology
 1RRO A;  1M39 A;  3HX4 A;  3EVU A;  3NHI A;  1KQV A;  3BFB A;  1U5I B;  2KBI A;  3DD4 A;  4C0K A;  5CSF A;  2QEB A;  3OX5 A;  3OBV A;  1S3P A;  3B6X A;  4INW A;  3DZT A;  4DS7 A;  4N1F A;  3S0G A;  4MZJ A;  3NHT A;  2PQL A;  2JXL A;  1F4Q A;  1OOG A;  4YI9 A;  1K8U A;  1RJV A;  1EG4 A;  1CKK A;  4XYN A;  3BOW B;  1F71 A;  3O2P A;  2BBM A;  1YVL A;  5HYD A;  1OMV A;  3VGO A;  4PE4 A;  1ZFS A;  5I2O A;  1L2O C;  2VRG A;  2BAP A;  1KCY A;  2Y5I A;  3SJS A;  2LMV A;  2LVI A;  3EK7 A;  1PSB A;  2QEO A;  4GAO A;  5J3X A;  2L5X B;  3V2L A;  3VB1 A;  1B7T Y;  4PDZ A;  3A8R A;  1KWO C;  2OS8 C;  1Y0V H;  2K8M B;  1KQM B;  5KTY A;  1LIN A;  2LE9 B;  2L0P A;  3L47 A;  3B7A A;  1CDP A;  1FI5 A;  3QME A;  1G8I A;  1UHJ A;  3FE8 A;  2FCE A;  1JFJ A;  1FI6 A;  4YGB B;  2LM5 A;  3OB2 B;  1Y1A A;  1XK4 C;  1XVJ A;  1HT9 A;  5D3O A;  1J7O A;  4DRW A;  3SIA A;  2JT8 A;  1TNP A;  2F2P A;  1CMG A;  3I5G B;  2LP2 A;  1RFJ A;  4IJ7 A;  3PLF B;  4IL1 A;  4PE1 A;  1DEK A;  1DJY A;  4GGF A;  1OMD A;  1UUR A;  2MHH A;  3OP0 A;  4WQ2 A;  2PYQ A;  1REC A;  1C07 A;  1PVB A;  4I5N B;  1DVI A;  1B4C A;  2LLT A;  3D76 A;  1R2U A;  2JQ6 A;  3RM1 A;  2V53 A;  2WCL A;  3EKJ A;  2NZ0 A;  2L2C A;  3CYZ A;  1DGV A;  1HQV A;  1B8C A;  1OZO A;  3FE9 A;  3SG3 A;  3SS5 A;  2K7C A;  4CFR A;  1XO5 A;  2CT9 A;  4OVN F;  3FE6 A;  1KFU L;  1OQP A;  4INX A;  3D73 A;  1YX7 A;  1L2O B;  1PVA A;  1SYM A;  4M2O A;  4BY5 A;  1M31 A;  1QVI Z;  1IJ5 A;  2M3W A;  5I8N A;  1CMF A;  1TOP A;  1LXF C;  4USL A;  1TNX A;  3FWC A;  1YUU A;  4C0J A;  2H8V A;  3BYA A;  5EL2 A;  1QJT A;  2MJW B;  2BNX A;  2LAN A;  1KWO B;  2OS8 B;  1WRK A;  1JUO A;  1KK8 B;  1Z4H A;  4PHM A;  1N65 A;  4M2Q A;  1WY9 A;  3GK4 X;  3CZ1 A;  2EHB A;  1W7I B;  2GTE A;  2R2I A;  4YGD B;  2EGD A;  2JUL A;  3O4Y A;  1A29 A;  1AJ4 A;  3B86 A;  2K2F A;  3VRQ A;  5AER A;  1SKT A;  3KO0 A;  1DJI A;  1IQ3 A;  3AKB A;  1YUS A;  2BCB A;  2P70 A;  5FI2 A;  3WNX B;  3NSK A;  2ZRT A;  1CFC A;  4MZK A;  3I5F C;  1IJ6 A;  3I5H C;  1PAL A;  1C7V A;  3PAT A;  2WC8 A;  2KI6 C;  2GGZ A;  1S5G Y;  3CAB A;  1CM1 A;  2KNE A;  1NWD A;  2JRF A;  