3CLNA

Structure of calmodulin refined at 2.2 angstroms resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Structure of calmodulin refined at 2.2 A resolution.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Calcium binding protein
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 1988-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3clnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3clnA02
2H2KA 3RM1A 2ISDA 2LVIA 1QATA 2L4IA 4DUQA 4OV2A 1IG5A 2FCDA 1SRAA 1ZFSA 4AOMA 1JFKA 1SCMB 1RFJA 2KGRA 1DTLA 1XFUO 1H4BA 1V1GA 1SCMC 2K7CA 2KI4B 3WHTB 5I2OA 2F3ZA 5AXIA 4MZKA 2KI4C 3LK0A 5DKQA 3IF7A 1DJHA 4U8DA 1N65A 1PVBA 3IQOA 2M97A 4OVNF 1F71A 1ZOTB 1TNWA 5KU1A 4CFQA 2LAPA 2MLEC 2CXJA 3WXAA 1YUSA 2LV7A 4YGBB 4CLNA 1K9KA 4XJKB 1EXRA 4M2QA 1W7IB 1PRWA 2NZ0A 3EK4A 2KAVA 3GOFA 3SIBA 2KAXA 2KFHA 1J1DA 3SG6A 2PASA 1J7PA 1M46A 1SMGA 1AVSA 1MR8A 3DF0B 1S36A 5BPJA 3OX6A 1U5IB 3C1VA 1QIWA 4MZLA 5GQQC 3NSKA 4PALA 4R1EA 2L5XB 4MRXA 2ZRSA 4L9MA 1SY9A 3BUXB 4E68A 2K7DA 1KQVA 2JZIA 2NLNA 1XFWO 1IJ6A 2M9GA 1WLZA 3JVTC 3JTDB 1K8UA 3CTNA 3SG2A 2M7LA 1AP4A 4MLWA 1J7OA 1JBAA 1MHOA 3SG7A 1B8RA 3JTDC 1KSMA 5CSJA 4QJ4B 2M49B 4YGDB 1LVCD 3BUOB 4PE0A 1PALA 3KO0A 2CBLA 1IKUA 2LMVA 3BXKA 1DMOA 4OR9B 3DF0A 1KFUL 3O78A 4F0ZB 1GQMA 1TOPA 2F2PA 4GPLB 5CPVA 2EGDA 4NQGA 1J1EA 1DT7B 3WHUB 5KSZA 1UHNA 4YGEB 2BL0B 4ETOA 2GGZA 2KSPA 1J7RA 2LUXA 1YTZC 2PALA 2WC8A 2L50A 3TS5B 1BR4B 1NYAA 3PFVA 1AJ4A 1CTRA 2BE4A 3TS5C 2K0JA 2KGBC 2JQ6A 1S3PA 2LP2A 4GFTA 3BUWB 4CPVA 4AQJA 1MXLC 1W7JB 1PSRA 2BCAA 4WRIA 2JNFA 2CTNA 4QJ5B 2EC6C 3SJSA 1KQMB 1ZUZA 1NP8A 1QTXA 1IGVA 3NSIA 1IRJA 1BMOA 1CFPA 3VRPA 4UPGA 4HSZA 2ZKMX 4USLA 4HRGA 4GAOA 1YRUB 1N0YA 3BOWB 3WNXB 5D7FA 5ER5A 2K2FA 3AKBA 3O2PA 4A4BA 1TCFA 5HLOA 5HKWA 2EHBA 4I5KA 5PALA 1L7ZA 3D0YA 1TN4A 1YX8A 1MQ1A 3KEVA 1N2DA 1HT9A 4DCKA 4PCWA 1SK6D 1C7VA 1QLKA 1VRKA 3IQQA 3ZNIA 5I2LA 2MAZA 5I8NA 3SG5A 4TNCA 1OSAA 1K93D 2JTTA 3TUYB 2HQ8A 3TDUA 1QX7A 1IQ5A 1QX2A 3M0WA 3TUYC 1BR1B 1DJXA 2LUCA 3O6BA 4GUKA 2AMIA 1B7TZ 2GGMA 1IJ5A 1CLMA 2JPTA 1RWYA 3OP0A 4QJ3B 1H8BA 1DJWA 4CIDA 1CDLA 1SKTA 2ZN8A 2QPTA 3AAKA 2O60A 4ORCB 2E30A 2F8PA 3PM8A 1BLQA 5HYDA 2M7NA 4NDDA 1EG3A 5D69A 1D1OA 1A29A 3VGOA 4D1EA 3OB1B 2K2AA 4JQ0D 1K9UA 1RECA 2WCEA 2FOTA 5I2QA 2TN4A 1QV0A 1KFUS 1ZACA 3H4SE 1DF0A 1UP5A 4ZCVA 2H61C 4MN0A 1GGZA 1UHHA 4PHMA 3NXAA 1IQ3A 2LMTA 3A8RA 1KK8B 1M63B 2I7AA 2BKIB 1XYDA 1PSBA 1QJTA 1QIVA 2JT8A 1NX3A 1KK8C 3I5GB 2BCBA 2JWWA 4FTGA 2KYCA 3VRRA 3EKJA 5B8IB 1A75B 1GGWA 4P5OE 3I5GC 1B4CA 2SCPA 1XFYO 1OZOA 1JWDA 2LC5A 1B8CA 5HKZA 2Y1NA 3I5FB 1BOCA 2CNPA 1JUOA 1ALWA 2KHNA 3CZTX 1SL8A 3GK4X 3TZ1A 1HQVA 2KDHA 3I5FC 1OMRA 4NDCA 5KTYA 3HX4A 1GJYA 2A4JA 1M45A 4GGFC 1KFXL 1QS7A 1SBJA 2BBNA 3PALA 2BECA 1FI5A 2LHLA 3FWCA 1PULA 1MUXA 4M2OA 1OMVA 1DVIA 2K61A 2G2BA 4HREE 4XJKA 1YX7A 3BQ3A 2F33A 5JOLA 1QVIY 1QV1A 1NX0A 2O5GA 2ZFDA 1CFCA 5AFPA 2WOSA 1S6JA 1B9AA 3NSOA 1XK4C 2GV5A 1RROA 1SL7A 1IH0A 1DJIA 1U5IA 1SPYA 1S5GY 4MVFA 2CT9A 2M1KB 3K21A 2KBIA 1SYMA 1CB1A 4YGCB 1AK8A 4N1GA 2VRGA 2ZN9A 2BL0C 3CR2A 1DGUA 1SR6B 2KI6D 3LCPC 1XO5A 1XFZO 1SR6C 2KYFA 2MRDA 1Y1XA 1OZSA 1NX2A 2B1UA 3KF9A 2COLB 2LM5A 1XK4A 1RK9A 3ICBA 5CSNA 2CCMA 1NUBA 5HKYA 3O4YA 2M0RA 4WQ3A 2KNEA 2LLTA 1J7QA 1F8HA 4ORAB 1Y1AA 2ZNEA 2M3WA 1Y0VH 1CDMA 2LVKA 1UHIA 1KQMC 1SL9A 1YR5A 1F70A 1LA0A 2HQWA 1BT6A 3PLFB 1S5GZ 3ZWHA 2JC2A 1FPWA 2MJWB 5DKNA 1YURA 1KWOB 1XFXO 3KHEA 4BY5A 4C0KA 1KWOC 1Y6WA 2M29A 1WDCB 4BY4A 1JF2A 3CS1A 1TTXA 1WDCC 4PE1A 1TNQA 2L2EA 1LA3A 2M1UA 3AAJA 2OTGB 1BG1A 1YUUA 1K9PA 1TRFA 1YRTB 4PHNA 1V1FA 2LLUA 1WRKA 2K7BA 3OHMB 1UURA 1WY9A 4PHKA 5AERA 5AEQA 3I5IB 2L98A 5K89A 1DJYA 2MBXA 1YUTA 3I5IC 2LHIA 3EVVA 2Q4UA 1S6IA 2KQYA 3FIAA 3QRXA 2OS8B 4GNKB 1FBVA 5G08A 1JSAA 1CLLA 4OCIA 4XYNA 3BOWA 3CR4X 3A4UB 4PHJA 1BJFA 2LNKA 3FS7A 4GGNA 1B47A 3I5HB 4PE7A 4AQIA 1KFXS 2NCPA 4I5NB 3I5HC 1CKKA 1JC2A 1BF5A 3SG3A 1X02A 2Y1MA 1FW4A 1NPQA 2I18A 4P2YB 1WRLA 3LLEA 1SNLA 2LMUA 3OB2B 3KPXA 1R2UA 4MZJA 4GBAA 2NCOA 2HPSA 2MLFC 3PSRA 2QACA 5HLVA 1S6CA 2JULA 1NCYA 1MWNA 3LL8B 1AHRA 2JT3A 2F2OA 2L4HA 1NCXA 2FJUB 1KSOA 4N1FA 5FYXA 3FWBA 2JXLA 4M2PA 1SCVA 2LE9B 2M8UA 4OKHA 2KAYA 1K90D 1TCOB 3SIAA 1ODBA 4DIRA 1F4OA 3CR5X 1XFVO 1Y1UA 1UHJA 2SASA 4YBHB 5ER4X 1SW8A 1LXFC 3CLNA 1XVJA 2FCEA 1XA5A 1OOJA 2JXCA 3SG4A 1CFFA 1UWOA 2Y4QA 3EK8A 3EVUA 2K7OA 2H61A 4MEWA 1C7WA 3BYAA 4N5XA 1A03A 2LLSA 3E3RA 1G33A 2PRUA 1RJVA 4DS7A 1L2OB 5JJGA 5CSFA 1OE9B 1NWDA 2I2RE 1L2OC 1R6PA 1CFDA 1JF0A 1A75A 2AAOA 1F4QA 1UUSA 1YVHA 1RTP1 1E8AA 2JNXA 1G4YR 1BODA 1CMGA 1PVAA 2BE6A 2JRFA 4GGFA 1C07A 1K95A 1QX5B 1A2XA 3JVTB 1K2HA 2OPOA 1TNXA 1JFJA 4MSPA 2AUCA 1M31A 4HRHA 2KBMA 1A4PA 2WORA 3VRQA 1NX1A 4C0LA 1OQPA 1DGVA 2JTZA 5TNCA 1EG4A 1IWQA 1NIWA 1BU3A 3CWGA 1CNPA 3HCMA 2JU0A 4FQOA 4YI9A 4ORBB 2WNDA 4C0JA 4A4CA 2E6WA 1TNPA 3BUNB 1QVIZ 3DVJA 2L0PA 4PDZA 1NCZA 2BKHB 2V53A 1F54A 3NSLA 2ZNDA 3DD4A 3TDIA 1YVLA 1CM1A 2D8NA 3GK1A 3MSEB 3VROA 2R2IA 1KK7Y 2KI6C 2LVVA 3LK1A 1CMFA 2IS9A 2MA2A 2Y5IA 2G9BA 4YI8A 3BUMB 1G8IA 2MHHA 2LP3A 3RLZA 1CLBA 5AANA 4PE4A 4MBEA 2L51A 5IBWA 2EC6B 2I94A 3D0YB 1EL4A 4I5LB 3EKHA 3AKAA 3PATA 1UHKA 1F55A 2OTGC 1FF1A 2KFGA 3CGAA 2K8MB 1S1EA 1PK0D 1LINA 4MRYA 2LVJA 1QASA 2KFFA 3DVMA 1AJ5A 1B7TY 2JOJA 3EK7A 2PVBA 4DRWA 3DVEA 2ZRTA 2KOTA 3OX5A 1KCYA 1DJZA 4IL1A 4YGAA 4ICBA 4WQ2A 1KK7Z 4Q04A 3DVKA 4CFRA 2OS8C 1ZMZA 2F3YA 3PN7B 1K94A 1CDNA 2HF5A 1LKJA 1QLSA 1WLMA 3GK2A 1NSHA 3VRNA 2KQ6A 3D10A 3PN7C 5J3XA 4YRUA 1DJGA 1EH2A 2DOQA 4NDBA 3EVRA 1TIZA 2PSRA 4I5JA 2WCFA 1S26D 2WCBA 5CSIA 1WRZA 4ZCUA 2BCXA 1AUIB 1J55A 1EJ3A 1OMDA 2HETA 2PMYA 1B1GA 2NXQA 1FI6A 1MXEA 2P6BB 1QXPA 1ALVA 4JPZB 5F6TA 1K96A 2RGIA 2LANA 1M39A 1DF0B 2BBMA 2Q91A 3TDZA 1Q80A 1CDPA 2JT0A 3F45A 5DKRA 1MF8B 2LCPA 4JWQA 1B8LA 1CM4A
