3PM8A

Cad domain of pff0520w, calcium dependent protein kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
165
Chain Sequence
b'QGHVELSSTLLKNLKNFKKENELKKIALTIIAKHLCDVEINNLRNIFIALDVDNSGTLSSQEILDGLKKIGPPDIHQVLRDQIHYTDFLAATIDKQTYLKKEVCLIPFKFFDIDGNGKISVEELKRIFGENPLIDKAIDSLLQEVDLNGDGEIDFHEFMLMMSKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-dependent protein kinase 2
publication title CAD domain of PFF0520w, Calcium dependent protein kinase
rcsb
source organism Plasmodium falciparum k1
molecule tags Transferase
total genus 57
structure length 165
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pm8A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3pm8A01
1CLMA 2L4IA 2NCPA 1H8BA 1SY9A 2JULA 4ZCVA 4QJ3B 4OCIA 2E30A 1F4OA 3C1VA 4N5XA 1KK8B 1B8LA 4OR9B 3JVTC 2NCOA 4P5OE 1JUOA 1ZOTB 2MRDA 2SASA 1XA5A 1KSOA 4GBAA 1J7QA 2K61A 1Y6WA 4HRHA 1S6CA 2MA2A 1QX2A 1UUSA 2BE6A 5AXIA 3I5GC 1S3PA 2K7DA 2JT8A 1OMDA 4YGBB 2FOTA 2G9BA 4PHNA 5BPJA 2LP3A 1H4BA 1IG5A 1PSBA 1SW8A 1TTXA 4YRUA 1KFUS 1IQ3A 1NSHA 3PM8A 1FW4A 1BG1A 1GJYA 1TRFA 1UP5A 1X02A 3EVVA 4PE0A 1TN4A 2D8NA 5DKRA 4BY4A 1QATA 2JTTA 2JOJA 1MQ1A 2BKIB 2M97A 1DF0A 1CLLA 1LVCD 1SRAA 1UHKA 2JU0A 3VRRA 1G4YR 4HSZA 1GGZA 3DVEA 2HPSA 1AJ4A 2Y1NA 3BQ3A 3M0WA 3WHUB 2JXCA 1F54A 3OP0A 1J1EA 2P6BB 3E3RA 1LA0A 1DGUA 2KI6D 5HKZA 5HKWA 1XYDA 2LP2A 2RGIA 3SJSA 1M31A 3KHEA 2ZRTA 2BCXA 3IQQA 2CTNA 1C07A 4YGDB 1AHRA 3LLEA 4MVFA 1SL7A 1N65A 1IGVA 1YRUB 1B8RA 2BL0C 1G8IA 1QLSA 4DRWA 4PALA 4E68A 3NSOA 2KBMA 2KOTA 1LKJA 2JQ6A 3OX5A 2H2KA 5I2LA 1R6PA 2LM5A 2KYCA 4XJKA 5J3XA 1NX2A 4HRGA 1RTP1 3CZTX 3EKJA 5DKNA 2KQ6A 1NCXA 5FYXA 2EHBA 3CWGA 2L98A 5CPVA 3FS7A 1QV0A 1SL8A 3GK4X 1Q80A 3A8RA 4DIRA 1K9PA 1ZMZA 1S6JA 1SL9A 3DVMA 1DT7B 2HQ8A 4GUKA 4PE7A 2M9GA 1TNPA 4M2PA 1RECA 2LV7A 4ORAB 1S36A 2JT0A 1NX3A 4C0JA 2I7AA 1YURA 3I5HC 2ZRSA 2A4JA 4A4CA 3GK2A 2LUXA 1B1GA 1NIWA 1UHIA 3CLNA 1GGWA 1TNQA 5CSJA 1QLKA 1YVHA 1M39A 1TCFA 1WRKA 1UWOA 1YX7A 3JTDB 3FIAA 1OZOA 1S26D 2K7BA 2M1KB 3FWCA 2LAPA 5F6TA 1LXFC 1J1DA 4YGAA 1BR4B 3SIAA 1EL4A 4YGEB 3D10A 3I5FB 3VRPA 5AANA 2R2IA 2K7CA 1D1OA 4DS7A 1AJ5A 1YUUA 2V53A 1G33A 1KK7Y 2EC6C 3O6BA 2BECA 1S5GY 3EVUA 1YUSA 2AMIA 2HETA 3CS1A 2MAZA 2JT3A 3BUMB 1KWOC 4YGCB 2JPTA 4HREE 2F8PA 1ODBA 1FBVA 1RWYA 1AP4A 2NZ0A 1UHHA 1S6IA 3I5GB 1M46A 2PASA 2M8UA 3ICBA 1ZACA 3BUWB 2OPOA 3PSRA 4YI8A 2K2FA 1XFUO 4MLWA 1BJFA 5CSNA 3BUNB 1KK7Z 1S5GZ 1L2OB 1XFVO 1HT9A 2LLSA 1MR8A 2F3YA 4PHJA 1XFWO 3CGAA 1A29A 1KFXL 3BUXB 1KQVA 1K94A 3DVJA 1HQVA 1EXRA 4GGNA 2CCMA 1WRZA 1BMOA 1JFKA 1CDMA 4WRIA 1VRKA 2PSRA 2HQWA 1TIZA 3BUOB 1DTLA 1PRWA 2LLTA 2M7NA 1CDNA 4ORCB 3HCMA 2TN4A 3LK1A 4M2QA 5D7FA 1WDCC 1B7TY 4YI9A 4AQIA 1CFFA 1CB1A 1K9UA 1BR1B 2I2RE 3SG4A 3PN7C 2JXLA 4PHMA 3ZWHA 2BL0B 1K90D 4PDZA 1F4QA 5K89A 1SNLA 4AOMA 3VRQA 1F71A 4CPVA 1NWDA 2AUCA 2G2BA 1QXPA 3SG3A 3A4UB 4P2YB 4JWQA 2L0PA 1DJXA 2OTGC 4CLNA 1EH2A 1CFDA 1PSRA 1MXEA 4TNCA 1B7TZ 2CT9A 5PALA 2KDHA 1RJVA 2KI4C 2JWWA 1TCOB 2KQYA 1JFJA 1F55A 2NLNA 1GQMA 1TOPA 1SMGA 3NSLA 4MZLA 4BY5A 1ZUZA 1IJ6A 3SIBA 2F33A 3NSIA 1Y1UA 3PATA 3BOWA 2ZN8A 2OS8C 1QV1A 1KK8C 1SR6C 1NX1A 2K8MB 2KSPA 1N0YA 5ER4X 4PE1A 2Q4UA 2M29A 2IS9A 5KSZA 3WHTB 1K2HA 3I5HB 2KFGA 1EG3A 2JC2A 2GGMA 3SG7A 2KHNA 2LMVA 1BF5A 1QJTA 2Y1MA 4JPZB 4C0LA 2MJWB 1A75A 1V1FA 2KYFA 1QTXA 2BKHB 1DJWA 1XFZO 3TDIA 3O2PA 2K7OA 1UHJA 2LE9B 2JNFA 4MRYA 2ZNDA 5JOLA 1CNPA 1PK0D 1NPQA 2BE4A 5IBWA 4I5KA 3I5IC 3WNXB 1SCVA 1CMGA 1J7PA 4XYNA 3KPXA 3DF0B 1SK6D 1YR5A 3CR4X 1OQPA 4F0ZB 2MBXA 2Y5IA 1Y0VH 4AQJA 1WY9A 2M0RA 3RLZA 2H61C 1KFXS 1SBJA 3EVRA 5CSIA 5GQQC 1NP8A 2L50A 2L4HA 1SCMC 4PCWA 1XVJA 2CXJA 3TDZA 1YX8A 4PE4A 1WLZA 3DD4A 1KWOB 1WLMA 1JSAA 2QACA 1QX7A 1R2UA 2ZN9A 3AAKA 3LK0A 1K9KA 5AERA 5AFPA 4Q04A 4JQ0D 4GFTA 2BCBA 1MHOA 1B8CA 1XK4C 4MEWA 4GGFA 1RROA 4MZJA 3VRNA 1SYMA 2MHHA 4L9MA 1PULA 5HLOA 1NX0A 2LMUA 1DJGA 2O60A 1OZSA 5ER5A 3EK8A 4WQ2A 2SCPA 1UHNA 1CKKA 2LVVA 1XO5A 3JVTB 1NCZA 1DF0B 2L2EA 2WC8A 4FTGA 1MWNA 2Y4QA 2WCEA 3EKHA 1WRLA 1CM1A 1DVIA 4CFQA 1MUXA 4OV2A 1F8HA 1BT6A 2JTZA 2FCDA 1A03A 4PHKA 3NSKA 1K93D 1DJIA 2PMYA 1M45A 4QJ5B 4GPLB 5I8NA 1B47A 1A4PA 3F45A 3H4SE 1WDCB 1FI6A 2KAVA 2ZNEA 1SPYA 1JF0A 3TDUA 4N1GA 1XFXO 2LHIA 3OB1B 1ALWA 1J7RA 3PN7B 2LVJA 1A2XA 1BU3A 3O4YA 1RFJA 4OKHA 1XFYO 4ORBB 1BODA 1QVIY 1C7VA 2AAOA 3IF7A 4XJKB 1OMVA 2OTGB 1RK9A 3BYAA 1K95A 2PVBA 1QIWA 3SG2A 4USLA 2KAXA 2KGBC 3QRXA 1ALVA 2KI4B 2HF5A 2E6WA 3DF0A 1IRJA 1K8UA 1IJ5A 3RM1A 1LA3A 1DJZA 4C0KA 5I2QA 1NYAA 2M7LA 3I5FC 2OS8B 1SR6B 3D0YB 1DJHA 4FQOA 3MSEB 4NDCA 2M1UA 2M49B 1QVIZ 3TS5C 2KI6C 1J7OA 3TUYC 4I5LB 3BXKA 4NQGA 1FPWA 3EK7A 2JNXA 1KQMC 1CDLA 3CTNA 5HYDA 1DJYA 4CIDA 3KEVA 1CMFA 2LC5A 1BOCA 4NDBA 1ZFSA 4I5NB 1YVLA 1K96A 1YUTA 1CFCA 3I5IB 1IQ5A 5AEQA 3KO0A 1AUIB 1QS7A 2GV5A 1L2OC 4GAOA 1S1EA 1QASA 1JWDA 1OOJA 1KSMA 3CR5X 4I5JA 4MSPA 4MRXA 2WCFA 1QIVA 3SG5A 3TZ1A 1LINA 2DOQA 2FJUB 2COLB 3FWBA 3GK1A 3OHMB 4IL1A 1MXLC 3VROA 4A4BA 1SCMB 4ETOA 1PALA 1DMOA 2WNDA 3WXAA 2KNEA 4DCKA 2BBMA 3DVKA 1F70A 2CNPA 1UURA 2F2OA 1IKUA 3LCPC 5KU1A 4MBEA 2ISDA 2FCEA 2LCPA 1EG4A 2CBLA 4GGFC 3LL8B 4YBHB 2NXQA 2LVKA 1FI5A 2M3WA 1U5IB 2KAYA 5D69A 5JJGA 2VRGA 2ZFDA 1JC2A 1AVSA 3GOFA 1W7IB 2QPTA 1M63B 5B8IB 4OVNF 4MZKA 1CDPA 2KFFA 4NDDA 2EC6B 4DUQA 3AAJA 1IH0A 1Y1XA 1OSAA 1B9AA 1PVAA 2F2PA 1JF2A 2B1UA 3HX4A 2LVIA 2EGDA 3NXAA 5I2OA 1DGVA 1N2DA 5G08A 2KGRA 2WORA 2JRFA 2LMTA 1E8AA 1W7JB 1FF1A 1IWQA 2WCBA 3D0YA 2BBNA 1QX5B 2LNKA 3PALA 3VGOA 2PALA 3SG6A 1CTRA 4CFRA 1KFUL 3IQOA 4N1FA 2O5GA 3AKAA 3O78A 2K0JA 4U8DA 1JBAA 1BLQA 2KBIA 4UPGA 3OB2B 1NCYA 1SKTA 4ICBA 2KFHA 1B4CA 2GGZA 3OX6A 5HLVA 3PLFB 1V1GA 4QJ4B 1CFPA 4R1EA 1Y1AA 2F3ZA 1OMRA 4M2OA 4WQ3A 1YRTB 2MLEC 2I18A 5KTYA 1OE9B 1C7WA 3CR2A 4MN0A 5CSFA 2LANA 1J55A 1L7ZA 2H61A 3BOWB 5HKYA 1KCYA 4GNKB 2L5XB 2LUCA 2I94A 3K21A 3TS5B 1PVBA 1CM4A 2LLUA 5TNCA 1AK8A 2ZKMX 2MLFC 1TNWA 2WOSA 3TUYB 1YTZC 1CLBA 3PFVA 2JZIA 2L51A 1KQMB 2LHLA 4ZCUA 4D1EA 2K2AA 2BCAA 3AKBA 1A75B 3JTDC 1XK4A 1EJ3A 3EK4A 1NUBA 1TNXA 3ZNIA 2Q91A 1MF8B 1U5IA 2PRUA 5DKQA 3KF9A