4YGE B;  1CM4 A;  2BKH B;  1GM0 A;  4OR9 B;  1VRK A;  4M2P A;  4PAL A;  2L50 A;  1P28 A;  1SL8 A;  1GGW A;  2JNF A;  1YUT A;  1LVC D;  2KFH A;  3DYE A;  5CSI A;  3SIB A;  1B8L A;  1KQM C;  4WQ3 A;  4U8D A;  1Y1X A;  3IVT A;  2JTZ A;  1TWO A;  1NX0 A;  2L98 A;  3CZT X;  3EVR A;  3N7H A;  3FS7 A;  1BG1 A;  2JNX A;  2BEC A;  4NDC A;  1BT6 A;  4CPV A;  2LHI A;  2KBM A;  4MEW A;  2M1K B;  2D8N A;  2HQW A;  2JWW A;  3LK1 A;  4NDB A;  2KAV A;  4L9M A;  3OX6 A;  4F0Z B;  2NXQ A;  1H8B A;  4AQJ A;  1AK8 A;  1MR8 A;  1AP4 A;  2LLU A;  1YR5 A;  1L7Z A;  1PSR A;  1Q80 A;  1UHK A;  5G08 A;  3TZ1 A;  4ETO A;  1IIO A;  3A4U B;  1SR6 C;  3H4S E;  2IS9 A;  2JZI A;  5JJG A;  1QWV A;  3CDN A;  1XFZ O;  1SSE B;  4ZCV A;  1W9Z A;  2LUC A;  4P2Y B;  2BKI B;  1TNQ A;  3S0B A;  1B47 A;  1SMG A;  1TUZ A;  4CLN A;  3PAL A;  2HF5 A;  1NSH A;  5BPJ A;  2LUX A;  5KSZ A;  1IH0 A;  1S6J A;  3HCM A;  2L2E A;  1DJW A;  2ZN9 A;  2PAS A;  2KFG A;  3DVJ A;  4GNK B;  1GQM A;  4OV2 A;  2Q4U A;  1KSO A;  1A4P A;  4PHN A;  5PAL A;  1BOC A;  1UUS A;  2DOQ A;  2QDI A;  3NGV A;  3UNW A;  1H4B A;  4OZD A;  1QV0 A;  1SW8 A;  4PHK A;  5DKR A;  3I5F B;  1OW4 A;  3I5H B;  1CLM A;  3UO9 A;  3CR5 X;  1J7P A;  1BR1 B;  3OGN A;  4GGF C;  2I94 A;  1K9U A;  1AJ5 A;  2F3Z A;  2PVB A;  2LVJ A;  1JF2 A;  1S6I A;  2ZRS A;  1J7R A;  1V1F A;  2CNP A;  2PSR A;  3LL8 B;  2HQ8 A;  1KK8 C;  3PN7 B;  1F70 A;  1Y6W A;  1XFW O;  3BUX B;  2KI6 D;  3AAK A;  4FQO A;  1K9K A;  3BFH A;  4ORC B;  2SCP A;  1WDC B;  3CWG A;  3CR2 A;  4GFT A;  2KYF A;  2AAO A;  2PRU A;  4ICB A;  3KHE A;  2I18 A;  3DF0 A;  3O78 A;  2MBX A;  2SAS A;  2Q91 A;  1OOH A;  2WCJ A;  4I5L B;  3D74 A;  1QIV A;  2H61 A;  3TDI A;  3BUW B;  2LVV A;  5DKN A;  1TTX A;  1XFV O;  1SR6 B;  3R72 A;  2KAY A;  2O5G A;  2QEV A;  4YBH B;  1EJ3 A;  4JKT A;  1QAS A;  1J1D A;  1CFD A;  3SG6 A;  1NCZ A;  1DTL A;  1FW4 A;  1DC1 A;  2ZNE A;  5CSJ A;  1K9P A;  2L4I A;  5HKY A;  4JQ0 D;  1JSA A;  1XA5 A;  3VRN A;  3JVT C;  4QJ4 B;  1XFU O;  1EL4 A;  1TCF A;  3TDU A;  1NX3 A;  1QV1 A;  2K7D A;  2LP3 A;  2O60 A;  2JXC A;  3PM2 A;  1CNP A;  2KQY A;  3LCP C;  3R1O A;  