chains in the Genus database with same CATH superfamily
2H2KA 3RM1A 2ISDA 2LVIA 1QATA 2L4IA 4DUQA 4OV2A 1IG5A 2FCDA 1SRAA 1ZFSA 4AOMA 4INWA 1JFKA 1SCMB 1RFJA 3TZ1A 2KGRA 1DTLA 1XFUO 3NHIA 4JKTA 1H4BA 1V1GA 1SCMC 1Z2CB 1OW4A 2K7CA 2KI4B 3WHTB 5I2OA 2F3ZA 5AXIA 4MZKA 3R1PA 2KI4C 3LK0A 3D78A 5DKQA 3IF7A 1DJHA 4U8DA 1N65A 1PVBA 3IQOA 2M97A 4OVNF 1F71A 1ZOTB 1TNWA 3CZ0A 4CFQA 5KU1A 2LAPA 2MLEC 2CXJA 3WXAA 1YUSA 2LV7A 4YGBB 2WCJA 4CLNA 1K9KA 4XJKB 1EXRA 4M2QA 1W7IB 1PRWA 2NZ0A 3EK4A 2KAVA 3GOFA 3SIBA 2KAXA 2KFHA 1J1DA 1OOHA 2PASA 3SG6A 1J7PA 1M46A 1SMGA 3L47A 1AVSA 1MR8A 3DF0B 1S36A 5BPJA 2BNXA 3OX6A 1U5IB 3C1VA 1QIWA 4MZLA 5GQQC 3NSKA 5D3OA 4PALA 4R1EA 2L5XB 4MRXA 5FI6A 2ZRSA 4L9MA 1C3YA 1SY9A 3BUXB 4E68A 2K7DA 1KQVA 2JZIA 2NLNA 1XFWO 1IJ6A 2M9GA 1WLZA 3JVTC 3JTDB 1K8UA 3CTNA 3SG2A 2M7LA 1AP4A 4MLWA 1J7OA 1JBAA 1MHOA 3D77A 3SG7A 1B8RA 1C3ZA 3JTDC 3V2LA 1KSMA 5CSJA 4QJ4B 2M49B 4YGDB 2BAPA 1LVCD 3BUOB 4PE0A 1PALA 3KO0A 2CBLA 1BLQA 1IKUA 2LMVA 3BXKA 1DMOA 4OR9B 3DF0A 1KFUL 3O78A 4F0ZB 2GTEA 1GQMA 1TOPA 2F2PA 4GPLB 5CPVA 2EGDA 4NQGA 1J1EA 1DT7B 3WHUB 5KSZA 1UHNA 4YGEB 2BL0B 4ETOA 2GGZA 2KSPA 3NGVA 1J7RA 3S0EA 2LUXA 1SSEB 1YTZC 2PALA 2WC8A 2L50A 3TS5B 1BR4B 1NYAA 3PFVA 1AJ4A 1CTRA 1QWVA 2BE4A 3TS5C 3NHTA 2K0JA 3BFAA 2KGBC 2FJYA 2JQ6A 1S3PA 2LP2A 4GFTA 3BUWB 4CPVA 4INXA 1MXLC 1W7JB 3CYZA 4AQJA 3R1OA 1PSRA 2BCAA 4WRIA 2KLDA 2JNFA 2CTNA 4QJ5B 2EC6C 3SJSA 1KQMB 1ZUZA 1NP8A 1QTXA 1IGVA 3NSIA 1IRJA 1BMOA 1CFPA 3CZ2A 3VRPA 4UPGA 4HSZA 2ZKMX 1TUZA 4USLA 4HRGA 4GAOA 1YRUB 1N0YA 3B7AA 3BOWB 3WNXB 5D7FA 5ER5A 2K2FA 3AKBA 3B86A 3O2PA 4A4BA 1TCFA 3FE8A 5HLOA 5HKWA 2EHBA 4I5KA 5PALA 1L7ZA 3D0YA 1TN4A 1YX8A 3DXLA 1MQ1A 3KEVA 1N2DA 1HT9A 4DCKA 4PCWA 3O4XA 1SK6D 1GM0A 2KLEA 3B88A 4KYNA 1C7VA 4FQTA 1QLKA 1VRKA 3IQQA 5FI2A 3ZNIA 5I2LA 2MAZA 3UO9A 5I8NA 3SG5A 4TNCA 1OSAA 1K93D 3EG5B 2JTTA 3TUYB 2HQ8A 3TDUA 1QX7A 1IQ5A 1QX2A 3D76A 3M0WA 3TUYC 1BR1B 1DJXA 2LUCA 3O6BA 4GUKA 1OOFA 3OBVA 2WC6A 2AMIA 2WCLA 1B7TZ 2GGMA 1IJ5A 3SS5A 1CLMA 2JPTA 1RWYA 3OP0A 4QJ3B 1H8BA 2PYQA 1DJWA 4CIDA 1CDLA 1SKTA 2ZN8A 2QPTA 3AAKA 2O60A 4ORCB 2E30A 2F8PA 3PM8A 3UNWA 5HYDA 2M7NA 4NDDA 1EG3A 5D69A 3S0DA 1D1OA 1A29A 3VGOA 4D1EA 3OB1B 2K2AA 4JQ0D 1K9UA 1RECA 2WCEA 2FOTA 5I2QA 2TN4A 1QV0A 2WCKA 1KFUS 1ZACA 2QDIA 3H4SE 1DF0A 1UP5A 2QEHA 2H61C 4ZCVA 4MN0A 1GGZA 1P28A 1T14A 1UHHA 3NXAA 2LMTA 3A8RA 4PHMA 1KK8B 1M63B 2I7AA 3PM2A 2BKIB 1XYDA 1PSBA 1QJTA 1QIVA 2JT8A 1NX3A 1KK8C 2WC5A 3I5GB 2BCBA 2JWWA 4FTGA 2KYCA 3VRRA 3EKJA 5B8IB 1A75B 3FE6A 1GGWA 4P5OE 3I5GC 1B4CA 2SCPA 1XFYO 1OZOA 1JWDA 1IIOA 2LC5A 1B8CA 2WCMA 5HKZA 2Y1NA 3I5FB 1BOCA 2CNPA 1JUOA 1ALWA 2KHNA 3BFHA 1SL8A 3CZTX 3GK4X 1HQVA 2KDHA 3I5FC 1OMRA 3B87A 4NDCA 5KTYA 3HX4A 1GJYA 2A4JA 1M45A 4GGFC 1KFXL 1QS7A 1SBJA 2BBNA 3PALA 2BECA 1FI5A 2LHLA 3FWCA 1PULA 1MUXA 4M2OA 1OMVA 1DVIA 2K61A 3SS3A 2G2BA 4HREE 4XJKA 1YX7A 3BQ3A 2F33A 5JOLA 1QVIY 1QV1A 1NX0A 2O5GA 3R72A 2ZFDA 1CFCA 5AFPA 2WOSA 1S6JA 1B9AA 3NSOA 1XK4C 2GV5A 1RROA 1SL7A 1IH0A 1DJIA 2KPHA 1U5IA 1SPYA 3D73A 1S5GY 4MVFA 2CT9A 2YGUA 2K60A 3CABA 2M1KB 3K21A 2KBIA 1SYMA 1CB1A 4YGCB 1AK8A 4N1GA 2VRGA 2ZN9A 2BL0C 3CR2A 1DGUA 1SR6B 2JPOA 2KI6D 3LCPC 3RZSA 1XO5A 3VB1A 1XFZO 1SR6C 2KYFA 2MRDA 3FE9A 1OOGA 1IQ3A 1Y1XA 1OZSA 1NX2A 2B1UA 3KF9A 2COLB 2LM5A 1XK4A 1RK9A 3ICBA 5CSNA 2CCMA 3D75A 3S0AA 1NUBA 5HKYA 3O4YA 2M0RA 4WQ3A 2KNEA 2LLTA 1J7QA 1F8HA 2QEBA 4ORAB 1Y1AA 3L4AA 2ZNEA 2M3WA 1Y0VH 3BJHA 1DQEA 1CDMA 2LVKA 1UHIA 1KQMC 1SL9A 1YR5A 1F70A 1LA0A 2HQWA 3SS4A 1BT6A 3PLFB 5FI7A 1S5GZ 3ZWHA 5DICA 2JC2A 1FPWA 1DC1A 2MJWB 5DKNA 1YURA 1KWOB 1XFXO 3K1EA 3KHEA 4BY5A 4C0KA 1KWOC 1Y6WA 2M29A 1WDCB 4BY4A 1JF2A 3CS1A 1TTXA 1WDCC 4PE1A 1TNQA 2L2EA 1LA3A 2M1UA 3AAJA 2OTGB 1BG1A 1YUUA 1K9PA 1TRFA 1YRTB 5I94A 4PHNA 1V1FA 2LLUA 1WRKA 2K7BA 3OHMB 1UURA 1WY9A 4PHKA 5AERA 5AEQA 3I5IB 3OGNA 2L98A 4IJ7A 5K89A 1DJYA 2MBXA 1YUTA 3I5IC 2LHIA 3EVVA 2Q4UA 1S6IA 2KQYA 3FIAA 3QRXA 2OS8B 4GNKB 1FBVA 5G08A 1JSAA 1CLLA 4OCIA 3DY9A 4XYNA 3BOWA 3CR4X 3A4UB 4PHJA 1BJFA 2LNKA 3FS7A 4GGNA 1B47A 3I5HB 3N7HA 2L2CA 4PE7A 4AQIA 1KFXS 2NCPA 4I5NB 3I5HC 1CKKA 1JC2A 1BF5A 3SG3A 1X02A 2Y1MA 1FW4A 1NPQA 2I18A 4P2YB 1WRLA 3LLEA 1SNLA 2LMUA 3OB2B 3KPXA 1R2UA 3PJIA 4MZJA 4GBAA 2NCOA 2QEOA 2HPSA 2MLFC 3CDNA 3PSRA 3IVTA 2QACA 5HLVA 1S6CA 2JULA 1NCYA 1MWNA 3LL8B 1AHRA 2JT3A 1DELA 2F2OA 2L4HA 3D74A 1NCXA 2FJUB 1KSOA 4N1FA 5FYXA 3FWBA 2JXLA 2QEVA 4M2PA 1SCVA 2LE9B 2M8UA 3L4LA 4OKHA 2KAYA 1K90D 1TCOB 1XFRA 3SIAA 1ODBA 4DIRA 1F4OA 3CR5X 1XFVO 1Y1UA 1UHJA 2SASA 4YBHB 5ER4X 3Q8IA 1SW8A 3S0FA 1LXFC 3CZ1A 3CLNA 1XVJA 2FCEA 1XA5A 1Z4HA 3S0BA 1OOJA 2JXCA 3SG4A 2L5YA 1CFFA 1UWOA 2Y4QA 3EK8A 3EVUA 2K7OA 2H61A 4MEWA 1C7WA 3BYAA 4N5XA 1A03A 2LLSA 3E3RA 5HL1A 1G33A 2PRUA 1RJVA 2H8VA 4DS7A 1L2OB 5JJGA 5CSFA 1OE9B 1NWDA 2I2RE 1L2OC 1R6PA 1CFDA 1JF0A 1A75A 2AAOA 1F4QA 1UUSA 1YVHA 1RTP1 3B6XA 3R1VA 3QMEA 1E8AA 2JNXA 1G4YR 1BODA 1CMGA 1PVAA 2BE6A 2JRFA 4GGFA 1C07A 1K95A 1QX5B 1A2XA 