chains in the Genus database with same CATH superfamily
1CLMA 2L4IA 2NCPA 1H8BA 1SY9A 2JULA 4ZCVA 4QJ3B 4OCIA 2E30A 1F4OA 3C1VA 4N5XA 1KK8B 1B8LA 4OR9B 3D77A 3JVTC 2NCOA 3NHTA 4P5OE 1JUOA 3CZ2A 1ZOTB 2MRDA 2SASA 1XA5A 1KSOA 3D78A 4GBAA 2K61A 5EL2A 1J7QA 1Y6WA 4HRHA 1S6CA 2MA2A 1QX2A 1UUSA 2BE6A 1OW4A 3I5GC 1S3PA 5AXIA 2K7DA 2JT8A 1OMDA 4YGBB 2FOTA 2G9BA 4PHNA 5BPJA 2LP3A 1H4BA 1IG5A 1PSBA 2QEHA 1LS8A 1SW8A 1TTXA 4YRUA 1KFUS 1IQ3A 1NSHA 3PM8A 1TWOA 1FW4A 1BG1A 3O4XA 1GJYA 1TRFA 1UP5A 1X02A 3EVVA 4PE0A 1TN4A 2D8NA 5DKRA 2WC5A 3BFHA 4BY4A 1QATA 2JTTA 2JOJA 1MQ1A 2BKIB 2M97A 1DF0A 1CLLA 1LVCD 1SRAA 1UHKA 2JU0A 3VRRA 1F54A 3BFBA 1G4YR 4HSZA 1GGZA 3DVEA 2HPSA 1AJ4A 2QDIA 2Y1NA 3BQ3A 3M0WA 2JXCA 3WHUB 3OP0A 1J1EA 2P6BB 3E3RA 1LA0A 1DGUA 1TUZA 2KI6D 3NGVA 5HKZA 5HKWA 1XYDA 2LP2A 2RGIA 3SJSA 1M31A 3KHEA 2ZRTA 2BCXA 3IQQA 3SS5A 4FQTA 2CTNA 1C07A 4YGDB 1AHRA 3D73A 3LLEA 4MVFA 1SL7A 1N65A 1IGVA 1YRUB 1B8RA 2BL0C 1G8IA 2YGUA 1Z4HA 1QLSA 4DRWA 1W9ZA 4PALA 4E68A 3NSOA 1DQEA 2KBMA 2KOTA 1LKJA 2JQ6A 3OX5A 2H2KA 5I2LA 1R6PA 2LM5A 2KYCA 4XJKA 5J3XA 1NX2A 4HRGA 1RTP1 3CZTX 3EKJA 5DKNA 2KQ6A 1NCXA 5FYXA 2EHBA 3CWGA 2L98A 2QEBA 5CPVA 3V2LA 3FS7A 1QV0A 1SL8A 3GK4X 1Q80A 3A8RA 4DIRA 1K9PA 1DC1A 2P71A 3D74A 1ZMZA 1S6JA 1SL9A 3DVMA 3FE8A 1CNPA 1DT7B 2HQ8A 3R72A 1OOGA 4GUKA 4PE7A 2M9GA 1TNPA 4M2PA 1RECA 2LV7A 4ORAB 1S36A 2JT0A 1NX3A 4C0JA 2I7AA 1YURA 3I5HC 2ZRSA 2A4JA 4A4CA 3GK2A 2LUXA 1B1GA 1NIWA 1UHIA 1Z2CB 3CLNA 1GGWA 1TNQA 5CSJA 1QLKA 1YVHA 1M39A 1TCFA 1WRKA 1UWOA 1YX7A 3JTDB 3FIAA 1IIOA 1OZOA 1S26D 2K7BA 2M1KB 3FWCA 2LAPA 5F6TA 3S0AA 1LXFC 1J1DA 4YGAA 1BR4B 3SIAA 1EL4A 2WCMA 4YGEB 3D10A 3I5FB 3VRPA 5AANA 2R2IA 2K7CA 1D1OA 3S0DA 4DS7A 1AJ5A 1YUUA 2V53A 1G33A 1KK7Y 2EC6C 3O6BA 2BECA 3OGNA 1S5GY 3EVUA 1YUSA 2AMIA 2HETA 2FJYA 3CS1A 2MAZA 2JT3A 3BUMB 1KWOC 4YGCB 2JPTA 4HREE 2F8PA 1ODBA 1FBVA 1RWYA 1AP4A 2NZ0A 1UHHA 1SSEB 1S6IA 3I5GB 1M46A 2PASA 3IVTA 2M8UA 3ICBA 1ZACA 3BUWB 2OPOA 3PSRA 4YI8A 2K2FA 1XFUO 4MLWA 1BJFA 3R1PA 5CSNA 1C3YA 3BUNB 1KK7Z 3N7HA 1S5GZ 1L2OB 1XFVO 1HT9A 2PQLA 2LLSA 1MR8A 2F3YA 1DEKA 4PHJA 1XFWO 4IJ7A 3CGAA 1A29A 1KFXL 3BUXB 3CYZA 4INXA 1KQVA 1K94A 3DVJA 1HQVA 1EXRA 4GGNA 2CCMA 1WRZA 1BMOA 1JFKA 1CDMA 4WRIA 1VRKA 2PSRA 2HQWA 1TIZA 3BUOB 1DTLA 1PRWA 2LLTA 2M7NA 1CDNA 4ORCB 3HCMA 2TN4A 3LK1A 4M2QA 5D7FA 3BJHA 1WDCC 1B7TY 4YI9A 4AQIA 1CFFA 1CB1A 1K9UA 1BR1B 2I2RE 3SG4A 3PN7C 2JXLA 4PHMA 3ZWHA 2BL0B 1K90D 4PDZA 1F4QA 5K89A 1SNLA 4AOMA 3R1VA 3VRQA 1F71A 1ORGA 4CPVA 1NWDA 2AUCA 2G2BA 3D75A 1QXPA 4JKTA 3A4UB 3SG3A 4P2YB 4JWQA 2L0PA 1DJXA 2OTGC 4CLNA 1EH2A 1CFDA 1PSRA 5FI2A 1MXEA 3DZTA 4TNCA 1B7TZ 2CT9A 2KLDA 3B86A 5PALA 2KDHA 3S0GA 1RJVA 2KI4C 2JWWA 1TCOB 2KQYA 1JFJA 3D76A 1F55A 2NLNA 3L4AA 1GQMA 1TOPA 1SMGA 3NSLA 4MZLA 4BY5A 1ZUZA 1IJ6A 3SIBA 2F33A 3B87A 1Y1UA 2GTEA 3NSIA 3PATA 3BOWA 2ZN8A 2OS8C 1QV1A 1KK8C 1SR6C 1NX1A 2K8MB 2KSPA 1N0YA 2WCHA 4PE1A 5ER4X 2Q4UA 2M29A 2IS9A 5KSZA 3WHTB 1K2HA 3I5HB 2KFGA 1EG3A 3DXLA 2JC2A 2GGMA 3SG7A 2KHNA 2LMVA 1BF5A 1QJTA 2Y1MA 2WCJA 4JPZB 4C0LA 2MJWB 1A75A 1V1FA 2KYFA 1QTXA 2BKHB 1DJWA 1XFZO 3TDIA 3O2PA 2K7OA 1UHJA 2LE9B 3DY9A 2JNFA 3PM2A 2ZNDA 4MRYA 5JOLA 1OOFA 1NPQA 1PK0D 2BE4A 2P70A 3I5IC 3PJIA 1SCVA 4I5KA 3WNXB 5IBWA 1CMGA 1J7PA 1OOHA 4XYNA 3KPXA 1TUJA 3DF0B 1SK6D 1YR5A 3CR4X 1OQPA 4F0ZB 2MBXA 2Y5IA 1Y0VH 4AQJA 3K1EA 1WY9A 2M0RA 3RLZA 2H61C 1KFXS 1SBJA 3EVRA 5CSIA 5GQQC 1NP8A 3S0BA 2L50A 4OZDA 2L4HA 1SCMC 4PCWA 1XVJA 2CXJA 3VB1A 3TDZA 1YX8A 4PE4A 1WLZA 3DD4A 1KWOB 1WLMA 1JSAA 2QACA 1QX7A 1R2UA 2ZN9A 3AAKA 2KLEA 3LK0A 1K9KA 5AERA 5AFPA 2QEVA 4Q04A 4JQ0D 4GFTA 2BCBA 1MHOA 1B8CA 1XK4C 4MEWA 4GGFA 1RROA 3FE6A 4MZJA 3VRNA 1SYMA 2MHHA 4L9MA 1PULA 2KPHA 5HLOA 3FE9A 1NX0A 2LMUA 1DJGA 2O60A 1OZSA 5ER5A 3EK8A 3RZSA 1QWVA 2L2CA 2WCLA 3Q8IA 4WQ2A 2SCPA 1UHNA 1CKKA 2LVVA 1XO5A 3JVTB 1NCZA 1DF0B 2L2EA 2WC8A 4FTGA 1MWNA 2Y4QA 2WCEA 3EKHA 1WRLA 1CM1A 1DVIA 3NHIA 1MUXA 4OV2A 4CFQA 1F8HA 1BT6A 2JTZA 2FCDA 1A03A 4PHKA 3NSKA 1K93D 1DJIA 2PMYA 1M45A 4QJ5B 4GPLB 5I8NA 1B47A 1A4PA 3F45A 3H4SE 3DYEA 1WDCB 1FI6A 2KAVA 2ZNEA 1SPYA 1JF0A 3TDUA 3SS4A 2L5YA 4N1GA 1XFXO 2LHIA 3B7AA 1ALWA 1J7RA 3OB1B 2LVJA 3PN7B 4KYNA 1A2XA 1BU3A 3O4YA 1RFJA 4OKHA 1XFYO 4ORBB 1BODA 2WCKA 1QVIY 1C7VA 2H8VA 2AAOA 3QMEA 3IF7A 4XJKB 1OMVA 2OTGB 1RK9A 3BYAA 3OBVA 1K95A 2PVBA 1P28A 1QIWA 3SG2A 3L47A 4USLA 2KAXA 2KGBC 3QRXA 1ALVA 2KI4B 2HF5A 2E6WA 3DF0A 1IRJA 1K8UA 1IJ5A 3RM1A 1LA3A 3S0EA 1DJZA 4C0KA 5I2QA 1GM0A 1NYAA 2M7LA 3I5FC 2OS8B 1SR6B 3D0YB 1DJHA 4FQOA 3MSEB 4NDCA 2M1UA 2M49B 1QVIZ 3TS5C 2KI6C 1J7OA 3TUYC 4I5LB 3BXKA 4NQGA 4F7FA 3S0FA 1FPWA 3EK7A 2JNXA 1KQMC 1CDLA 3CTNA 5HYDA 3B88A 1DJYA 4CIDA 3KEVA 1CMFA 1T14A 2LC5A 1BOCA 4NDBA 1ZFSA 4I5NB 1YVLA 1K96A 5FI6A 5FI7A 1YUTA 1CFCA 