1IWQ A;  1UWO A;  3BFA A;  1OE9 B;  1SPY A;  3R1V A;  1CFF A;  1OZS A;  1PK0 D;  1Y1U A;  1ZAC A;  3LK0 A;  3LLE A;  4XJK A;  2YGU A;  3SG4 A;  2F33 A;  2F2O A;  2KOT A;  2A4J A;  2GGM A;  3CR4 X;  3F45 A;  3O6B A;  4A4C A;  4D1E A;  1Z2C B;  3OB1 B;  3L4L A;  4NDD A;  3IQQ A;  4FTG A;  4QJ3 B;  3ZNI A;  1OOI X;  1DF0 A;  2L51 A;  2WC6 A;  2KYC A;  2CCM A;  2MLE C;  2GV5 A;  2JTT A;  1LKJ A;  3AKA A;  1NP8 A;  4GBA A;  2M49 B;  1ORG A;  1RWY A;  1KFU S;  4FQT A;  5GQQ C;  3TS5 C;  2P6B B;  5AAN A;  3VRR A;  2HPS A;  1KFX L;  2L5Y A;  3SG2 A;  3CZ0 A;  3IQO A;  1EG3 A;  1MF8 B;  1QX5 B;  2CBL A;  1KK7 Y;  2KHN A;  3QRX A;  4OCI A;  5ER4 X;  4C0L A;  1A75 A;  2KSP A;  5B8I B;  1IQ5 A;  2WC5 A;  2QEH A;  3PSR A;  3PFV A;  1MUX A;  1ODB A;  5HL1 A;  4HRG A;  1G4Y R;  1KSM A;  2HET A;  3FIA A;  1S5G Z;  1QVI Y;  3WHU B;  1BR4 B;  3WXA A;  3TUY B;  5IBW A;  2AMI A;  1TIZ A;  1TUJ A;  5CSN A;  1BMO A;  3GK1 A;  5HKW A;  1F55 A;  5FI6 A;  3FWB A;  1XFY O;  1F4O A;  2BL0 C;  2KAX A;  3ICB A;  3K1E A;  1IKU A;  5ER5 A;  3D10 A;  3S0A A;  3EG5 B;  1WLM A;  3EK8 A;  1YTZ C;  4OKH A;  3S0D A;  3JVT B;  3PN7 C;  1BJF A;  2NCP A;  1M63 B;  2FOT A;  4N1G A;  1LA3 A;  2WCE A;  1SCM C;  1K96 A;  1S26 D;  1WDC C;  2WCH A;  3SS4 A;  1GGZ A;  3D0Y A;  1M45 A;  3TDZ A;  3KEV A;  4BY4 A;  3MSE B;  4HRE E;  1FF1 A;  3JTD C;  2KGR A;  4CID A;  2WCB A;  2P71 A;  4AOM A;  1C3Y A;  2LNK A;  4I5J A;  1SL9 A;  4MRY A;  1QX2 A;  3E3R A;  3DY9 A;  4DCK A;  2G2B A;  2EC6 C;  1YVH A;  4E68 A;  1FPW A;  1WRZ A;  1TNW A;  3C1V A;  1U5I A;  1SBJ A;  4CFQ A;  3CLN A;  2BE6 A;  4MBE A;  3SG5 A;  5JOL A;  1C7W A;  3TS5 B;  5D7F A;  1G33 A;  1C3Z A;  2ZND A;  2MA2 A;  4JPZ B;  3D0Y B;  5I2L A;  2LV7 A;  1NPQ A;  1NUB A;  1XYD A;  4JD9 A;  3D78 A;  3BJH A;  2M8U A;  1QS7 A;  4GPL B;  2H61 C;  2M7L A;  3BOW A;  2MRD A;  1QX7 A;  4PT1 A;  3Q8I A;  1S1E A;  1QTX A;  2FJY A;  2M7N A;  3CZ2 A;  2TN4 A;  1FBV A;  4PE0 A;  1F8H A;  2JPO A;  2OPO A;  3GK2 A;  5HLV A;  1B7T Z;  1MQ1 A;  3PJI A;  3CS1 A;  3EVV A;  1XFR A;  4P5O E;  2BL0 B;  2WOS A;  2ISD A;  1A03 A;  1QXP A;  1IRJ A;  1UHH A;  