3JVTB 1K2HA 2OPOA 1TNXA 1JFJA 1OOIX 4MSPA 2AUCA 1M31A 4HRHA 2KBMA 1A4PA 2WORA 3VRQA 1NX1A 4C0LA 1OQPA 1DGVA 2JTZA 5TNCA 3BFBA 1EG4A 1IWQA 1NIWA 1BU3A 1TUJA 3CWGA 1CNPA 3HCMA 2JU0A 4FQOA 4YI9A 4ORBB 4F7FA 2WNDA 4C0JA 4A4CA 2E6WA 1TNPA 3BUNB 1QVIZ 3DVJA 2L0PA 4PDZA 1W9ZA 1NCZA 2BKHB 2V53A 1F54A 3NSLA 2ZNDA 3DD4A 3TDIA 1YVLA 1CM1A 5EL2A 2D8NA 3GK1A 3MSEB 3VROA 2R2IA 1TWOA 1KK7Y 2KI6C 2LVVA 3LK1A 1CMFA 2IS9A 2MA2A 2Y5IA 1ORGA 2G9BA 4YI8A 3BUMB 3DZTA 1G8IA 2MHHA 2LP3A 3RLZA 1CLBA 4PT1A 5AANA 4PE4A 4MBEA 2L51A 5IBWA 2EC6B 2I94A 2PQLA 3D0YB 1EL4A 3S0GA 4I5LB 2WCHA 3EKHA 3AKAA 3DYEA 3PATA 1UHKA 1F55A 2OTGC 1FF1A 2KFGA 3CGAA 2K8MB 1S1EA 1PK0D 1DEKA 1LINA 4MRYA 2LVJA 1QASA 2KFFA 3DVMA 1AJ5A 1B7TY 2ERBA 2JOJA 3EK7A 2PVBA 4DRWA 3DVEA 2ZRTA 2KOTA 3OX5A 1KCYA 1DJZA 4IL1A 4YGAA 4ICBA 4WQ2A 1KK7Z 4Q04A 3DVKA 4CFRA 2OS8C 1ZMZA 2F3YA 3PN7B 1K94A 1CDNA 2HF5A 1LKJA 1QLSA 1WLMA 3GK2A 1NSHA 3VRNA 2KQ6A 3D10A 3PN7C 5J3XA 4YRUA 1DJGA 1EH2A 2DOQA 4NDBA 4OZDA 2P71A 2P70A 3EVRA 1TIZA 2PSRA 4I5JA 2WCFA 1S26D 4JD9A 2WCBA 1LS8A 5CSIA 1WRZA 4ZCUA 2BCXA 1AUIB 1J55A 1EJ3A 1OMDA 2HETA 2PMYA 1B1GA 2NXQA 1FI6A 1MXEA 2P6BB 1QXPA 1ALVA 4JPZB 5F6TA 1K96A 2RGIA 2LANA 1M39A 1DF0B 2BBMA 2Q91A 3TDZA 1Q80A 1CDPA 2JT0A 3F45A 5DKRA 1MF8B 2LCPA 4JWQA 1B8LA 1CM4A
chains in the Genus database with same CATH topology
2H2KA 3RM1A 2ISDA 2LVIA 1QATA 2L4IA 4DUQA 4OV2A 1IG5A 2FCDA 1SRAA 1ZFSA 4AOMA 1JFKA 1SCMB 1RFJA 2KGRA 1DTLA 1XFUO 1H4BA 1V1GA 1SCMC 2K7CA 2KI4B 3WHTB 5I2OA 2F3ZA 5AXIA 4MZKA 2KI4C 3LK0A 5DKQA 3IF7A 1DJHA 4U8DA 1N65A 1PVBA 3IQOA 2M97A 4OVNF 1F71A 1ZOTB 1TNWA 5KU1A 4CFQA 2LAPA 2MLEC 2CXJA 3WXAA 1YUSA 2LV7A 4YGBB 4CLNA 1K9KA 4XJKB 1EXRA 4M2QA 1W7IB 1PRWA 2NZ0A 3EK4A 2KAVA 3GOFA 3SIBA 2KAXA 2KFHA 1J1DA 3SG6A 2PASA 1J7PA 1M46A 1SMGA 1AVSA 1MR8A 3DF0B 1S36A 5BPJA 3OX6A 1U5IB 3C1VA 1QIWA 4MZLA 5GQQC 3NSKA 4PALA 4R1EA 2L5XB 4MRXA 2ZRSA 4L9MA 1SY9A 3BUXB 4E68A 2K7DA 1KQVA 2JZIA 2NLNA 1XFWO 1IJ6A 2M9GA 1WLZA 3JVTC 3JTDB 1K8UA 3CTNA 3SG2A 2M7LA 1AP4A 4MLWA 1J7OA 1JBAA 1MHOA 3SG7A 1B8RA 3JTDC 1KSMA 5CSJA 4QJ4B 2M49B 4YGDB 1LVCD 3BUOB 4PE0A 1PALA 3KO0A 2CBLA 1IKUA 2LMVA 3BXKA 1DMOA 4OR9B 3DF0A 1KFUL 3O78A 4F0ZB 1GQMA 1TOPA 2F2PA 4GPLB 5CPVA 2EGDA 4NQGA 1J1EA 1DT7B 3WHUB 5KSZA 1UHNA 4YGEB 2BL0B 4ETOA 2GGZA 2KSPA 1J7RA 2LUXA 1YTZC 2PALA 2WC8A 2L50A 3TS5B 1BR4B 1NYAA 3PFVA 1AJ4A 1CTRA 2BE4A 3TS5C 2K0JA 2KGBC 2JQ6A 1S3PA 2LP2A 4GFTA 3BUWB 4CPVA 4AQJA 1MXLC 1W7JB 1PSRA 2BCAA 4WRIA 2JNFA 2CTNA 4QJ5B 2EC6C 3SJSA 1KQMB 1ZUZA 1NP8A 1QTXA 1IGVA 3NSIA 1IRJA 1BMOA 1CFPA 3VRPA 4UPGA 4HSZA 2ZKMX 4USLA 4HRGA 4GAOA 1YRUB 1N0YA 3BOWB 3WNXB 5D7FA 5ER5A 2K2FA 3AKBA 3O2PA 4A4BA 1TCFA 5HLOA 5HKWA 2EHBA 4I5KA 5PALA 1L7ZA 3D0YA 1TN4A 1YX8A 1MQ1A 3KEVA 1N2DA 1HT9A 4DCKA 4PCWA 1SK6D 1C7VA 1QLKA 1VRKA 3IQQA 3ZNIA 5I2LA 2MAZA 5I8NA 3SG5A 4TNCA 1OSAA 1K93D 2JTTA 3TUYB 2HQ8A 3TDUA 1QX7A 1IQ5A 1QX2A 3M0WA 3TUYC 1BR1B 1DJXA 2LUCA 3O6BA 4GUKA 2AMIA 1B7TZ 2GGMA 1IJ5A 1CLMA 2JPTA 1RWYA 3OP0A 4QJ3B 1H8BA 1DJWA 4CIDA 1CDLA 1SKTA 2ZN8A 2QPTA 3AAKA 2O60A 4ORCB 2E30A 2F8PA 3PM8A 1BLQA 5HYDA 2M7NA 4NDDA 1EG3A 5D69A 1D1OA 1A29A 3VGOA 4D1EA 3OB1B 2K2AA 4JQ0D 1K9UA 1RECA 2WCEA 2FOTA 5I2QA 2TN4A 1QV0A 1KFUS 1ZACA 3H4SE 1DF0A 1UP5A 4ZCVA 2H61C 4MN0A 1GGZA 1UHHA 4PHMA 3NXAA 1IQ3A 2LMTA 3A8RA 1KK8B 1M63B 2I7AA 2BKIB 1XYDA 1PSBA 1QJTA 1QIVA 2JT8A 1NX3A 1KK8C 3I5GB 2BCBA 2JWWA 4FTGA 2KYCA 3VRRA 3EKJA 5B8IB 1A75B 1GGWA 4P5OE 3I5GC 1B4CA 2SCPA 1XFYO 1OZOA 1JWDA 2LC5A 1B8CA 5HKZA 2Y1NA 3I5FB 1BOCA 2CNPA 1JUOA 1ALWA 2KHNA 3CZTX 1SL8A 3GK4X 3TZ1A 1HQVA 2KDHA 3I5FC 1OMRA 4NDCA 5KTYA 3HX4A 1GJYA 2A4JA 1M45A 4GGFC 1KFXL 1QS7A 1SBJA 2BBNA 3PALA 2BECA 1FI5A 2LHLA 3FWCA 1PULA 1MUXA 4M2OA 1OMVA 1DVIA 2K61A 2G2BA 4HREE 4XJKA 1YX7A 3BQ3A 2F33A 5JOLA 1QVIY 1QV1A 1NX0A 2O5GA 2ZFDA 1CFCA 5AFPA 2WOSA 1S6JA 1B9AA 3NSOA 1XK4C 2GV5A 1RROA 1SL7A 1IH0A 1DJIA 1U5IA 1SPYA 1S5GY 4MVFA 2CT9A 2M1KB 3K21A 2KBIA 1SYMA 1CB1A 4YGCB 1AK8A 4N1GA 2VRGA 2ZN9A 2BL0C 3CR2A 1DGUA 1SR6B 2KI6D 3LCPC 1XO5A 1XFZO 1SR6C 2KYFA 2MRDA 1Y1XA 1OZSA 1NX2A 2B1UA 3KF9A 2COLB 2LM5A 1XK4A 1RK9A 3ICBA 5CSNA 2CCMA 1NUBA 5HKYA 3O4YA 2M0RA 4WQ3A 2KNEA 2LLTA 1J7QA 1F8HA 4ORAB 1Y1AA 2ZNEA 2M3WA 1Y0VH 1CDMA 2LVKA 1UHIA 1KQMC 1SL9A 1YR5A 1F70A 1LA0A 2HQWA 1BT6A 3PLFB 1S5GZ 3ZWHA 2JC2A 1FPWA 2MJWB 5DKNA 1YURA 1KWOB 1XFXO 3KHEA 4BY5A 4C0KA 1KWOC 1Y6WA 2M29A 1WDCB 4BY4A 1JF2A 3CS1A 1TTXA 1WDCC 4PE1A 1TNQA 2L2EA 1LA3A 2M1UA 3AAJA 2OTGB 1BG1A 1YUUA 1K9PA 1TRFA 1YRTB 4PHNA 1V1FA 2LLUA 1WRKA 2K7BA 3OHMB 1UURA 1WY9A 4PHKA 5AERA 5AEQA 3I5IB 2L98A 5K89A 1DJYA 2MBXA 1YUTA 3I5IC 2LHIA 3EVVA 2Q4UA 1S6IA 2KQYA 3FIAA 3QRXA 2OS8B 4GNKB 1FBVA 5G08A 1JSAA 1CLLA 4OCIA 4XYNA 3BOWA 3CR4X 3A4UB 4PHJA 1BJFA 2LNKA 3FS7A 4GGNA 1B47A 3I5HB 4PE7A 4AQIA 1KFXS 2NCPA 4I5NB 3I5HC 1CKKA 1JC2A 1BF5A 3SG3A 1X02A 2Y1MA 1FW4A 1NPQA 2I18A 4P2YB 1WRLA 3LLEA 1SNLA 2LMUA 3OB2B 3KPXA 1R2UA 4MZJA 4GBAA 2NCOA 2HPSA 2MLFC 3PSRA 2QACA 5HLVA 1S6CA 2JULA 1NCYA 1MWNA 3LL8B 1AHRA 2JT3A 2F2OA 2L4HA 1NCXA 2FJUB 1KSOA 4N1FA 5FYXA 3FWBA 2JXLA 4M2PA 1SCVA 2LE9B 2M8UA 4OKHA 2KAYA 1K90D 1TCOB 3SIAA 1ODBA 4DIRA 1F4OA 3CR5X 1XFVO 1Y1UA 1UHJA 2SASA 4YBHB 5ER4X 1SW8A 1LXFC 3CLNA 1XVJA 2FCEA 1XA5A 1OOJA 2JXCA 3SG4A 1CFFA 1UWOA 2Y4QA 3EK8A 3EVUA 2K7OA 2H61A 4MEWA 1C7WA 3BYAA 4N5XA 1A03A 2LLSA 3E3RA 1G33A 2PRUA 1RJVA 4DS7A 1L2OB 5JJGA 5CSFA 1OE9B 