3CZ0A 3I5IB 1IQ5A 5AEQA 3KO0A 1AUIB 5D3OA 1QS7A 2GV5A 1L2OC 4GAOA 1S1EA 3UNWA 1QASA 1JWDA 1OOJA 3CABA 1KSMA 3CR5X 4I5JA 4MSPA 4MRXA 2K60A 2WCFA 1QIVA 3SG5A 3TZ1A 1LINA 2DOQA 2FJUB 2COLB 3FWBA 3GK1A 3OHMB 4IL1A 1MXLC 3VROA 4A4BA 1SCMB 4ETOA 1PALA 1DMOA 2WNDA 3WXAA 2KNEA 4DCKA 2BBMA 3DVKA 2BNXA 1F70A 2CNPA 1UURA 2F2OA 3R1OA 1IKUA 3LCPC 5KU1A 4MBEA 2ISDA 2FCEA 2LCPA 1EG4A 2CBLA 2WC6A 4GGFC 3LL8B 4YBHB 2NXQA 2LVKA 1FI5A 2M3WA 1U5IB 2KAYA 5D69A 5JJGA 2VRGA 2ZFDA 1JC2A 1AVSA 5DICA 3GOFA 1W7IB 2QPTA 1M63B 5B8IB 4OVNF 4PT1A 4MZKA 1CDPA 2KFFA 3BFAA 4NDDA 2EC6B 4DUQA 2BAPA 2ERBA 3AAJA 1IH0A 1Y1XA 1OSAA 1B9AA 1PVAA 2F2PA 1JF2A 2B1UA 3HX4A 2LVIA 2EGDA 3NXAA 5I2OA 1DGVA 1N2DA 5G08A 2KGRA 1XFRA 4JD9A 2WORA 2JRFA 2LMTA 1E8AA 1W7JB 2JPOA 3SS3A 1FF1A 1IWQA 2WCBA 3D0YA 2BBNA 1QX5B 2LNKA 3PALA 3VGOA 3L4LA 2PALA 3SG6A 1CTRA 4CFRA 1KFUL 3IQOA 4N1FA 2O5GA 3AKAA 3O78A 2K0JA 3B6XA 4U8DA 1JBAA 1BLQA 2PYQA 2KBIA 4UPGA 3OB2B 1NCYA 1SKTA 4ICBA 2KFHA 1B4CA 2GGZA 3OX6A 5HLVA 3PLFB 1V1GA 4QJ4B 1CFPA 1DELA 4R1EA 3CDNA 1Y1AA 2F3ZA 5HL1A 1OMRA 4M2OA 4WQ3A 1YRTB 2MLEC 2I18A 5KTYA 1OE9B 1C7WA 3CR2A 4MN0A 5CSFA 2LANA 1J55A 1L7ZA 2QEOA 3CZ1A 2H61A 3BOWB 5HKYA 3EG5B 1KCYA 4GNKB 2L5XB 2LUCA 2I94A 3K21A 3TS5B 3UO9A 1C3ZA 1PVBA 1CM4A 2LLUA 5TNCA 1AK8A 2ZKMX 2MLFC 1TNWA 2WOSA 3TUYB 5I94A 1YTZC 1CLBA 3PFVA 2JZIA 4INWA 2L51A 1KQMB 2LHLA 4ZCUA 4D1EA 2K2AA 2BCAA 3AKBA 1A75B 3JTDC 1XK4A 1EJ3A 3EK4A 1NUBA 1TNXA 3ZNIA 2Q91A 1MF8B 1U5IA 2PRUA 5DKQA 1OOIX 3KF9A
chains in the Genus database with same CATH topology
1CLMA 2L4IA 2NCPA 1H8BA 1SY9A 2JULA 4ZCVA 4QJ3B 4OCIA 2E30A 1F4OA 3C1VA 4N5XA 1KK8B 1B8LA 4OR9B 3JVTC 2NCOA 4P5OE 1JUOA 1ZOTB 2MRDA 2SASA 1XA5A 1KSOA 4GBAA 1J7QA 2K61A 1Y6WA 4HRHA 1S6CA 2MA2A 1QX2A 1UUSA 2BE6A 5AXIA 3I5GC 1S3PA 2K7DA 2JT8A 1OMDA 4YGBB 2FOTA 2G9BA 4PHNA 5BPJA 2LP3A 1H4BA 1IG5A 1PSBA 1SW8A 1TTXA 4YRUA 1KFUS 1IQ3A 1NSHA 3PM8A 1FW4A 1BG1A 1GJYA 1TRFA 1UP5A 1X02A 3EVVA 4PE0A 1TN4A 2D8NA 5DKRA 4BY4A 1QATA 2JTTA 2JOJA 1MQ1A 2BKIB 2M97A 1DF0A 1CLLA 1LVCD 1SRAA 1UHKA 2JU0A 3VRRA 1G4YR 4HSZA 1GGZA 3DVEA 2HPSA 1AJ4A 2Y1NA 3BQ3A 3M0WA 3WHUB 2JXCA 1F54A 3OP0A 1J1EA 2P6BB 3E3RA 1LA0A 1DGUA 2KI6D 5HKZA 5HKWA 1XYDA 2LP2A 2RGIA 3SJSA 1M31A 3KHEA 2ZRTA 2BCXA 3IQQA 2CTNA 1C07A 4YGDB 1AHRA 3LLEA 4MVFA 1SL7A 1N65A 1IGVA 1YRUB 1B8RA 2BL0C 1G8IA 1QLSA 4DRWA 4PALA 4E68A 3NSOA 2KBMA 2KOTA 1LKJA 2JQ6A 3OX5A 2H2KA 5I2LA 1R6PA 2LM5A 2KYCA 4XJKA 5J3XA 1NX2A 4HRGA 1RTP1 3CZTX 3EKJA 5DKNA 2KQ6A 1NCXA 5FYXA 2EHBA 3CWGA 2L98A 5CPVA 3FS7A 1QV0A 1SL8A 3GK4X 1Q80A 3A8RA 4DIRA 1K9PA 1ZMZA 1S6JA 1SL9A 3DVMA 1DT7B 2HQ8A 4GUKA 4PE7A 2M9GA 1TNPA 4M2PA 1RECA 2LV7A 4ORAB 1S36A 2JT0A 1NX3A 4C0JA 2I7AA 1YURA 3I5HC 2ZRSA 2A4JA 4A4CA 3GK2A 2LUXA 1B1GA 1NIWA 1UHIA 3CLNA 1GGWA 1TNQA 5CSJA 1QLKA 1YVHA 1M39A 1TCFA 1WRKA 1UWOA 1YX7A 3JTDB 3FIAA 1OZOA 1S26D 2K7BA 2M1KB 3FWCA 2LAPA 5F6TA 1LXFC 1J1DA 4YGAA 1BR4B 3SIAA 1EL4A 4YGEB 3D10A 3I5FB 3VRPA 5AANA 2R2IA 2K7CA 1D1OA 4DS7A 1AJ5A 1YUUA 2V53A 1G33A 1KK7Y 2EC6C 3O6BA 2BECA 1S5GY 3EVUA 1YUSA 2AMIA 2HETA 3CS1A 2MAZA 2JT3A 3BUMB 1KWOC 4YGCB 2JPTA 4HREE 2F8PA 1ODBA 1FBVA 1RWYA 1AP4A 2NZ0A 1UHHA 1S6IA 3I5GB 1M46A 2PASA 2M8UA 3ICBA 1ZACA 3BUWB 2OPOA 3PSRA 4YI8A 2K2FA 1XFUO 4MLWA 1BJFA 5CSNA 3BUNB 1KK7Z 1S5GZ 1L2OB 1XFVO 1HT9A 2LLSA 1MR8A 2F3YA 4PHJA 1XFWO 3CGAA 1A29A 1KFXL 3BUXB 1KQVA 1K94A 3DVJA 1HQVA 1EXRA 4GGNA 2CCMA 1WRZA 1BMOA 1JFKA 1CDMA 4WRIA 1VRKA 2PSRA 2HQWA 1TIZA 3BUOB 1DTLA 1PRWA 2LLTA 2M7NA 1CDNA 4ORCB 3HCMA 2TN4A 3LK1A 4M2QA 5D7FA 1WDCC 1B7TY 4YI9A 4AQIA 1CFFA 1CB1A 1K9UA 1BR1B 2I2RE 3SG4A 3PN7C 2JXLA 4PHMA 3ZWHA 2BL0B 1K90D 4PDZA 1F4QA 5K89A 1SNLA 4AOMA 3VRQA 1F71A 4CPVA 1NWDA 2AUCA 2G2BA 1QXPA 3SG3A 3A4UB 4P2YB 4JWQA 2L0PA 1DJXA 2OTGC 4CLNA 1EH2A 1CFDA 1PSRA 1MXEA 4TNCA 1B7TZ 2CT9A 5PALA 2KDHA 1RJVA 2KI4C 2JWWA 1TCOB 2KQYA 1JFJA 1F55A 2NLNA 1GQMA 1TOPA 1SMGA 3NSLA 4MZLA 4BY5A 1ZUZA 1IJ6A 3SIBA 2F33A 3NSIA 1Y1UA 3PATA 3BOWA 2ZN8A 2OS8C 1QV1A 1KK8C 1SR6C 1NX1A 2K8MB 2KSPA 1N0YA 5ER4X 4PE1A 2Q4UA 2M29A 2IS9A 5KSZA 3WHTB 1K2HA 3I5HB 2KFGA 1EG3A 2JC2A 2GGMA 3SG7A 2KHNA 2LMVA 1BF5A 1QJTA 2Y1MA 4JPZB 4C0LA 2MJWB 1A75A 1V1FA 2KYFA 1QTXA 2BKHB 1DJWA 1XFZO 3TDIA 3O2PA 2K7OA 1UHJA 2LE9B 2JNFA 4MRYA 2ZNDA 5JOLA 1CNPA 1PK0D 1NPQA 2BE4A 5IBWA 4I5KA 3I5IC 3WNXB 1SCVA 1CMGA 1J7PA 4XYNA 3KPXA 3DF0B 1SK6D 1YR5A 3CR4X 1OQPA 4F0ZB 2MBXA 2Y5IA 1Y0VH 4AQJA 1WY9A 2M0RA 3RLZA 2H61C 1KFXS 1SBJA 3EVRA 5CSIA 5GQQC 1NP8A 2L50A 2L4HA 1SCMC 4PCWA 1XVJA 2CXJA 3TDZA 1YX8A 4PE4A 1WLZA 3DD4A 1KWOB 1WLMA 1JSAA 2QACA 1QX7A 1R2UA 2ZN9A 3AAKA 3LK0A 1K9KA 5AERA 5AFPA 4Q04A 4JQ0D 4GFTA 2BCBA 1MHOA 1B8CA 1XK4C 4MEWA 4GGFA 1RROA 4MZJA 3VRNA 1SYMA 2MHHA 4L9MA 1PULA 5HLOA 1NX0A 2LMUA 1DJGA 2O60A 1OZSA 5ER5A 3EK8A 4WQ2A 2SCPA 1UHNA 1CKKA 2LVVA 1XO5A 3JVTB 1NCZA 1DF0B 2L2EA 2WC8A 4FTGA 1MWNA 2Y4QA 2WCEA 3EKHA 1WRLA 1CM1A 1DVIA 4CFQA 1MUXA 4OV2A 1F8HA 1BT6A 2JTZA 2FCDA 1A03A 4PHKA 3NSKA 1K93D 1DJIA 2PMYA 1M45A 4QJ5B 4GPLB 5I8NA 1B47A 1A4PA 3F45A 3H4SE 1WDCB 1FI6A 2KAVA 2ZNEA 1SPYA 1JF0A 3TDUA 4N1GA 1XFXO 2LHIA 3OB1B 1ALWA 1J7RA 3PN7B 2LVJA 1A2XA 1BU3A 3O4YA 1RFJA 4OKHA 1XFYO 4ORBB 1BODA 1QVIY 1C7VA 2AAOA 3IF7A 4XJKB 1OMVA 2OTGB 1RK9A 3BYAA 1K95A 2PVBA 1QIWA 3SG2A 4USLA 2KAXA 2KGBC 3QRXA 1ALVA 2KI4B 2HF5A 2E6WA 3DF0A 1IRJA 1K8UA 1IJ5A 3RM1A 1LA3A 1DJZA 4C0KA 5I2QA 1NYAA 2M7LA 3I5FC 2OS8B 1SR6B 3D0YB 1DJHA 4FQOA 3MSEB 4NDCA 2M1UA 