3CLNA

Structure of calmodulin refined at 2.2 angstroms resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
b'TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEEFVQMMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Structure of calmodulin refined at 2.2 A resolution.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Calcium binding protein
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 1988-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3clnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3clnA02
3OX5A 3VROA 1L7ZA 1CDMA 1KFUS 2BKIB 3O78A 4CLNA 4YRUA 1BOCA 1TIZA 1CMFA 2KAYA 2BKHB 1WLMA 3BUWB 2SCPA 1CFPA 1NX2A 1ZACA 1IWQA 1UWOA 2KBIA 1S6CA 1NX1A 3ZWHA 2ZKMX 3GK1A 1SY9A 4PE4A 1SCVA 2L4IA 4GGFA 3ICBA 1TOPA 4XYNA 2M7NA 1PVAA 1G4YR 2MBXA 1CDPA 2BCAA 1NUBA 3OX6A 2JWWA 2JT0A 3K21A 1TNWA 3SG7A 3VRQA 1IH0A 2KI6C 1XFVO 1CFFA 2PMYA 1MQ1A 1TN4A 4NQGA 2L2EA 1ZMZA 3MSEB 1SKTA 3H4SE 3SG6A 2E6WA 3VRNA 2BL0B 1XVJA 2KI6D 1FPWA 1OMDA 3BUXB 2JTZA 4OR9B 2M7LA 4YBHB 1BF5A 3DD4A 2HQWA 1ALVA 4IL1A 1W7JB 1AP4A 3OP0A 5KTYA 1F8HA 2PASA 3M0WA 1QLKA 2OS8B 1AK8A 4PE1A 5AANA 1CM4A 2BE4A 2G9BA 1KK8B 2B1UA 1OSAA 4ZCUA 2JTTA 2MA2A 2KAVA 3KPXA 4YGBB 3PN7B 1JSAA 3O2PA 4OV2A 2L50A 1SL8A 3CTNA 1K2HA 1MF8B 1QLSA 4PHNA 4E68A 3HCMA 2BCBA 1SMGA 2D8NA 2KGBC 2KFHA 1F4QA 1V1GA 3LLEA 5HLVA 3SIAA 1WRZA 2G2BA 1S36A 2L4HA 4GPLB 3DVKA 1DF0A 1D1OA 1UHHA 1A29A 1C7WA 1IQ5A 2K7CA 3SJSA 1YVHA 2H2KA 2OS8C 1SR6B 3SG3A 4BY4A 2JNXA 2ZRTA 3CS1A 1K96A 1BODA 1CM1A 4WQ3A 4FTGA 1FF1A 4MSPA 1IQ3A 3JTDB 1DJWA 2L0PA 1AHRA 2QPTA 3PN7C 4I5LB 2KFFA 4CPVA 1NPQA 2LM5A 4OCIA 4NDDA 3DVMA 3NSOA 1MXLC 3ZNIA 3CLNA 1EJ3A 1KFXS 4MN0A 5I2OA 1K8UA 2LVJA 3KO0A 2Q4UA 5HKZA 1B1GA 1ZUZA 1TTXA 5AXIA 1CMGA 1G8IA 2LHIA 1S6IA 2LVIA 4GNKB 5G08A 1JFKA 2KGRA 1YUTA 2ZN9A 2ISDA 1CLBA 1SR6C 2LVKA 1RTP1 2KYCA 3NSKA 1K90D 1B8CA 1M45A 4HRGA 5DKRA 3EK4A 1UHIA 2JXCA 3JTDC 3AKBA 1LKJA 2LP2A 3KEVA 3PATA 1KWOC 5B8IB 1H4BA 1WY9A 4Q04A 3FWBA 4MLWA 1F54A 3SG2A 1WDCC 1IJ6A 1DTLA 1Y1XA 2K7OA 2L5XB 1PALA 1OOJA 2LMTA 2MJWB 2L51A 3TDUA 1XFYO 3VRPA 3PALA 1WLZA 1NX0A 2JU0A 2F3ZA 2QACA 5KSZA 1AUIB 1C07A 3TZ1A 2WCBA 3TDIA 2KSPA 1QV1A 4AOMA 1NP8A 1CLLA 2K2FA 1XK4C 1PK0D 1V1FA 2F2PA 2LMUA 5CSNA 2JT3A 2K8MB 1AJ5A 3CWGA 4ORBB 2E30A 5D7FA 2LHLA 2LVVA 1CDLA 5HKYA 1YUSA 1UHNA 1F55A 4DCKA 1SW8A 3AKAA 3BYAA 2M3WA 4AQIA 1DGVA 2AMIA 2JULA 3VGOA 3NSIA 4WQ2A 1QXPA 2V53A 4YI9A 2MAZA 1EG4A 1WRLA 1ZFSA 4YGEB 1R2UA 1TCOB 3LCPC 3GK2A 4JWQA 4GAOA 2FOTA 2ZNDA 3D10A 4M2OA 4MEWA 3QRXA 4M2PA 2M1KB 1OZOA 4ICBA 4A4CA 3BOWB 1BR4B 3FWCA 4FQOA 2CCMA 1Q80A 1QS7A 4GBAA 2KDHA 1AJ4A 1ALWA 1IGVA 4N5XA 1NIWA 1N0YA 5FYXA 2AAOA 1NCYA 1QVIZ 1XFUO 1H8BA 1F4OA 1J7PA 2JQ6A 1SBJA 2WOSA 2K0JA 2LV7A 1CLMA 3LK1A 4USLA 4ZCVA 4PHKA 1CKKA 2KQYA 4YGDB 3DF0B 1SCMB 2JZIA 3SG4A 1QVIY 2KBMA 2EHBA 2LANA 2WNDA 3DVEA 2JRFA 2WORA 1UURA 2FJUB 3HX4A 1YRUB 5HKWA 2TN4A 3EVUA 4BY5A 2NCOA 2OPOA 3LL8B 1J55A 3EK7A 2LUCA 2F3YA 1OZSA 2O60A 1CTRA 1RFJA 1GQMA 2JNFA 5I2QA 1XK4A 4C0KA 2JOJA 4PE0A 3LK0A 3CZTX 3TUYC 1BMOA 1QX2A 1YRTB 1CFCA 3JVTB 2F33A 1K93D 3WNXB 1QIWA 4I5KA 1QJTA 2F8PA 1B4CA 1SCMC 1S5GZ 1CDNA 2WCEA 2LE9B 1XO5A 1R6PA 1KQVA 4P5OE 5AFPA 2M0RA 3EVRA 4MRYA 1YTZC 1J7OA 2A4JA 3RM1A 2GGZA 2WC8A 2COLB 1S5GY 4DIRA 4XJKA 4CFQA 1YURA 3PM8A 2LC5A 4C0JA 1KWOB 2KYFA 4MBEA 1S6JA 2KOTA 1F70A 3VRRA 1TRFA 2K7BA 1BJFA 1WDCB 3IQOA 1PVBA 5BPJA 3CR2A 2I7AA 2HPSA 1RROA 3JVTC 4I5JA 3CR4X 1LA3A 1OQPA 1PSRA 2PVBA 4PHMA 3WHTB 3D0YB 1OMRA 1B9AA 1VRKA 4DRWA 1KCYA 1K95A 2MHHA 2M9GA 2K2AA 2BCXA 1ZOTB 2KI4B 4OKHA 2LMVA 1J7RA 1Y6WA 3AAJA 3EKJA 3BOWA 1SK6D 3DVJA 4HSZA 4U8DA 4MZKA 4HREE 1GGZA 1C7VA 4N1GA 2LLTA 1A75B 4JPZB 3IQQA 1BU3A 2PRUA 3SG5A 1XFXO 1FI6A 4UPGA 2H61C 4XJKB 3OB1B 1CB1A 1NCXA 3TS5B 1LXFC 1PULA 1S3PA 1SL9A 2BBMA 2KHNA 2HETA 1N65A 2Y4QA 4JQ0D 2LLUA 2M8UA 5I2LA 3DF0A 5HLOA 5K89A 4PCWA 1Y1AA 4PHJA 2FCEA 2KI4C 1XYDA 4MRXA 2KFGA 3AAKA 2M97A 3A8RA 1MUXA 1U5IB 4QJ5B 2JC2A 1QX7A 1EG3A 3EKHA 2KAXA 1KSOA 1CFDA 5DKQA 1J7QA 1IG5A 1DGUA 4PALA 1UUSA 1DT7B 4MZLA 1YR5A 2HQ8A 3FS7A 3KHEA 3KF9A 1OMVA 3PFVA 2IS9A 1TNXA 1DJZA 3I5FB 5DKNA 3NXAA 4A4BA 5CSIA 1AVSA 5ER4X 2GGMA 3TS5C 1EXRA 1UHJA 2NLNA 2RGIA 2EC6B 2NCPA 2R2IA 2LLSA 1QTXA 1XFWO 4NDBA 1DJXA 2NXQA 1JWDA 1NYAA 5PALA 1KFXL 1NCZA 2OTGB 3FIAA 2MLFC 1PSBA 4M2QA 5JJGA 2Y5IA 1YX7A 3TUYB 1JC2A 1WRKA 2M1UA 1TCFA 1K9PA 4HRHA 1DVIA 4AQJA 1GJYA 2ZNEA 1MWNA 1TNPA 4ETOA 1QATA 1L2OB 2CNPA 3WXAA 1B8RA 2DOQA 4DUQA 1IKUA 2I2RE 1E8AA 1KSMA 1NSHA 1QIVA 1SYMA 3I5HB 1LA0A 1BT6A 1ODBA 3I5FC 1X02A 2BBNA 2ZN8A 2CT9A 3O4YA 2SASA 1CNPA 1B8LA 2H61A 2EC6C 1RWYA 1K94A 2ZRSA 3I5IB 4ORAB 4YGAA 4F0ZB 1JF2A 1MR8A 2OTGC 5D69A 3D0YA 3PLFB 5CPVA 4R1EA 1XA5A 2LP3A 3BQ3A 2JXLA 3EK8A 2CBLA 1RECA 1S1EA 3A4UB 3WHUB 2Q91A 1FW4A 1JUOA 1LINA 3PSRA 4GUKA 1J1EA 1JF0A 3F45A 4ORCB 4PDZA 1A2XA 1KFUL 1L2OC 4CFRA 1RK9A 1OE9B 5TNCA 1JBAA 2I94A 1B7TZ 1G33A 3EVVA 1DMOA 3I5GB 3BXKA 3I5HC 5ER5A 4YGCB 1F71A 1PRWA 3RLZA 2AUCA 3IF7A 1A75A 1A4PA 1NX3A 2JT8A 1DJYA 1RJVA 3OHMB 2F2OA 1M46A 1TNQA 3BUOB 5IBWA 4D1EA 1FBVA 3I5IC 1B7TY 2BL0C 2CXJA 2P6BB 1XFZO 2KNEA 5I8NA 3C1VA 1B47A 2BE6A 1SRAA 1JFJA 4QJ3B 2BECA 2LAPA 1FI5A 4C0LA 1HT9A 1YX8A 1QASA 5AERA 4N1FA 4P2YB 3GK4X 5AEQA 1S26D 1BG1A 4DS7A 1Y1UA 2Y1MA 4GFTA 4TNCA 5F6TA 1U5IA 2KQ6A 1MHOA 1W7IB 2LNKA 1A03A 1BLQA 5CSJA 1KK8C 2L98A 3CR5X 1QX5B 1M39A 3GOFA 3O6BA 1BR1B 3I5GC 4MVFA 2JPTA 2I18A 1LVCD 1SNLA 4GGFC 1SL7A 3BUMB 3TDZA 1K9UA 4OVNF 1IRJA 5CSFA 1HQVA 1KQMB 2M29A 3SIBA 1M31A 2O5GA 1J1DA 4CIDA 1IJ5A 1N2DA 2WCFA 1DJGA 2MRDA 1MXEA 2NZ0A 2LUXA 1Y0VH 1NWDA 2CTNA 2M49B 2MLEC 4QJ4B 1KK7Z 2FCDA 5J3XA 4NDCA 2HF5A 4PE7A 2PALA 1UHKA 4I5NB 4MZJA 1EH2A 1QV0A 1DJHA 1K9KA 1KK7Y 1DJIA 1M63B 1DF0B 2ZFDA 3BUNB 1EL4A 1UP5A 1KQMC 2EGDA 4YI8A 2GV5A 2PSRA 4L9MA 1SPYA 3OB2B 1YVLA 2VRGA 5JOLA 2LCPA 5GQQC 4WRIA 4GGNA 3E3RA 2K7DA 2Y1NA 5KU1A 5HYDA 1GGWA 3CGAA 2K61A 1YUUA 3NSLA
chains in the Genus database with same CATH superfamily
3OX5A 3VROA 4KYNA 1L7ZA 1CDMA 1KFUS 2BKIB 3O78A 3FE9A 4CLNA 4YRUA 1BOCA 2WCHA 1TIZA 1CMFA 2KAYA 2BKHB 1WLMA 3BUWB 2BAPA 2SCPA 3BFBA 1CFPA 1NX2A 1ZACA 1IWQA 1UWOA 2KBIA 1S6CA 1NX1A 2KLEA 3SS4A 3ZWHA 2ZKMX 3GK1A 1SY9A 4PE4A 3CZ0A 1SCVA 2L4IA 3NHTA 3ICBA 4GGFA 1TOPA 4XYNA 2M7NA 1PVAA 1G4YR 2MBXA 3B87A 2L2CA 1CDPA 2BCAA 1NUBA 3OX6A 2JWWA 2JT0A 3K21A 1TNWA 3SG7A 3VRQA 1IH0A 3DZTA 2KI6C 1XFVO 1CFFA 2PMYA 1MQ1A 1TN4A 3OBVA 2L2EA 1ZMZA 3MSEB 4NQGA 1SKTA 3H4SE 3SG6A 2E6WA 3VRNA 2BL0B 1XVJA 2KI6D 1FPWA 1OMDA 3BUXB 3PM2A 2JTZA 4OR9B 2M7LA 4YBHB 1LS8A 1BF5A 1OOHA 2HQWA 3DD4A 1ALVA 4IL1A 1W7JB 1AP4A 3CZ2A 3OP0A 5KTYA 3L4LA 1F8HA 2PASA 3M0WA 1TUJA 1QLKA 2OS8B 1AK8A 4PE1A 2QEOA 5AANA 1CM4A 2BE4A 2G9BA 1KK8B 2B1UA 1OSAA 4ZCUA 2JTTA 2MA2A 2KAVA 3KPXA 4YGBB 3PN7B 4F7FA 1JSAA 3O2PA 3D75A 4OV2A 3SS5A 2L50A 1SL8A 3CTNA 1K2HA 1MF8B 1QLSA 4PHNA 4E68A 3DYEA 3HCMA 2BCBA 1SMGA 2D8NA 2KGBC 2KFHA 1F4QA 1V1GA 3LLEA 5HLVA 3SIAA 1WRZA 2G2BA 1S36A 2L4HA 4GPLB 3DVKA 1DF0A 1D1OA 1UHHA 1A29A 1C7WA 1IQ5A 2K7CA 3SJSA 1YVHA 1OW4A 2GTEA 1SR6B 2H2KA 2OS8C 2WCKA 2JNXA 3BFAA 3SG3A 4BY4A 2ZRTA 3CS1A 1K96A 1BODA 1CM1A 4WQ3A 4FTGA 2P70A 1FF1A 4MSPA 1IQ3A 3JTDB 1DJWA 2L0PA 1AHRA 2QPTA 3PN7C 4I5LB 2KFFA 4CPVA 1NPQA 3R1PA 2LM5A 2ERBA 4OCIA 4NDDA 3DVMA 3NSOA 1MXLC 3ZNIA 3CLNA 1EJ3A 1KFXS 4MN0A 3BJHA 1K8UA 2LVJA 3KO0A 2Q4UA 5HKZA 5I2OA 1B1GA 1ZUZA 1TTXA 5AXIA 4JKTA 1CMGA 1G8IA 3S0AA 1XFRA 2LHIA 1S6IA 2LVIA 4GNKB 5G08A 1JFKA 2KGRA 1IIOA 3UO9A 1YUTA 2ZN9A 2ISDA 3S0BA 1SR6C 1CLBA 2LVKA 1RTP1 2KYCA 3NSKA 1K90D 1B8CA 3L4AA 1M45A 4HRGA 2WCMA 5DKRA 3EK4A 1UHIA 2JXCA 3JTDC 3AKBA 1ORGA 4INXA 1LKJA 2LP2A 3KEVA 3PATA 1KWOC 5B8IB 1H4BA 1WY9A 3UNWA 4Q04A 3FWBA 4MLWA 1F54A 3SG2A 1WDCC 1IJ6A 1DTLA 1Y1XA 2K7OA 2L5XB 1PALA 1OOJA 2LMTA 2MJWB 2L51A 3TDUA 1XFYO 3VRPA 3PALA 1WLZA 1NX0A 2JU0A 2F3ZA 2QACA 5KSZA 1AUIB 1C07A 3N7HA 2WCBA 3TZ1A 3TDIA 2KSPA 1QV1A 4AOMA 1NP8A 1CLLA 2K2FA 1XK4C 1PK0D 1V1FA 2F2PA 2LMUA 5CSNA 2JT3A 2K8MB 1AJ5A 3CWGA 4ORBB 2E30A 5D7FA 2LHLA 2LVVA 1CDLA 5HKYA 2QDIA 1YUSA 3FE8A 1UHNA 2JPOA 1F55A 3R72A 4DCKA 1SW8A 2H8VA 3AKAA 2M3WA 3BYAA 4AQIA 1DGVA 2AMIA 2JULA 3VGOA 3NSIA 4WQ2A 1QXPA 2V53A 4YI9A 2MAZA 1EG4A 1WRLA 1ZFSA 4YGEB 1R2UA 1TCOB 3LCPC 3GK2A 4JWQA 4GAOA 2FOTA 2ZNDA 3D10A 4M2OA 4MEWA 3QRXA 4M2PA 2M1KB 1OZOA 4ICBA 4A4CA 3BOWB 1BR4B 3FWCA 4FQOA 2CCMA 1Q80A 1QS7A 4GBAA 2KDHA 1AJ4A 1ALWA 1IGVA 4N5XA 1NIWA 1N0YA 5FYXA 2AAOA 1NCYA 1QVIZ 3IVTA 1XFUO 1H8BA 1F4OA 3DY9A 1J7PA 2JQ6A 1SBJA 2WOSA 2K0JA 2LV7A 1DEKA 1CLMA 3LK1A 4USLA 4ZCVA 4PHKA 1CKKA 2KQYA 3D77A 4YGDB 3DF0B 1SCMB 3B88A 2JZIA 3SG4A 4IJ7A 1QVIY 2KBMA 2EHBA 2LANA 2WNDA 2KLDA 2JRFA 2WORA 1UURA 2FJUB 3CDNA 3DVEA 3HX4A 1YRUB 4DRWA 5HKWA 2TN4A 3EVUA 3O4XA 4BY5A 2NCOA 2OPOA 3LL8B 1J55A 3EK7A 2LUCA 2F3YA 1OZSA 2O60A 1CTRA 1RFJA 2QEHA 1GQMA 3DXLA 2JNFA 5I2QA 1XK4A 4C0KA 2JOJA 4PE0A 3LK0A 3CZTX 3TUYC 5HL1A 1BMOA 1QX2A 1YRTB 1CFCA 3JVTB 2F33A 1K93D 3WNXB 1QIWA 4I5KA 1QJTA 2F8PA 1B4CA 1SCMC 1S5GZ 1CDNA 2WCEA 2LE9B 3S0DA 1XO5A 1R6PA 1DC1A 1KQVA 4P5OE 5AFPA 2M0RA 3EVRA 4MRYA 1YTZC 1J7OA 1GM0A 2A4JA 3RM1A 2GGZA 2WC8A 2COLB 1S5GY 4DIRA 3CYZA 4XJKA 1YURA 4CFQA 3PM8A 2LC5A 4C0JA 3VB1A 1KWOB 2PYQA 2KYFA 4MBEA 1S6JA 2KOTA 1F70A 3VRRA 1TRFA 2K7BA 1BJFA 1OOIX 1WDCB 3IQOA 1PVBA 5BPJA 5D3OA 3CR2A 1OOFA 2I7AA 2HPSA 1TWOA 1RROA 3JVTC 4I5JA 2WC5A 5I94A 3CR4X 4JD9A 1LA3A 1TUZA 1OQPA 1PSRA 1C3ZA 2K60A 2PVBA 3D0YB 1OMRA 1B9AA 1VRKA 4PHMA 3WHTB 1K95A 2MHHA 2M9GA 1C3YA 2K2AA 2BCXA 2BNXA 1ZOTB 2KI4B 4OKHA 2LMVA 2FJYA 1J7RA 2L5YA 1Y6WA 3AAJA 3EKJA 3BOWA 1SK6D 3DVJA 4HSZA 4U8DA 1DQEA 4MZKA 5EL2A 4HREE 1GGZA 1C7VA 4N1GA 2LLTA 1P28A 1A75B 4JPZB 3IQQA 1BU3A 2PRUA 3SG5A 1XFXO 1FI6A 4UPGA 2H61C 4XJKB 3OB1B 1CB1A 3CZ1A 1NCXA 3TS5B 1LXFC 1PULA 1S3PA 1SL9A 2BBMA 2KHNA 5FI7A 2HETA 1N65A 2Y4QA 4JQ0D 1DELA 2LLUA 2M8UA 5I2LA 3DF0A 5HLOA 5K89A 4PCWA 1Y1AA 4PHJA 5DICA 2FCEA 2KI4C 3D78A 5FI6A 1OOGA 1XYDA 2QEVA 2KFGA 3AAKA 4MRXA 2M97A 3A8RA 1MUXA 1U5IB 4QJ5B 3S0EA 2JC2A 1QX7A 1EG3A 3EKHA 2KAXA 1KSOA 1CFDA 5DKQA 1J7QA 1IG5A 1DGUA 4OZDA 4PALA 1UUSA 1DT7B 4MZLA 1YR5A 2HQ8A 3FS7A 3KHEA 3D76A 1OMVA 3KF9A 3PFVA 2P71A 2IS9A 1TNXA 2WC6A 1DJZA 3I5FB 5DKNA 3NXAA 4A4BA 5CSIA 1AVSA 5ER4X 2GGMA 3TS5C 1EXRA 1UHJA 2NLNA 2RGIA 2EC6B 2NCPA 2R2IA 2LLSA 1QTXA 1XFWO 3NHIA 1DJXA 2NXQA 4NDBA 3R1OA 1JWDA 1NYAA 5PALA 1KFXL 3RZSA 1NCZA 2OTGB 3BFHA 3FIAA 2MLFC 1PSBA 4M2QA 5JJGA 2Y5IA 1YX7A 3TUYB 1JC2A 1WRKA 2M1UA 1TCFA 1K9PA 4HRHA 1DVIA 4PT1A 1GJYA 2ZNEA 1MWNA 1TNPA 4AQJA 1QATA 4ETOA 2WCLA 1L2OB 2CNPA 3WXAA 1B8RA 2DOQA 4DUQA 1IKUA 3L47A 2I2RE 1E8AA 1KSMA 1NSHA 1QIVA 1SYMA 3I5HB 1LA0A 1BT6A 1ODBA 3I5FC 1X02A 2BBNA 2ZN8A 2CT9A 3O4YA 2SASA 1CNPA 1B8LA 2H61A 2EC6C 1RWYA 1K94A 2ZRSA 3I5IB 4ORAB 3FE6A 4YGAA 4F0ZB 1JF2A 1MR8A 1Z4HA 2OTGC 5D69A 3D0YA 3PLFB 5CPVA 4R1EA 1XA5A 2LP3A 3BQ3A 2JXLA 3EK8A 2CBLA 1RECA 1S1EA 3A4UB 3WHUB 2Q91A 1FW4A 2QEBA 1JUOA 1LINA 3PSRA 1W9ZA 4GUKA 1J1EA 1JF0A 3F45A 4ORCB 4PDZA 1A2XA 1KFUL 1L2OC 2KPHA 4CFRA 1RK9A 2YGUA 3OGNA 1OE9B 5TNCA 1JBAA 2I94A 1B7TZ 1G33A 3EVVA 1DMOA 3I5GB 3BXKA 3I5HC 5ER5A 4YGCB 1F71A 1PRWA 3RLZA 2AUCA 3IF7A 1A75A 1A4PA 1NX3A 2JT8A 1DJYA 1RJVA 3OHMB 2F2OA 1M46A 1TNQA 3Q8IA 3BUOB 5IBWA 4D1EA 1FBVA 3I5IC 5FI2A 1B7TY 2BL0C 2CXJA 2P6BB 1XFZO 2KNEA 5I8NA 3B6XA 3C1VA 1B47A 2BE6A 1SRAA 1JFJA 2WCJA 4QJ3B 2BECA 2LAPA 1FI5A 4C0LA 1HT9A 1SSEB 1YX8A 1QASA 5AERA 4N1FA 4P2YB 3CABA 1QWVA 3GK4X 1S26D 5AEQA 1BG1A 4DS7A 1Y1UA 2Y1MA 4GFTA 4TNCA 5F6TA 1U5IA 2KQ6A 1MHOA 1T14A 1W7IB 2LNKA 3B86A 1A03A 5CSJA 1KK8C 1BLQA 2L98A 3CR5X 1QX5B 1M39A 3GOFA 3O6BA 1BR1B 3I5GC 4MVFA 2JPTA 2I18A 1LVCD 1SNLA 4GGFC 1SL7A 3BUMB 3TDZA 1K9UA 4OVNF 1IRJA 5CSFA 1HQVA 1KQMB 2M29A 3SIBA 1M31A 2O5GA 3S0GA 1KCYA 3SS3A 1Z2CB 1J1DA 3PJIA 4CIDA 1IJ5A 1N2DA 2WCFA 1DJGA 2MRDA 3QMEA 1MXEA 2NZ0A 2LUXA 4FQTA 1Y0VH 1NWDA 2CTNA 2M49B 2MLEC 4QJ4B 1KK7Z 2FCDA 5J3XA 4NDCA 2HF5A 3EG5B 4PE7A 2PALA 1UHKA 2PQLA 4I5NB 4MZJA 1EH2A 1QV0A 3V2LA 1DJHA 1K9KA 1KK7Y 1DJIA 1M63B 1DF0B 2ZFDA 3BUNB 3S0FA 1EL4A 1UP5A 1KQMC 2EGDA 3D74A 4YI8A 2GV5A 2PSRA 3D73A 4L9MA 1SPYA 3OB2B 1YVLA 2VRGA 3R1VA 5JOLA 2LCPA 3NGVA 5GQQC 3K1EA 4WRIA 4GGNA 3E3RA 2K7DA 2Y1NA 5KU1A 5HYDA 1GGWA 3B7AA 3CGAA 2K61A 1YUUA 3NSLA 4INWA
chains in the Genus database with same CATH topology
3OX5A 3VROA 1L7ZA 1CDMA 1KFUS 2BKIB 3O78A 4CLNA 4YRUA 1BOCA 1TIZA 1CMFA 2KAYA 2BKHB 1WLMA 3BUWB 2SCPA 1CFPA 1NX2A 1ZACA 1IWQA 1UWOA 2KBIA 1S6CA 1NX1A 3ZWHA 2ZKMX 3GK1A 1SY9A 4PE4A 1SCVA 2L4IA 4GGFA 3ICBA 1TOPA 4XYNA 2M7NA 1PVAA 1G4YR 2MBXA 1CDPA 2BCAA 1NUBA 3OX6A 2JWWA 2JT0A 3K21A 1TNWA 3SG7A 3VRQA 1IH0A 2KI6C 1XFVO 1CFFA 2PMYA 1MQ1A 1TN4A 4NQGA 2L2EA 1ZMZA 3MSEB 1SKTA 3H4SE 3SG6A 2E6WA 3VRNA 2BL0B 1XVJA 2KI6D 1FPWA 1OMDA 3BUXB 2JTZA 4OR9B 2M7LA 4YBHB 1BF5A 3DD4A 2HQWA 1ALVA 4IL1A 1W7JB 1AP4A 3OP0A 5KTYA 1F8HA 2PASA 3M0WA 1QLKA 2OS8B 1AK8A 4PE1A 5AANA 1CM4A 2BE4A 2G9BA 1KK8B 2B1UA 1OSAA 4ZCUA 2JTTA 2MA2A 2KAVA 3KPXA 4YGBB 3PN7B 1JSAA 3O2PA 4OV2A 2L50A 1SL8A 3CTNA 1K2HA 1MF8B 1QLSA 4PHNA 4E68A 3HCMA 2BCBA 1SMGA 2D8NA 2KGBC 2KFHA 1F4QA 1V1GA 3LLEA 5HLVA 3SIAA 1WRZA 2G2BA 1S36A 2L4HA 4GPLB 3DVKA 1DF0A 1D1OA 1UHHA 1A29A 1C7WA 1IQ5A 2K7CA 3SJSA 1YVHA 2H2KA 2OS8C 1SR6B 3SG3A 4BY4A 2JNXA 2ZRTA 3CS1A 1K96A 1BODA 1CM1A 4WQ3A 4FTGA 1FF1A 4MSPA 1IQ3A 3JTDB 1DJWA 2L0PA 1AHRA 2QPTA 3PN7C 4I5LB 2KFFA 4CPVA 1NPQA 2LM5A 4OCIA 4NDDA 3DVMA 3NSOA 1MXLC 3ZNIA 3CLNA 1EJ3A 1KFXS 4MN0A 5I2OA 1K8UA 2LVJA 3KO0A 2Q4UA 5HKZA 1B1GA 1ZUZA 1TTXA 5AXIA 1CMGA 1G8IA 2LHIA 1S6IA 2LVIA 4GNKB 5G08A 1JFKA 2KGRA 1YUTA 2ZN9A 2ISDA 1CLBA 1SR6C 2LVKA 1RTP1 2KYCA 3NSKA 1K90D 1B8CA 1M45A 4HRGA 5DKRA 3EK4A 1UHIA 2JXCA 3JTDC 3AKBA 1LKJA 2LP2A 3KEVA 3PATA 1KWOC 5B8IB 1H4BA 1WY9A 4Q04A 3FWBA 4MLWA 1F54A 3SG2A 1WDCC 1IJ6A 1DTLA 1Y1XA 2K7OA 2L5XB 1PALA 1OOJA 2LMTA 2MJWB 2L51A 3TDUA 1XFYO 3VRPA 3PALA 1WLZA 1NX0A 2JU0A 2F3ZA 2QACA 5KSZA 1AUIB 1C07A 3TZ1A 2WCBA 3TDIA 2KSPA 1QV1A 4AOMA 1NP8A 1CLLA 2K2FA 1XK4C 1PK0D 1V1FA 2F2PA 2LMUA 5CSNA 2JT3A 2K8MB 1AJ5A 3CWGA 4ORBB 2E30A 5D7FA 2LHLA 2LVVA 1CDLA 5HKYA 1YUSA 1UHNA 1F55A 4DCKA 1SW8A 3AKAA 3BYAA 2M3WA 4AQIA 1DGVA 2AMIA 2JULA 3VGOA 3NSIA 4WQ2A 1QXPA 2V53A 4YI9A 2MAZA 1EG4A 1WRLA 1ZFSA 4YGEB 1R2UA 1TCOB 3LCPC 3GK2A 4JWQA 4GAOA 2FOTA 2ZNDA 3D10A 4M2OA 4MEWA 3QRXA 4M2PA 2M1KB 1OZOA 4ICBA 4A4CA 3BOWB 1BR4B 3FWCA 4FQOA 2CCMA 1Q80A 1QS7A 4GBAA 2KDHA 1AJ4A 1ALWA 1IGVA 4N5XA 1NIWA 1N0YA 5FYXA 2AAOA 1NCYA 1QVIZ 1XFUO 1H8BA 1F4OA 1J7PA 2JQ6A 1SBJA 2WOSA 2K0JA 2LV7A 1CLMA 3LK1A 4USLA 4ZCVA 4PHKA 1CKKA 2KQYA 4YGDB 3DF0B 1SCMB 2JZIA 3SG4A 1QVIY 2KBMA 2EHBA 2LANA 2WNDA 3DVEA 2JRFA 2WORA 1UURA 2FJUB 3HX4A 1YRUB 5HKWA 2TN4A 3EVUA 4BY5A 2NCOA 2OPOA 3LL8B 1J55A 3EK7A 2LUCA 2F3YA 1OZSA 2O60A 1CTRA 1RFJA 1GQMA 2JNFA 5I2QA 1XK4A 4C0KA 2JOJA 4PE0A 3LK0A 3CZTX 3TUYC 1BMOA 1QX2A 1YRTB 1CFCA 3JVTB 2F33A 1K93D 3WNXB 1QIWA 4I5KA 1QJTA 2F8PA 1B4CA 1SCMC 1S5GZ 1CDNA 2WCEA 2LE9B 1XO5A 1R6PA 1KQVA 4P5OE 5AFPA 2M0RA 3EVRA 4MRYA 1YTZC 1J7OA 2A4JA 3RM1A 2GGZA 2WC8A 2COLB 1S5GY 4DIRA 4XJKA 4CFQA 1YURA 3PM8A 2LC5A 4C0JA 1KWOB 2KYFA 4MBEA 1S6JA 2KOTA 1F70A 3VRRA 1TRFA 2K7BA 1BJFA 1WDCB 3IQOA 1PVBA 5BPJA 3CR2A 2I7AA 2HPSA 1RROA 3JVTC 4I5JA 3CR4X 1LA3A 1OQPA 1PSRA 2PVBA 4PHMA 3WHTB 3D0YB 1OMRA 1B9AA 1VRKA 4DRWA 1KCYA 1K95A 2MHHA 2M9GA 2K2AA 2BCXA 1ZOTB 2KI4B 4OKHA 2LMVA 1J7RA 1Y6WA 3AAJA 3EKJA 3BOWA 1SK6D 3DVJA 4HSZA 4U8DA 4MZKA 4HREE 1GGZA 1C7VA 4N1GA 2LLTA 1A75B 4JPZB 3IQQA 1BU3A 2PRUA 3SG5A 1XFXO 1FI6A 4UPGA 2H61C 4XJKB 3OB1B 1CB1A 1NCXA 3TS5B 1LXFC 1PULA 1S3PA 1SL9A 2BBMA 2KHNA 2HETA 1N65A 2Y4QA 4JQ0D 2LLUA 2M8UA 5I2LA 3DF0A 5HLOA 5K89A 4PCWA 1Y1AA 4PHJA 2FCEA 2KI4C 1XYDA 4MRXA 2KFGA 3AAKA 2M97A 3A8RA 1MUXA 1U5IB 4QJ5B 2JC2A 1QX7A 1EG3A 3EKHA 2KAXA 1KSOA 1CFDA 5DKQA 1J7QA 1IG5A 1DGUA 4PALA 1UUSA 1DT7B 4MZLA 1YR5A 2HQ8A 3FS7A 3KHEA 3KF9A 1OMVA 3PFVA 2IS9A 1TNXA 1DJZA 3I5FB 5DKNA 3NXAA 4A4BA 5CSIA 1AVSA 5ER4X 2GGMA 3TS5C 1EXRA 1UHJA 2NLNA 2RGIA 2EC6B 2NCPA 2R2IA 2LLSA 1QTXA 1XFWO 4NDBA 1DJXA 2NXQA 1JWDA 1NYAA 5PALA 1KFXL 1NCZA 2OTGB 3FIAA 2MLFC 1PSBA 4M2QA 5JJGA 2Y5IA 1YX7A 3TUYB 1JC2A 1WRKA 2M1UA 1TCFA 1K9PA 4HRHA 1DVIA 4AQJA 1GJYA 2ZNEA 1MWNA 1TNPA 4ETOA 1QATA 1L2OB 2CNPA 3WXAA 1B8RA 2DOQA 4DUQA 1IKUA 2I2RE 1E8AA 1KSMA 1NSHA 1QIVA 