1NWDA 2I2RE 1L2OC 1R6PA 1CFDA 1JF0A 1A75A 2AAOA 1F4QA 1UUSA 1YVHA 1RTP1 1E8AA 2JNXA 1G4YR 1BODA 1CMGA 1PVAA 2BE6A 2JRFA 4GGFA 1C07A 1K95A 1QX5B 1A2XA 3JVTB 1K2HA 2OPOA 1TNXA 1JFJA 4MSPA 2AUCA 1M31A 4HRHA 2KBMA 1A4PA 2WORA 3VRQA 1NX1A 4C0LA 1OQPA 1DGVA 2JTZA 5TNCA 1EG4A 1IWQA 1NIWA 1BU3A 3CWGA 1CNPA 3HCMA 2JU0A 4FQOA 4YI9A 4ORBB 2WNDA 4C0JA 4A4CA 2E6WA 1TNPA 3BUNB 1QVIZ 3DVJA 2L0PA 4PDZA 1NCZA 2BKHB 2V53A 1F54A 3NSLA 2ZNDA 3DD4A 3TDIA 1YVLA 1CM1A 2D8NA 3GK1A 3MSEB 3VROA 2R2IA 1KK7Y 2KI6C 2LVVA 3LK1A 1CMFA 2IS9A 2MA2A 2Y5IA 2G9BA 4YI8A 3BUMB 1G8IA 2MHHA 2LP3A 3RLZA 1CLBA 5AANA 4PE4A 4MBEA 2L51A 5IBWA 2EC6B 2I94A 3D0YB 1EL4A 4I5LB 3EKHA 3AKAA 3PATA 1UHKA 1F55A 2OTGC 1FF1A 2KFGA 3CGAA 2K8MB 1S1EA 1PK0D 1LINA 4MRYA 2LVJA 1QASA 2KFFA 3DVMA 1AJ5A 1B7TY 2JOJA 3EK7A 2PVBA 4DRWA 3DVEA 2ZRTA 2KOTA 3OX5A 1KCYA 1DJZA 4IL1A 4YGAA 4ICBA 4WQ2A 1KK7Z 4Q04A 3DVKA 4CFRA 2OS8C 1ZMZA 2F3YA 3PN7B 1K94A 1CDNA 2HF5A 1LKJA 1QLSA 1WLMA 3GK2A 1NSHA 3VRNA 2KQ6A 3D10A 3PN7C 5J3XA 4YRUA 1DJGA 1EH2A 2DOQA 4NDBA 3EVRA 1TIZA 2PSRA 4I5JA 2WCFA 1S26D 2WCBA 5CSIA 1WRZA 4ZCUA 2BCXA 1AUIB 1J55A 1EJ3A 1OMDA 2HETA 2PMYA 1B1GA 2NXQA 1FI6A 1MXEA 2P6BB 1QXPA 1ALVA 4JPZB 5F6TA 1K96A 2RGIA 2LANA 1M39A 1DF0B 2BBMA 2Q91A 3TDZA 1Q80A 1CDPA 2JT0A 3F45A 5DKRA 1MF8B 2LCPA 4JWQA 1B8LA 1CM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H2K A;  3RM1 A;  2ISD A;  2LVI A;  1QAT A;  2L4I A;  4DUQ A;  4OV2 A;  1IG5 A;  2FCD A;  1SRA A;  1ZFS A;  4AOM A;  1JFK A;  1SCM B;  1RFJ A;  2KGR A;  1DTL A;  1XFU O;  1H4B A;  1V1G A;  1SCM C;  2K7C A;  2KI4 B;  3WHT B;  5I2O A;  2F3Z A;  5AXI A;  4MZK A;  2KI4 C;  3LK0 A;  5DKQ A;  3IF7 A;  1DJH A;  4U8D A;  1N65 A;  1PVB A;  3IQO A;  2M97 A;  4OVN F;  1F71 A;  1ZOT B;  1TNW A;  5KU1 A;  4CFQ A;  2LAP A;  2MLE C;  2CXJ A;  3WXA A;  1YUS A;  2LV7 A;  4YGB B;  4CLN A;  1K9K A;  4XJK B;  1EXR A;  4M2Q A;  1W7I B;  1PRW A;  2NZ0 A;  3EK4 A;  2KAV A;  3GOF A;  3SIB A;  2KAX A;  2KFH A;  1J1D A;  3SG6 A;  2PAS A;  1J7P A;  1M46 A;  1SMG A;  1AVS A;  1MR8 A;  3DF0 B;  1S36 A;  5BPJ A;  3OX6 A;  1U5I B;  3C1V A;  1QIW A;  4MZL A;  5GQQ C;  3NSK A;  4PAL A;  4R1E A;  2L5X B;  4MRX A;  2ZRS A;  4L9M A;  1SY9 A;  3BUX B;  4E68 A;  2K7D A;  1KQV A;  2JZI A;  2NLN A;  1XFW O;  1IJ6 A;  2M9G A;  1WLZ A;  3JVT C;  3JTD B;  1K8U A;  3CTN A;  3SG2 A;  2M7L A;  1AP4 A;  4MLW A;  1J7O A;  1JBA A;  1MHO A;  3SG7 A;  1B8R A;  3JTD C;  1KSM A;  5CSJ A;  4QJ4 B;  2M49 B;  4YGD B;  1LVC D;  3BUO B;  4PE0 A;  1PAL A;  3KO0 A;  2CBL A;  1IKU A;  2LMV A;  3BXK A;  1DMO A;  4OR9 B;  3DF0 A;  1KFU L;  3O78 A;  4F0Z B;  1GQM A;  1TOP A;  2F2P A;  4GPL B;  5CPV A;  2EGD A;  4NQG A;  1J1E A;  1DT7 B;  3WHU B;  5KSZ A;  1UHN A;  4YGE B;  2BL0 B;  4ETO A;  2GGZ A;  2KSP A;  1J7R A;  2LUX A;  1YTZ C;  2PAL A;  2WC8 A;  2L50 A;  3TS5 B;  1BR4 B;  1NYA A;  3PFV A;  1AJ4 A;  1CTR A;  2BE4 A;  3TS5 C;  2K0J A;  2KGB C;  2JQ6 A;  1S3P A;  2LP2 A;  4GFT A;  3BUW B;  4CPV A;  4AQJ A;  1MXL C;  1W7J B;  1PSR A;  2BCA A;  4WRI A;  2JNF A;  2CTN A;  4QJ5 B;  2EC6 C;  3SJS A;  1KQM B;  1ZUZ A;  1NP8 A;  1QTX A;  1IGV A;  3NSI A;  1IRJ A;  1BMO A;  1CFP A;  3VRP A;  4UPG A;  4HSZ A;  2ZKM X;  4USL A;  4HRG A;  4GAO A;  1YRU B;  1N0Y A;  3BOW B;  3WNX B;  5D7F A;  5ER5 A;  2K2F A;  3AKB A;  3O2P A;  4A4B A;  1TCF A;  5HLO A;  5HKW A;  2EHB A;  4I5K A;  5PAL A;  1L7Z A;  3D0Y A;  1TN4 A;  1YX8 A;  1MQ1 A;  3KEV A;  1N2D A;  1HT9 A;  4DCK A;  4PCW A;  1SK6 D;  1C7V A;  1QLK A;  1VRK A;  3IQQ A;  3ZNI A;  5I2L A;  2MAZ A;  5I8N A;  3SG5 A;  4TNC A;  1OSA A;  1K93 D;  2JTT A;  3TUY B;  2HQ8 A;  3TDU A;  1QX7 A;  1IQ5 A;  1QX2 A;  3M0W A;  3TUY C;  1BR1 B;  1DJX A;  2LUC A;  3O6B A;  4GUK A;  2AMI A;  1B7T Z;  2GGM A;  1IJ5 A;  1CLM A;  2JPT A;  1RWY A;  3OP0 A;  4QJ3 B;  1H8B A;  1DJW A;  4CID A;  1CDL A;  1SKT A;  2ZN8 A;  2QPT A;  3AAK A;  2O60 A;  4ORC B;  2E30 A;  2F8P A;  3PM8 A;  1BLQ A;  5HYD A;  2M7N A;  4NDD A;  1EG3 A;  5D69 A;  1D1O A;  1A29 A;  3VGO A;  4D1E A;  3OB1 B;  2K2A A;  4JQ0 D;  1K9U A;  1REC A;  2WCE A;  2FOT A;  5I2Q A;  2TN4 A;  1QV0 A;  1KFU S;  1ZAC A;  3H4S E;  1DF0 A;  1UP5 A;  4ZCV A;  2H61 C;  4MN0 A;  1GGZ A;  1UHH A;  4PHM A;  3NXA A;  1IQ3 A;  2LMT A;  3A8R A;  1KK8 B;  1M63 B;  2I7A A;  2BKI B;  1XYD A;  1PSB A;  1QJT A;  1QIV A;  2JT8 A;  1NX3 A;  1KK8 C;  3I5G B;  2BCB A;  2JWW A;  4FTG A;  2KYC A;  3VRR A;  3EKJ A;  5B8I B;  1A75 B;  1GGW A;  4P5O E;  3I5G C;  1B4C A;  2SCP A;  1XFY O;  1OZO A;  1JWD A;  2LC5 A;  1B8C A;  5HKZ A;  2Y1N A;  3I5F B;  1BOC A;  2CNP A;  1JUO A;  1ALW A;  2KHN A;  3CZT X;  1SL8 A;  3GK4 X;  3TZ1 A;  1HQV A;  2KDH A;  3I5F C;  1OMR A;  4NDC A;  5KTY A;  3HX4 A;  1GJY A;  2A4J A;  1M45 A;  4GGF C;  1KFX L;  1QS7 A;  1SBJ A;  2BBN A;  3PAL A;  2BEC A;  1FI5 A;  2LHL A;  3FWC A;  1PUL A;  1MUX A;  4M2O A;  1OMV A;  1DVI A;  2K61 A;  2G2B A;  4HRE E;  4XJK A;  1YX7 A;  3BQ3 A;  2F33 A;  5JOL A;  1QVI Y;  1QV1 A;  1NX0 A;  2O5G A;  2ZFD A;  1CFC A;  5AFP A;  2WOS A;  1S6J A;  1B9A A;  3NSO A;  1XK4 C;  2GV5 A;  1RRO A;  1SL7 A;  1IH0 A;  1DJI A;  1U5I A;  1SPY A;  1S5G Y;  4MVF A;  2CT9 A;  2M1K B;  3K21 A;  2KBI A;  1SYM A;  1CB1 A;  4YGC B;  1AK8 A;  4N1G A;  2VRG A;  2ZN9 A;  2BL0 C;  3CR2 A;  1DGU A;  1SR6 B;  2KI6 D;  3LCP C;  