2M49B 1QVIZ 3TS5C 2KI6C 1J7OA 3TUYC 4I5LB 3BXKA 4NQGA 1FPWA 3EK7A 2JNXA 1KQMC 1CDLA 3CTNA 5HYDA 1DJYA 4CIDA 3KEVA 1CMFA 2LC5A 1BOCA 4NDBA 1ZFSA 4I5NB 1YVLA 1K96A 1YUTA 1CFCA 3I5IB 1IQ5A 5AEQA 3KO0A 1AUIB 1QS7A 2GV5A 1L2OC 4GAOA 1S1EA 1QASA 1JWDA 1OOJA 1KSMA 3CR5X 4I5JA 4MSPA 4MRXA 2WCFA 1QIVA 3SG5A 3TZ1A 1LINA 2DOQA 2FJUB 2COLB 3FWBA 3GK1A 3OHMB 4IL1A 1MXLC 3VROA 4A4BA 1SCMB 4ETOA 1PALA 1DMOA 2WNDA 3WXAA 2KNEA 4DCKA 2BBMA 3DVKA 1F70A 2CNPA 1UURA 2F2OA 1IKUA 3LCPC 5KU1A 4MBEA 2ISDA 2FCEA 2LCPA 1EG4A 2CBLA 4GGFC 3LL8B 4YBHB 2NXQA 2LVKA 1FI5A 2M3WA 1U5IB 2KAYA 5D69A 5JJGA 2VRGA 2ZFDA 1JC2A 1AVSA 3GOFA 1W7IB 2QPTA 1M63B 5B8IB 4OVNF 4MZKA 1CDPA 2KFFA 4NDDA 2EC6B 4DUQA 3AAJA 1IH0A 1Y1XA 1OSAA 1B9AA 1PVAA 2F2PA 1JF2A 2B1UA 3HX4A 2LVIA 2EGDA 3NXAA 5I2OA 1DGVA 1N2DA 5G08A 2KGRA 2WORA 2JRFA 2LMTA 1E8AA 1W7JB 1FF1A 1IWQA 2WCBA 3D0YA 2BBNA 1QX5B 2LNKA 3PALA 3VGOA 2PALA 3SG6A 1CTRA 4CFRA 1KFUL 3IQOA 4N1FA 2O5GA 3AKAA 3O78A 2K0JA 4U8DA 1JBAA 1BLQA 2KBIA 4UPGA 3OB2B 1NCYA 1SKTA 4ICBA 2KFHA 1B4CA 2GGZA 3OX6A 5HLVA 3PLFB 1V1GA 4QJ4B 1CFPA 4R1EA 1Y1AA 2F3ZA 1OMRA 4M2OA 4WQ3A 1YRTB 2MLEC 2I18A 5KTYA 1OE9B 1C7WA 3CR2A 4MN0A 5CSFA 2LANA 1J55A 1L7ZA 2H61A 3BOWB 5HKYA 1KCYA 4GNKB 2L5XB 2LUCA 2I94A 3K21A 3TS5B 1PVBA 1CM4A 2LLUA 5TNCA 1AK8A 2ZKMX 2MLFC 1TNWA 2WOSA 3TUYB 1YTZC 1CLBA 3PFVA 2JZIA 2L51A 1KQMB 2LHLA 4ZCUA 4D1EA 2K2AA 2BCAA 3AKBA 1A75B 3JTDC 1XK4A 1EJ3A 3EK4A 1NUBA 1TNXA 3ZNIA 2Q91A 1MF8B 1U5IA 2PRUA 5DKQA 3KF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLM A;  2L4I A;  2NCP A;  1H8B A;  1SY9 A;  2JUL A;  4ZCV A;  4QJ3 B;  4OCI A;  2E30 A;  1F4O A;  3C1V A;  4N5X A;  1KK8 B;  1B8L A;  4OR9 B;  3JVT C;  2NCO A;  4P5O E;  1JUO A;  1ZOT B;  2MRD A;  2SAS A;  1XA5 A;  1KSO A;  4GBA A;  1J7Q A;  2K61 A;  1Y6W A;  4HRH A;  1S6C A;  2MA2 A;  1QX2 A;  1UUS A;  2BE6 A;  5AXI A;  3I5G C;  1S3P A;  2K7D A;  2JT8 A;  1OMD A;  4YGB B;  2FOT A;  2G9B A;  4PHN A;  5BPJ A;  2LP3 A;  1H4B A;  1IG5 A;  1PSB A;  1SW8 A;  1TTX A;  4YRU A;  1KFU S;  1IQ3 A;  1NSH A;  3PM8 A;  1FW4 A;  1BG1 A;  1GJY A;  1TRF A;  1UP5 A;  1X02 A;  3EVV A;  4PE0 A;  1TN4 A;  2D8N A;  5DKR A;  4BY4 A;  1QAT A;  2JTT A;  2JOJ A;  1MQ1 A;  2BKI B;  2M97 A;  1DF0 A;  1CLL A;  1LVC D;  1SRA A;  1UHK A;  2JU0 A;  3VRR A;  1G4Y R;  4HSZ A;  1GGZ A;  3DVE A;  2HPS A;  1AJ4 A;  2Y1N A;  3BQ3 A;  3M0W A;  3WHU B;  2JXC A;  1F54 A;  3OP0 A;  1J1E A;  2P6B B;  3E3R A;  1LA0 A;  1DGU A;  2KI6 D;  5HKZ A;  5HKW A;  1XYD A;  2LP2 A;  2RGI A;  3SJS A;  1M31 A;  3KHE A;  2ZRT A;  2BCX A;  3IQQ A;  2CTN A;  1C07 A;  4YGD B;  1AHR A;  3LLE A;  4MVF A;  1SL7 A;  1N65 A;  1IGV A;  1YRU B;  1B8R A;  2BL0 C;  1G8I A;  1QLS A;  4DRW A;  4PAL A;  4E68 A;  3NSO A;  2KBM A;  2KOT A;  1LKJ A;  2JQ6 A;  3OX5 A;  2H2K A;  5I2L A;  1R6P A;  2LM5 A;  2KYC A;  4XJK A;  5J3X A;  1NX2 A;  4HRG A;  1RTP 1;  3CZT X;  3EKJ A;  5DKN A;  2KQ6 A;  1NCX A;  5FYX A;  2EHB A;  3CWG A;  2L98 A;  5CPV A;  3FS7 A;  1QV0 A;  1SL8 A;  3GK4 X;  1Q80 A;  3A8R A;  4DIR A;  1K9P A;  1ZMZ A;  1S6J A;  1SL9 A;  3DVM A;  1DT7 B;  2HQ8 A;  4GUK A;  4PE7 A;  2M9G A;  1TNP A;  4M2P A;  1REC A;  2LV7 A;  4ORA B;  1S36 A;  2JT0 A;  1NX3 A;  4C0J A;  2I7A A;  1YUR A;  3I5H C;  2ZRS A;  2A4J A;  4A4C A;  3GK2 A;  2LUX A;  1B1G A;  1NIW A;  1UHI A;  3CLN A;  1GGW A;  1TNQ A;  5CSJ A;  1QLK A;  1YVH A;  1M39 A;  1TCF A;  1WRK A;  1UWO A;  1YX7 A;  3JTD B;  3FIA A;  1OZO A;  1S26 D;  2K7B A;  2M1K B;  3FWC A;  2LAP A;  5F6T A;  1LXF C;  1J1D A;  4YGA A;  1BR4 B;  3SIA A;  1EL4 A;  4YGE B;  3D10 A;  3I5F B;  3VRP A;  5AAN A;  2R2I A;  2K7C A;  1D1O A;  4DS7 A;  1AJ5 A;  1YUU A;  2V53 A;  1G33 A;  1KK7 Y;  2EC6 C;  3O6B A;  2BEC A;  1S5G Y;  3EVU A;  1YUS A;  2AMI A;  2HET A;  3CS1 A;  2MAZ A;  2JT3 A;  3BUM B;  1KWO C;  4YGC B;  2JPT A;  4HRE E;  2F8P A;  1ODB A;  1FBV A;  1RWY A;  1AP4 A;  2NZ0 A;  1UHH A;  1S6I A;  3I5G B;  1M46 A;  2PAS A;  2M8U A;  3ICB A;  1ZAC A;  3BUW B;  2OPO A;  3PSR A;  4YI8 A;  2K2F A;  1XFU O;  4MLW A;  1BJF A;  5CSN A;  3BUN B;  1KK7 Z;  1S5G Z;  1L2O B;  1XFV O;  1HT9 A;  2LLS A;  1MR8 A;  2F3Y A;  4PHJ A;  1XFW O;  3CGA A;  1A29 A;  1KFX L;  3BUX B;  1KQV A;  1K94 A;  3DVJ A;  1HQV A;  1EXR A;  4GGN A;  2CCM A;  1WRZ A;  1BMO A;  1JFK A;  1CDM A;  4WRI A;  1VRK A;  2PSR A;  2HQW A;  1TIZ A;  3BUO B;  1DTL A;  1PRW A;  2LLT A;  2M7N A;  1CDN A;  4ORC B;  3HCM A;  2TN4 A;  3LK1 A;  4M2Q A;  5D7F A;  1WDC C;  1B7T Y;  4YI9 A;  4AQI A;  1CFF A;  1CB1 A;  1K9U A;  1BR1 B;  2I2R E;  3SG4 A;  3PN7 C;  2JXL A;  4PHM A;  3ZWH A;  2BL0 B;  1K90 D;  4PDZ A;  1F4Q A;  5K89 A;  1SNL A;  4AOM A;  3VRQ A;  1F71 A;  4CPV A;  1NWD A;  2AUC A;  2G2B A;  1QXP A;  3SG3 A;  3A4U B;  4P2Y B;  4JWQ A;  2L0P A;  1DJX A;  2OTG C;  4CLN A;  1EH2 A;  1CFD A;  1PSR A;  1MXE A;  4TNC A;  1B7T Z;  2CT9 A;  5PAL A;  2KDH A;  1RJV A;  2KI4 C;  2JWW A;  1TCO B;  2KQY A;  1JFJ A;  1F55 A;  2NLN A;  1GQM A;  1TOP A;  1SMG A;  3NSL A;  4MZL A;  4BY5 A;  1ZUZ A;  1IJ6 A;  3SIB A;  2F33 A;  3NSI A;  1Y1U A;  3PAT A;  3BOW A;  2ZN8 A;  2OS8 C;  1QV1 A;  1KK8 C;  1SR6 C;  1NX1 A;  2K8M B;  2KSP A;  1N0Y A;  5ER4 X;  4PE1 A;  2Q4U A;  2M29 A;  2IS9 A;  5KSZ A;  3WHT B;  1K2H A;  3I5H B;  2KFG A;  1EG3 A;  2JC2 A;  2GGM A;  3SG7 A;  2KHN A;  2LMV A;  1BF5 A;  1QJT A;  2Y1M A;  4JPZ B;  4C0L A;  2MJW B;  1A75 A;  1V1F A;  2KYF A;  1QTX A;  2BKH B;  1DJW A;  1XFZ O;  3TDI A;  3O2P A;  2K7O A;  1UHJ A;  2LE9 B;  2JNF A;  4MRY A;  2ZND A;  5JOL A;  1CNP A;  1PK0 D;  1NPQ A;  2BE4 A;  5IBW A;  4I5K A;  3I5I C;  3WNX B;  1SCV A;  1CMG A;  1J7P A;  4XYN A;  3KPX A;  3DF0 B;  1SK6 D;  1YR5 A;  3CR4 X;  1OQP A;  4F0Z B;  2MBX A;  2Y5I A;  1Y0V H;  4AQJ A;  1WY9 A;  2M0R A;  3RLZ A;  2H61 C;  1KFX S;  1SBJ A;  3EVR A;  5CSI A;  5GQQ C;  1NP8 A;  2L50 A;  2L4H A;  1SCM C;  4PCW A;  1XVJ A;  2CXJ A;  3TDZ A;  1YX8 A;  4PE4 A;  1WLZ A;  3DD4 A;  1KWO B;  1WLM A;  1JSA A;  2QAC A;  1QX7 A;  1R2U A;  2ZN9 A;  3AAK A;  3LK0 A;  1K9K A;  5AER A;  5AFP A;  4Q04 A;  4JQ0 D;  4GFT A;  2BCB A;  1MHO A;  1B8C A;  1XK4 C;  4MEW A;  4GGF A;  1RRO A;  4MZJ A;  3VRN A;  1SYM A;  2MHH A;  4L9M A;  1PUL A;  5HLO A;  1NX0 A;  2LMU A;  1DJG A;  2O60 A;  1OZS A;  5ER5 A;  3EK8 A;  4WQ2 A;  2SCP A;  1UHN A;  1CKK A;  2LVV A;  1XO5 A;  3JVT B;  1NCZ A;  1DF0 B;  2L2E A;  2WC8 A;  4FTG A;  1MWN A;  2Y4Q A;  2WCE A;  3EKH A;  1WRL A;  1CM1 A;  1DVI A;  4CFQ A;  1MUX A;  4OV2 A;  1F8H A;  1BT6 A;  2JTZ A;  2FCD A;  1A03 A;  4PHK A;  3NSK A;  1K93 D;  1DJI A;  2PMY A;  1M45 A;  4QJ5 B;  4GPL B;  5I8N A;  1B47 A;  1A4P A;  3F45 A;  3H4S E;  1WDC B;  1FI6 A;  2KAV A;  2ZNE A;  1SPY A;  1JF0 A;  3TDU A;  4N1G A;  1XFX O;  2LHI A;  3OB1 B;  1ALW A;  1J7R A;  3PN7 B;  2LVJ A;  1A2X A;  1BU3 A;  3O4Y A;  1RFJ A;  4OKH A;  1XFY O;  4ORB B;  1BOD A;  1QVI Y;  1C7V A;  2AAO A;  3IF7 A;  4XJK B;  1OMV A;  2OTG B;  1RK9 A;  3BYA A;  1K95 A;  2PVB A;  1QIW A;  3SG2 A;  4USL A;  2KAX A;  2KGB C;  3QRX A;  1ALV A;  2KI4 B;  2HF5 A;  2E6W A;  3DF0 A;  1IRJ A;  1K8U A;  1IJ5 A;  3RM1 A;  1LA3 A;  1DJZ A;  4C0K A;  5I2Q A;  1NYA A;  2M7L A;  3I5F C;  2OS8 B;  1SR6 B;  3D0Y B;  1DJH A;  4FQO A;  3MSE B;  4NDC A;  2M1U A;  2M49 B;  1QVI Z;  3TS5 C;  2KI6 C;  1J7O A;  3TUY C;  4I5L B;  3BXK A;  4NQG A;  1FPW A;  3EK7 A;  2JNX A;  1KQM C;  1CDL A;  3CTN A;  5HYD A;  1DJY A;  4CID A;  3KEV A;  1CMF A;  2LC5 A;  1BOC A;  4NDB A;  1ZFS A;  4I5N B;  1YVL A;  1K96 A;  1YUT A;  1CFC A;  3I5I B;  1IQ5 A;  5AEQ A;  3KO0 A;  1AUI B;  1QS7 A;  2GV5 A;  1L2O C;  4GAO A;  1S1E A;  1QAS A;  1JWD A;  1OOJ A;  1KSM A;  3CR5 X;  4I5J A;  4MSP A;  4MRX A;  2WCF A;  1QIV A;  3SG5 A;  3TZ1 A;  1LIN A;  2DOQ A;  2FJU B;  2COL B;  3FWB A;  3GK1 A;  3OHM B;  4IL1 A;  1MXL C;  3VRO A;  4A4B A;  1SCM B;  4ETO A;  1PAL A;  1DMO A;  2WND A;  3WXA A;  2KNE A;  4DCK A;  2BBM A;  3DVK A;  1F70 A;  2CNP A;  1UUR A;  2F2O A;  1IKU A;  3LCP C;  5KU1 A;  4MBE A;  2ISD A;  2FCE A;  2LCP A;  1EG4 A;  2CBL A;  4GGF C;  3LL8 B;  4YBH B;  2NXQ A;  2LVK A;  1FI5 A;  2M3W A;  1U5I B;  2KAY A;  5D69 A;  5JJG A;  2VRG A;  2ZFD A;  1JC2 A;  1AVS A;  3GOF A;  1W7I B;  2QPT A;  1M63 B;  5B8I B;  4OVN F;  4MZK A;  1CDP A;  2KFF A;  4NDD A;  2EC6 B;  4DUQ A;  3AAJ A;  1IH0 A;  1Y1X A;  1OSA A;  1B9A A;  1PVA A;  2F2P A;  1JF2 A;  2B1U A;  3HX4 A;  2LVI A;  2EGD A;  3NXA A;  5I2O A;  1DGV A;  1N2D A;  5G08 A;  2KGR A;  2WOR A;  2JRF A;  2LMT A;  1E8A A;  1W7J B;  1FF1 A;  1IWQ A;  2WCB A;  3D0Y A;  2BBN A;  1QX5 B;  2LNK A;  3PAL A;  3VGO A;  2PAL A;  3SG6 A;  1CTR A;  4CFR A;  1KFU L;  3IQO A;  4N1F A;  2O5G A;  3AKA A;  3O78 A;  2K0J A;  4U8D A;  1JBA A;  1BLQ A;  2KBI A;  4UPG A;  3OB2 B;  1NCY A;  1SKT A;  4ICB A;  2KFH A;  1B4C A;  2GGZ A;  3OX6 A;  5HLV A;  3PLF B;  1V1G A;  4QJ4 B;  1CFP A;  4R1E A;  1Y1A A;  2F3Z A;  1OMR A;  4M2O A;  4WQ3 A;  1YRT B;  2MLE C;  2I18 A;  5KTY A;  1OE9 B;  1C7W A;  3CR2 A;  4MN0 A;  5CSF A;  2LAN A;  1J55 A;  1L7Z A;  2H61 A;  3BOW B;  5HKY A;  1KCY A;  4GNK B;  2L5X B;  2LUC A;  2I94 A;  3K21 A;  3TS5 B;  1PVB A;  1CM4 A;  2LLU A;  5TNC A;  1AK8 A;  2ZKM X;  2MLF C;  1TNW A;  2WOS A;  3TUY B;  1YTZ C;  1CLB A;  3PFV A;  2JZI A;  2L51 A;  1KQM B;  2LHL A;  4ZCU A;  4D1E A;  2K2A A;  2BCA A;  3AKB A;  1A75 B;  3JTD C;  1XK4 A;  1EJ3 A;  3EK4 A;  1NUB A;  1TNX A;  3ZNI A;  2Q91 A;  1MF8 B;  1U5I A;  2PRU A;  5DKQ A;  3KF9 A; 
#chains in the Genus database with same CATH topology
 1CLM A;  2L4I A;  2NCP A;  1H8B A;  1SY9 A;  2JUL A;  4ZCV A;  4QJ3 B;  4OCI A;  2E30 A;  1F4O A;  3C1V A;  4N5X A;  1KK8 B;  1B8L A;  4OR9 B;  3D77 A;  3JVT C;  2NCO A;  3NHT A;  4P5O E;  1JUO A;  3CZ2 A;  1ZOT B;  2MRD A;  2SAS A;  1XA5 A;  1KSO A;  3D78 A;  4GBA A;  2K61 A;  5EL2 A;  1J7Q A;  1Y6W A;  4HRH A;  1S6C A;  2MA2 A;  1QX2 A;  1UUS A;  2BE6 A;  1OW4 A;  3I5G C;  1S3P A;  5AXI A;  2K7D A;  2JT8 A;  1OMD A;  4YGB B;  2FOT A;  2G9B A;  4PHN A;  5BPJ A;  2LP3 A;  1H4B A;  1IG5 A;  1PSB A;  2QEH A;  1LS8 A;  1SW8 A;  1TTX A;  4YRU A;  1KFU S;  1IQ3 A;  1NSH A;  3PM8 A;  1TWO A;  1FW4 A;  1BG1 A;  3O4X A;  1GJY A;  1TRF A;  1UP5 A;  1X02 A;  3EVV A;  4PE0 A;  1TN4 A;  2D8N A;  5DKR A;  2WC5 A;  3BFH A;  4BY4 A;  1QAT A;  2JTT A;  2JOJ A;  1MQ1 A;  2BKI B;  2M97 A;  1DF0 A;  1CLL A;  1LVC D;  1SRA A;  1UHK A;  2JU0 A;  3VRR A;  1F54 A;  3BFB A;  1G4Y R;  4HSZ A;  1GGZ A;  3DVE A;  2HPS A;  1AJ4 A;  2QDI A;  2Y1N A;  3BQ3 A;  3M0W A;  2JXC A;  3WHU B;  3OP0 A;  1J1E A;  2P6B B;  3E3R A;  1LA0 A;  1DGU A;  1TUZ A;  2KI6 D;  3NGV A;  5HKZ A;  5HKW A;  1XYD A;  2LP2 A;  2RGI A;  3SJS A;  1M31 A;  3KHE A;  2ZRT A;  2BCX A;  3IQQ A;  3SS5 A;  4FQT A;  2CTN A;  1C07 A;  4YGD B;  1AHR A;  3D73 A;  3LLE A;  4MVF A;  1SL7 A;  1N65 A;  1IGV A;  1YRU B;  1B8R A;  2BL0 C;  1G8I A;  2YGU A;  1Z4H A;  1QLS A;  4DRW A;  1W9Z A;  4PAL A;  4E68 A;  3NSO A;  1DQE A;  2KBM A;  2KOT A;  1LKJ A;  2JQ6 A;  3OX5 A;  2H2K A;  5I2L A;  1R6P A;  2LM5 A;  2KYC A;  4XJK A;  5J3X A;  1NX2 A;  4HRG A;  1RTP 1;  3CZT X;  3EKJ A;  5DKN A;  2KQ6 A;  1NCX A;  5FYX A;  2EHB A;  3CWG A;  2L98 A;  2QEB A;  5CPV A;  3V2L A;  3FS7 A;  1QV0 A;  1SL8 A;  3GK4 X;  1Q80 A;  3A8R A;  4DIR A;  1K9P A;  1DC1 A;  2P71 A;  3D74 A;  1ZMZ A;  1S6J A;  1SL9 A;  3DVM A;  3FE8 A;  1CNP A;  1DT7 B;  2HQ8 A;  3R72 A;  1OOG A;  4GUK A;  4PE7 A;  2M9G A;  1TNP A;  4M2P A;  1REC A;  2LV7 A;  4ORA B;  1S36 A;  2JT0 A;  1NX3 A;  4C0J A;  2I7A A;  1YUR A;  3I5H C;  2ZRS A;  2A4J A;  4A4C A;  3GK2 A;  2LUX A;  1B1G A;  1NIW A;  1UHI A;  1Z2C B;  3CLN A;  1GGW A;  1TNQ A;  5CSJ A;  1QLK A;  1YVH A;  1M39 A;  1TCF A;  1WRK A;  1UWO A;  1YX7 A;  3JTD B;  3FIA A;  1IIO A;  1OZO A;  1S26 D;  2K7B A;  2M1K B;  3FWC A;  2LAP A;  5F6T A;  3S0A A;  1LXF C;  1J1D A;  4YGA A;  1BR4 B;  3SIA A;  1EL4 A;  2WCM A;  4YGE B;  3D10 A;  3I5F B;  3VRP A;  5AAN A;  2R2I A;  2K7C A;  1D1O A;  3S0D A;  4DS7 A;  1AJ5 A;  1YUU A;  2V53 A;  1G33 A;  1KK7 Y;  2EC6 C;  3O6B A;  2BEC A;  3OGN A;  1S5G Y;  3EVU A;  1YUS A;  2AMI A;  2HET A;  2FJY A;  3CS1 A;  2MAZ A;  2JT3 A;  3BUM B;  1KWO C;  4YGC B;  2JPT A;  4HRE E;  2F8P A;  1ODB A;  1FBV A;  1RWY A;  1AP4 A;  2NZ0 A;  1UHH A;  1SSE B;  1S6I A;  3I5G B;  1M46 A;  2PAS A;  3IVT A;  2M8U A;  3ICB A;  1ZAC A;  3BUW B;  2OPO A;  3PSR A;  4YI8 A;  2K2F A;  1XFU O;  4MLW A;  1BJF A;  3R1P A;  5CSN A;  1C3Y A;  3BUN B;  1KK7 Z;  3N7H A;  1S5G Z;  1L2O B;  1XFV O;  1HT9 A;  2PQL A;  2LLS A;  1MR8 A;  2F3Y A;  1DEK A;  4PHJ A;  1XFW O;  4IJ7 A;  3CGA A;  1A29 A;  1KFX L;  3BUX B;  3CYZ A;  4INX A;  1KQV A;  1K94 A;  3DVJ A;  1HQV A;  1EXR A;  4GGN A;  2CCM A;  1WRZ A;  1BMO A;  1JFK A;  1CDM A;  4WRI A;  1VRK A;  2PSR A;  2HQW A;  1TIZ A;  3BUO B;  1DTL A;  1PRW A;  2LLT A;  2M7N A;  1CDN A;  4ORC B;  3HCM A;  2TN4 A;  3LK1 A;  4M2Q A;  5D7F A;  3BJH A;  1WDC C;  1B7T Y;  4YI9 A;  4AQI A;  1CFF A;  1CB1 A;  1K9U A;  1BR1 B;  2I2R E;  3SG4 A;  3PN7 C;  2JXL A;  4PHM A;  3ZWH A;  2BL0 B;  1K90 D;  4PDZ A;  1F4Q A;  5K89 A;  1SNL A;  4AOM A;  3R1V A;  3VRQ A;  1F71 A;  1ORG A;  4CPV A;  1NWD A;  2AUC A;  2G2B A;  3D75 A;  1QXP A;  4JKT A;  3A4U B;  3SG3 A;  4P2Y B;  4JWQ A;  2L0P A;  1DJX A;  2OTG C;  4CLN A;  1EH2 A;  1CFD A;  1PSR A;  5FI2 A;  1MXE A;  3DZT A;  4TNC A;  1B7T Z;  2CT9 A;  2KLD A;  3B86 A;  5PAL A;  2KDH A;  3S0G A;  1RJV A;  2KI4 C;  2JWW A;  1TCO B;  2KQY A;  1JFJ A;  3D76 A;  1F55 A;  2NLN A;  3L4A A;  1GQM A;  1TOP A;  1SMG A;  3NSL A;  4MZL A;  4BY5 A;  1ZUZ A;  1IJ6 A;  3SIB A;  2F33 A;  3B87 A;  1Y1U A;  2GTE A;  3NSI A;  3PAT A;  3BOW A;  2ZN8 A;  2OS8 C;  1QV1 A;  1KK8 C;  1SR6 C;  1NX1 A;  2K8M B;  2KSP A;  1N0Y A;  2WCH A;  4PE1 A;  5ER4 X;  2Q4U A;  2M29 A;  2IS9 A;  5KSZ A;  3WHT B;  1K2H A;  3I5H B;  2KFG A;  1EG3 A;  3DXL A;  2JC2 A;  2GGM A;  3SG7 A;  2KHN A;  2LMV A;  1BF5 A;  1QJT A;  2Y1M A;  2WCJ A;  4JPZ B;  4C0L A;  2MJW B;  1A75 A;  1V1F A;  2KYF A;  1QTX A;  2BKH B;  1DJW A;  1XFZ O;  3TDI A;  3O2P A;  2K7O A;  1UHJ A;  2LE9 B;  3DY9 A;  2JNF A;  3PM2 A;  2ZND A;  4MRY A;  5JOL A;  1OOF A;  1NPQ A;  1PK0 D;  2BE4 A;  2P70 A;  3I5I C;  3PJI A;  1SCV A;  4I5K A;  3WNX B;  5IBW A;  1CMG A;  1J7P A;  1OOH A;  4XYN A;  3KPX A;  1TUJ A;  3DF0 B;  1SK6 D;  1YR5 A;  3CR4 X;  1OQP A;  4F0Z B;  2MBX A;  2Y5I A;  1Y0V H;  4AQJ A;  3K1E A;  1WY9 A;  2M0R A;  3RLZ A;  2H61 C;  1KFX S;  1SBJ A;  3EVR A;  5CSI A;  5GQQ C;  1NP8 A;  3S0B A;  2L50 A;  4OZD A;  2L4H A;  1SCM C;  4PCW A;  1XVJ A;  2CXJ A;  3VB1 A;  3TDZ A;  1YX8 A;  4PE4 A;  1WLZ A;  3DD4 A;  1KWO B;  1WLM A;  1JSA A;  2QAC A;  1QX7 A;  1R2U A;  2ZN9 A;  3AAK A;  2KLE A;  3LK0 A;  1K9K A;  5AER A;  5AFP A;  2QEV A;  4Q04 A;  4JQ0 D;  4GFT A;  2BCB A;  1MHO A;  1B8C A;  1XK4 C;  4MEW A;  4GGF A;  1RRO A;  3FE6 A;  4MZJ A;  3VRN A;  1SYM A;  2MHH A;  4L9M A;  1PUL A;  2KPH A;  5HLO A;  3FE9 A;  1NX0 A;  2LMU A;  1DJG A;  2O60 A;  1OZS A;  5ER5 A;  3EK8 A;  3RZS A;  1QWV A;  2L2C A;  2WCL A;  3Q8I A;  4WQ2 A;  2SCP A;  1UHN A;  1CKK A;  2LVV A;  1XO5 A;  3JVT B;  1NCZ A;  1DF0 B;  2L2E A;  2WC8 A;  4FTG A;  1MWN A;  2Y4Q A;  2WCE A;  3EKH A;  1WRL A;  1CM1 A;  1DVI A;  3NHI A;  1MUX A;  4OV2 A;  4CFQ A;  1F8H A;  1BT6 A;  2JTZ A;  2FCD A;  1A03 A;  4PHK A;  3NSK A;  1K93 D;  1DJI A;  2PMY A;  1M45 A;  4QJ5 B;  4GPL B;  5I8N A;  1B47 A;  1A4P A;  3F45 A;  3H4S E;  3DYE A;  1WDC B;  1FI6 A;  2KAV A;  2ZNE A;  1SPY A;  1JF0 A;  3TDU A;  3SS4 A;  2L5Y A;  4N1G A;  1XFX O;  2LHI A;  3B7A A;  1ALW A;  1J7R A;  3OB1 B;  2LVJ A;  3PN7 B;  4KYN A;  1A2X A;  1BU3 A;  3O4Y A;  1RFJ A;  4OKH A;  1XFY O;  4ORB B;  1BOD A;  2WCK A;  1QVI Y;  1C7V A;  2H8V A;  2AAO A;  3QME A;  3IF7 A;  4XJK B;  1OMV A;  2OTG B;  1RK9 A;  3BYA A;  3OBV A;  1K95 A;  2PVB A;  1P28 A;  1QIW A;  3SG2 A;  3L47 A;  4USL A;  2KAX A;  2KGB C;  3QRX A;  1ALV A;  2KI4 B;  2HF5 A;  2E6W A;  3DF0 A;  1IRJ A;  1K8U A;  1IJ5 A;  3RM1 A;  1LA3 A;  3S0E A;  1DJZ A;  4C0K A;  5I2Q A;  1GM0 