1SYMA 3I5HB 1LA0A 1BT6A 1ODBA 3I5FC 1X02A 2BBNA 2ZN8A 2CT9A 3O4YA 2SASA 1CNPA 1B8LA 2H61A 2EC6C 1RWYA 1K94A 2ZRSA 3I5IB 4ORAB 4YGAA 4F0ZB 1JF2A 1MR8A 2OTGC 5D69A 3D0YA 3PLFB 5CPVA 4R1EA 1XA5A 2LP3A 3BQ3A 2JXLA 3EK8A 2CBLA 1RECA 1S1EA 3A4UB 3WHUB 2Q91A 1FW4A 1JUOA 1LINA 3PSRA 4GUKA 1J1EA 1JF0A 3F45A 4ORCB 4PDZA 1A2XA 1KFUL 1L2OC 4CFRA 1RK9A 1OE9B 5TNCA 1JBAA 2I94A 1B7TZ 1G33A 3EVVA 1DMOA 3I5GB 3BXKA 3I5HC 5ER5A 4YGCB 1F71A 1PRWA 3RLZA 2AUCA 3IF7A 1A75A 1A4PA 1NX3A 2JT8A 1DJYA 1RJVA 3OHMB 2F2OA 1M46A 1TNQA 3BUOB 5IBWA 4D1EA 1FBVA 3I5IC 1B7TY 2BL0C 2CXJA 2P6BB 1XFZO 2KNEA 5I8NA 3C1VA 1B47A 2BE6A 1SRAA 1JFJA 4QJ3B 2BECA 2LAPA 1FI5A 4C0LA 1HT9A 1YX8A 1QASA 5AERA 4N1FA 4P2YB 3GK4X 5AEQA 1S26D 1BG1A 4DS7A 1Y1UA 2Y1MA 4GFTA 4TNCA 5F6TA 1U5IA 2KQ6A 1MHOA 1W7IB 2LNKA 1A03A 1BLQA 5CSJA 1KK8C 2L98A 3CR5X 1QX5B 1M39A 3GOFA 3O6BA 1BR1B 3I5GC 4MVFA 2JPTA 2I18A 1LVCD 1SNLA 4GGFC 1SL7A 3BUMB 3TDZA 1K9UA 4OVNF 1IRJA 5CSFA 1HQVA 1KQMB 2M29A 3SIBA 1M31A 2O5GA 1J1DA 4CIDA 1IJ5A 1N2DA 2WCFA 1DJGA 2MRDA 1MXEA 2NZ0A 2LUXA 1Y0VH 1NWDA 2CTNA 2M49B 2MLEC 4QJ4B 1KK7Z 2FCDA 5J3XA 4NDCA 2HF5A 4PE7A 2PALA 1UHKA 4I5NB 4MZJA 1EH2A 1QV0A 1DJHA 1K9KA 1KK7Y 1DJIA 1M63B 1DF0B 2ZFDA 3BUNB 1EL4A 1UP5A 1KQMC 2EGDA 4YI8A 2GV5A 2PSRA 4L9MA 1SPYA 3OB2B 1YVLA 2VRGA 5JOLA 2LCPA 5GQQC 4WRIA 4GGNA 3E3RA 2K7DA 2Y1NA 5KU1A 5HYDA 1GGWA 3CGAA 2K61A 1YUUA 3NSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OX5 A;  3VRO A;  1L7Z A;  1CDM A;  1KFU S;  2BKI B;  3O78 A;  4CLN A;  4YRU A;  1BOC A;  1TIZ A;  1CMF A;  2KAY A;  2BKH B;  1WLM A;  3BUW B;  2SCP A;  1CFP A;  1NX2 A;  1ZAC A;  1IWQ A;  1UWO A;  2KBI A;  1S6C A;  1NX1 A;  3ZWH A;  2ZKM X;  3GK1 A;  1SY9 A;  4PE4 A;  1SCV A;  2L4I A;  4GGF A;  3ICB A;  1TOP A;  4XYN A;  2M7N A;  1PVA A;  1G4Y R;  2MBX A;  1CDP A;  2BCA A;  1NUB A;  3OX6 A;  2JWW A;  2JT0 A;  3K21 A;  1TNW A;  3SG7 A;  3VRQ A;  1IH0 A;  2KI6 C;  1XFV O;  1CFF A;  2PMY A;  1MQ1 A;  1TN4 A;  4NQG A;  2L2E A;  1ZMZ A;  3MSE B;  1SKT A;  3H4S E;  3SG6 A;  2E6W A;  3VRN A;  2BL0 B;  1XVJ A;  2KI6 D;  1FPW A;  1OMD A;  3BUX B;  2JTZ A;  4OR9 B;  2M7L A;  4YBH B;  1BF5 A;  3DD4 A;  2HQW A;  1ALV A;  4IL1 A;  1W7J B;  1AP4 A;  3OP0 A;  5KTY A;  1F8H A;  2PAS A;  3M0W A;  1QLK A;  2OS8 B;  1AK8 A;  4PE1 A;  5AAN A;  1CM4 A;  2BE4 A;  2G9B A;  1KK8 B;  2B1U A;  1OSA A;  4ZCU A;  2JTT A;  2MA2 A;  2KAV A;  3KPX A;  4YGB B;  3PN7 B;  1JSA A;  3O2P A;  4OV2 A;  2L50 A;  1SL8 A;  3CTN A;  1K2H A;  1MF8 B;  1QLS A;  4PHN A;  4E68 A;  3HCM A;  2BCB A;  1SMG A;  2D8N A;  2KGB C;  2KFH A;  1F4Q A;  1V1G A;  3LLE A;  5HLV A;  3SIA A;  1WRZ A;  2G2B A;  1S36 A;  2L4H A;  4GPL B;  3DVK A;  1DF0 A;  1D1O A;  1UHH A;  1A29 A;  1C7W A;  1IQ5 A;  2K7C A;  3SJS A;  1YVH A;  2H2K A;  2OS8 C;  1SR6 B;  3SG3 A;  4BY4 A;  2JNX A;  2ZRT A;  3CS1 A;  1K96 A;  1BOD A;  1CM1 A;  4WQ3 A;  4FTG A;  1FF1 A;  4MSP A;  1IQ3 A;  3JTD B;  1DJW A;  2L0P A;  1AHR A;  2QPT A;  3PN7 C;  4I5L B;  2KFF A;  4CPV A;  1NPQ A;  2LM5 A;  4OCI A;  4NDD A;  3DVM A;  3NSO A;  1MXL C;  3ZNI A;  3CLN A;  1EJ3 A;  1KFX S;  4MN0 A;  5I2O A;  1K8U A;  2LVJ A;  3KO0 A;  2Q4U A;  5HKZ A;  1B1G A;  1ZUZ A;  1TTX A;  5AXI A;  1CMG A;  1G8I A;  2LHI A;  1S6I A;  2LVI A;  4GNK B;  5G08 A;  1JFK A;  2KGR A;  1YUT A;  2ZN9 A;  2ISD A;  1CLB A;  1SR6 C;  2LVK A;  1RTP 1;  2KYC A;  3NSK A;  1K90 D;  1B8C A;  1M45 A;  4HRG A;  5DKR A;  3EK4 A;  1UHI A;  2JXC A;  3JTD C;  3AKB A;  1LKJ A;  2LP2 A;  3KEV A;  3PAT A;  1KWO C;  5B8I B;  1H4B A;  1WY9 A;  4Q04 A;  3FWB A;  4MLW A;  1F54 A;  3SG2 A;  1WDC C;  1IJ6 A;  1DTL A;  1Y1X A;  2K7O A;  2L5X B;  1PAL A;  1OOJ A;  2LMT A;  2MJW B;  2L51 A;  3TDU A;  1XFY O;  3VRP A;  3PAL A;  1WLZ A;  1NX0 A;  2JU0 A;  2F3Z A;  2QAC A;  5KSZ A;  1AUI B;  1C07 A;  3TZ1 A;  2WCB A;  3TDI A;  2KSP A;  1QV1 A;  4AOM A;  1NP8 A;  1CLL A;  2K2F A;  1XK4 C;  1PK0 D;  1V1F A;  2F2P A;  2LMU A;  5CSN A;  2JT3 A;  2K8M B;  1AJ5 A;  3CWG A;  4ORB B;  2E30 A;  5D7F A;  2LHL A;  2LVV A;  1CDL A;  5HKY A;  1YUS A;  1UHN A;  1F55 A;  4DCK A;  1SW8 A;  3AKA A;  3BYA A;  2M3W A;  4AQI A;  1DGV A;  2AMI A;  2JUL A;  3VGO A;  3NSI A;  4WQ2 A;  1QXP A;  2V53 A;  4YI9 A;  2MAZ A;  1EG4 A;  1WRL A;  1ZFS A;  4YGE B;  1R2U A;  1TCO B;  3LCP C;  3GK2 A;  4JWQ A;  4GAO A;  2FOT A;  2ZND A;  3D10 A;  4M2O A;  4MEW A;  3QRX A;  4M2P A;  2M1K B;  1OZO A;  4ICB A;  4A4C A;  3BOW B;  1BR4 B;  3FWC A;  4FQO A;  2CCM A;  1Q80 A;  1QS7 A;  4GBA A;  2KDH A;  1AJ4 A;  1ALW A;  1IGV A;  4N5X A;  1NIW A;  1N0Y A;  5FYX A;  2AAO A;  1NCY A;  1QVI Z;  1XFU O;  1H8B A;  1F4O A;  1J7P A;  2JQ6 A;  1SBJ A;  2WOS A;  2K0J A;  2LV7 A;  1CLM A;  3LK1 A;  4USL A;  4ZCV A;  4PHK A;  1CKK A;  2KQY A;  4YGD B;  3DF0 B;  1SCM B;  2JZI A;  3SG4 A;  1QVI Y;  2KBM A;  2EHB A;  2LAN A;  2WND A;  3DVE A;  2JRF A;  2WOR A;  1UUR A;  2FJU B;  3HX4 A;  1YRU B;  5HKW A;  2TN4 A;  3EVU A;  4BY5 A;  2NCO A;  2OPO A;  3LL8 B;  1J55 A;  3EK7 A;  2LUC A;  2F3Y A;  1OZS A;  2O60 A;  1CTR A;  1RFJ A;  1GQM A;  2JNF A;  5I2Q A;  1XK4 A;  4C0K A;  2JOJ A;  4PE0 A;  3LK0 A;  3CZT X;  3TUY C;  1BMO A;  1QX2 A;  1YRT B;  1CFC A;  3JVT B;  2F33 A;  1K93 D;  3WNX B;  1QIW A;  4I5K A;  1QJT A;  2F8P A;  1B4C A;  1SCM C;  1S5G Z;  1CDN A;  2WCE A;  2LE9 B;  1XO5 A;  1R6P A;  1KQV