1XO5 A;  1XFZ O;  1SR6 C;  2KYF A;  2MRD A;  1Y1X A;  1OZS A;  1NX2 A;  2B1U A;  3KF9 A;  2COL B;  2LM5 A;  1XK4 A;  1RK9 A;  3ICB A;  5CSN A;  2CCM A;  1NUB A;  5HKY A;  3O4Y A;  2M0R A;  4WQ3 A;  2KNE A;  2LLT A;  1J7Q A;  1F8H A;  4ORA B;  1Y1A A;  2ZNE A;  2M3W A;  1Y0V H;  1CDM A;  2LVK A;  1UHI A;  1KQM C;  1SL9 A;  1YR5 A;  1F70 A;  1LA0 A;  2HQW A;  1BT6 A;  3PLF B;  1S5G Z;  3ZWH A;  2JC2 A;  1FPW A;  2MJW B;  5DKN A;  1YUR A;  1KWO B;  1XFX O;  3KHE A;  4BY5 A;  4C0K A;  1KWO C;  1Y6W A;  2M29 A;  1WDC B;  4BY4 A;  1JF2 A;  3CS1 A;  1TTX A;  1WDC C;  4PE1 A;  1TNQ A;  2L2E A;  1LA3 A;  2M1U A;  3AAJ A;  2OTG B;  1BG1 A;  1YUU A;  1K9P A;  1TRF A;  1YRT B;  4PHN A;  1V1F A;  2LLU A;  1WRK A;  2K7B A;  3OHM B;  1UUR A;  1WY9 A;  4PHK A;  5AER A;  5AEQ A;  3I5I B;  2L98 A;  5K89 A;  1DJY A;  2MBX A;  1YUT A;  3I5I C;  2LHI A;  3EVV A;  2Q4U A;  1S6I A;  2KQY A;  3FIA A;  3QRX A;  2OS8 B;  4GNK B;  1FBV A;  5G08 A;  1JSA A;  1CLL A;  4OCI A;  4XYN A;  3BOW A;  3CR4 X;  3A4U B;  4PHJ A;  1BJF A;  2LNK A;  3FS7 A;  4GGN A;  1B47 A;  3I5H B;  4PE7 A;  4AQI A;  1KFX S;  2NCP A;  4I5N B;  3I5H C;  1CKK A;  1JC2 A;  1BF5 A;  3SG3 A;  1X02 A;  2Y1M A;  1FW4 A;  1NPQ A;  2I18 A;  4P2Y B;  1WRL A;  3LLE A;  1SNL A;  2LMU A;  3OB2 B;  3KPX A;  1R2U A;  4MZJ A;  4GBA A;  2NCO A;  2HPS A;  2MLF C;  3PSR A;  2QAC A;  5HLV A;  1S6C A;  2JUL A;  1NCY A;  1MWN A;  3LL8 B;  1AHR A;  2JT3 A;  2F2O A;  2L4H A;  1NCX A;  2FJU B;  1KSO A;  4N1F A;  5FYX A;  3FWB A;  2JXL A;  4M2P A;  1SCV A;  2LE9 B;  2M8U A;  4OKH A;  2KAY A;  1K90 D;  1TCO B;  3SIA A;  1ODB A;  4DIR A;  1F4O A;  3CR5 X;  1XFV O;  1Y1U A;  1UHJ A;  2SAS A;  4YBH B;  5ER4 X;  1SW8 A;  1LXF C;  3CLN A;  1XVJ A;  2FCE A;  1XA5 A;  1OOJ A;  2JXC A;  3SG4 A;  1CFF A;  1UWO A;  2Y4Q A;  3EK8 A;  3EVU A;  2K7O A;  2H61 A;  4MEW A;  1C7W A;  3BYA A;  4N5X A;  1A03 A;  2LLS A;  3E3R A;  1G33 A;  2PRU A;  1RJV A;  4DS7 A;  1L2O B;  5JJG A;  5CSF A;  1OE9 B;  1NWD A;  2I2R E;  1L2O C;  1R6P A;  1CFD A;  1JF0 A;  1A75 A;  2AAO A;  1F4Q A;  1UUS A;  1YVH A;  1RTP 1;  1E8A A;  2JNX A;  1G4Y R;  1BOD A;  1CMG A;  1PVA A;  2BE6 A;  2JRF A;  4GGF A;  1C07 A;  1K95 A;  1QX5 B;  1A2X A;  3JVT B;  1K2H A;  2OPO A;  1TNX A;  1JFJ A;  4MSP A;  2AUC A;  1M31 A;  4HRH A;  2KBM A;  1A4P A;  2WOR A;  3VRQ A;  1NX1 A;  4C0L A;  1OQP A;  1DGV A;  2JTZ A;  5TNC A;  1EG4 A;  1IWQ A;  1NIW A;  1BU3 A;  3CWG A;  1CNP A;  3HCM A;  2JU0 A;  4FQO A;  4YI9 A;  4ORB B;  2WND A;  4C0J A;  4A4C A;  2E6W A;  1TNP A;  3BUN B;  1QVI Z;  3DVJ A;  2L0P A;  4PDZ A;  1NCZ A;  2BKH B;  2V53 A;  1F54 A;  3NSL A;  2ZND A;  3DD4 A;  3TDI A;  1YVL A;  1CM1 A;  2D8N A;  3GK1 A;  3MSE B;  3VRO A;  2R2I A;  1KK7 Y;  2KI6 C;  2LVV A;  3LK1 A;  1CMF A;  2IS9 A;  2MA2 A;  2Y5I A;  2G9B A;  4YI8 A;  3BUM B;  1G8I A;  2MHH A;  2LP3 A;  3RLZ A;  1CLB A;  5AAN A;  4PE4 A;  4MBE A;  2L51 A;  5IBW A;  2EC6 B;  2I94 A;  3D0Y B;  1EL4 A;  4I5L B;  3EKH A;  3AKA A;  3PAT A;  1UHK A;  1F55 A;  2OTG C;  1FF1 A;  2KFG A;  3CGA A;  2K8M B;  1S1E A;  1PK0 D;  1LIN A;  4MRY A;  2LVJ A;  1QAS A;  2KFF A;  3DVM A;  1AJ5 A;  1B7T Y;  2JOJ A;  3EK7 A;  2PVB A;  4DRW A;  3DVE A;  2ZRT A;  2KOT A;  3OX5 A;  1KCY A;  1DJZ A;  4IL1 A;  4YGA A;  4ICB A;  4WQ2 A;  1KK7 Z;  4Q04 A;  3DVK A;  4CFR A;  2OS8 C;  1ZMZ A;  2F3Y A;  3PN7 B;  1K94 A;  1CDN A;  2HF5 A;  1LKJ A;  1QLS A;  1WLM A;  3GK2 A;  1NSH A;  3VRN A;  2KQ6 A;  3D10 A;  3PN7 C;  5J3X A;  4YRU A;  1DJG A;  1EH2 A;  2DOQ A;  4NDB A;  3EVR A;  1TIZ A;  2PSR A;  4I5J A;  2WCF A;  1S26 D;  2WCB A;  5CSI A;  1WRZ A;  4ZCU A;  2BCX A;  1AUI B;  1J55 A;  1EJ3 A;  1OMD A;  2HET A;  2PMY A;  1B1G A;  2NXQ A;  1FI6 A;  1MXE A;  2P6B B;  1QXP A;  1ALV A;  4JPZ B;  5F6T A;  1K96 A;  2RGI A;  2LAN A;  1M39 A;  1DF0 B;  2BBM A;  2Q91 A;  3TDZ A;  1Q80 A;  1CDP A;  2JT0 A;  3F45 A;  5DKR A;  1MF8 B;  2LCP A;  4JWQ A;  1B8L A;  1CM4 A; 
#chains in the Genus database with same CATH topology
 2H2K A;  3RM1 A;  2ISD A;  2LVI A;  1QAT A;  2L4I A;  4DUQ A;  4OV2 A;  1IG5 A;  2FCD A;  1SRA A;  1ZFS A;  4AOM A;  4INW A;  1JFK A;  1SCM B;  1RFJ A;  3TZ1 A;  2KGR A;  1DTL A;  1XFU O;  3NHI A;  4JKT A;  1H4B A;  1V1G A;  1SCM C;  1Z2C B;  1OW4 A;  2K7C A;  2KI4 B;  3WHT B;  5I2O A;  2F3Z A;  5AXI A;  4MZK A;  3R1P A;  2KI4 C;  3LK0 A;  3D78 A;  5DKQ A;  3IF7 A;  1DJH A;  4U8D A;  1N65 A;  1PVB A;  3IQO A;  2M97 A;  4OVN F;  1F71 A;  1ZOT B;  1TNW A;  3CZ0 A;  4CFQ A;  5KU1 A;  2LAP A;  2MLE C;  2CXJ A;  3WXA A;  1YUS A;  2LV7 A;  4YGB B;  2WCJ A;  4CLN A;  1K9K A;  4XJK B;  1EXR A;  4M2Q A;  1W7I B;  1PRW A;  2NZ0 A;  3EK4 A;  2KAV A;  3GOF A;  3SIB A;  2KAX A;  2KFH A;  1J1D A;  1OOH A;  2PAS A;  3SG6 A;  1J7P A;  1M46 A;  1SMG A;  3L47 A;  1AVS A;  1MR8 A;  3DF0 B;  1S36 A;  5BPJ A;  2BNX A;  3OX6 A;  1U5I B;  3C1V A;  1QIW A;  4MZL A;  5GQQ C;  3NSK A;  5D3O A;  4PAL A;  4R1E A;  2L5X B;  4MRX A;  5FI6 A;  2ZRS A;  4L9M A;  1C3Y A;  1SY9 A;  3BUX B;  4E68 A;  2K7D A;  1KQV A;  2JZI A;  2NLN A;  1XFW O;  1IJ6 A;  2M9G A;  1WLZ A;  3JVT C;  3JTD B;  1K8U A;  3CTN A;  3SG2 A;  2M7L A;  1AP4 A;  4MLW A;  1J7O A;  1JBA A;  1MHO A;  3D77 A;  3SG7 A;  1B8R A;  1C3Z A;  3JTD C;  3V2L A;  1KSM A;  5CSJ A;  4QJ4 B;  2M49 B;  4YGD