1YUR A;  1QLK A;  2QAC A;  1NCY A;  5TNC A;  1LS8 A;  3VRP A;  1CLL A;  3AAJ A;  1SY9 A;  2K60 A;  2ZKM X;  3NXA A;  2LLS A;  2Y1N A;  1WLZ A;  2QPT A;  1AVS A;  1SCM B;  2PAL A;  1DJZ A;  1PUL A;  1ZMZ A;  2I2R E;  3I5I C;  1ALW A;  4JWQ A;  2COL B;  5D69 A;  1B1G A;  4MZL A;  2WCK A;  2K0J A;  2K7B A;  2KI4 B;  2E30 A;  3JTD B;  3EKH A;  2ZFD A;  4TNC A;  4PHJ A;  4ZCU A;  1DEL A;  4Q04 A;  1JWD A;  1SK6 D;  3NSO A;  1F54 A;  1B9A A;  2FCD A;  5FYX A;  1M46 A;  1CFP A;  5AXI A;  1OOJ A;  4MVF A;  3SS3 A;  3DVM A;  4MSP A;  4AQI A;  2KGB C;  1LA0 A;  3TUY C;  1IG5 A;  3OHM B;  5K89 A;  2EC6 B;  1S6C A;  2JC2 A;  1YRU B;  2JOJ A;  2MAZ A;  1CB1 A;  1XFX O;  1DJX A;  3BQ3 A;  1K2H A;  1NYA A;  2JT0 A;  1SNL A;  3CTN A;  3DVK A;  4YGA A;  4PCW A;  2NCO A;  2LCP A;  1OMR A;  3DF0 B;  5AEQ A;  2LMU A;  1DT7 B;  1GJY A;  1TN4 A;  3BUN B;  1B8R A;  1AHR A;  1CDM A;  1K94 A;  3RLZ A;  1SRA A;  2ERB A;  1UP5 A;  3NSL A;  4NQG A;  1CDL A;  2NLN A;  3GOF A;  1J1E A;  2AUC A;  3K21 A;  1NCX A;  1QLS A;  1AUI B;  2BE4 A;  2KDH A;  4HRH A;  1DJG A;  2Y1M A;  4KYN A;  2KPH A;  2MLF C;  2OTG C;  1K95 A;  2F3Y A;  1IGV A;  2JPT A;  2WCM A;  1EXR A;  2ZN8 A;  4YGC B;  2I7A A;  2RGI A;  3D75 A;  2WND A;  5AFP A;  4QJ5 B;  3RZS A;  3EK4 A;  3BXK A;  3I5I B;  1KK7 Z;  1TCO B;  1TRF A;  1QAT A;  3PM8 A;  5DIC A;  2KLD A;  1DQE A;  1NX1 A;  3KF9 A;  2H2K A;  1XK4 A;  3DXL A;  4R1E A;  2K7O A;  3SG7 A;  5HKZ A;  4ORA B;  3ZWH A;  4WRI A;  4XJK B;  4DUQ A;  1YX8 A;  1V1G A;  2BCX A;  2LAP A;  1EH2 A;  4PE7 A;  1X02 A;  2M1U A;  4MLW A;  1MXE A;  2KQ6 A;  1JBA A;  1OSA A;  2FJU B;  2Y4Q A;  1S36 A;  2K61 A;  1KFX S;  1DF0 B;  1DGU A;  1MXL C;  2CXJ A;  4HSZ A;  3VRO A;  1N2D A;  5I2Q A;  1JF0 A;  1JFK A;  2BBN A;  3BUO B;  1MWN A;  3R1P A;  3B87 A;  5DKQ A;  2E6W A;  1W7J B;  1T14 A;  4F7F A;  1OOF A;  2LC5 A;  3CGA A;  1E8A A;  1R6P A;  1A75 B;  1CDN A;  4UPG A;  2KLE A;  3S0F A;  1RK9 A;  2LMT A;  1N0Y A;  3D77 A;  1ALV A;  4GGN A;  1NIW A;  1BF5 A;  3IF7 A;  4MN0 A;  5HLO A;  3S0E A;  4YI8 A;  2BCA A;  2KI4 C;  5F6T A;  1DMO A;  2LVK A;  4YRU A;  3DVE A;  1QIW A;  