A;  4P5O E;  5AFP A;  2M0R A;  3EVR A;  4MRY A;  1YTZ C;  1J7O A;  2A4J A;  3RM1 A;  2GGZ A;  2WC8 A;  2COL B;  1S5G Y;  4DIR A;  4XJK A;  4CFQ A;  1YUR A;  3PM8 A;  2LC5 A;  4C0J A;  1KWO B;  2KYF A;  4MBE A;  1S6J A;  2KOT A;  1F70 A;  3VRR A;  1TRF A;  2K7B A;  1BJF A;  1WDC B;  3IQO A;  1PVB A;  5BPJ A;  3CR2 A;  2I7A A;  2HPS A;  1RRO A;  3JVT C;  4I5J A;  3CR4 X;  1LA3 A;  1OQP A;  1PSR A;  2PVB A;  4PHM A;  3WHT B;  3D0Y B;  1OMR A;  1B9A A;  1VRK A;  4DRW A;  1KCY A;  1K95 A;  2MHH A;  2M9G A;  2K2A A;  2BCX A;  1ZOT B;  2KI4 B;  4OKH A;  2LMV A;  1J7R A;  1Y6W A;  3AAJ A;  3EKJ A;  3BOW A;  1SK6 D;  3DVJ A;  4HSZ A;  4U8D A;  4MZK A;  4HRE E;  1GGZ A;  1C7V A;  4N1G A;  2LLT A;  1A75 B;  4JPZ B;  3IQQ A;  1BU3 A;  2PRU A;  3SG5 A;  1XFX O;  1FI6 A;  4UPG A;  2H61 C;  4XJK B;  3OB1 B;  1CB1 A;  1NCX A;  3TS5 B;  1LXF C;  1PUL A;  1S3P A;  1SL9 A;  2BBM A;  2KHN A;  2HET A;  1N65 A;  2Y4Q A;  4JQ0 D;  2LLU A;  2M8U A;  5I2L A;  3DF0 A;  5HLO A;  5K89 A;  4PCW A;  1Y1A A;  4PHJ A;  2FCE A;  2KI4 C;  1XYD A;  4MRX A;  2KFG A;  3AAK A;  2M97 A;  3A8R A;  1MUX A;  1U5I B;  4QJ5 B;  2JC2 A;  1QX7 A;  1EG3 A;  3EKH A;  2KAX A;  1KSO A;  1CFD A;  5DKQ A;  1J7Q A;  1IG5 A;  1DGU A;  4PAL A;  1UUS A;  1DT7 B;  4MZL A;  1YR5 A;  2HQ8 A;  3FS7 A;  3KHE A;  3KF9 A;  1OMV A;  3PFV A;  2IS9 A;  1TNX A;  1DJZ A;  3I5F B;  5DKN A;  3NXA A;  4A4B A;  5CSI A;  1AVS A;  5ER4 X;  2GGM A;  3TS5 C;  1EXR A;  1UHJ A;  2NLN A;  2RGI A;  2EC6 B;  2NCP A;  2R2I A;  2LLS A;  1QTX A;  1XFW O;  4NDB A;  1DJX A;  2NXQ A;  1JWD A;  1NYA A;  5PAL A;  1KFX L;  1NCZ A;  2OTG B;  3FIA A;  2MLF C;  1PSB A;  4M2Q A;  5JJG A;  2Y5I A;  1YX7 A;  3TUY B;  1JC2 A;  1WRK A;  2M1U A;  1TCF A;  1K9P A;  4HRH A;  1DVI A;  4AQJ A;  1GJY A;  2ZNE A;  1MWN A;  1TNP A;  4ETO A;  1QAT A;  1L2O B;  2CNP A;  3WXA A;  1B8R A;  2DOQ A;  4DUQ A;  1IKU A;  2I2R E;  1E8A A;  1KSM A;  1NSH A;  1QIV A;  1SYM A;  3I5H B;  1LA0 A;  1BT6 A;  1ODB A;  3I5F C;  1X02 A;  2BBN A;  2ZN8 A;  2CT9 A;  3O4Y A;  2SAS A;  1CNP A;  1B8L A;  2H61 A;  2EC6 C;  1RWY A;  1K94 A;  2ZRS A;  3I5I B;  4ORA B;  4YGA A;  4F0Z B;  1JF2 A;  1MR8 A;  2OTG C;  5D69 A;  3D0Y A;  3PLF B;  5CPV A;  4R1E A;  1XA5 A;  2LP3 A;  3BQ3 A;  2JXL A;  3EK8 A;  2CBL A;  1REC A;  1S1E A;  3A4U B;  3WHU B;  2Q91 A;  1FW4 A;  1JUO A;  1LIN A;  3PSR A;  4GUK A;  1J1E A;  1JF0 A;  3F45 A;  4ORC B;  4PDZ A;  1A2X A;  1KFU L;  1L2O C;  4CFR A;  1RK9 A;  1OE9 B;  5TNC A;  1JBA A;  2I94 A;  1B7T Z;  1G33 A;  3EVV A;  1DMO A;  3I5G B;  3BXK A;  3I5H C;  5ER5 A;  4YGC B;  1F71 A;  1PRW A;  3RLZ A;  2AUC A;  3IF7 A;  1A75 A;  1A4P A;  1NX3 A;  2JT8 A;  1DJY A;  1RJV A;  3OHM B;  2F2O A;  1M46 A;  1TNQ A;  3BUO B;  5IBW A;  4D1E A;  1FBV A;  3I5I C;  1B7T Y;  2BL0 C;  2CXJ A;  2P6B B;  1XFZ O;  2KNE A;  5I8N A;  3C1V A;  1B47 A;  2BE6 A;  1SRA A;  1JFJ A;  4QJ3 B;  2BEC A;  2LAP A;  1FI5 A;  4C0L A;  1HT9 A;  1YX8 A;  1QAS A;  5AER A;  4N1F A;  4P2Y B;  3GK4 X;  5AEQ A;  1S26 D;  1BG1 A;  4DS7 A;  1Y1U A;  2Y1M A;  4GFT A;  4TNC A;  5F6T A;  1U5I A;  2KQ6 A;  1MHO A;  1W7I B;  2LNK A;  1A03 A;  1BLQ A;  5CSJ A;  1KK8 C;  2L98 A;  3CR5 X;  1QX5 B;  1M39 A;  3GOF A;  3O6B A;  1BR1 B;  3I5G C;  4MVF A;  2JPT A;  2I18 A;  1LVC D;  1SNL A;  4GGF C;  1SL7 A;  3BUM B;  3TDZ A;  1K9U A;  4OVN F;  1IRJ A;  5CSF A;  1HQV A;  1KQM B;  2M29 A;  3SIB A;  1M31 A;  2O5G A;  1J1D A;  4CID A;  1IJ5 A;  1N2D A;  2WCF A;  1DJG A;  2MRD A;  1MXE A;  2NZ0 A;  2LUX A;  1Y0V H;  1NWD A;  2CTN A;  2M49 B;  2MLE C;  4QJ4 B;  1KK7 Z;  2FCD A;  5J3X A;  4NDC A;  2HF5 A;  4PE7 A;  2PAL A;  1UHK A;  4I5N B;  4MZJ A;  1EH2 A;  1QV0 A;  1DJH A;  1K9K A;  1KK7 Y;  1DJI A;  1M63 B;  1DF0 B;  2ZFD A;  3BUN B;  1EL4 A;  1UP5 A;  1KQM C;  2EGD A;  4YI8 A;  2GV5 A;  2PSR A;  4L9M A;  1SPY A;  3OB2 B;  1YVL A;  2VRG A;  5JOL A;  2LCP A;  5GQQ C;  4WRI A;  4GGN A;  3E3R A;  2K7D A;  2Y1N A;  5KU1 A;  5HYD A;  1GGW A;  3CGA A;  2K61 A;  1YUU A;  3NSL A; 
#chains in the Genus database with same CATH topology
 3OX5 A;  3VRO A;  4KYN A;  1L7Z A;  1CDM A;  1KFU S;  2BKI B;  3O78 A;  3FE9 A;  4CLN A;  4YRU A;  1BOC A;  2WCH A;  1TIZ A;  1CMF A;  2KAY A;  2BKH B;  1WLM A;  3BUW B;  2BAP A;  2SCP A;  3BFB A;  1CFP A;  1NX2 A;  1ZAC A;  1IWQ A;  1UWO A;  2KBI A;  1S6C A;  1NX1 A;  2KLE A;  3SS4 A;  3ZWH A;  2ZKM X;  3GK1 A;  1SY9 A;  4PE4 A;  3CZ0 A;  1SCV A;  2L4I A;  3NHT A;  3ICB A;  4GGF A;  1TOP A;  4XYN A;  2M7N A;  1PVA A;  1G4Y R;  2MBX A;  3B87 A;  2L2C A;  1CDP A;  2BCA A;  1NUB A;  3OX6 A;  2JWW A;  2JT0 A;  3K21 A;  1TNW A;  3SG7 A;  3VRQ A;  1IH0 A;  3DZT A;  2KI6 C;  1XFV O;  1CFF A;  2PMY A;  1MQ1 A;  1TN4 A;  3OBV A;  2L2E A;  1ZMZ A;  3MSE B;  4NQG A;  1SKT A;  3H4S E;  3SG6 A;  2E6W A;  3VRN A;  2BL0 B;  1XVJ A;  2KI6 D;  1FPW A;  1OMD A;  3BUX B;  3PM2 A;  2JTZ A;  4OR9 B;  2M7L A;  4YBH B;  1LS8 A;  1BF5 A;  1OOH A;  2HQW A;  3DD4 A;  1ALV A;  4IL1 A;  1W7J B;  1AP4 A;  3CZ2 A;  3OP0 A;  5KTY A;  3L4L A;  1F8H A;  2PAS A;  3M0W A;  1TUJ A;  1QLK A;  2OS8 B;  1AK8 A;  4PE1 A;  2QEO A;  5AAN A;  1CM4 A;  2BE4 A;  2G9B A;  1KK8 B;  2B1U A;  1OSA A;  4ZCU A;  2JTT A;  2MA2 A;  2KAV A;  3KPX A;  4YGB B;  3PN7 B;  4F7F A;  1JSA A;  3O2P A;  3D75 A;  4OV2 A;  3SS5 A;  2L50 A;  1SL8 