A;  1NYA A;  2M7L A;  3I5F C;  2OS8 B;  1SR6 B;  3D0Y B;  1DJH A;  4FQO A;  3MSE B;  4NDC A;  2M1U A;  2M49 B;  1QVI Z;  3TS5 C;  2KI6 C;  1J7O A;  3TUY C;  4I5L B;  3BXK A;  4NQG A;  4F7F A;  3S0F A;  1FPW A;  3EK7 A;  2JNX A;  1KQM C;  1CDL A;  3CTN A;  5HYD A;  3B88 A;  1DJY A;  4CID A;  3KEV A;  1CMF A;  1T14 A;  2LC5 A;  1BOC A;  4NDB A;  1ZFS A;  4I5N B;  1YVL A;  1K96 A;  5FI6 A;  5FI7 A;  1YUT A;  1CFC A;  3CZ0 A;  3I5I B;  1IQ5 A;  5AEQ A;  3KO0 A;  1AUI B;  5D3O A;  1QS7 A;  2GV5 A;  1L2O C;  4GAO A;  1S1E A;  3UNW A;  1QAS A;  1JWD A;  1OOJ A;  3CAB A;  1KSM A;  3CR5 X;  4I5J A;  4MSP A;  4MRX A;  2K60 A;  2WCF A;  1QIV A;  3SG5 A;  3TZ1 A;  1LIN A;  2DOQ A;  2FJU B;  2COL B;  3FWB A;  3GK1 A;  3OHM B;  4IL1 A;  1MXL C;  3VRO A;  4A4B A;  1SCM B;  4ETO A;  1PAL A;  1DMO A;  2WND A;  3WXA A;  2KNE A;  4DCK A;  2BBM A;  3DVK A;  2BNX A;  1F70 A;  2CNP A;  1UUR A;  2F2O A;  3R1O A;  1IKU A;  3LCP C;  5KU1 A;  4MBE A;  2ISD A;  2FCE A;  2LCP A;  1EG4 A;  2CBL A;  2WC6 A;  4GGF C;  3LL8 B;  4YBH B;  2NXQ A;  2LVK A;  1FI5 A;  2M3W A;  1U5I B;  2KAY A;  5D69 A;  5JJG A;  2VRG A;  2ZFD A;  1JC2 A;  1AVS A;  5DIC A;  3GOF A;  1W7I B;  2QPT A;  1M63 B;  5B8I B;  4OVN F;  4PT1 A;  4MZK A;  1CDP A;  2KFF A;  3BFA A;  4NDD A;  2EC6 B;  4DUQ A;  2BAP A;  2ERB A;  3AAJ A;  1IH0 A;  1Y1X A;  1OSA A;  1B9A A;  1PVA A;  2F2P A;  1JF2 A;  2B1U A;  3HX4 A;  2LVI A;  2EGD A;  3NXA A;  5I2O A;  1DGV A;  1N2D A;  5G08 A;  2KGR A;  1XFR A;  4JD9 A;  2WOR A;  2JRF A;  2LMT A;  1E8A A;  1W7J B;  2JPO A;  3SS3 A;  1FF1 A;  1IWQ A;  2WCB A;  3D0Y A;  2BBN A;  1QX5 B;  2LNK A;  3PAL A;  3VGO A;  3L4L A;  2PAL A;  3SG6 A;  1CTR A;  4CFR A;  1KFU L;  3IQO A;  4N1F A;  2O5G A;  3AKA A;  3O78 A;  2K0J A;  3B6X A;  4U8D A;  1JBA A;  1BLQ A;  2PYQ A;  2KBI A;  4UPG A;  3OB2 B;  1NCY A;  1SKT A;  4ICB A;  2KFH A;  1B4C A;  2GGZ A;  3OX6 A;  5HLV A;  3PLF B;  1V1G A;  4QJ4 B;  1CFP A;  1DEL A;  4R1E A;  3CDN A;  1Y1A A;  2F3Z A;  5HL1 A;  1OMR A;  4M2O A;  4WQ3 A;  1YRT B;  2MLE C;  2I18 A;  5KTY A;  1OE9 B;  1C7W A;  3CR2 A;  4MN0 A;  5CSF A;  2LAN A;  1J55 A;  1L7Z A;  2QEO A;  3CZ1 A;  2H61 A;  3BOW B;  5HKY A;  3EG5 B;  1KCY A;  4GNK B;  2L5X B;  2LUC A;  2I94 A;  3K21 A;  3TS5 B;  3UO9 A;  1C3Z A;  1PVB A;  1CM4 A;  2LLU A;  5TNC A;  1AK8 A;  2ZKM X;  2MLF C;  1TNW A;  2WOS A;  3TUY B;  5I94 A;  1YTZ C;  1CLB A;  3PFV A;  2JZI A;  4INW A;  2L51 A;  1KQM B;  2LHL A;  4ZCU A;  4D1E A;  2K2A A;  2BCA A;  3AKB A;  1A75 B;  3JTD C;  1XK4 A;  1EJ3 A;  3EK4 A;  1NUB A;  1TNX A;  3ZNI A;  2Q91 A;  1MF8 B;  1U5I A;  2PRU A;  5DKQ A;  1OOI X;  3KF9 A; 
#chains in the Genus database with same CATH homology
 1CLM A;  2L4I A;  2NCP A;  1H8B A;  1SY9 A;  2JUL A;  4ZCV A;  4QJ3 B;  4OCI A;  2E30 A;  1F4O A;  3C1V A;  4N5X A;  1KK8 B;  1B8L A;  4OR9 B;  3JVT C;  2NCO A;  4P5O E;  1JUO A;  1ZOT B;  2MRD A;  2SAS A;  1XA5 A;  1KSO A;  4GBA A;  1J7Q A;  2K61 A;  1Y6W A;  4HRH A;  1S6C A;  2MA2 A;  1QX2 A;  1UUS A;  2BE6 A;  5AXI A;  3I5G C;  1S3P A;  2K7D A;  2JT8 A;  1OMD A;  4YGB B;  2FOT A;  2G9B A;  4PHN A;  5BPJ A;  2LP3 A;  1H4B A;  1IG5 A;  1PSB A;  1SW8 A;  1TTX A;  4YRU A;  1KFU S;  1IQ3 A;  1NSH A;  3PM8 A;  1FW4 A;  1BG1 A;  1GJY A;  1TRF A;  1UP5 A;  1X02 A;  3EVV A;  4PE0 A;  1TN4 A;  2D8N A;  5DKR A;  4BY4 A;  1QAT A;  2JTT A;  2JOJ A;  1MQ1 A;  2BKI B;  2M97 A;  1DF0 A;  1CLL A;  1LVC D;  1SRA A;  1UHK A;  2JU0 A;  3VRR A;  1G4Y R;  4HSZ A;  1GGZ A;  3DVE A;  2HPS A;  1AJ4 A;  2Y1N A;  3BQ3 A;  3M0W A;  3WHU B;  2JXC A;  1F54 A;  3OP0 A;  1J1E A;  2P6B B;  3E3R A;  1LA0 A;  1DGU A;  2KI6 D;  5HKZ A;  5HKW A;  1XYD A;  2LP2 A;  2RGI A;  3SJS A;  1M31 A;  3KHE A;  2ZRT A;  2BCX A;  3IQQ A;  2CTN A;  1C07 A;  4YGD B;  1AHR A;  3LLE A;  4MVF A;  1SL7 A;  1N65 A;  1IGV A;  1YRU B;  1B8R A;  2BL0 C;  1G8I A;  1QLS A;  4DRW A;  4PAL A;  4E68 A;  3NSO A;  2KBM A;  2KOT A;  1LKJ A;  2JQ6 A;  3OX5 A;  2H2K A;  5I2L A;  1R6P A;  2LM5 A;  2KYC A;  4XJK A;  5J3X A;  1NX2 A;  4HRG A;  1RTP 1;  3CZT X;  3EKJ A;  5DKN A;  2KQ6 A;  1NCX A;  5FYX A;  2EHB A;  3CWG A;  2L98 A;  5CPV A;  3FS7 A;  1QV0 A;  1SL8 A;  3GK4 X;  1Q80 A;  3A8R A;  4DIR A;  1K9P A;  1ZMZ A;  1S6J A;  1SL9 A;  3DVM A;  1DT7 B;  2HQ8 A;  4GUK A;  4PE7 A;  2M9G A;  1TNP A;  4M2P A;  1REC A;  2LV7 A;  4ORA B;  1S36 A;  2JT0 A;  1NX3 A;  4C0J A;  2I7A A;  1YUR A;  3I5H C;  2ZRS A;  2A4J A;  4A4C A;  3GK2 A;  2LUX A;  1B1G A;  1NIW A;  1UHI A;  3CLN A;  1GGW A;  1TNQ A;  5CSJ A;  1QLK A;  1YVH A;  1M39 A;  1TCF A;  1WRK A;  1UWO A;  1YX7 A;  3JTD B;  3FIA A;  1OZO A;  1S26 D;  2K7B A;  2M1K B;  3FWC A;  2LAP A;  5F6T A;  1LXF C;  1J1D A;  4YGA A;  1BR4 B;  3SIA A;  1EL4 A;  4YGE B;  3D10 A;  3I5F B;  3VRP A;  5AAN A;  2R2I A;  2K7C A;  1D1O A;  4DS7 A;  1AJ5 A;  1YUU A;  2V53 A;  1G33 A;  1KK7 Y;  2EC6 C;  3O6B A;  2BEC A;  1S5G Y;  3EVU A;  1YUS A;  2AMI A;  2HET A;  3CS1 A;  2MAZ A;  2JT3 A;  3BUM B;  1KWO C;  4YGC B;  2JPT A;  4HRE E;  2F8P A;  1ODB A;  1FBV A;  1RWY A;  1AP4 A;  2NZ0 A;  1UHH A;  1S6I A;  3I5G B;  1M46 A;  2PAS A;  2M8U A;  3ICB A;  1ZAC A;  3BUW B;  2OPO A;  3PSR A;  4YI8 A;  2K2F A;  1XFU O;  4MLW A;  1BJF A;  5CSN A;  3BUN B;  1KK7 Z;  1S5G Z;  1L2O B;  1XFV O;  1HT9 A;  2LLS A;  1MR8 A;  2F3Y A;  4PHJ A;  1XFW