3M0W A;  1K90 D;  5I94 A;  2L4H A;  1UHI A;  1NX2 A;  2CTN A;  2K2A A;  2JT3 A;  1RTP 1;  3BUM B;  1CTR A;  4MRX A;  1J55 A;  1ZUZ A;  2OTG B;  3O4X A;  4N5X A;  2KFF A;  2G9B A;  4DIR A;  1WRL A;  1CLB A;  1J7Q A;  3NSI A;  4I5K A;  2JU0 A;  2B1U A;  2LHL A;  2M9G A;  5FI7 A;  2PMY A;  3KPX A;  3WHT B;  2M97 A;  4ORB B;  2WOR A;  5CPV A;  1DJH A;  1K93 D;  1MHO A;  5KU1 A;  1A2X A;  2M29 A;  4A4B A;  1YRT B;  1BOD A;  3B88 A;  1D1O A;  2F8P A;  1JC2 A;  1ZOT B;  1UHN A;  2M0R A;  4GUK A;  1BLQ A;  1SCV A;  3L4A A;  1PRW A;  2WCF A;  1BU3 A;  3I5G C;  1SL7 A; 
#chains in the Genus database with same CATH homology
 1RRO A;  1M39 A;  3HX4 A;  3EVU A;  1KQV A;  1U5I B;  2KBI A;  3DD4 A;  4C0K A;  5CSF A;  3OX5 A;  1S3P A;  4DS7 A;  4N1F A;  4MZJ A;  2JXL A;  1F4Q A;  4YI9 A;  1K8U A;  1RJV A;  1EG4 A;  1CKK A;  4XYN A;  3BOW B;  1F71 A;  3O2P A;  2BBM A;  1YVL A;  5HYD A;  1OMV A;  3VGO A;  4PE4 A;  1ZFS A;  5I2O A;  1L2O C;  2VRG A;  1KCY A;  2Y5I A;  3SJS A;  2LMV A;  2LVI A;  3EK7 A;  1PSB A;  4GAO A;  5J3X A;  2L5X B;  1B7T Y;  4PDZ A;  3A8R A;  1KWO C;  2OS8 C;  1Y0V H;  2K8M B;  1KQM B;  5KTY A;  1LIN A;  2LE9 B;  2L0P A;  1CDP A;  1FI5 A;  1G8I A;  1UHJ A;  2FCE A;  1JFJ A;  1FI6 A;  4YGB B;  2LM5 A;  3OB2 B;  1Y1A A;  1XK4 C;  1XVJ A;  1HT9 A;  1J7O A;  4DRW A;  3SIA A;  2JT8 A;  1TNP A;  2F2P A;  1CMG A;  3I5G B;  2LP2 A;  1RFJ A;  3PLF B;  4IL1 A;  4PE1 A;  1DJY A;  4GGF A;  1OMD A;  1UUR A;  2MHH A;  3OP0 A;  4WQ2 A;  1REC A;  1C07 A;  1PVB A;  4I5N B;  1DVI A;  1B4C A;  2LLT A;  1R2U A;  2JQ6 A;  3RM1 A;  2V53 A;  3EKJ A;  2NZ0 A;  1DGV A;  1HQV A;  1B8C A;  1OZO A;  3SG3 A;  4CFR A;  2K7C A;  1XO5 A;  2CT9 A;  4OVN F;  1KFU L;  1OQP A;  1YX7 A;  1L2O B;  1PVA A;  1SYM A;  4M2O A;  4BY5 A;  1M31 A;  1QVI Z;  1IJ5 A;  2M3W A;  5I8N A;  1CMF A;  1TOP A;  1LXF C;  4USL A;  1TNX A;  3FWC A;  1YUU A;  4C0J A;  3BYA A;  1QJT A;  2MJW B;  2LAN A;  1KWO B;  2OS8 B;  1WRK A;  1JUO A;  1KK8 B;  4PHM A;  1N65 A;  4M2Q A;  1WY9 A;  3GK4 X;  2EHB A;  1W7I B;  2R2I A;  4YGD B;  2EGD A;  2JUL A;  3O4Y A;  1A29 A;  1AJ4 A;  2K2F A;  3VRQ A;  5AER