A;  3CTN A;  1K2H A;  1MF8 B;  1QLS A;  4PHN A;  4E68 A;  3DYE A;  3HCM A;  2BCB A;  1SMG A;  2D8N A;  2KGB C;  2KFH A;  1F4Q A;  1V1G A;  3LLE A;  5HLV A;  3SIA A;  1WRZ A;  2G2B A;  1S36 A;  2L4H A;  4GPL B;  3DVK A;  1DF0 A;  1D1O A;  1UHH A;  1A29 A;  1C7W A;  1IQ5 A;  2K7C A;  3SJS A;  1YVH A;  1OW4 A;  2GTE A;  1SR6 B;  2H2K A;  2OS8 C;  2WCK A;  2JNX A;  3BFA A;  3SG3 A;  4BY4 A;  2ZRT A;  3CS1 A;  1K96 A;  1BOD A;  1CM1 A;  4WQ3 A;  4FTG A;  2P70 A;  1FF1 A;  4MSP A;  1IQ3 A;  3JTD B;  1DJW A;  2L0P A;  1AHR A;  2QPT A;  3PN7 C;  4I5L B;  2KFF A;  4CPV A;  1NPQ A;  3R1P A;  2LM5 A;  2ERB A;  4OCI A;  4NDD A;  3DVM A;  3NSO A;  1MXL C;  3ZNI A;  3CLN A;  1EJ3 A;  1KFX S;  4MN0 A;  3BJH A;  1K8U A;  2LVJ A;  3KO0 A;  2Q4U A;  5HKZ A;  5I2O A;  1B1G A;  1ZUZ A;  1TTX A;  5AXI A;  4JKT A;  1CMG A;  1G8I A;  3S0A A;  1XFR A;  2LHI A;  1S6I A;  2LVI A;  4GNK B;  5G08 A;  1JFK A;  2KGR A;  1IIO A;  3UO9 A;  1YUT A;  2ZN9 A;  2ISD A;  3S0B A;  1SR6 C;  1CLB A;  2LVK A;  1RTP 1;  2KYC A;  3NSK A;  1K90 D;  1B8C A;  3L4A A;  1M45 A;  4HRG A;  2WCM A;  5DKR A;  3EK4 A;  1UHI A;  2JXC A;  3JTD C;  3AKB A;  1ORG A;  4INX A;  1LKJ A;  2LP2 A;  3KEV A;  3PAT A;  1KWO C;  5B8I B;  1H4B A;  1WY9 A;  3UNW A;  4Q04 A;  3FWB A;  4MLW A;  1F54 A;  3SG2 A;  1WDC C;  1IJ6 A;  1DTL A;  1Y1X A;  2K7O A;  2L5X B;  1PAL A;  1OOJ A;  2LMT A;  2MJW B;  2L51 A;  3TDU A;  1XFY O;  3VRP A;  3PAL A;  1WLZ A;  1NX0 A;  2JU0 A;  2F3Z A;  2QAC A;  5KSZ A;  1AUI B;  1C07 A;  3N7H A;  2WCB A;  3TZ1 A;  3TDI A;  2KSP A;  1QV1 A;  4AOM A;  1NP8 A;  1CLL A;  2K2F A;  1XK4 C;  1PK0 D;  1V1F A;  2F2P A;  2LMU A;  5CSN A;  2JT3 A;  2K8M B;  1AJ5 A;  3CWG A;  4ORB B;  2E30 A;  5D7F A;  2LHL A;  2LVV A;  1CDL A;  5HKY A;  2QDI A;  1YUS A;  3FE8 A;  1UHN A;  2JPO A;  1F55 A;  3R72 A;  4DCK A;  1SW8 A;  2H8V A;  3AKA A;  2M3W A;  3BYA A;  4AQI A;  1DGV A;  2AMI A;  2JUL A;  3VGO A;  3NSI A;  4WQ2 A;  1QXP A;  2V53 A;  4YI9 A;  2MAZ A;  1EG4 A;  1WRL A;  1ZFS A;  4YGE B;  1R2U A;  1TCO B;  3LCP C;  3GK2 A;  4JWQ A;  4GAO A;  2FOT A;  2ZND A;  3D10 A;  4M2O A;  4MEW A;  3QRX A;  4M2P A;  2M1K B;  1OZO A;  4ICB A;  4A4C A;  3BOW B;  1BR4 B;  3FWC A;  4FQO A;  2CCM A;  1Q80 A;  1QS7 A;  4GBA A;  2KDH A;  1AJ4 A;  1ALW A;  1IGV A;  4N5X A;  1NIW A;  1N0Y A;  5FYX A;  2AAO A;  1NCY A;  1QVI Z;  3IVT A;  1XFU O;  1H8B A;  1F4O A;  3DY9 A;  1J7P A;  2JQ6 A;  1SBJ A;  2WOS A;  2K0J A;  2LV7 A;  1DEK A;  1CLM A;  3LK1 A;  4USL A;  4ZCV A;  4PHK A;  1CKK A;  2KQY A;  3D77 A;  4YGD B;  3DF0 B;  1SCM B;  3B88 A;  2JZI A;  3SG4 A;  4IJ7 A;  1QVI Y;  2KBM A;  2EHB A;  2LAN A;  2WND A;  2KLD A;  2JRF A;  2WOR A;  1UUR A;  2FJU B;  3CDN A;  3DVE A;  3HX4 A;  1YRU B;  4DRW A;  5HKW A;  2TN4 A;  3EVU A;  3O4X A;  4BY5 A;  2NCO A;  2OPO A;  3LL8 B;  1J55 A;  3EK7 A;  2LUC A;  2F3Y A;  1OZS A;  2O60 A;  1CTR A;  1RFJ A;  2QEH A;  1GQM A;  3DXL A;  2JNF A;  5I2Q A;  1XK4 A;  4C0K A;  2JOJ A;  4PE0 A;  3LK0 A;  3CZT X;  3TUY C;  5HL1 A;  1BMO A;  1QX2 A;  1YRT B;  1CFC A;  3JVT B;  2F33 A;  1K93 D;  3WNX B;  1QIW A;  4I5K A;  1QJT A;  2F8P A;  1B4C A;  1SCM C;  1S5G Z;  1CDN A;  2WCE A;  2LE9 B;  3S0D A;  1XO5 A;  1R6P A;  1DC1 A;  1KQV A;  4P5O E;  5AFP A;  2M0R A;  3EVR A;  4MRY A;  1YTZ C;  1J7O A;  1GM0 A;  2A4J A;  3RM1 A;  2GGZ A;  2WC8 A;  2COL B;  1S5G Y;  4DIR A;  3CYZ A;  4XJK A;  1YUR A;  4CFQ A;  3PM8 A;  2LC5 A;  4C0J A;  3VB1 A;  1KWO B;  2PYQ A;  2KYF A;  4MBE A;  1S6J A;  2KOT A;  1F70 A;  3VRR A;  1TRF A;  2K7B A;  1BJF A;  1OOI X;  1WDC B;  3IQO A;  1PVB A;  5BPJ A;  5D3O A;  3CR2 A;  1OOF A;  2I7A A;  2HPS A;  1TWO A;  1RRO A;  3JVT C;  4I5J A;  2WC5 A;  5I94 A;  3CR4 X;  4JD9 A;  1LA3 A;  1TUZ A;  1OQP A;  1PSR A;  1C3Z A;  2K60 A;  2PVB A;  3D0Y B;  1OMR A;  1B9A A;  1VRK A;  4PHM A;  3WHT B;  1K95 A;  2MHH A;  2M9G A;  1C3Y A;  2K2A A;  2BCX A;  2BNX A;  1ZOT B;  2KI4 B;  4OKH A;  2LMV A;  2FJY A;  1J7R A;  2L5Y A;  1Y6W A;  3AAJ A;  3EKJ A;  3BOW A;  1SK6 D;  3DVJ A;  4HSZ A;  4U8D A;  1DQE A;  4MZK A;  5EL2 A;  4HRE E;  1GGZ A;  1C7V A;  4N1G A;  2LLT A;  1P28 A;  1A75 B;  4JPZ B;  3IQQ A;  1BU3 A;  2PRU A;  3SG5 A;  1XFX O;  1FI6 A;  4UPG A;  2H61 C;  4XJK B;  3OB1 B;  1CB1 A;  3CZ1 A;  1NCX A;  3TS5 B;  1LXF C;  1PUL A;  1S3P A;  1SL9 A;  2BBM A;  2KHN A;  5FI7 A;  2HET A;  1N65 A;  2Y4Q A;  4JQ0 D;  1DEL A;  2LLU A;  2M8U A;  5I2L A;  3DF0 A;  5HLO A;  5K89 A;  4PCW A;  1Y1A A;  4PHJ A;  5DIC A;  2FCE A;  2KI4 C;  3D78 A;  5FI6 A;  1OOG A;  1XYD A;  2QEV A;  2KFG A;  3AAK A;  4MRX A;  2M97 A;  3A8R A;  1MUX A;  1U5I B;  4QJ5 B;  3S0E A;  2JC2 A;  1QX7 A;  1EG3 A;  3EKH A;  2KAX A;  1KSO A;  1CFD A;  5DKQ A;  1J7Q A;  1IG5 A;  1DGU A;  4OZD A;  4PAL A;  1UUS A;  1DT7 B;  4MZL A;  1YR5 A;  2HQ8 A;  3FS7 A;  3KHE A;  3D76 A;  1OMV A;  3KF9 A;  3PFV A;  2P71 A;  2IS9 A;  1TNX A;  2WC6 A;  1DJZ A;  3I5F B;  5DKN A;  3NXA A;  4A4B A;  5CSI A;  1AVS A;  5ER4 X;  2GGM A;  3TS5 C;  1EXR A;  1UHJ A;  2NLN A;  2RGI A;  2EC6 B;  2NCP A;  2R2I A;  2LLS A;  1QTX A;  1XFW O;  3NHI A;  1DJX A;  2NXQ A;  4NDB A;  3R1O A;  1JWD A;  1NYA A;  5PAL A;  1KFX L;  3RZS A;  1NCZ A;  2OTG B;  3BFH A;  3FIA A;  2MLF C;  1PSB A;  4M2Q A;  5JJG A;  2Y5I A;  1YX7 A;  3TUY B;  1JC2 A;  1WRK A;  2M1U A;  1TCF