O;  3CGA A;  1A29 A;  1KFX L;  3BUX B;  1KQV A;  1K94 A;  3DVJ A;  1HQV A;  1EXR A;  4GGN A;  2CCM A;  1WRZ A;  1BMO A;  1JFK A;  1CDM A;  4WRI A;  1VRK A;  2PSR A;  2HQW A;  1TIZ A;  3BUO B;  1DTL A;  1PRW A;  2LLT A;  2M7N A;  1CDN A;  4ORC B;  3HCM A;  2TN4 A;  3LK1 A;  4M2Q A;  5D7F A;  1WDC C;  1B7T Y;  4YI9 A;  4AQI A;  1CFF A;  1CB1 A;  1K9U A;  1BR1 B;  2I2R E;  3SG4 A;  3PN7 C;  2JXL A;  4PHM A;  3ZWH A;  2BL0 B;  1K90 D;  4PDZ A;  1F4Q A;  5K89 A;  1SNL A;  4AOM A;  3VRQ A;  1F71 A;  4CPV A;  1NWD A;  2AUC A;  2G2B A;  1QXP A;  3SG3 A;  3A4U B;  4P2Y B;  4JWQ A;  2L0P A;  1DJX A;  2OTG C;  4CLN A;  1EH2 A;  1CFD A;  1PSR A;  1MXE A;  4TNC A;  1B7T Z;  2CT9 A;  5PAL A;  2KDH A;  1RJV A;  2KI4 C;  2JWW A;  1TCO B;  2KQY A;  1JFJ A;  1F55 A;  2NLN A;  1GQM A;  1TOP A;  1SMG A;  3NSL A;  4MZL A;  4BY5 A;  1ZUZ A;  1IJ6 A;  3SIB A;  2F33 A;  3NSI A;  1Y1U A;  3PAT A;  3BOW A;  2ZN8 A;  2OS8 C;  1QV1 A;  1KK8 C;  1SR6 C;  1NX1 A;  2K8M B;  2KSP A;  1N0Y A;  5ER4 X;  4PE1 A;  2Q4U A;  2M29 A;  2IS9 A;  5KSZ A;  3WHT B;  1K2H A;  3I5H B;  2KFG A;  1EG3 A;  2JC2 A;  2GGM A;  3SG7 A;  2KHN A;  2LMV A;  1BF5 A;  1QJT A;  2Y1M A;  4JPZ B;  4C0L A;  2MJW B;  1A75 A;  1V1F A;  2KYF A;  1QTX A;  2BKH B;  1DJW A;  1XFZ O;  3TDI A;  3O2P A;  2K7O A;  1UHJ A;  2LE9 B;  2JNF A;  4MRY A;  2ZND A;  5JOL A;  1CNP A;  1PK0 D;  1NPQ A;  2BE4 A;  5IBW A;  4I5K A;  3I5I C;  3WNX B;  1SCV A;  1CMG A;  1J7P A;  4XYN A;  3KPX A;  3DF0 B;  1SK6 D;  1YR5 A;  3CR4 X;  1OQP A;  4F0Z B;  2MBX A;  2Y5I A;  1Y0V H;  4AQJ A;  1WY9 A;  2M0R A;  3RLZ A;  2H61 C;  1KFX S;  1SBJ A;  3EVR A;  5CSI A;  5GQQ C;  1NP8 A;  2L50 A;  2L4H A;  1SCM C;  4PCW A;  1XVJ A;  2CXJ A;  3TDZ A;  1YX8 A;  4PE4 A;  1WLZ A;  3DD4 A;  1KWO B;  1WLM A;  1JSA A;  2QAC A;  1QX7 A;  1R2U A;  2ZN9 A;  3AAK A;  3LK0 A;  1K9K A;  5AER A;  5AFP A;  4Q04 A;  4JQ0 D;  4GFT A;  2BCB A;  1MHO A;  1B8C A;  1XK4 C;  4MEW A;  4GGF A;  1RRO A;  4MZJ A;  3VRN A;  1SYM A;  2MHH A;  4L9M A;  1PUL A;  5HLO A;  1NX0 A;  2LMU A;  1DJG A;  2O60 A;  1OZS A;  5ER5 A;  3EK8 A;  4WQ2 A;  2SCP A;  1UHN A;  1CKK A;  2LVV A;  1XO5 A;  3JVT B;  1NCZ A;  1DF0 B;  2L2E A;  2WC8 A;  4FTG A;  1MWN A;  2Y4Q A;  2WCE A;  3EKH A;  1WRL A;  1CM1 A;  1DVI A;  4CFQ A;  1MUX A;  4OV2 A;  1F8H A;  1BT6 A;  2JTZ A;  2FCD A;  1A03 A;  4PHK A;  3NSK A;  1K93 D;  1DJI A;  2PMY A;  1M45 A;  4QJ5 B;  4GPL B;  5I8N A;  1B47 A;  1A4P A;  3F45 A;  3H4S E;  1WDC B;  1FI6 A;  2KAV A;  2ZNE A;  1SPY A;  1JF0 A;  3TDU A;  4N1G A;  1XFX O;  2LHI A;  3OB1 B;  1ALW A;  1J7R A;  3PN7 B;  2LVJ A;  1A2X A;  1BU3 A;  3O4Y A;  1RFJ A;  4OKH A;  1XFY O;  4ORB B;  1BOD A;  1QVI Y;  1C7V A;  2AAO A;  3IF7 A;  4XJK B;  1OMV A;  2OTG B;  1RK9 A;  3BYA A;  1K95 A;  2PVB A;  1QIW A;  3SG2 A;  4USL A;  2KAX A;  2KGB C;  3QRX A;  1ALV A;  2KI4 B;  2HF5 A;  2E6W A;  3DF0 A;  1IRJ A;  1K8U A;  1IJ5 A;  3RM1 A;  1LA3 A;  1DJZ A;  4C0K A;  5I2Q A;  1NYA A;  2M7L A;  3I5F C;  2OS8 B;  1SR6 B;  3D0Y B;  1DJH A;  4FQO A;  3MSE B;  4NDC A;  2M1U A;  2M49 B;  1QVI Z;  3TS5 C;  2KI6 C;  1J7O A;  3TUY C;  4I5L B;  3BXK A;  4NQG A;  1FPW A;  3EK7 A;  2JNX A;  1KQM C;  1CDL A;  3CTN A;  5HYD A;  1DJY A;  4CID A;  3KEV A;  1CMF A;  2LC5 A;  1BOC A;  4NDB A;  1ZFS A;  4I5N B;  1YVL A;  1K96 A;  1YUT A;  1CFC A;  3I5I B;  1IQ5 A;  5AEQ A;  3KO0 A;  1AUI B;  1QS7 A;  2GV5 A;  1L2O C;  4GAO A;  1S1E A;  1QAS A;  1JWD A;  1OOJ A;  1KSM A;  3CR5 X;  4I5J A;  4MSP A;  4MRX A;  2WCF A;  1QIV A;  3SG5 A;  3TZ1 A;  1LIN A;  2DOQ A;  2FJU B;  2COL B;  3FWB A;  3GK1 A;  3OHM B;  4IL1 A;  1MXL C;  3VRO A;  4A4B A;  1SCM B;  4ETO A;  1PAL A;  1DMO A;  2WND A;  3WXA A;  2KNE A;  4DCK A;  2BBM A;  3DVK A;  1F70 A;  2CNP A;  1UUR A;  2F2O A;  1IKU A;  3LCP C;  5KU1 A;  4MBE A;  2ISD A;  2FCE A;  2LCP A;  1EG4 A;  2CBL A;  4GGF C;  3LL8 B;  4YBH B;  2NXQ A;  2LVK A;  1FI5 A;  2M3W A;  1U5I B;  2KAY A;  5D69 A;  5JJG A;  2VRG A;  2ZFD A;  1JC2 A;  1AVS A;  3GOF A;  1W7I B;  2QPT A;  1M63 B;  5B8I B;  4OVN F;  4MZK A;  1CDP A;  2KFF A;  4NDD A;  2EC6 B;  4DUQ A;  3AAJ A;  1IH0 A;  1Y1X A;  1OSA A;  1B9A A;  1PVA A;  2F2P A;  1JF2 A;  2B1U A;  3HX4 A;  2LVI A;  2EGD A;  3NXA A;  5I2O A;  1DGV A;  1N2D A;  5G08 A;  2KGR A;  2WOR A;  2JRF A;  2LMT A;  1E8A A;  1W7J B;  1FF1 A;  1IWQ A;  2WCB A;  3D0Y A;  2BBN A;  1QX5 B;  2LNK A;  3PAL A;  3VGO A;  2PAL A;  3SG6 A;  1CTR A;  4CFR A;  1KFU L;  3IQO A;  4N1F A;  2O5G A;  3AKA A;  3O78 A;  2K0J A;  4U8D A;  1JBA A;  1BLQ A;  2KBI A;  4UPG A;  3OB2 B;  1NCY A;  1SKT A;  4ICB A;  2KFH A;  1B4C A;  2GGZ A;  3OX6 A;  5HLV A;  3PLF B;  1V1G A;  4QJ4 B;  1CFP A;  4R1E A;  1Y1A A;  2F3Z A;  1OMR A;  4M2O A;  4WQ3 A;  1YRT B;  2MLE C;  2I18 A;  5KTY A;  1OE9 B;  1C7W A;  3CR2 A;  4MN0 A;  5CSF A;  2LAN A;  1J55 A;  1L7Z A;  2H61 A;  3BOW B;  5HKY A;  1KCY A;  4GNK B;  2L5X B;  2LUC A;  2I94 A;  3K21 A;  3TS5 B;  1PVB A;  1CM4 A;  2LLU A;  5TNC A;  1AK8 A;  2ZKM X;  2MLF C;  1TNW A;  2WOS A;  3TUY B;  1YTZ C;  1CLB A;  3PFV A;  2JZI A;  2L51 A;  1KQM B;  2LHL A;  4ZCU A;  4D1E A;  2K2A A;  2BCA A;  3AKB A;  1A75 B;  3JTD C;  1XK4 A;  1EJ3 A;  3EK4 A;  1NUB A;  1TNX A;  3ZNI A;  2Q91 A;  1MF8 B;  1U5I A;  2PRU A;  5DKQ A;  3KF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...