A;  1SKT A;  3KO0 A;  1DJI A;  1IQ3 A;  3AKB A;  1YUS A;  2BCB A;  3WNX B;  3NSK A;  2ZRT A;  1CFC A;  4MZK A;  3I5F C;  1IJ6 A;  3I5H C;  1PAL A;  1C7V A;  3PAT A;  2WC8 A;  2KI6 C;  2GGZ A;  1S5G Y;  1CM1 A;  2KNE A;  1NWD A;  2JRF A;  4YGE B;  1CM4 A;  2BKH B;  4OR9 B;  1VRK A;  4M2P A;  4PAL A;  2L50 A;  1SL8 A;  1GGW A;  2JNF A;  1YUT A;  1LVC D;  2KFH A;  5CSI A;  3SIB A;  1B8L A;  1KQM C;  4WQ3 A;  4U8D A;  1Y1X A;  2JTZ A;  1NX0 A;  2L98 A;  3CZT X;  3EVR A;  3FS7 A;  1BG1 A;  2JNX A;  2BEC A;  4NDC A;  1BT6 A;  4CPV A;  2LHI A;  2KBM A;  4MEW A;  2M1K B;  2D8N A;  2HQW A;  2JWW A;  3LK1 A;  4NDB A;  2KAV A;  4L9M A;  3OX6 A;  2NXQ A;  1H8B A;  4AQJ A;  1AK8 A;  1MR8 A;  1AP4 A;  2LLU A;  1YR5 A;  1L7Z A;  1PSR A;  1Q80 A;  1UHK A;  5G08 A;  3TZ1 A;  4ETO A;  3A4U B;  1SR6 C;  3H4S E;  2IS9 A;  2JZI A;  5JJG A;  1XFZ O;  4ZCV A;  2LUC A;  4P2Y B;  2BKI B;  1TNQ A;  1B47 A;  1SMG A;  4CLN A;  3PAL A;  2HF5 A;  1NSH A;  5BPJ A;  2LUX A;  5KSZ A;  1IH0 A;  1S6J A;  3HCM A;  2L2E A;  1DJW A;  2ZN9 A;  2PAS A;  2KFG A;  3DVJ A;  4GNK B;  1GQM A;  4OV2 A;  2Q4U A;  1KSO A;  1A4P A;  4PHN A;  5PAL A;  1BOC A;  1UUS A;  2DOQ A;  1H4B A;  4PHK A;  1QV0 A;  1SW8 A;  5DKR A;  3I5F B;  3I5H B;  1CLM A;  3CR5 X;  1J7P A;  1BR1 B;  4GGF C;  2I94 A;  1K9U A;  1AJ5 A;  2F3Z A;  2PVB A;  2LVJ A;  1JF2 A;  1S6I A;  2ZRS A;  2CNP A;  1J7R A;  1V1F A;  2PSR A;  3LL8 B;  2HQ8 A;  1KK8 C;  3PN7 B;  1F70 A;  1Y6W A;  1XFW O;  3BUX B;  2KI6 D;  3AAK A;  4FQO A;  1K9K A;  4ORC B;  2SCP A;  1WDC B;  3CWG A;  3CR2 A;  4GFT A;  2KYF A;  2AAO A;  2PRU A;  4ICB A;  3KHE A;  2I18 A;  3DF0 A;  3O78 A;  2MBX A;  2SAS A;  2Q91 A;  4I5L B;  1QIV A;  2H61 A;  3TDI A;  3BUW B;  2LVV A;  5DKN A;  1TTX A;  1XFV O;  1SR6 B;  2KAY A;  2O5G A;  4YBH B;  1EJ3 A;  1QAS A;  1J1D A;  1CFD A;  3SG6 A;  1NCZ A;  1DTL A;  1FW4 A;  2ZNE A;  5CSJ A;  1K9P A;  2L4I A;  5HKY A;  4JQ0 D;  1JSA A;  1XA5 A;  3VRN A;  3JVT C;  4QJ4 B;  1XFU O;  1EL4 A;  1TCF A;  3TDU A;  1NX3 A;  1QV1 A;  2K7D A;  2LP3 A;  2O60 A;  2JXC A;  1CNP A;  2KQY A;  3LCP C;  1IWQ A;  1UWO A;  1OE9 B;  1SPY A;  1CFF