A;  1K9P A;  4HRH A;  1DVI A;  4PT1 A;  1GJY A;  2ZNE A;  1MWN A;  1TNP A;  4AQJ A;  1QAT A;  4ETO A;  2WCL A;  1L2O B;  2CNP A;  3WXA A;  1B8R A;  2DOQ A;  4DUQ A;  1IKU A;  3L47 A;  2I2R E;  1E8A A;  1KSM A;  1NSH A;  1QIV A;  1SYM A;  3I5H B;  1LA0 A;  1BT6 A;  1ODB A;  3I5F C;  1X02 A;  2BBN A;  2ZN8 A;  2CT9 A;  3O4Y A;  2SAS A;  1CNP A;  1B8L A;  2H61 A;  2EC6 C;  1RWY A;  1K94 A;  2ZRS A;  3I5I B;  4ORA B;  3FE6 A;  4YGA A;  4F0Z B;  1JF2 A;  1MR8 A;  1Z4H A;  2OTG C;  5D69 A;  3D0Y A;  3PLF B;  5CPV A;  4R1E A;  1XA5 A;  2LP3 A;  3BQ3 A;  2JXL A;  3EK8 A;  2CBL A;  1REC A;  1S1E A;  3A4U B;  3WHU B;  2Q91 A;  1FW4 A;  2QEB A;  1JUO A;  1LIN A;  3PSR A;  1W9Z A;  4GUK A;  1J1E A;  1JF0 A;  3F45 A;  4ORC B;  4PDZ A;  1A2X A;  1KFU L;  1L2O C;  2KPH A;  4CFR A;  1RK9 A;  2YGU A;  3OGN A;  1OE9 B;  5TNC A;  1JBA A;  2I94 A;  1B7T Z;  1G33 A;  3EVV A;  1DMO A;  3I5G B;  3BXK A;  3I5H C;  5ER5 A;  4YGC B;  1F71 A;  1PRW A;  3RLZ A;  2AUC A;  3IF7 A;  1A75 A;  1A4P A;  1NX3 A;  2JT8 A;  1DJY A;  1RJV A;  3OHM B;  2F2O A;  1M46 A;  1TNQ A;  3Q8I A;  3BUO B;  5IBW A;  4D1E A;  1FBV A;  3I5I C;  5FI2 A;  1B7T Y;  2BL0 C;  2CXJ A;  2P6B B;  1XFZ O;  2KNE A;  5I8N A;  3B6X A;  3C1V A;  1B47 A;  2BE6 A;  1SRA A;  1JFJ A;  2WCJ A;  4QJ3 B;  2BEC A;  2LAP A;  1FI5 A;  4C0L A;  1HT9 A;  1SSE B;  1YX8 A;  1QAS A;  5AER A;  4N1F A;  4P2Y B;  3CAB A;  1QWV A;  3GK4 X;  1S26 D;  5AEQ A;  1BG1 A;  4DS7 A;  1Y1U A;  2Y1M A;  4GFT A;  4TNC A;  5F6T A;  1U5I A;  2KQ6 A;  1MHO A;  1T14 A;  1W7I B;  2LNK A;  3B86 A;  1A03 A;  5CSJ A;  1KK8 C;  1BLQ A;  2L98 A;  3CR5 X;  1QX5 B;  1M39 A;  3GOF A;  3O6B A;  1BR1 B;  3I5G C;  4MVF A;  2JPT A;  2I18 A;  1LVC D;  1SNL A;  4GGF C;  1SL7 A;  3BUM B;  3TDZ A;  1K9U A;  4OVN F;  1IRJ A;  5CSF A;  1HQV A;  1KQM B;  2M29 A;  3SIB A;  1M31 A;  2O5G A;  3S0G A;  1KCY A;  3SS3 A;  1Z2C B;  1J1D A;  3PJI A;  4CID A;  1IJ5 A;  1N2D A;  2WCF A;  1DJG A;  2MRD A;  3QME A;  1MXE A;  2NZ0 A;  2LUX A;  4FQT A;  1Y0V H;  1NWD A;  2CTN A;  2M49 B;  2MLE C;  4QJ4 B;  1KK7 Z;  2FCD A;  5J3X A;  4NDC A;  2HF5 A;  3EG5 B;  4PE7 A;  2PAL A;  1UHK A;  2PQL A;  4I5N B;  4MZJ A;  1EH2 A;  1QV0 A;  3V2L A;  1DJH A;  1K9K A;  1KK7 Y;  1DJI A;  1M63 B;  1DF0 B;  2ZFD A;  3BUN B;  3S0F A;  1EL4 A;  1UP5 A;  1KQM C;  2EGD A;  3D74 A;  4YI8 A;  2GV5 A;  2PSR A;  3D73 A;  4L9M A;  1SPY A;  3OB2 B;  1YVL A;  2VRG A;  3R1V A;  5JOL A;  2LCP A;  3NGV A;  5GQQ C;  3K1E A;  4WRI A;  4GGN A;  3E3R A;  2K7D A;  2Y1N A;  5KU1 A;  5HYD A;  1GGW A;  3B7A A;  3CGA A;  2K61 A;  1YUU A;  3NSL A;  4INW A; 
#chains in the Genus database with same CATH homology
 3OX5 A;  3VRO A;  1L7Z A;  1CDM A;  1KFU S;  2BKI B;  3O78 A;  4CLN A;  4YRU A;  1BOC A;  1TIZ A;  1CMF A;  2KAY A;  2BKH B;  1WLM A;  3BUW B;  2SCP A;  1CFP A;  1NX2 A;  1ZAC A;  1IWQ A;  1UWO A;  2KBI A;  1S6C A;  1NX1 A;  3ZWH A;  2ZKM X;  3GK1 A;  1SY9 A;  4PE4 A;  1SCV A;  2L4I A;  4GGF A;  3ICB A;  1TOP A;  4XYN A;  2M7N A;  1PVA A;  1G4Y R;  2MBX A;  1CDP A;  2BCA A;  1NUB A;  3OX6 A;  2JWW A;  2JT0 A;  3K21 A;  1TNW A;  3SG7 A;  3VRQ A;  1IH0 A;  2KI6 C;  1XFV O;  1CFF A;  2PMY A;  1MQ1 A;  1TN4 A;  4NQG A;  2L2E A;  1ZMZ A;  3MSE B;  1SKT A;  3H4S E;  3SG6 A;  2E6W A;  3VRN A;  2BL0 B;  1XVJ A;  2KI6 D;  1FPW A;  1OMD A;  3BUX B;  2JTZ A;  4OR9 B;  2M7L A;  4YBH B;  1BF5 A;  3DD4 A;  2HQW A;  1ALV A;  4IL1 A;  1W7J B;  1AP4 A;  3OP0 A;  5KTY A;  1F8H A;  2PAS A;  3M0W A;  1QLK A;  2OS8 B;  1AK8 A;  4PE1 A;  5AAN A;  1CM4 A;  2BE4 A;  2G9B A;  1KK8 B;  2B1U A;  1OSA A;  4ZCU A;  2JTT A;  2MA2 A;  2KAV A;  3KPX A;  4YGB B;  3PN7 B;  1JSA A;  3O2P A;  4OV2 A;  2L50 A;  1SL8 A;  3CTN A;  1K2H A;  1MF8 B;  1QLS A;  4PHN A;  4E68 A;  3HCM A;  2BCB A;  1SMG A;  2D8N A;  2KGB C;  2KFH A;  1F4Q A;  1V1G A;  3LLE A;  5HLV A;  3SIA A;  1WRZ A;  2G2B A;  1S36 A;  2L4H A;  4GPL B;  3DVK A;  1DF0 A;  1D1O A;  1UHH A;  1A29 A;  1C7W A;  1IQ5 A;  2K7C A;  3SJS A;  1YVH A;  2H2K A;  2OS8 C;  1SR6 B;  3SG3 A;  4BY4 A;  2JNX A;  2ZRT A;  3CS1 A;  1K96 A;  1BOD A;  1CM1 A;  4WQ3 A;  4FTG A;  1FF1 A;  4MSP A;  1IQ3 A;  3JTD B;  1DJW A;  2L0P A;  1AHR A;  2QPT A;  3PN7 C;  4I5L B;  2KFF A;  4CPV A;  1NPQ A;  2LM5 A;  4OCI A;  4NDD A;  3DVM A;  3NSO A;  1MXL C;  3ZNI A;  3CLN A;  1EJ3 A;  1KFX S;  4MN0 A;  5I2O A;  1K8U A;  2LVJ A;  3KO0 A;  2Q4U A;  5HKZ A;  1B1G A;  1ZUZ A;  1TTX A;  5AXI A;  1CMG A;  1G8I A;  2LHI A;  1S6I A;  2LVI A;  4GNK B;  5G08 A;  1JFK A;  2KGR A;  1YUT A;  2ZN9 A;  2ISD A;  1CLB A;  1SR6 C;  2LVK A;  1RTP 1;  2KYC A;  3NSK A;  1K90 D;  1B8C A;  1M45 A;  4HRG A;  5DKR A;  3EK4 A;  1UHI A;  2JXC A;  3JTD C;  3AKB A;  1LKJ A;  2LP2 A;  3KEV A;  3PAT A;  1KWO C;  5B8I B;  1H4B A;  1WY9 A;  4Q04 A;  3FWB A;  4MLW A;  1F54 A;  3SG2 A;  1WDC C;  1IJ6 A;  1DTL A;  1Y1X A;  2K7O A;  2L5X B;  1PAL A;  1OOJ A;  2LMT A;  2MJW B;  2L51 A;  3TDU A;  1XFY O;  3VRP A;  3PAL A;  1WLZ A;  1NX0 A;  2JU0 A;  2F3Z A;  2QAC A;  5KSZ A;  1AUI B;  1C07 A;  3TZ1 A;  2WCB A;  3TDI A;  2KSP A;  1QV1 A;  4AOM A;  1NP8 A;  1CLL A;  2K2F A;  1XK4 C;  1PK0 D;  1V1F A;  2F2P A;  2LMU A;  5CSN A;  2JT3 A;  2K8M B;  1AJ5 A;  3CWG A;  4ORB B;  2E30 A;  5D7F A;  2LHL A;  2LVV A;  1CDL A;  5HKY A;  1YUS A;  1UHN A;  1F55 A;  4DCK