B;  2BAP A;  1LVC D;  3BUO B;  4PE0 A;  1PAL A;  3KO0 A;  2CBL A;  1BLQ A;  1IKU A;  2LMV A;  3BXK A;  1DMO A;  4OR9 B;  3DF0 A;  1KFU L;  3O78 A;  4F0Z B;  2GTE A;  1GQM A;  1TOP A;  2F2P A;  4GPL B;  5CPV A;  2EGD A;  4NQG A;  1J1E A;  1DT7 B;  3WHU B;  5KSZ A;  1UHN A;  4YGE B;  2BL0 B;  4ETO A;  2GGZ A;  2KSP A;  3NGV A;  1J7R A;  3S0E A;  2LUX A;  1SSE B;  1YTZ C;  2PAL A;  2WC8 A;  2L50 A;  3TS5 B;  1BR4 B;  1NYA A;  3PFV A;  1AJ4 A;  1CTR A;  1QWV A;  2BE4 A;  3TS5 C;  3NHT A;  2K0J A;  3BFA A;  2KGB C;  2FJY A;  2JQ6 A;  1S3P A;  2LP2 A;  4GFT A;  3BUW B;  4CPV A;  4INX A;  1MXL C;  1W7J B;  3CYZ A;  4AQJ A;  3R1O A;  1PSR A;  2BCA A;  4WRI A;  2KLD A;  2JNF A;  2CTN A;  4QJ5 B;  2EC6 C;  3SJS A;  1KQM B;  1ZUZ A;  1NP8 A;  1QTX A;  1IGV A;  3NSI A;  1IRJ A;  1BMO A;  1CFP A;  3CZ2 A;  3VRP A;  4UPG A;  4HSZ A;  2ZKM X;  1TUZ A;  4USL A;  4HRG A;  4GAO A;  1YRU B;  1N0Y A;  3B7A A;  3BOW B;  3WNX B;  5D7F A;  5ER5 A;  2K2F A;  3AKB A;  3B86 A;  3O2P A;  4A4B A;  1TCF A;  3FE8 A;  5HLO A;  5HKW A;  2EHB A;  4I5K A;  5PAL A;  1L7Z A;  3D0Y A;  1TN4 A;  1YX8 A;  3DXL A;  1MQ1 A;  3KEV A;  1N2D A;  1HT9 A;  4DCK A;  4PCW A;  3O4X A;  1SK6 D;  1GM0 A;  2KLE A;  3B88 A;  4KYN A;  1C7V A;  4FQT A;  1QLK A;  1VRK A;  3IQQ A;  5FI2 A;  3ZNI A;  5I2L A;  2MAZ A;  3UO9 A;  5I8N A;  3SG5 A;  4TNC A;  1OSA A;  1K93 D;  3EG5 B;  2JTT A;  3TUY B;  2HQ8 A;  3TDU A;  1QX7 A;  1IQ5 A;  1QX2 A;  3D76 A;  3M0W A;  3TUY C;  1BR1 B;  1DJX A;  2LUC A;  3O6B A;  4GUK A;  1OOF A;  3OBV A;  2WC6 A;  2AMI A;  2WCL A;  1B7T Z;  2GGM A;  1IJ5 A;  3SS5 A;  1CLM A;  2JPT A;  1RWY A;  3OP0 A;  4QJ3 B;  1H8B A;  2PYQ A;  1DJW A;  4CID A;  1CDL A;  1SKT A;  2ZN8 A;  2QPT A;  3AAK A;  2O60 A;  4ORC B;  2E30 A;  2F8P A;  3PM8 A;  3UNW A;  5HYD A;  2M7N A;  4NDD A;  1EG3 A;  5D69 A;  3S0D A;  1D1O A;  1A29 A;  3VGO A;  4D1E A;  3OB1 B;  2K2A A;  4JQ0 D;  1K9U A;  1REC A;  2WCE A;  2FOT A;  5I2Q A;  2TN4 A;  1QV0 A;  2WCK A;  1KFU S;  1ZAC A;  2QDI A;  3H4S E;  1DF0 A;  1UP5 A;  2QEH A;  2H61 C;  4ZCV A;  4MN0 A;  1GGZ A;  1P28 A;  1T14 A;  1UHH A;  3NXA A;  2LMT A;  3A8R A;  4PHM A;  1KK8 B;  1M63 B;  2I7A A;  3PM2 A;  2BKI B;  1XYD A;  1PSB A;  1QJT A;  1QIV A;  2JT8 A;  1NX3 A;  1KK8 C;  2WC5 A;  3I5G B;  2BCB A;  2JWW A;  4FTG A;  2KYC A;  3VRR A;  3EKJ A;  5B8I B;  1A75 B;  3FE6 A;  1GGW A;  4P5O E;  3I5G C;  1B4C A;  2SCP A;  1XFY O;  1OZO A;  1JWD A;  1IIO A;  2LC5 A;  1B8C A;  2WCM A;  5HKZ A;  2Y1N A;  3I5F B;  1BOC A;  2CNP A;  1JUO A;  1ALW A;  2KHN A;  3BFH A;  1SL8 A;  3CZT X;  3GK4 X;  1HQV A;  2KDH A;  3I5F C;  1OMR A;  3B87 A;  4NDC A;  5KTY A;  3HX4 A;  1GJY A;  2A4J A;  1M45 A;  4GGF C;  1KFX L;  1QS7 A;  1SBJ A;  2BBN A;  3PAL A;  2BEC A;  1FI5 A;  2LHL A;  3FWC A;  1PUL A;  1MUX A;  4M2O A;  1OMV A;  1DVI A;  2K61 A;  3SS3 A;  2G2B A;  4HRE E;  4XJK A;  1YX7 A;  3BQ3 A;  2F33 A;  5JOL A;  1QVI Y;  1QV1 A;  1NX0 A;  2O5G A;  3R72 A;  2ZFD A;  1CFC A;  5AFP A;  2WOS A;  1S6J A;  1B9A A;  3NSO A;  1XK4 C;  2GV5 A;  1RRO A;  1SL7 A;  1IH0 A;  1DJI A;  2KPH A;  1U5I A;  1SPY A;  3D73 A;  1S5G Y;  4MVF A;  2CT9 A;  2YGU A;  2K60 A;  3CAB A;  2M1K B;  3K21 A;  2KBI A;  1SYM A;  1CB1 A;  4YGC B;  1AK8 A;  4N1G A;  2VRG A;  2ZN9 A;  2BL0 C;  3CR2 A;  1DGU A;  1SR6 B;  2JPO A;  2KI6 D;  3LCP C;  3RZS A;  1XO5 A;  3VB1 A;  1XFZ O;  1SR6 C;  2KYF A;  2MRD A;  3FE9 A;  1OOG A;  1IQ3 A;  1Y1X A;  1OZS A;  1NX2 A;  2B1U A;  3KF9 A;  2COL B;  2LM5 A;  1XK4 A;  1RK9 A;  3ICB A;  5CSN A;  2CCM A;  3D75 A;  3S0A A;  1NUB A;  5HKY A;  3O4Y A;  2M0R A;  4WQ3 A;  2KNE A;  2LLT A;  1J7Q A;  1F8H A;  2QEB A;  4ORA B;  1Y1A A;  3L4A A;  2ZNE A;  2M3W A;  1Y0V H;  3BJH A;  1DQE A;  1CDM A;  2LVK A;  1UHI A;  1KQM C;  1SL9 A;  1YR5 A;  1F70 A;  1LA0 A;  2HQW A;  3SS4 A;  1BT6 A;  3PLF B;  5FI7 A;  1S5G Z;  3ZWH A;  5DIC A;  2JC2 A;  1FPW A;  1DC1 A;  2MJW B;  5DKN A;  1YUR A;  1KWO B;  1XFX O;  3K1E A;  3KHE A;  4BY5 A;  4C0K A;  1KWO C;  1Y6W A;  2M29 A;  1WDC B;  4BY4 A;  1JF2 A;  3CS1 A;  1TTX A;  1WDC C;  4PE1 A;  1TNQ A;  2L2E A;  1LA3 A;  2M1U A;  3AAJ A;  2OTG B;  1BG1 A;  1YUU A;  1K9P A;  1TRF A;  1YRT B;  5I94 A;  4PHN A;  1V1F A;  2LLU A;  1WRK A;  2K7B A;  3OHM B;  1UUR A;  1WY9 A;  4PHK A;  5AER A;  5AEQ A;  3I5I B;  3OGN A;  2L98 A;  4IJ7 A;  5K89 A;  1DJY A;  2MBX A;  1YUT A;  3I5I C;  2LHI A;  3EVV A;  2Q4U A;  1S6I A;  2KQY A;  3FIA A;  3QRX A;  2OS8 B;  4GNK B;  1FBV A;  5G08 A;  1JSA A;  1CLL A;  4OCI A;  3DY9 A;  4XYN A;  3BOW A;  3CR4 X;  3A4U B;  4PHJ A;  1BJF A;  2LNK A;  3FS7 A;  4GGN A;  1B47 A;  3I5H B;  3N7H A;  2L2C A;  4PE7 A;  4AQI A;  1KFX S;  2NCP A;  4I5N B;  3I5H C;  1CKK A;  1JC2 A;  1BF5 A;  3SG3 A;  1X02 A;  2Y1M A;  1FW4 A;  1NPQ A;  2I18 A;  4P2Y B;  1WRL A;  3LLE A;  1SNL A;  2LMU A;  3OB2 B;  3KPX A;  1R2U A;  3PJI A;  4MZJ A;  4GBA A;  2NCO A;  2QEO A;  2HPS A;  2MLF C;  3CDN A;  3PSR A;  3IVT A;  2QAC A;  5HLV A;  1S6C A;  2JUL A;  1NCY A;  1MWN A;  3LL8 B;  1AHR A;  2JT3 A;  1DEL A;  2F2O A;  2L4H A;  3D74 A;  1NCX A;  2FJU B;  1KSO A;  4N1F A;  5FYX A;  3FWB A;  2JXL A;  2QEV A;  4M2P A;  1SCV A;  2LE9 B;  2M8U A;  3L4L A;  4OKH A;  2KAY A;  1K90 D;  1TCO B;  1XFR A;  3SIA A;  1ODB A;  4DIR A;  1F4O A;  3CR5 X;  1XFV O;  