A;  1OZS A;  1PK0 D;  1Y1U A;  1ZAC A;  3LK0 A;  3LLE A;  4XJK A;  3SG4 A;  2F33 A;  2F2O A;  2KOT A;  2A4J A;  2GGM A;  3CR4 X;  3F45 A;  3O6B A;  4A4C A;  4D1E A;  3OB1 B;  4NDD A;  3IQQ A;  4FTG A;  4QJ3 B;  3ZNI A;  1DF0 A;  2L51 A;  2KYC A;  2CCM A;  2MLE C;  2GV5 A;  2JTT A;  1LKJ A;  3AKA A;  1NP8 A;  4GBA A;  2M49 B;  1RWY A;  5GQQ C;  1KFU S;  3TS5 C;  3VRR A;  2P6B B;  5AAN A;  2HPS A;  1KFX L;  3SG2 A;  3IQO A;  4F0Z B;  1EG3 A;  1MF8 B;  1QX5 B;  2CBL A;  1KK7 Y;  2KHN A;  3QRX A;  4OCI A;  5ER4 X;  4C0L A;  1A75 A;  2KSP A;  5B8I B;  1IQ5 A;  3PSR A;  3PFV A;  1MUX A;  1ODB A;  4HRG A;  1G4Y R;  1KSM A;  2HET A;  3FIA A;  1S5G Z;  1QVI Y;  3WHU B;  1BR4 B;  3WXA A;  3TUY B;  5IBW A;  2AMI A;  1TIZ A;  5CSN A;  1BMO A;  3GK1 A;  5HKW A;  1F55 A;  3FWB A;  1XFY O;  1F4O A;  2BL0 C;  2KAX A;  3ICB A;  1IKU A;  5ER5 A;  3D10 A;  1WLM A;  3EK8 A;  1YTZ C;  4OKH A;  3JVT B;  3PN7 C;  1BJF A;  2NCP A;  1M63 B;  2FOT A;  4N1G A;  1LA3 A;  2WCE A;  1SCM C;  1K96 A;  1S26 D;  1WDC C;  1GGZ A;  3D0Y A;  1M45 A;  3TDZ A;  3KEV A;  4BY4 A;  3MSE B;  4HRE E;  1FF1 A;  3JTD C;  2KGR A;  4CID A;  2WCB A;  4AOM A;  2LNK A;  4I5J A;  1SL9 A;  4MRY A;  1QX2 A;  3E3R A;  4DCK A;  2G2B A;  2EC6 C;  1YVH A;  4E68 A;  1FPW A;  1WRZ A;  1TNW A;  3C1V A;  1U5I A;  1SBJ A;  4CFQ A;  3CLN A;  2BE6 A;  4MBE A;  3SG5 A;  5JOL A;  1C7W A;  3TS5 B;  5D7F A;  1G33 A;  2ZND A;  2MA2 A;  4JPZ B;  3D0Y B;  5I2L A;  2LV7 A;  1NPQ A;  1NUB A;  1XYD A;  2M8U A;  1QS7 A;  4GPL B;  2H61 C;  2M7L A;  3BOW A;  2MRD A;  1QX7 A;  1S1E A;  1QTX A;  2M7N A;  2TN4 A;  1FBV A;  4PE0 A;  1F8H A;  2OPO A;  3GK2 A;  5HLV A;  1B7T Z;  1MQ1 A;  3CS1 A;  3EVV A;  4P5O E;  2BL0 B;  2WOS A;  2ISD A;  1A03 A;  1QXP A;  1IRJ A;  1UHH A;  1YUR A;  1QLK A;  2QAC A;  1NCY A;  5TNC A;  3VRP A;  1CLL A;  3AAJ A;  1SY9 A;  2ZKM X;  3NXA A;  2LLS A;  2Y1N A;  1WLZ A;  2QPT A;  1AVS A;  1SCM B;  2PAL A;  1DJZ A;  1PUL A;  1ZMZ A;  2I2R E;  3I5I C;  1ALW A;  4JWQ A;  2COL B;  5D69 A;  1B1G A;  4MZL A;  2K0J A;  2K7B A;  2KI4 B;  2E30 A;  3JTD B;  3EKH A;  2ZFD A;  4TNC A;  4PHJ A;  4ZCU A;  4Q04 