A;  1SW8 A;  3AKA A;  3BYA A;  2M3W A;  4AQI A;  1DGV A;  2AMI A;  2JUL A;  3VGO A;  3NSI A;  4WQ2 A;  1QXP A;  2V53 A;  4YI9 A;  2MAZ A;  1EG4 A;  1WRL A;  1ZFS A;  4YGE B;  1R2U A;  1TCO B;  3LCP C;  3GK2 A;  4JWQ A;  4GAO A;  2FOT A;  2ZND A;  3D10 A;  4M2O A;  4MEW A;  3QRX A;  4M2P A;  2M1K B;  1OZO A;  4ICB A;  4A4C A;  3BOW B;  1BR4 B;  3FWC A;  4FQO A;  2CCM A;  1Q80 A;  1QS7 A;  4GBA A;  2KDH A;  1AJ4 A;  1ALW A;  1IGV A;  4N5X A;  1NIW A;  1N0Y A;  5FYX A;  2AAO A;  1NCY A;  1QVI Z;  1XFU O;  1H8B A;  1F4O A;  1J7P A;  2JQ6 A;  1SBJ A;  2WOS A;  2K0J A;  2LV7 A;  1CLM A;  3LK1 A;  4USL A;  4ZCV A;  4PHK A;  1CKK A;  2KQY A;  4YGD B;  3DF0 B;  1SCM B;  2JZI A;  3SG4 A;  1QVI Y;  2KBM A;  2EHB A;  2LAN A;  2WND A;  3DVE A;  2JRF A;  2WOR A;  1UUR A;  2FJU B;  3HX4 A;  1YRU B;  5HKW A;  2TN4 A;  3EVU A;  4BY5 A;  2NCO A;  2OPO A;  3LL8 B;  1J55 A;  3EK7 A;  2LUC A;  2F3Y A;  1OZS A;  2O60 A;  1CTR A;  1RFJ A;  1GQM A;  2JNF A;  5I2Q A;  1XK4 A;  4C0K A;  2JOJ A;  4PE0 A;  3LK0 A;  3CZT X;  3TUY C;  1BMO A;  1QX2 A;  1YRT B;  1CFC A;  3JVT B;  2F33 A;  1K93 D;  3WNX B;  1QIW A;  4I5K A;  1QJT A;  2F8P A;  1B4C A;  1SCM C;  1S5G Z;  1CDN A;  2WCE A;  2LE9 B;  1XO5 A;  1R6P A;  1KQV A;  4P5O E;  5AFP A;  2M0R A;  3EVR A;  4MRY A;  1YTZ C;  1J7O A;  2A4J A;  3RM1 A;  2GGZ A;  2WC8 A;  2COL B;  1S5G Y;  4DIR A;  4XJK A;  4CFQ A;  1YUR A;  3PM8 A;  2LC5 A;  4C0J A;  1KWO B;  2KYF A;  4MBE A;  1S6J A;  2KOT A;  1F70 A;  3VRR A;  1TRF A;  2K7B A;  1BJF A;  1WDC B;  3IQO A;  1PVB A;  5BPJ A;  3CR2 A;  2I7A A;  2HPS A;  1RRO A;  3JVT C;  4I5J A;  3CR4 X;  1LA3 A;  1OQP A;  1PSR A;  2PVB A;  4PHM A;  3WHT B;  3D0Y B;  1OMR A;  1B9A A;  1VRK A;  4DRW A;  1KCY A;  1K95 A;  2MHH A;  2M9G A;  2K2A A;  2BCX A;  1ZOT B;  2KI4 B;  4OKH A;  2LMV A;  1J7R A;  1Y6W A;  3AAJ A;  3EKJ A;  3BOW A;  1SK6 D;  3DVJ A;  4HSZ A;  4U8D A;  4MZK A;  4HRE E;  1GGZ A;  1C7V A;  4N1G A;  2LLT A;  1A75 B;  4JPZ B;  3IQQ A;  1BU3 A;  2PRU A;  3SG5 A;  1XFX O;  1FI6 A;  4UPG A;  2H61 C;  4XJK B;  3OB1 B;  1CB1 A;  1NCX A;  3TS5 B;  1LXF C;  1PUL A;  1S3P A;  1SL9 A;  2BBM A;  2KHN A;  2HET A;  1N65 A;  2Y4Q A;  4JQ0 D;  2LLU A;  2M8U A;  5I2L A;  3DF0 A;  5HLO A;  5K89 A;  4PCW A;  1Y1A A;  4PHJ A;  2FCE A;  2KI4 C;  1XYD A;  4MRX A;  2KFG A;  3AAK A;  2M97 A;  3A8R A;  1MUX A;  1U5I B;  4QJ5 B;  2JC2 A;  1QX7 A;  1EG3 A;  3EKH A;  2KAX A;  1KSO A;  1CFD A;  5DKQ A;  1J7Q A;  1IG5 A;  1DGU A;  4PAL A;  1UUS A;  1DT7 B;  4MZL A;  1YR5 A;  2HQ8 A;  3FS7 A;  3KHE A;  3KF9 A;  1OMV A;  3PFV A;  2IS9 A;  1TNX A;  1DJZ A;  3I5F B;  5DKN A;  3NXA A;  4A4B A;  5CSI A;  1AVS A;  5ER4 X;  2GGM A;  3TS5 C;  1EXR A;  1UHJ A;  2NLN A;  2RGI A;  2EC6 B;  2NCP A;  2R2I A;  2LLS A;  1QTX A;  1XFW O;  4NDB A;  1DJX A;  2NXQ A;  1JWD A;  1NYA A;  5PAL A;  1KFX L;  1NCZ A;  2OTG B;  3FIA A;  2MLF C;  1PSB A;  4M2Q A;  5JJG A;  2Y5I A;  1YX7 A;  3TUY B;  1JC2 A;  1WRK A;  2M1U A;  1TCF A;  1K9P A;  4HRH A;  1DVI A;  4AQJ A;  1GJY A;  2ZNE A;  1MWN A;  1TNP A;  4ETO A;  1QAT A;  1L2O B;  2CNP A;  3WXA A;  1B8R A;  2DOQ A;  4DUQ A;  1IKU A;  2I2R E;  1E8A A;  1KSM A;  1NSH A;  1QIV A;  1SYM A;  3I5H B;  1LA0 A;  1BT6 A;  1ODB A;  3I5F C;  1X02 A;  2BBN A;  2ZN8 A;  2CT9 A;  3O4Y A;  2SAS A;  1CNP A;  1B8L A;  2H61 A;  2EC6 C;  1RWY A;  1K94 A;  2ZRS A;  3I5I B;  4ORA B;  4YGA A;  4F0Z B;  1JF2 A;  1MR8 A;  2OTG C;  5D69 A;  3D0Y A;  3PLF B;  5CPV A;  4R1E A;  1XA5 A;  2LP3 A;  3BQ3 A;  2JXL A;  3EK8 A;  2CBL A;  1REC A;  1S1E A;  3A4U B;  3WHU B;  2Q91 A;  1FW4 A;  1JUO A;  1LIN A;  3PSR A;  4GUK A;  1J1E A;  1JF0 A;  3F45 A;  4ORC B;  4PDZ A;  1A2X A;  1KFU L;  1L2O C;  4CFR A;  1RK9 A;  1OE9 B;  5TNC A;  1JBA A;  2I94 A;  1B7T Z;  1G33 A;  3EVV A;  1DMO A;  3I5G B;  3BXK A;  3I5H C;  5ER5 A;  4YGC B;  1F71 A;  1PRW A;  3RLZ A;  2AUC A;  3IF7 A;  1A75 A;  1A4P A;  1NX3 A;  2JT8 A;  1DJY A;  1RJV A;  3OHM B;  2F2O A;  1M46 A;  1TNQ A;  3BUO B;  5IBW A;  4D1E A;  1FBV A;  3I5I C;  1B7T Y;  2BL0 C;  2CXJ A;  2P6B B;  1XFZ O;  2KNE A;  5I8N A;  3C1V A;  1B47 A;  2BE6 A;  1SRA A;  1JFJ A;  4QJ3 B;  2BEC A;  2LAP A;  1FI5 A;  4C0L A;  1HT9 A;  1YX8 A;  1QAS A;  5AER A;  4N1F A;  4P2Y B;  3GK4 X;  5AEQ A;  1S26 D;  1BG1 A;  4DS7 A;  1Y1U A;  2Y1M A;  4GFT A;  4TNC A;  5F6T A;  1U5I A;  2KQ6 A;  1MHO A;  1W7I B;  2LNK A;  1A03 A;  1BLQ A;  5CSJ A;  1KK8 C;  2L98 A;  3CR5 X;  1QX5 B;  1M39 A;  3GOF A;  3O6B A;  1BR1 B;  3I5G C;  4MVF A;  2JPT A;  2I18 A;  1LVC D;  1SNL A;  4GGF C;  1SL7 A;  3BUM B;  3TDZ A;  1K9U A;  4OVN F;  1IRJ A;  5CSF A;  1HQV A;  1KQM B;  2M29 A;  3SIB A;  1M31 A;  2O5G A;  1J1D A;  4CID A;  1IJ5 A;  1N2D A;  2WCF A;  1DJG A;  2MRD A;  1MXE A;  2NZ0 A;  2LUX A;  1Y0V H;  1NWD A;  2CTN A;  2M49 B;  2MLE C;  4QJ4 B;  1KK7 Z;  2FCD A;  5J3X A;  4NDC A;  2HF5 A;  4PE7 A;  2PAL A;  1UHK A;  4I5N B;  4MZJ A;  1EH2 A;  1QV0 A;  1DJH A;  1K9K A;  1KK7 Y;  1DJI A;  1M63 B;  1DF0 B;  2ZFD A;  3BUN B;  1EL4 A;  1UP5 A;  1KQM C;  2EGD A;  4YI8 A;  2GV5 A;  2PSR A;  4L9M A;  1SPY A;  3OB2 B;  1YVL A;  2VRG A;  5JOL A;  2LCP A;  5GQQ C;  4WRI A;  4GGN A;  3E3R A;  2K7D A;  2Y1N A;  5KU1 A;  5HYD A;  1GGW A;  3CGA A;  2K61 A;  1YUU A;  3NSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...