1Y1U A;  1UHJ A;  2SAS A;  4YBH B;  5ER4 X;  3Q8I A;  1SW8 A;  3S0F A;  1LXF C;  3CZ1 A;  3CLN A;  1XVJ A;  2FCE A;  1XA5 A;  1Z4H A;  3S0B A;  1OOJ A;  2JXC A;  3SG4 A;  2L5Y A;  1CFF A;  1UWO A;  2Y4Q A;  3EK8 A;  3EVU A;  2K7O A;  2H61 A;  4MEW A;  1C7W A;  3BYA A;  4N5X A;  1A03 A;  2LLS A;  3E3R A;  5HL1 A;  1G33 A;  2PRU A;  1RJV A;  2H8V A;  4DS7 A;  1L2O B;  5JJG A;  5CSF A;  1OE9 B;  1NWD A;  2I2R E;  1L2O C;  1R6P A;  1CFD A;  1JF0 A;  1A75 A;  2AAO A;  1F4Q A;  1UUS A;  1YVH A;  1RTP 1;  3B6X A;  3R1V A;  3QME A;  1E8A A;  2JNX A;  1G4Y R;  1BOD A;  1CMG A;  1PVA A;  2BE6 A;  2JRF A;  4GGF A;  1C07 A;  1K95 A;  1QX5 B;  1A2X A;  3JVT B;  1K2H A;  2OPO A;  1TNX A;  1JFJ A;  1OOI X;  4MSP A;  2AUC A;  1M31 A;  4HRH A;  2KBM A;  1A4P A;  2WOR A;  3VRQ A;  1NX1 A;  4C0L A;  1OQP A;  1DGV A;  2JTZ A;  5TNC A;  3BFB A;  1EG4 A;  1IWQ A;  1NIW A;  1BU3 A;  1TUJ A;  3CWG A;  1CNP A;  3HCM A;  2JU0 A;  4FQO A;  4YI9 A;  4ORB B;  4F7F A;  2WND A;  4C0J A;  4A4C A;  2E6W A;  1TNP A;  3BUN B;  1QVI Z;  3DVJ A;  2L0P A;  4PDZ A;  1W9Z A;  1NCZ A;  2BKH B;  2V53 A;  1F54 A;  3NSL A;  2ZND A;  3DD4 A;  3TDI A;  1YVL A;  1CM1 A;  5EL2 A;  2D8N A;  3GK1 A;  3MSE B;  3VRO A;  2R2I A;  1TWO A;  1KK7 Y;  2KI6 C;  2LVV A;  3LK1 A;  1CMF A;  2IS9 A;  2MA2 A;  2Y5I A;  1ORG A;  2G9B A;  4YI8 A;  3BUM B;  3DZT A;  1G8I A;  2MHH A;  2LP3 A;  3RLZ A;  1CLB A;  4PT1 A;  5AAN A;  4PE4 A;  4MBE A;  2L51 A;  5IBW A;  2EC6 B;  2I94 A;  2PQL A;  3D0Y B;  1EL4 A;  3S0G A;  4I5L B;  2WCH A;  3EKH A;  3AKA A;  3DYE A;  3PAT A;  1UHK A;  1F55 A;  2OTG C;  1FF1 A;  2KFG A;  3CGA A;  2K8M B;  1S1E A;  1PK0 D;  1DEK A;  1LIN A;  4MRY A;  2LVJ A;  1QAS A;  2KFF A;  3DVM A;  1AJ5 A;  1B7T Y;  2ERB A;  2JOJ A;  3EK7 A;  2PVB A;  4DRW A;  3DVE A;  2ZRT A;  2KOT A;  3OX5 A;  1KCY A;  1DJZ A;  4IL1 A;  4YGA A;  4ICB A;  4WQ2 A;  1KK7 Z;  4Q04 A;  3DVK A;  4CFR A;  2OS8 C;  1ZMZ A;  2F3Y A;  3PN7 B;  1K94 A;  1CDN A;  2HF5 A;  1LKJ A;  1QLS A;  1WLM A;  3GK2 A;  1NSH A;  3VRN A;  2KQ6 A;  3D10 A;  3PN7 C;  5J3X A;  4YRU A;  1DJG A;  1EH2 A;  2DOQ A;  4NDB A;  4OZD A;  2P71 A;  2P70 A;  3EVR A;  1TIZ A;  2PSR A;  4I5J A;  2WCF A;  1S26 D;  4JD9 A;  2WCB A;  1LS8 A;  5CSI A;  1WRZ A;  4ZCU A;  2BCX A;  1AUI B;  1J55 A;  1EJ3 A;  1OMD A;  2HET A;  2PMY A;  1B1G A;  2NXQ A;  1FI6 A;  1MXE A;  2P6B B;  1QXP A;  1ALV A;  4JPZ B;  5F6T A;  1K96 A;  2RGI A;  2LAN A;  1M39 A;  1DF0 B;  2BBM A;  2Q91 A;  3TDZ A;  1Q80 A;  1CDP A;  2JT0 A;  3F45 A;  5DKR A;  1MF8 B;  2LCP A;  4JWQ A;  1B8L A;  1CM4 A; 
#chains in the Genus database with same CATH homology
 2H2K A;  3RM1 A;  2ISD A;  2LVI A;  1QAT A;  2L4I A;  4DUQ A;  4OV2 A;  1IG5 A;  2FCD A;  1SRA A;  1ZFS A;  4AOM A;  1JFK A;  1SCM B;  1RFJ A;  2KGR A;  1DTL A;  1XFU O;  1H4B A;  1V1G A;  1SCM C;  2K7C A;  2KI4 B;  3WHT B;  5I2O A;  2F3Z A;  5AXI A;  4MZK A;  2KI4 C;  3LK0 A;  5DKQ A;  3IF7 A;  1DJH A;  4U8D A;  1N65 A;  1PVB A;  3IQO A;  2M97 A;  4OVN F;  1F71 A;  1ZOT B;  1TNW A;  5KU1 A;  4CFQ A;  2LAP A;  2MLE C;  2CXJ A;  3WXA A;  1YUS A;  2LV7 A;  4YGB B;  4CLN A;  1K9K A;  4XJK B;  1EXR A;  4M2Q A;  1W7I B;  1PRW A;  2NZ0 A;  3EK4 A;  2KAV A;  3GOF A;  3SIB A;  2KAX A;  2KFH A;  1J1D A;  3SG6 A;  2PAS A;  1J7P A;  1M46 A;  1SMG A;  1AVS A;  1MR8 A;  3DF0 B;  1S36 A;  5BPJ A;  3OX6 A;  1U5I B;  3C1V A;  1QIW A;  4MZL A;  5GQQ C;  3NSK A;  4PAL A;  4R1E A;  2L5X B;  4MRX A;  2ZRS A;  4L9M A;  1SY9 A;  3BUX B;  4E68 A;  2K7D A;  1KQV A;  2JZI A;  2NLN A;  1XFW O;  1IJ6 A;  2M9G A;  1WLZ A;  3JVT C;  3JTD B;  1K8U A;  3CTN A;  3SG2 A;  2M7L A;  1AP4 A;  4MLW A;  1J7O A;  1JBA A;  1MHO A;  3SG7 A;  1B8R A;  3JTD C;  1KSM A;  5CSJ A;  4QJ4 B;  2M49 B;  4YGD B;  1LVC D;  3BUO B;  4PE0 A;  1PAL A;  3KO0 A;  2CBL A;  1IKU A;  2LMV A;  3BXK A;  1DMO A;  4OR9 B;  3DF0 A;  1KFU L;  3O78 A;  4F0Z B;  1GQM A;  1TOP A;  2F2P A;  4GPL B;  5CPV A;  2EGD A;  4NQG A;  1J1E A;  1DT7 B;  3WHU B;  5KSZ A;  1UHN A;  4YGE B;  2BL0 B;  4ETO A;  2GGZ A;  2KSP A;  1J7R A;  2LUX A;  1YTZ C;  2PAL A;  2WC8 A;  2L50 A;  3TS5 B;  1BR4 B;  1NYA A;  3PFV A;  1AJ4 A;  1CTR A;  2BE4 A;  3TS5 C;  2K0J A;  2KGB C;  2JQ6 A;  1S3P A;  2LP2 A;  4GFT A;  3BUW B;  4CPV A;  4AQJ A;  1MXL C;  1W7J B;  1PSR A;  2BCA A;  4WRI A;  2JNF A;  2CTN A;  4QJ5 B;  2EC6 C;  3SJS A;  1KQM B;  1ZUZ A;  1NP8 A;  1QTX A;  1IGV A;  3NSI A;  1IRJ A;  1BMO A;  1CFP A;  3VRP A;  4UPG A;  4HSZ A;  2ZKM X;  4USL A;  4HRG A;  4GAO A;  1YRU B;  1N0Y A;  3BOW B;  3WNX B;  5D7F A;  5ER5 A;  2K2F A;  3AKB A;  3O2P A;  4A4B A;  1TCF A;  5HLO A;  5HKW A;  2EHB A;  4I5K A;  5PAL A;  1L7Z A;  3D0Y A;  1TN4 A;  1YX8 A;  1MQ1 A;  3KEV A;  1N2D A;  1HT9 A;  4DCK A;  4PCW A;  1SK6 D;  1C7V A;  1QLK A;  1VRK A;  3IQQ A;  3ZNI A;  5I2L A;  2MAZ A;  5I8N A;  3SG5 A;  4TNC A;  1OSA A;  1K93 D;  2JTT A;  3TUY B;  2HQ8 A;  3TDU A;  1QX7 A;  1IQ5 A;  1QX2 A;  3M0W A;  3TUY C;  1BR1 B;  1DJX A;  2LUC A;  3O6B A;  4GUK A;  2AMI A;  1B7T Z;  2GGM A;  1IJ5 A;  1CLM A;  2JPT A;  1RWY A;  3OP0 A;  4QJ3 B;  1H8B A;  1DJW A;  4CID A;  1CDL A;  1SKT A;  2ZN8 A;  2QPT A;  3AAK A;  2O60 A;  4ORC B;  2E30 A;  2F8P A;  3PM8 A;  1BLQ A;  5HYD A;  2M7N A;  4NDD A;  1EG3 A;  5D69 A;  1D1O A;  1A29 A;  3VGO A;  