A;  1JWD A;  1SK6 D;  3NSO A;  1F54 A;  1B9A A;  2FCD A;  5FYX A;  1M46 A;  1CFP A;  5AXI A;  1OOJ A;  4MVF A;  3DVM A;  4MSP A;  4AQI A;  2KGB C;  1LA0 A;  3TUY C;  1IG5 A;  3OHM B;  5K89 A;  2EC6 B;  1S6C A;  2JC2 A;  1YRU B;  2JOJ A;  2MAZ A;  1CB1 A;  1XFX O;  1DJX A;  3BQ3 A;  1K2H A;  1NYA A;  2JT0 A;  1SNL A;  3CTN A;  3DVK A;  4YGA A;  4PCW A;  2NCO A;  2LCP A;  1OMR A;  3DF0 B;  5AEQ A;  2LMU A;  1DT7 B;  1GJY A;  1TN4 A;  3BUN B;  1B8R A;  1AHR A;  1CDM A;  1K94 A;  3RLZ A;  1SRA A;  1UP5 A;  3NSL A;  4NQG A;  1CDL A;  2NLN A;  3GOF A;  1J1E A;  2AUC A;  3K21 A;  1NCX A;  1QLS A;  1AUI B;  2BE4 A;  2KDH A;  4HRH A;  1DJG A;  2Y1M A;  2MLF C;  2OTG C;  1K95 A;  2F3Y A;  1IGV A;  2JPT A;  4YGC B;  1EXR A;  2ZN8 A;  2I7A A;  2RGI A;  2WND A;  5AFP A;  4QJ5 B;  3EK4 A;  3BXK A;  3I5I B;  1KK7 Z;  1TCO B;  1TRF A;  1QAT A;  3PM8 A;  1NX1 A;  3KF9 A;  2H2K A;  1XK4 A;  4R1E A;  2K7O A;  3SG7 A;  5HKZ A;  4ORA B;  3ZWH A;  4WRI A;  4XJK B;  4DUQ A;  1YX8 A;  1V1G A;  2BCX A;  2LAP A;  1EH2 A;  4PE7 A;  1X02 A;  2M1U A;  4MLW A;  1MXE A;  2KQ6 A;  1JBA A;  1OSA A;  2FJU B;  2Y4Q A;  1S36 A;  2K61 A;  1KFX S;  1DF0 B;  1DGU A;  1MXL C;  2CXJ A;  4HSZ A;  3VRO A;  1N2D A;  5I2Q A;  1JF0 A;  1JFK A;  2BBN A;  3BUO B;  1MWN A;  5DKQ A;  2E6W A;  1W7J B;  2LC5 A;  3CGA A;  1E8A A;  1R6P A;  1A75 B;  1CDN A;  4UPG A;  1RK9 A;  2LMT A;  1N0Y A;  1ALV A;  4GGN A;  1NIW A;  1BF5 A;  3IF7 A;  4MN0 A;  5HLO A;  4YI8 A;  2BCA A;  2KI4 C;  5F6T A;  1DMO A;  2LVK A;  4YRU A;  3DVE A;  1QIW A;  3M0W A;  1K90 D;  2L4H A;  1UHI A;  1NX2 A;  2CTN A;  2K2A A;  2JT3 A;  1RTP 1;  3BUM B;  1CTR A;  4MRX A;  1J55 A;  1ZUZ A;  2OTG B;  4N5X A;  2KFF A;  2G9B A;  4DIR A;  1WRL A;  1CLB A;  1J7Q A;  3NSI A;  4I5K A;  2JU0 A;  2B1U A;  2LHL A;  2M9G A;  2PMY A;  3KPX A;  3WHT B;  2M97 A;  4ORB B;  2WOR A;  5CPV A;  1DJH A;  1K93 D;  1MHO A;  5KU1 A;  1A2X A;  2M29 A;  4A4B A;  1YRT B;  1BOD A;  1D1O A;  2F8P A;  1JC2 A;  1ZOT B;  1UHN A;  2M0R A;  4GUK A;  1BLQ A;  1SCV A;  1PRW A;  2WCF A;  1BU3 A;  3I5G C;  1SL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...