4D1E A;  3OB1 B;  2K2A A;  4JQ0 D;  1K9U A;  1REC A;  2WCE A;  2FOT A;  5I2Q A;  2TN4 A;  1QV0 A;  1KFU S;  1ZAC A;  3H4S E;  1DF0 A;  1UP5 A;  4ZCV A;  2H61 C;  4MN0 A;  1GGZ A;  1UHH A;  4PHM A;  3NXA A;  1IQ3 A;  2LMT A;  3A8R A;  1KK8 B;  1M63 B;  2I7A A;  2BKI B;  1XYD A;  1PSB A;  1QJT A;  1QIV A;  2JT8 A;  1NX3 A;  1KK8 C;  3I5G B;  2BCB A;  2JWW A;  4FTG A;  2KYC A;  3VRR A;  3EKJ A;  5B8I B;  1A75 B;  1GGW A;  4P5O E;  3I5G C;  1B4C A;  2SCP A;  1XFY O;  1OZO A;  1JWD A;  2LC5 A;  1B8C A;  5HKZ A;  2Y1N A;  3I5F B;  1BOC A;  2CNP A;  1JUO A;  1ALW A;  2KHN A;  3CZT X;  1SL8 A;  3GK4 X;  3TZ1 A;  1HQV A;  2KDH A;  3I5F C;  1OMR A;  4NDC A;  5KTY A;  3HX4 A;  1GJY A;  2A4J A;  1M45 A;  4GGF C;  1KFX L;  1QS7 A;  1SBJ A;  2BBN A;  3PAL A;  2BEC A;  1FI5 A;  2LHL A;  3FWC A;  1PUL A;  1MUX A;  4M2O A;  1OMV A;  1DVI A;  2K61 A;  2G2B A;  4HRE E;  4XJK A;  1YX7 A;  3BQ3 A;  2F33 A;  5JOL A;  1QVI Y;  1QV1 A;  1NX0 A;  2O5G A;  2ZFD A;  1CFC A;  5AFP A;  2WOS A;  1S6J A;  1B9A A;  3NSO A;  1XK4 C;  2GV5 A;  1RRO A;  1SL7 A;  1IH0 A;  1DJI A;  1U5I A;  1SPY A;  1S5G Y;  4MVF A;  2CT9 A;  2M1K B;  3K21 A;  2KBI A;  1SYM A;  1CB1 A;  4YGC B;  1AK8 A;  4N1G A;  2VRG A;  2ZN9 A;  2BL0 C;  3CR2 A;  1DGU A;  1SR6 B;  2KI6 D;  3LCP C;  1XO5 A;  1XFZ O;  1SR6 C;  2KYF A;  2MRD A;  1Y1X A;  1OZS A;  1NX2 A;  2B1U A;  3KF9 A;  2COL B;  2LM5 A;  1XK4 A;  1RK9 A;  3ICB A;  5CSN A;  2CCM A;  1NUB A;  5HKY A;  3O4Y A;  2M0R A;  4WQ3 A;  2KNE A;  2LLT A;  1J7Q A;  1F8H A;  4ORA B;  1Y1A A;  2ZNE A;  2M3W A;  1Y0V H;  1CDM A;  2LVK A;  1UHI A;  1KQM C;  1SL9 A;  1YR5 A;  1F70 A;  1LA0 A;  2HQW A;  1BT6 A;  3PLF B;  1S5G Z;  3ZWH A;  2JC2 A;  1FPW A;  2MJW B;  5DKN A;  1YUR A;  1KWO B;  1XFX O;  3KHE A;  4BY5 A;  4C0K A;  1KWO C;  1Y6W A;  2M29 A;  1WDC B;  4BY4 A;  1JF2 A;  3CS1 A;  1TTX A;  1WDC C;  4PE1 A;  1TNQ A;  2L2E A;  1LA3 A;  2M1U A;  3AAJ A;  2OTG B;  1BG1 A;  1YUU A;  1K9P A;  1TRF A;  1YRT B;  4PHN A;  1V1F A;  2LLU A;  1WRK A;  2K7B A;  3OHM B;  1UUR A;  1WY9 A;  4PHK A;  5AER A;  5AEQ A;  3I5I B;  2L98 A;  5K89 A;  1DJY A;  2MBX A;  1YUT A;  3I5I C;  2LHI A;  3EVV A;  2Q4U A;  1S6I A;  2KQY A;  3FIA A;  3QRX A;  2OS8 B;  4GNK B;  1FBV A;  5G08 A;  1JSA A;  1CLL A;  4OCI A;  4XYN A;  3BOW A;  3CR4 X;  3A4U B;  4PHJ A;  1BJF A;  2LNK A;  3FS7 A;  4GGN A;  1B47 A;  3I5H B;  4PE7 A;  4AQI A;  1KFX S;  2NCP A;  4I5N B;  3I5H C;  1CKK A;  1JC2 A;  1BF5 A;  3SG3 A;  1X02 A;  2Y1M A;  1FW4 A;  1NPQ A;  2I18 A;  4P2Y B;  1WRL A;  3LLE A;  1SNL A;  2LMU A;  3OB2 B;  3KPX A;  1R2U A;  4MZJ A;  4GBA A;  2NCO A;  2HPS A;  2MLF C;  3PSR A;  2QAC A;  5HLV A;  1S6C A;  2JUL A;  1NCY A;  1MWN A;  3LL8 B;  1AHR A;  2JT3 A;  2F2O A;  2L4H A;  1NCX A;  2FJU B;  1KSO A;  4N1F A;  5FYX A;  3FWB A;  2JXL A;  4M2P A;  1SCV A;  2LE9 B;  2M8U A;  4OKH A;  2KAY A;  1K90 D;  1TCO B;  3SIA A;  1ODB A;  4DIR A;  1F4O A;  3CR5 X;  1XFV O;  1Y1U A;  1UHJ A;  2SAS A;  4YBH B;  5ER4 X;  1SW8 A;  1LXF C;  3CLN A;  1XVJ A;  2FCE A;  1XA5 A;  1OOJ A;  2JXC A;  3SG4 A;  1CFF A;  1UWO A;  2Y4Q A;  3EK8 A;  3EVU A;  2K7O A;  2H61 A;  4MEW A;  1C7W A;  3BYA A;  4N5X A;  1A03 A;  2LLS A;  3E3R A;  1G33 A;  2PRU A;  1RJV A;  4DS7 A;  1L2O B;  5JJG A;  5CSF A;  1OE9 B;  1NWD A;  2I2R E;  1L2O C;  1R6P A;  1CFD A;  1JF0 A;  1A75 A;  2AAO A;  1F4Q A;  1UUS A;  1YVH A;  1RTP 1;  1E8A A;  2JNX A;  1G4Y R;  1BOD A;  1CMG A;  1PVA A;  2BE6 A;  2JRF A;  4GGF A;  1C07 A;  1K95 A;  1QX5 B;  1A2X A;  3JVT B;  1K2H A;  2OPO A;  1TNX A;  1JFJ A;  4MSP A;  2AUC A;  1M31 A;  4HRH A;  2KBM A;  1A4P A;  2WOR A;  3VRQ A;  1NX1 A;  4C0L A;  1OQP A;  1DGV A;  2JTZ A;  5TNC A;  1EG4 A;  1IWQ A;  1NIW A;  1BU3 A;  3CWG A;  1CNP A;  3HCM A;  2JU0 A;  4FQO A;  4YI9 A;  4ORB B;  2WND A;  4C0J A;  4A4C A;  2E6W A;  1TNP A;  3BUN B;  1QVI Z;  3DVJ A;  2L0P A;  4PDZ A;  1NCZ A;  2BKH B;  2V53 A;  1F54 A;  3NSL A;  2ZND A;  3DD4 A;  3TDI A;  1YVL A;  1CM1 A;  2D8N A;  3GK1 A;  3MSE B;  3VRO A;  2R2I A;  1KK7 Y;  2KI6 C;  2LVV A;  3LK1 A;  1CMF A;  2IS9 A;  2MA2 A;  2Y5I A;  2G9B A;  4YI8 A;  3BUM B;  1G8I A;  2MHH A;  2LP3 A;  3RLZ A;  1CLB A;  5AAN A;  4PE4 A;  4MBE A;  2L51 A;  5IBW A;  2EC6 B;  2I94 A;  3D0Y B;  1EL4 A;  4I5L B;  3EKH A;  3AKA A;  3PAT A;  1UHK A;  1F55 A;  2OTG C;  1FF1 A;  2KFG A;  3CGA A;  2K8M B;  1S1E A;  1PK0 D;  1LIN A;  4MRY A;  2LVJ A;  1QAS A;  2KFF A;  3DVM A;  1AJ5 A;  1B7T Y;  2JOJ A;  3EK7 A;  2PVB A;  4DRW A;  3DVE A;  2ZRT A;  2KOT A;  3OX5 A;  1KCY A;  1DJZ A;  4IL1 A;  4YGA A;  4ICB A;  4WQ2 A;  1KK7 Z;  4Q04 A;  3DVK A;  4CFR A;  2OS8 C;  1ZMZ A;  2F3Y A;  3PN7 B;  1K94 A;  1CDN A;  2HF5 A;  1LKJ A;  1QLS A;  1WLM A;  3GK2 A;  1NSH A;  3VRN A;  2KQ6 A;  3D10 A;  3PN7 C;  5J3X A;  4YRU A;  1DJG A;  1EH2 A;  2DOQ A;  4NDB A;  3EVR A;  1TIZ A;  2PSR A;  4I5J A;  2WCF A;  1S26 D;  2WCB A;  5CSI A;  1WRZ A;  4ZCU A;  2BCX A;  1AUI B;  1J55 A;  1EJ3 A;  1OMD A;  2HET A;  2PMY A;  1B1G A;  2NXQ A;  1FI6 A;  1MXE A;  2P6B B;  1QXP A;  1ALV A;  4JPZ B;  5F6T A;  1K96 A;  2RGI A;  2LAN A;  1M39 A;  1DF0 B;  2BBM A;  2Q91 A;  3TDZ A;  1Q80 A;  1CDP A;  2JT0 A;  3F45 A;  5DKR A;  1MF8 B;  2LCP A;  4JWQ A;  1B8L A;  1CM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...